1FC2C

Crystallographic refinement and atomic models of a human fc fragment and its complex with fragment b of protein a from staphylococcus aureus at 2.9-and 2.8-angstroms resolution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
43
structure length
43
Chain Sequence
FNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FRAGMENT B OF PROTEIN A COMPLEX
publication title Crystallographic refinement and atomic models of a human Fc fragment and its complex with fragment B of protein A from Staphylococcus aureus at 2.9- and 2.8-A resolution.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Immunoglobulin
total genus 9
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 1981-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1fc2C00
2KIKA 3S1KA 1EDIA 4KJMA 1MFTA 1EDKA 4NPDA 1BDCA 5DJUB 2B87B 2B88A 2HR3A 4HJGH 4NPFX 1EDLA 5CBOA 1OVRA 1X0TA 2P58A 2KZJA 3ZDMA 3PH0A 4JBZA 1OVUA 2QRXA 4GOFA 2R44A 2KUBA 1LP1A 2KS1B 3RGUA 2JWDA 1Q2NA 1ZW0A 2I8DA 1H0TB 4ASWA 2K3RA 1OVVA 4ASVA 2LR2A 2M5AB 4ZMDA 2B87A 5C39A 4MN4C 2M0BA 1Y47A 3MZWB 3QWOC 2LXBA 3FXEA 5DJTB 4K3AA 2WMMA 4GODA 4EYYQ 2UWJE 2RKLA 4HB1A 2KI7B 5CBNA 5EFWB 1H0TA 3FXDA 2M5AA 2KZIA 1NVOA 1EDJA 1JM0A 2Q1KA 1SS1A 4NPEA 1EC5A 1FC2C 2OTKE 1DEEG 4CPGA 2LXCB 2ZAEB 1ZXGA 4HKZH 4ZNCA 1LT1A 4GOEA 1JMBA 2B89A 3MHVA 2QVAA 2SPZA 1U7MA 4K35A 4IOIH 1S3JA 1BDDA 4BXLA 5K5GB 1LP1B 4WWIA 1U7JA
chains in the Genus database with same CATH superfamily
4EI2A 1S5LE 1VQ5P 4UB6E 1FZCB 4OGQB 2WSCH 2BCCD 3S4RA 5KLIB 3AEGC 2FYUK 1KILB 3MIWA 2KYVA 1IK9A 3PH0A 4XFJA 5TISH 3KYQA 4YXDC 3BATA 2WPSA 3CCQP 1RH5B 5AVRB 4PD4D 1ZW0A 2WQYC 1CI6A 1ZV8A 2KLUA 5KAIE 1DIPA 1M1JA 2IBZD 3KDPB 3TNUA 5DJTB 1DEBA 4OH8B 1BGYD 3VYIA 3V2RA 2WSSH 1OFCX 1BCCJ 3LW5J 3HRNA 3CXHI 3IAOA 3GHGB 3H1HE 2AEFA 3P32A 1G1JA 2C9LY 4HKZH 1USDA 5AVSB 3TSIA 4PV1C 1JMBA 3SSUA 1LTGC 1AQTA 3CXHH 1X8YA 1M90Q 3MUDA 4U3FD 1KILE 1ZP0C 4H13D 4PJ0H 1IC2A 4RO0A 2FFDB 4H44C 1N73A 3BCCJ 2W8ZA 2BEZF 1S72P 1JOCA 1EDKA 3D6YA 2WPRA 2Z4EA 1L0LE 1L4AB 2OYIA 4TT3H 1LP1A 3S9OA 1YJ9P 3L74D 1N7SB 2JWDA 2KOGA 3CWBG 1SQXK 2GM4A 2HLOA 4JPZB 3V6IA 1VQ8P 1JMMA 1KC8Q 2K9YA 4AQRD 3CCSP 2YMYA 3CCRP 1A02F 1VQ9P 1SFCA 3LW5H 3LIEA 1LTSC 3VN0A 5B66E 2POHA 3L72D 2R5BA 1JM0A 2R3CA 1OW7A 5AW6B 1QX8A 2IDBA 4JQ0D 4WY4D 1MFZA 1M57D 3L70E 4L75A 3GF7A 1SQBD 3L71D 3A0HH 2BCCG 4I7ZC 3A0BE 3CC4P 4UB8E 2YIUB 2Z5HA 3AEFC 1PPJE 2Y0EA 2LKMA 1RE4C 2N1TD 2PGDA 3H1HJ 4AYCA 4PD4H 1LWUA 4XE5B 1L0NK 3KQGA 3L73E 1T6AA 1ZOYC 3H1ID 3BRVB 4Y99C 2BASA 2IBZG 1Y9BA 3SFDC 4EOTA 3RGUA 2XNXA 1PV3A 5KKZB 2I8DA 2QJYB 1SQQD 2PFXA 1S5LH 1YQ4C 5C39A 1IFJA 2M0BA 3RK3D 3W68A 2P10A 5BU5A 1Y47A 3NMDA 1PGQA 3Q2YA 4Y28J 2WT7A 3H1LE 2KNCA 3WMM0 1L0LJ 1QL2A 2JJLA 3JCUH 1JTHA 1VQ6P 2HPCB 2KZIA 2WPQA 1NVOA 3EWKA 1K8AQ 4KT0J 1S4XA 1EZVE 4U3FG 5KAIH 2FYUG 2KXPB 2OARA 2FYZA 2R5DA 2RN0A 1GMJA 2NPSB 1FZAA 2W27A 3HD7B 3HE4B 4RKUJ 4H13C 3MD0A 4WB4A 1SQVK 1YITP 5AVQB 1GK4A 2QJPC 2W6JH 2Y9ZA 3ITKA 2E5TA 5AVUB 3L74G 2B87B 1LGHB 3O6QB 2QM7A 1SQVE 3L70J 1YYCA 2Q3IA 2O1KA 1URQB 2P7JA 2N9YB 3GMAA 1NU1K 2R44A 2WPVB 2QJKB 2AXTE 4O9BA 1RF1B 5APUA 3CCEP 1Z56A 1VF5D 1NTKE 5TJHA 1KYOE 1FS0E 1KQLA 5APTA 1VQOP 1AA0A 3MP7B 3MZWB 1MUUA 1KILA 1ZRTD 2C0WA 4C7NB 1KB9E 5APWA 3L73J 4D6TE 1GDTA 2QIWA 2ZXEB 1PL5A 3WU2H 3Q5SA 3M0DC 2QE7H 3AE4C 3M9HA 4WY4C 1SQBG 1LTAC 3I56P 3L71G 2PAJA 1QLED 1FC2C 2E43A 2OTKE 1FZEA 3I55P 1ZXGA 1LJ2A 2OYHC 3RBZA 5KLVE 3CX5E 4M3LA 1J1EB 2N1TC 2K9JB 3HE5B 2YXRB 4WBAA 2GUVA 1Y8AA 3H1IG 1SQXG 4U7JA 4JF7A 3RK2B 1JY2N 3D71A 1JCCA 3CLQA 1NAYA 1S2EA 1YQ3C 1RE3C 4I7ZB 1OXZA 1EDLA 5CBOA 3L36A 3GW6A 1G2CB 1VQ4P 3RK3C 2E74B 2FFDA 1BSNA 1KORA 3C8VA 1EXIA 1NTMD 3H1JD 3CXHD 1IO4A 5AVZB 1P84H 1L4AA 5CHXA 4GODA 1NTZE 2HG5D 1S5LX 2A45I 3WUTA 1SQVJ 3HUSA 5AVXB 5B5EE 3SWFA 1N7SA 3VP9A 1S9KD 2YKPA 5CCHA 3L35A 2JP3A 2M8RA 2E76D 1AVYA 1LTJC 5AVWB 2H88C 1NTKJ 1L0NG 4C46A 3RL0g 1DEEG 2ZAEB 2A45H 4GKGA 1EZVI 2E5YA 4D6TJ 1GK6A 1YTZT 1N2DC 1SFCD 3PJSK 5K5GB 1NHLA 1SLQA 2QSIA 2CPSA 3H1KG 3V2QA 4B86A 4KJMA 1MFTA 5CJ0A 5DJUB 1LT9B 1FOSF 3AE1C 1OVRA 1X0TA 3ZDMA 2FKWB 1JY3N 1VF5C 4Z1MH 5KLVJ 3CCUP 3Q5PA 3NXSA 2IX7C 3TGUG 2JR8A 1BE3E 1AJYA 1YTZI 2YKOA 4ASWA 1BGYE 3GG2A 2MKVA 1X22A 5H2FE 1UIXA 1Q86Q 3M06A 3BCCD 4HB1A 2RKLA 2K88A 1X9VA 1QVFO 1KB9I 4W80A 3A2AA 3FGAD 2ZYAA 1M1JC 4IFMA 3SWYA 1H89A 2YNYA 1YBKA 2RH0A 1GW3A 2Q1KA 3D6ZA 4NPEA 5AW5B 3CC7P 1T3UA 4JYCA 1M8OB 5AW4B 3SFEC 2JDIH 3K5BA 3EQ2A 1SQPE 1NU1G 5AW9B 2ITAA 1NTZJ 3E1IA 4K35A 2FYNC 1Q81Q 2N9BA 3CX5I 1QEXA 2HPCA 2A06D 1XTGB 2OYHB 1GU4A 1NAFA 1FJKA 3WUUA 2GA1A 2OYOA 2NPSA 4NPDA 5KJ7A 3HD7A 1QVGO 1FOSE 3SWKA 1NTMG 3MUDC 1OMIA 1FAVA 3CX5H 3H1JG 1L0LK 2FYUD 1OVUA 3T97A 1JEKA 1N73C 2IFNA 3H32B 3HTKB 1M1KQ 3B5NB 3O8ZA 1EQ7A 1KV4A 2HODB 4H0LB 2VRSA 4AUWA 2K3RA 4DCKA 3WUVA 3L75E 2M5AB 1N8RQ 2B87A 1PP9E 3O6QA 3RBXA 2OYIC 3CMAP 1URQA 4EYYQ 2E76C 3RL0D 3H1HD 3U1CA 1VQLP 4N78D 3L72E 2L5GB 4R4MA 3C1LA 1RF1A 2ZT9D 3BRTB 3C9IA 2RMZA 1OX3A 2IFMA 1BE3J 4OGQD 1MKMA 1BGYJ 2W90A 4C7NA 3H6PA 1Q7YQ 1IJDB 3P8CE 2J5UA 2LXCB 2YXQB 1VDFA 1RQVA 1SFCC 2XKMA 1HBWA 1KILD 4IL6E 3MHVA 2QVAA 1J1DC 2ZVNB 1GL2B 1BCCG 3CCVP 1E5WA 2NRGA 3FWNA 1VL2A 1W2BO 2KIKA 2M3EA 1KQSO 1L0LD 3H1IE 3OA7A 3MTUE 1KFMA 3Q3DA 4DOJA 4RESB 4NPFX 1T2KD 2K9JA 3KXDA 3HE5A 1YJWP 2O01J 4JBZA 1SQPJ 1SQQE 1NJIQ 3G71P 3RK3E 1S1CX 2Q5UA 3BCCG 1LWUC 4HH2A 1AFOA 1OVVA 2D2CB 1RY3A 4DT0A 5E79E 1SQXD 2E75B 2M3BA 1L2PA 3N7NA 2YO2A 2WMMA 3VTPC 2V7QJ 1G2CA 1NH4A 1FJPA 5GTIH 1FZGA 3NFQA 3VOPA 1JY2O 4LGDE 5GTHE 1AV1A 1YIJP 3L70D 4UB6H 3CI9A 3L75J 1DH3A 1PP9J 2A06G 4CPGA 4OWFA 5H2FH 1VQPP 1PPJD 1L4AD 2Z5IA 3L72J 3TNUB 3A5TA 1N7SD 3W67A 3EFGA 5CCHD 1IZNB 2HYNA 1P84D 3L73D 3AE6C 1J2JB 5APYA 2HFED 2HR3A 1Q90D 3CPWO 1L0ND 2O01H 1X79B 1YJNP 3V4QA 3G3ZA 1FZBA 3R4YA 4PV1B 2BEQD 1FDOA 2JO1A 1TU3F 1ZRTE 3H1HG 3IR9A 2QM8A 3IN6A 3RL0C 1NTKK 1LT9A 3PTZA 3G6EP 1FU1A 1R5SA 3AEEC 2ZT9C 3H1KD 2V7QH 4H44B 1DD3A 2YKQA 3M9QA 5AVYB 4HYTB 3AECC 1ZN5A 2YMKA 4XA4A 3M9BA 2WSFJ 4R4LA 4OGQC 1FZCA 1SQQJ 5KLIC 1EZVD 1HJBA 3AE3C 3AEBC 1RF0A 1GW4A 3AEDC 1KILC 3E1RA 1IFIA 1WMKA 3TGUD 2QA4P 3CL3D 4YTPC 1GZLA 1JY3O 1L0LG 1UIIA 1M56D 2V4HA 5KLVK 3BASA 4WWIA 4RJTA 1HGVA 3IF4A 1T2KC 1SQVD 3LIDA 1LTBC 3H1LJ 2P2UA 3GHGA 1A02J 2QRXA 4GOFA 5B66H 2KUBA 5AW3B 3H1JE 3F5HA 1CSBA 1USEA 1NU1D 4PJ0E 2XZRA 4I6MC 4D6TD 3V5BA 4W7YA 3L37A 3V4WA 3PRJA 2NPSD 3FWLA 1S9KE 5KJ7D 3HD7D 3L70G 1FDIA 2FFDC 2H7HA 3A0BH 3HTKA 4UB8H 1OW6A 2KK7A 3PP5A 1NTZK 3B5NA 1K05A 2HODA 3OW2O 1PPJG 3CWBE 2M5AA 2KLVA 4Y99B 3CX5D 1KZUB 1EC5A 1L4AC 1Q82Q 3BVHA 3KPEA 5E79H 2I1JA 3HUSC 5KAFE 2QEXP 1N7SC 1JB0J 1HF9A 3B4SA 3L73G 4L76A 5CCHC 1URQD 1U7JA 4LC1A 2W6BA 3B71A 1JTHB 3PLNA 4BRYB 3N4XA 2A45G 3AE9C 3V2NA 4HJGH 1GL2A 5CMZA 4YPCA 3R2PA 2BCCE 3GF3A 5CCGA 1VQKP 1PIXA 3A0HE 4I1LA 2Y9YA 4H13B 1BCCD 2WITA 4ZMDA 1HH0A 3BCCE 5AW8B 1EZVG 4PD4E 2QJPB 1KN7A 4K3AA 1T8ZA 1KQGB 2UWJE 2KI7B 4C7RA 4ZKUA 5CBNA 1PFIA 2IBZE 1KTMA 3TDKA 1FZFA 3AE7C 3RK2D 3Q5RA 5APSA 2QG4A 1FBMA 1VPCA 2K1AA 1SS1A 1KYOI 1OWAA 2B9BA 1SP4A 4GOEA 1PGJA 1IFMA 2A06E 2MJZA 2OGUA 1SQVG 5KKZC 2QJYC 2AXTH 2C9NY 4IOIH 2IYOA 1SQPK 2E74D 3U1AA 1YHQP 1LNQA 1N86A 3JCUE 1KYOH 3KZIE 1ZR2A 1NTKG 2JWAA 1HWTC 2OQQA 3CWBJ 1EDIA 4WVZA 3JC22 4U3FE 1PGPA 2FYUE 1BDCA 1KB9H 4WY4B 2W6AA 2YO3A 3M0AA 2P58A 5AVVB 2O1JA 1BE3D 4D6TG 2WSEJ 3G9RA 2KS1B 2FXPA 2IZ0A 2NPSC 4IL6X 4A7PA 2IYPA 1NOHA 5KJ7C 3HD7C 2N1TB 3CMEP 1IFDA 3HE4A 4L74A 1W2EA 1R8EA 2LR2A 4N78E 1FDMA 3L74E 1ZLLA 4EDFA 2ZFCA 3AE5C 5KLVG 3II6A 1KD1Q 2CK3H 2WWWA 2BCCJ 1VQ7P 2DW3A 3MGNA 3U59A 2KSJA 2WTYA 2FXMA 1EDJA 3UIAA 1CZQA 1URQC 1SQPD 3CCJP 3RK3B 2QJKC 1SQBK 4ZNCA 1RF1C 1R5LA 1PZQA 2WVRA 1RHZB 4JYBA 2IPPA 3IFMA 1GD2E 1NYHA 1IK7A 3M91A 3PHLA 2C0XA 3WU2E 1SQBE 3HUSB 3D70A 3L71E 2G3AA 2XNDH 3CC2P 3OJAB 2Q7CA 1BSHA 1OW8A 2J59M 5KAFH 1LTJB 2CPBA 5AW7B 5AW0B 5B5EH 2FBWC 1NTZG 5AW2B 2Q9IA 5APQA 2WSEH 2P1JA 3L75D 1PP9D 1SQXE 1T3JA 1SQQK 2ZVOB 1AVOA 1OZHA 4IFDK 2ZJSE 1Q2NA 1AQ5A 1H0TB 1QL1A 1J1EC 4U3FJ 2FYUJ 2K37A 2NZ2A 2KP8A 2IZ1A 3RK2C 2R32A 1RQUA 4PD4I 3P7KA 3VMZA 3P8MC 3P8CD 2IBZI 1NKNA 4TLFA 5BVZA 2E42A 1VF5B 3VP8A 4ZKPA 1LTTC 1RE4A 3L74J 3A3YB 2E74C 2Q6QA 3V2PA 1P84E 2G8YA 1EXJA 4KHXA 2W83C 3B5ND 4BXLA 3KHUA 2XV5A 4H0LD 3H25A 2OTLP 1BE3G 1VQMP 1DD4A 1L0NE 3OAKA 1BGYG 4GT1A 5KTBA 1CI6B 4DZOA 3TK1A 1M1JB 2JEEA 1KQFB 2H43A 1E79H 1YI2P 1HJ0A 2I1KA 4IFFA 4YXWH 3JSVC 1D7MA 2AEMA 1GU5A 2AXCA 3NTNA 1W5CE 2AEJA 4QMAA 3H1KE 3KZIH 1SQBJ 4BRYA 2FYNB 3ABVC 3L71J 3EFFK 2FY8A 3QWOC 4N6JA 2LXBA 1MV8A 3CCLP 1SVFA 3AEAC 1GL2D 1FE6A 3VMYA 2XDJA 1SQPG 5L8RJ 3TF5A 1JY2P 1K04A 4N3YB 2P67A 3H1LD 3TGUE 5CCGD 3TYYA 1LT9C 1WRGA 3H1IJ 1SQXJ 4BWNA 3T97B 1DX7A 1IFNA 1N73B 1NWQA 1LT1A 3E7KA 2B89A 1FZCC 1H88A 1HUCA 1U7MA 5TISE 1RF0C 1S3JA 1MZ9A 2OYIB 1BDDA 1LP1B 2E76B 3L4FA 4L73A 2D2CD 2L91A 3S1KA 2WZ7A 3A7OA 1CW5A 3L75G 1HTLC 1PP9G 2E75D 1ZR4A 2KSEA 1NU1E 1NKZB 3GLMA 3L72G 2Y0CA 5AW1B 1K9MQ 1KFNA 2R3SA 1NTMK 4GDOA 1SFCB 2XU6A 1K73Q 4DJGA 1J1DB 3G4SP 5AVTB 5CJ4A 1PGOA 2GUSA 3M0DA 2Q3EA 4ASVA 4MN4C 3GHGC 1L0NJ 4WY4A 4IL6H 3Q1MA 1IFPA 1NTME 1NTKD 1KYOD 3CXHE 2H8PD 2KS1A 2OYHA 1JO5A 3F89A 4W7ZA 1KB9D 5EFWB 2N1TA 3FXDA 3VMXA 3H1KJ 5APXA 1JY3P 2KB7P 3CCMP 4LLHA 3H32A 3B5NC 1OIPA 2H89C 2WSFH 1LWUB 1G1IA 4H0LC 2SPZA 2O3JA 1RE3A 1SQQG 1GTWA 4PV1D 4I2LC 1P84I 5KLVD 3TGUJ 1JUNA 1ZMEC 2ZYDA 1WT6A 1NGMB 4OVNF 5BU8B 3AE2C 2WSCJ 2Y0DA 2B88A 4H44D 2ZXXA 2KZJA 2WT7B 1N7LA 1BCCE 2KNCB 1JCDA 1JNMA 1LTIC 5GTHH 2O01N 1VQNP 3QH9A 3I5CA 2FXOA 1GL2C 3H1LG 1H8AA 1LTJA 3AE8C 3FXEA 5CCGC 1QGKB 3CWBD 1NU1J 1KMIZ 1HGZA 1NO4A 1HVVA 3CD6P 5M1BA 1NTZD 1H0TA 2JKVA 1U57A 3USSA 2OTJP 1M7LA 3VMAA 2J58A 2YIUC 5APVA 3B8EB 2PP6A 3FX0A 1NTMJ 2ZYGA 1XTCC 3RL0B 3H1JJ 2D2CC 4GIFA 2ZT9B 2E75C 5GTIE 4EIJA 2PRRA
chains in the Genus database with same CATH topology
2KIKA 3S1KA 1EDIA 4KJMA 1MFTA 1EDKA 4NPDA 1BDCA 5DJUB 2B87B 2B88A 2HR3A 4HJGH 4NPFX 1EDLA 5CBOA 1OVRA 1X0TA 2P58A 2KZJA 3ZDMA 3PH0A 4JBZA 1OVUA 2QRXA 4GOFA 2R44A 2KUBA 1LP1A 2KS1B 3RGUA 2JWDA 1Q2NA 1ZW0A 2I8DA 1H0TB 4ASWA 2K3RA 1OVVA 4ASVA 2LR2A 2M5AB 4ZMDA 2B87A 5C39A 4MN4C 2M0BA 1Y47A 3MZWB 3QWOC 2LXBA 3FXEA 5DJTB 4K3AA 2WMMA 4GODA 4EYYQ 2UWJE 2RKLA 4HB1A 2KI7B 5CBNA 5EFWB 1H0TA 3FXDA 2M5AA 2KZIA 1NVOA 1EDJA 1JM0A 2Q1KA 1SS1A 4NPEA 1EC5A 1FC2C 2OTKE 1DEEG 4CPGA 2LXCB 2ZAEB 1ZXGA 4HKZH 4ZNCA 1LT1A 4GOEA 1JMBA 2B89A 3MHVA 2QVAA 2SPZA 1U7MA 4K35A 4IOIH 1S3JA 1BDDA 4BXLA 5K5GB 1LP1B 4WWIA 1U7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIK A;  3S1K A;  1EDI A;  4KJM A;  1MFT A;  1EDK A;  4NPD A;  1BDC A;  5DJU B;  2B87 B;  2B88 A;  2HR3 A;  4HJG H;  4NPF X;  1EDL A;  5CBO A;  1OVR A;  1X0T A;  2P58 A;  2KZJ A;  3ZDM A;  3PH0 A;  4JBZ A;  1OVU A;  2QRX A;  4GOF A;  2R44 A;  2KUB A;  1LP1 A;  2KS1 B;  3RGU A;  2JWD A;  1Q2N A;  1ZW0 A;  2I8D A;  1H0T B;  4ASW A;  2K3R A;  1OVV A;  4ASV A;  2LR2 A;  2M5A B;  4ZMD A;  2B87 A;  5C39 A;  4MN4 C;  2M0B A;  1Y47 A;  3MZW B;  3QWO C;  2LXB A;  3FXE A;  5DJT B;  4K3A A;  2WMM A;  4GOD A;  4EYY Q;  2UWJ E;  2RKL A;  4HB1 A;  2KI7 B;  5CBN A;  5EFW B;  1H0T A;  3FXD A;  2M5A A;  2KZI A;  1NVO A;  1EDJ A;  1JM0 A;  2Q1K A;  1SS1 A;  4NPE A;  1EC5 A;  1FC2 C;  2OTK E;  1DEE G;  4CPG A;  2LXC B;  2ZAE B;  1ZXG A;  4HKZ H;  4ZNC A;  1LT1 A;  4GOE A;  1JMB A;  2B89 A;  3MHV A;  2QVA A;  2SPZ A;  1U7M A;  4K35 A;  4IOI H;  1S3J A;  1BDD A;  4BXL A;  5K5G B;  1LP1 B;  4WWI A;  1U7J A; 
#chains in the Genus database with same CATH topology
 4EI2 A;  1S5L E;  1VQ5 P;  4UB6 E;  1FZC B;  4OGQ B;  2WSC H;  2BCC D;  3S4R A;  5KLI B;  3AEG C;  2FYU K;  1KIL B;  3MIW A;  2KYV A;  1IK9 A;  3PH0 A;  4XFJ A;  5TIS H;  3KYQ A;  4YXD C;  3BAT A;  2WPS A;  3CCQ P;  1RH5 B;  5AVR B;  4PD4 D;  1ZW0 A;  2WQY C;  1CI6 A;  1ZV8 A;  2KLU A;  5KAI E;  1DIP A;  1M1J A;  2IBZ D;  3KDP B;  3TNU A;  5DJT B;  1DEB A;  4OH8 B;  1BGY D;  3VYI A;  3V2R A;  2WSS H;  1OFC X;  1BCC J;  3LW5 J;  3HRN A;  3CXH I;  3IAO A;  3GHG B;  3H1H E;  2AEF A;  3P32 A;  1G1J A;  2C9L Y;  4HKZ H;  1USD A;  5AVS B;  3TSI A;  4PV1 C;  1JMB A;  3SSU A;  1LTG C;  1AQT A;  3CXH H;  1X8Y A;  1M90 Q;  3MUD A;  4U3F D;  1KIL E;  1ZP0 C;  4H13 D;  4PJ0 H;  1IC2 A;  4RO0 A;  2FFD B;  4H44 C;  1N73 A;  3BCC J;  2W8Z A;  2BEZ F;  1S72 P;  1JOC A;  1EDK A;  3D6Y A;  2WPR A;  2Z4E A;  1L0L E;  1L4A B;  2OYI A;  4TT3 H;  1LP1 A;  3S9O A;  1YJ9 P;  3L74 D;  1N7S B;  2JWD A;  2KOG A;  3CWB G;  1SQX K;  2GM4 A;  2HLO A;  4JPZ B;  3V6I A;  1VQ8 P;  1JMM A;  1KC8 Q;  2K9Y A;  4AQR D;  3CCS P;  2YMY A;  3CCR P;  1A02 F;  1VQ9 P;  1SFC A;  3LW5 H;  3LIE A;  1LTS C;  3VN0 A;  5B66 E;  2POH A;  3L72 D;  2R5B A;  1JM0 A;  2R3C A;  1OW7 A;  5AW6 B;  1QX8 A;  2IDB A;  4JQ0 D;  4WY4 D;  1MFZ A;  1M57 D;  3L70 E;  4L75 A;  3GF7 A;  1SQB D;  3L71 D;  3A0H H;  2BCC G;  4I7Z C;  3A0B E;  3CC4 P;  4UB8 E;  2YIU B;  2Z5H A;  3AEF C;  1PPJ E;  2Y0E A;  2LKM A;  1RE4 C;  2N1T D;  2PGD A;  3H1H J;  4AYC A;  4PD4 H;  1LWU A;  4XE5 B;  1L0N K;  3KQG A;  3L73 E;  1T6A A;  1ZOY C;  3H1I D;  3BRV B;  4Y99 C;  2BAS A;  2IBZ G;  1Y9B A;  3SFD C;  4EOT A;  3RGU A;  2XNX A;  1PV3 A;  5KKZ B;  2I8D A;  2QJY B;  1SQQ D;  2PFX A;  1S5L H;  1YQ4 C;  5C39 A;  1IFJ A;  2M0B A;  3RK3 D;  3W68 A;  2P10 A;  5BU5 A;  1Y47 A;  3NMD A;  1PGQ A;  3Q2Y A;  4Y28 J;  2WT7 A;  3H1L E;  2KNC A;  3WMM 0;  1L0L J;  1QL2 A;  2JJL A;  3JCU H;  1JTH A;  1VQ6 P;  2HPC B;  2KZI A;  2WPQ A;  1NVO A;  3EWK A;  1K8A Q;  4KT0 J;  1S4X A;  1EZV E;  4U3F G;  5KAI H;  2FYU G;  2KXP B;  2OAR A;  2FYZ A;  2R5D A;  2RN0 A;  1GMJ A;  2NPS B;  1FZA A;  2W27 A;  3HD7 B;  3HE4 B;  4RKU J;  4H13 C;  3MD0 A;  4WB4 A;  1SQV K;  1YIT P;  5AVQ B;  1GK4 A;  2QJP C;  2W6J H;  2Y9Z A;  3ITK A;  2E5T A;  5AVU B;  3L74 G;  2B87 B;  1LGH B;  3O6Q B;  2QM7 A;  1SQV E;  3L70 J;  1YYC A;  2Q3I A;  2O1K A;  1URQ B;  2P7J A;  2N9Y B;  3GMA A;  1NU1 K;  2R44 A;  2WPV B;  2QJK B;  2AXT E;  4O9B A;  1RF1 B;  5APU A;  3CCE P;  1Z56 A;  1VF5 D;  1NTK E;  5TJH A;  1KYO E;  1FS0 E;  1KQL A;  5APT A;  1VQO P;  1AA0 A;  3MP7 B;  3MZW B;  1MUU A;  1KIL A;  1ZRT D;  2C0W A;  4C7N B;  1KB9 E;  5APW A;  3L73 J;  4D6T E;  1GDT A;  2QIW A;  2ZXE B;  1PL5 A;  3WU2 H;  3Q5S A;  3M0D C;  2QE7 H;  3AE4 C;  3M9H A;  4WY4 C;  1SQB G;  1LTA C;  3I56 P;  3L71 G;  2PAJ A;  1QLE D;  1FC2 C;  2E43 A;  2OTK E;  1FZE A;  3I55 P;  1ZXG A;  1LJ2 A;  2OYH C;  3RBZ A;  5KLV E;  3CX5 E;  4M3L A;  1J1E B;  2N1T C;  2K9J B;  3HE5 B;  2YXR B;  4WBA A;  2GUV A;  1Y8A A;  3H1I G;  1SQX G;  4U7J A;  4JF7 A;  3RK2 B;  1JY2 N;  3D71 A;  1JCC A;  3CLQ A;  1NAY A;  1S2E A;  1YQ3 C;  1RE3 C;  4I7Z B;  1OXZ A;  1EDL A;  5CBO A;  3L36 A;  3GW6 A;  1G2C B;  1VQ4 P;  3RK3 C;  2E74 B;  2FFD A;  1BSN A;  1KOR A;  3C8V A;  1EXI A;  1NTM D;  3H1J D;  3CXH D;  1IO4 A;  5AVZ B;  1P84 H;  1L4A A;  5CHX A;  4GOD A;  1NTZ E;  2HG5 D;  1S5L X;  2A45 I;  3WUT A;  1SQV J;  3HUS A;  5AVX B;  5B5E E;  3SWF A;  1N7S A;  3VP9 A;  1S9K D;  2YKP A;  5CCH A;  3L35 A;  2JP3 A;  2M8R A;  2E76 D;  1AVY A;  1LTJ C;  5AVW B;  2H88 C;  1NTK J;  1L0N G;  4C46 A;  3RL0 g;  1DEE G;  2ZAE B;  2A45 H;  4GKG A;  1EZV I;  2E5Y A;  4D6T J;  1GK6 A;  1YTZ T;  1N2D C;  1SFC D;  3PJS K;  5K5G B;  1NHL A;  1SLQ A;  2QSI A;  2CPS A;  3H1K G;  3V2Q A;  4B86 A;  4KJM A;  1MFT A;  5CJ0 A;  5DJU B;  1LT9 B;  1FOS F;  3AE1 C;  1OVR A;  1X0T A;  3ZDM A;  2FKW B;  1JY3 N;  1VF5 C;  4Z1M H;  5KLV J;  3CCU P;  3Q5P A;  3NXS A;  2IX7 C;  3TGU G;  2JR8 A;  1BE3 E;  1AJY A;  1YTZ I;  2YKO A;  4ASW A;  1BGY E;  3GG2 A;  2MKV A;  1X22 A;  5H2F E;  1UIX A;  1Q86 Q;  3M06 A;  3BCC D;  4HB1 A;  2RKL A;  2K88 A;  1X9V A;  1QVF O;  1KB9 I;  4W80 A;  3A2A A;  3FGA D;  2ZYA A;  1M1J C;  4IFM A;  3SWY A;  1H89 A;  2YNY A;  1YBK A;  2RH0 A;  1GW3 A;  2Q1K A;  3D6Z A;  4NPE A;  5AW5 B;  3CC7 P;  1T3U A;  4JYC A;  1M8O B;  5AW4 B;  3SFE C;  2JDI H;  3K5B A;  3EQ2 A;  1SQP E;  1NU1 G;  5AW9 B;  2ITA A;  1NTZ J;  3E1I A;  4K35 A;  2FYN C;  1Q81 Q;  2N9B A;  3CX5 I;  1QEX A;  2HPC A;  2A06 D;  1XTG B;  2OYH B;  1GU4 A;  1NAF A;  1FJK A;  3WUU A;  2GA1 A;  2OYO A;  2NPS A;  4NPD A;  5KJ7 A;  3HD7 A;  1QVG O;  1FOS E;  3SWK A;  1NTM G;  3MUD C;  1OMI A;  1FAV A;  3CX5 H;  3H1J G;  1L0L K;  2FYU D;  1OVU A;  3T97 A;  1JEK A;  1N73 C;  2IFN A;  3H32 B;  3HTK B;  1M1K Q;  3B5N B;  3O8Z A;  1EQ7 A;  1KV4 A;  2HOD B;  4H0L B;  2VRS A;  4AUW A;  2K3R A;  4DCK A;  3WUV A;  3L75 E;  2M5A B;  1N8R Q;  2B87 A;  1PP9 E;  3O6Q A;  3RBX A;  2OYI C;  3CMA P;  1URQ A;  4EYY Q;  2E76 C;  3RL0 D;  3H1H D;  3U1C A;  1VQL P;  4N78 D;  3L72 E;  2L5G B;  4R4M A;  3C1L A;  1RF1 A;  2ZT9 D;  3BRT B;  3C9I A;  2RMZ A;  1OX3 A;  2IFM A;  1BE3 J;  4OGQ D;  1MKM A;  1BGY J;  2W90 A;  4C7N A;  3H6P A;  1Q7Y Q;  1IJD B;  3P8C E;  2J5U A;  2LXC B;  2YXQ B;  1VDF A;  1RQV A;  1SFC C;  2XKM A;  1HBW A;  1KIL D;  4IL6 E;  3MHV A;  2QVA A;  1J1D C;  2ZVN B;  1GL2 B;  1BCC G;  3CCV P;  1E5W A;  2NRG A;  3FWN A;  1VL2 A;  1W2B O;  2KIK A;  2M3E A;  1KQS O;  1L0L D;  3H1I E;  3OA7 A;  3MTU E;  1KFM A;  3Q3D A;  4DOJ A;  4RES B;  4NPF X;  1T2K D;  2K9J A;  3KXD A;  3HE5 A;  1YJW P;  2O01 J;  4JBZ A;  1SQP J;  1SQQ E;  1NJI Q;  3G71 P;  3RK3 E;  1S1C X;  2Q5U A;  3BCC G;  1LWU C;  4HH2 A;  1AFO A;  1OVV A;  2D2C B;  1RY3 A;  4DT0 A;  5E79 E;  1SQX D;  2E75 B;  2M3B A;  1L2P A;  3N7N A;  2YO2 A;  2WMM A;  3VTP C;  2V7Q J;  1G2C A;  1NH4 A;  1FJP A;  5GTI H;  1FZG A;  3NFQ A;  3VOP A;  1JY2 O;  4LGD E;  5GTH E;  1AV1 A;  1YIJ P;  3L70 D;  4UB6 H;  3CI9 A;  3L75 J;  1DH3 A;  1PP9 J;  2A06 G;  4CPG A;  4OWF A;  5H2F H;  1VQP P;  1PPJ D;  1L4A D;  2Z5I A;  3L72 J;  3TNU B;  3A5T A;  1N7S D;  3W67 A;  3EFG A;  5CCH D;  1IZN B;  2HYN A;  1P84 D;  3L73 D;  3AE6 C;  1J2J B;  5APY A;  2HFE D;  2HR3 A;  1Q90 D;  3CPW O;  1L0N D;  2O01 H;  1X79 B;  1YJN P;  3V4Q A;  3G3Z A;  1FZB A;  3R4Y A;  4PV1 B;  2BEQ D;  1FDO A;  2JO1 A;  1TU3 F;  1ZRT E;  3H1H G;  3IR9 A;  2QM8 A;  3IN6 A;  3RL0 C;  1NTK K;  1LT9 A;  3PTZ A;  3G6E P;  1FU1 A;  1R5S A;  3AEE C;  2ZT9 C;  3H1K D;  2V7Q H;  4H44 B;  1DD3 A;  2YKQ A;  3M9Q A;  5AVY B;  4HYT B;  3AEC C;  1ZN5 A;  2YMK A;  4XA4 A;  3M9B A;  2WSF J;  4R4L A;  4OGQ C;  1FZC A;  1SQQ J;  5KLI C;  1EZV D;  1HJB A;  3AE3 C;  3AEB C;  1RF0 A;  1GW4 A;  3AED C;  1KIL C;  3E1R A;  1IFI A;  1WMK A;  3TGU D;  2QA4 P;  3CL3 D;  4YTP C;  1GZL A;  1JY3 O;  1L0L G;  1UII A;  1M56 D;  2V4H A;  5KLV K;  3BAS A;  4WWI A;  4RJT A;  1HGV A;  3IF4 A;  1T2K C;  1SQV D;  3LID A;  1LTB C;  3H1L J;  2P2U A;  3GHG A;  1A02 J;  2QRX A;  4GOF A;  5B66 H;  2KUB A;  5AW3 B;  3H1J E;  3F5H A;  1CSB A;  1USE A;  1NU1 D;  4PJ0 E;  2XZR A;  4I6M C;  4D6T D;  3V5B A;  4W7Y A;  3L37 A;  3V4W A;  3PRJ A;  2NPS D;  3FWL A;  1S9K E;  5KJ7 D;  3HD7 D;  3L70 G;  1FDI A;  2FFD C;  2H7H A;  3A0B H;  3HTK A;  4UB8 H;  1OW6 A;  2KK7 A;  3PP5 A;  1NTZ K;  3B5N A;  1K05 A;  2HOD A;  3OW2 O;  1PPJ G;  3CWB E;  2M5A A;  2KLV A;  4Y99 B;  3CX5 D;  1KZU B;  1EC5 A;  1L4A C;  1Q82 Q;  3BVH A;  3KPE A;  5E79 H;  2I1J A;  3HUS C;  5KAF E;  2QEX P;  1N7S C;  1JB0 J;  1HF9 A;  3B4S A;  3L73 G;  4L76 A;  5CCH C;  1URQ D;  1U7J A;  4LC1 A;  2W6B A;  3B71 A;  1JTH B;  3PLN A;  4BRY B;  3N4X A;  2A45 G;  3AE9 C;  3V2N A;  4HJG H;  1GL2 A;  5CMZ A;  4YPC A;  3R2P A;  2BCC E;  3GF3 A;  5CCG A;  1VQK P;  1PIX A;  3A0H E;  4I1L A;  2Y9Y A;  4H13 B;  1BCC D;  2WIT A;  4ZMD A;  1HH0 A;  3BCC E;  5AW8 B;  1EZV G;  4PD4 E;  2QJP B;  1KN7 A;  4K3A A;  1T8Z A;  1KQG B;  2UWJ E;  2KI7 B;  4C7R A;  4ZKU A;  5CBN A;  1PFI A;  2IBZ E;  1KTM A;  3TDK A;  1FZF A;  3AE7 C;  3RK2 D;  3Q5R A;  5APS A;  2QG4 A;  1FBM A;  1VPC A;  2K1A A;  1SS1 A;  1KYO I;  1OWA A;  2B9B A;  1SP4 A;  4GOE A;  1PGJ A;  1IFM A;  2A06 E;  2MJZ A;  2OGU A;  1SQV G;  5KKZ C;  2QJY C;  2AXT H;  2C9N Y;  4IOI H;  2IYO A;  1SQP K;  2E74 D;  3U1A A;  1YHQ P;  1LNQ A;  1N86 A;  3JCU E;  1KYO H;  3KZI E;  1ZR2 A;  1NTK G;  2JWA A;  1HWT C;  2OQQ A;  3CWB J;  1EDI A;  4WVZ A;  3JC2 2;  4U3F E;  1PGP A;  2FYU E;  1BDC A;  1KB9 H;  4WY4 B;  2W6A A;  2YO3 A;  3M0A A;  2P58 A;  5AVV B;  2O1J A;  1BE3 D;  4D6T G;  2WSE J;  3G9R A;  2KS1 B;  2FXP A;  2IZ0 A;  2NPS C;  4IL6 X;  4A7P A;  2IYP A;  1NOH A;  5KJ7 C;  3HD7 C;  2N1T B;  3CME P;  1IFD A;  3HE4 A;  4L74 A;  1W2E A;  1R8E A;  2LR2 A;  4N78 E;  1FDM A;  3L74 E;  1ZLL A;  4EDF A;  2ZFC A;  3AE5 C;  5KLV G;  3II6 A;  1KD1 Q;  2CK3 H;  2WWW A;  2BCC J;  1VQ7 P;  2DW3 A;  3MGN A;  3U59 A;  2KSJ A;  2WTY A;  2FXM A;  1EDJ A;  3UIA A;  1CZQ A;  1URQ C;  1SQP D;  3CCJ P;  3RK3 B;  2QJK C;  1SQB K;  4ZNC A;  1RF1 C;  1R5L A;  1PZQ A;  2WVR A;  1RHZ B;  4JYB A;  2IPP A;  3IFM A;  1GD2 E;  1NYH A;  1IK7 A;  3M91 A;  3PHL A;  2C0X A;  3WU2 E;  1SQB E;  3HUS B;  3D70 A;  3L71 E;  2G3A A;  2XND H;  3CC2 P;  3OJA B;  2Q7C A;  1BSH A;  1OW8 A;  2J59 M;  5KAF H;  1LTJ B;  2CPB A;  5AW7 B;  5AW0 B;  5B5E H;  2FBW C;  1NTZ G;  5AW2 B;  2Q9I A;  5APQ A;  2WSE H;  2P1J A;  3L75 D;  1PP9 D;  1SQX E;  1T3J A;  1SQQ K;  2ZVO B;  1AVO A;  1OZH A;  4IFD K;  2ZJS E;  1Q2N A;  1AQ5 A;  1H0T B;  1QL1 A;  1J1E C;  4U3F J;  2FYU J;  2K37 A;  2NZ2 A;  2KP8 A;  2IZ1 A;  3RK2 C;  2R32 A;  1RQU A;  4PD4 I;  3P7K A;  3VMZ A;  3P8M C;  3P8C D;  2IBZ I;  1NKN A;  4TLF A;  5BVZ A;  2E42 A;  1VF5 B;  3VP8 A;  4ZKP A;  1LTT C;  1RE4 A;  3L74 J;  3A3Y B;  2E74 C;  2Q6Q A;  3V2P A;  1P84 E;  2G8Y A;  1EXJ A;  4KHX A;  2W83 C;  3B5N D;  4BXL A;  3KHU A;  2XV5 A;  4H0L D;  3H25 A;  2OTL P;  1BE3 G;  1VQM P;  1DD4 A;  1L0N E;  3OAK A;  1BGY G;  4GT1 A;  5KTB A;  1CI6 B;  4DZO A;  3TK1 A;  1M1J B;  2JEE A;  1KQF B;  2H43 A;  1E79 H;  1YI2 P;  1HJ0 A;  2I1K A;  4IFF A;  4YXW H;  3JSV C;  1D7M A;  2AEM A;  1GU5 A;  2AXC A;  3NTN A;  1W5C E;  2AEJ A;  4QMA A;  3H1K E;  3KZI H;  1SQB J;  4BRY A;  2FYN B;  3ABV C;  3L71 J;  3EFF K;  2FY8 A;  3QWO C;  4N6J A;  2LXB A;  1MV8 A;  3CCL P;  1SVF A;  3AEA C;  1GL2 D;  1FE6 A;  3VMY A;  2XDJ A;  1SQP G;  5L8R J;  3TF5 A;  1JY2 P;  1K04 A;  4N3Y B;  2P67 A;  3H1L D;  3TGU E;  5CCG D;  3TYY A;  1LT9 C;  1WRG A;  3H1I J;  1SQX J;  4BWN A;  3T97 B;  1DX7 A;  1IFN A;  1N73 B;  1NWQ A;  1LT1 A;  3E7K A;  2B89 A;  1FZC C;  1H88 A;  1HUC A;  1U7M A;  5TIS E;  1RF0 C;  1S3J A;  1MZ9 A;  2OYI B;  1BDD A;  1LP1 B;  2E76 B;  3L4F A;  4L73 A;  2D2C D;  2L91 A;  3S1K A;  2WZ7 A;  3A7O A;  1CW5 A;  3L75 G;  1HTL C;  1PP9 G;  2E75 D;  1ZR4 A;  2KSE A;  1NU1 E;  1NKZ B;  3GLM A;  3L72 G;  2Y0C A;  5AW1 B;  1K9M Q;  1KFN A;  2R3S A;  1NTM K;  4GDO A;  1SFC B;  2XU6 A;  1K73 Q;  4DJG A;  1J1D B;  3G4S P;  5AVT B;  5CJ4 A;  1PGO A;  2GUS A;  3M0D A;  2Q3E A;  4ASV A;  4MN4 C;  3GHG C;  1L0N J;  4WY4 A;  4IL6 H;  3Q1M A;  1IFP A;  1NTM E;  1NTK D;  1KYO D;  3CXH E;  2H8P D;  2KS1 A;  2OYH A;  1JO5 A;  3F89 A;  4W7Z A;  1KB9 D;  5EFW B;  2N1T A;  3FXD A;  3VMX A;  3H1K J;  5APX A;  1JY3 P;  2KB7 P;  3CCM P;  4LLH A;  3H32 A;  3B5N C;  1OIP A;  2H89 C;  2WSF H;  1LWU B;  1G1I A;  4H0L C;  2SPZ A;  2O3J A;  1RE3 A;  1SQQ G;  1GTW A;  4PV1 D;  4I2L C;  1P84 I;  5KLV D;  3TGU J;  1JUN A;  1ZME C;  2ZYD A;  1WT6 A;  1NGM B;  4OVN F;  5BU8 B;  3AE2 C;  2WSC J;  2Y0D A;  2B88 A;  4H44 D;  2ZXX A;  2KZJ A;  2WT7 B;  1N7L A;  1BCC E;  2KNC B;  1JCD A;  1JNM A;  1LTI C;  5GTH H;  2O01 N;  1VQN P;  3QH9 A;  3I5C A;  2FXO A;  1GL2 C;  3H1L G;  1H8A A;  1LTJ A;  3AE8 C;  3FXE A;  5CCG C;  1QGK B;  3CWB D;  1NU1 J;  1KMI Z;  1HGZ A;  1NO4 A;  1HVV A;  3CD6 P;  5M1B A;  1NTZ D;  1H0T A;  2JKV A;  1U57 A;  3USS A;  2OTJ P;  1M7L A;  3VMA A;  2J58 A;  2YIU C;  5APV A;  3B8E B;  2PP6 A;  3FX0 A;  1NTM J;  2ZYG A;  1XTC C;  3RL0 B;  3H1J J;  2D2C C;  4GIF A;  2ZT9 B;  2E75 C;  5GTI E;  4EIJ A;  2PRR A; 
#chains in the Genus database with same CATH homology
 2KIK A;  3S1K A;  1EDI A;  4KJM A;  1MFT A;  1EDK A;  4NPD A;  1BDC A;  5DJU B;  2B87 B;  2B88 A;  2HR3 A;  4HJG H;  4NPF X;  1EDL A;  5CBO A;  1OVR A;  1X0T A;  2P58 A;  2KZJ A;  3ZDM A;  3PH0 A;  4JBZ A;  1OVU A;  2QRX A;  4GOF A;  2R44 A;  2KUB A;  1LP1 A;  2KS1 B;  3RGU A;  2JWD A;  1Q2N A;  1ZW0 A;  2I8D A;  1H0T B;  4ASW A;  2K3R A;  1OVV A;  4ASV A;  2LR2 A;  2M5A B;  4ZMD A;  2B87 A;  5C39 A;  4MN4 C;  2M0B A;  1Y47 A;  3MZW B;  3QWO C;  2LXB A;  3FXE A;  5DJT B;  4K3A A;  2WMM A;  4GOD A;  4EYY Q;  2UWJ E;  2RKL A;  4HB1 A;  2KI7 B;  5CBN A;  5EFW B;  1H0T A;  3FXD A;  2M5A A;  2KZI A;  1NVO A;  1EDJ A;  1JM0 A;  2Q1K A;  1SS1 A;  4NPE A;  1EC5 A;  1FC2 C;  2OTK E;  1DEE G;  4CPG A;  2LXC B;  2ZAE B;  1ZXG A;  4HKZ H;  4ZNC A;  1LT1 A;  4GOE A;  1JMB A;  2B89 A;  3MHV A;  2QVA A;  2SPZ A;  1U7M A;  4K35 A;  4IOI H;  1S3J A;  1BDD A;  4BXL A;  5K5G B;  1LP1 B;  4WWI A;  1U7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...