1FC2C

Crystallographic refinement and atomic models of a human fc fragment and its complex with fragment b of protein a from staphylococcus aureus at 2.9-and 2.8-angstroms resolution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
43
structure length
43
Chain Sequence
FNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immunoglobulin
molecule keywords FRAGMENT B OF PROTEIN A COMPLEX
publication title Crystallographic refinement and atomic models of a human Fc fragment and its complex with fragment B of protein A from Staphylococcus aureus at 2.9- and 2.8-A resolution.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 9
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 1981-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1fc2C00
1OVRA 2M5AB 4EYYQ 1MFTA 2UWJE 2JWDA 4NPDA 1LP1A 4K35A 2LR2A 1LT1A 1BDDA 2M5AA 4HJGH 1EDLA 1Q2NA 4BXLA 1BDCA 4HB1A 1Y47A 4GOFA 1H0TB 2M0BA 3FXDA 4ZNCA 1DEEG 4MN4C 4K3AA 2QRXA 5DJTB 5CBNA 4ZMDA 4ASWA 2OTKE 1EDKA 5K5GB 2QVAA 1U7MA 1ZXGA 1S3JA 2KI7B 3ZDMA 4GODA 3FXEA 2KZIA 1OVVA 4NPFX 1FC2C 2WMMA 4KJMA 1EC5A 2ZAEB 5CBOA 4GOEA 1H0TA 1JMBA 1OVUA 2SPZA 1EDIA 4WWIA 2LXCB 2HR3A 4JBZA 2P58A 2R44A 3QWOC 2LXBA 4IOIH 2K3RA 2KUBA 4CPGA 1LP1B 3S1KA 2B89A 5EFWB 2Q1KA 1ZW0A 2B88A 1NVOA 3RGUA 4NPEA 5C39A 2KS1B 4ASVA 1JM0A 2B87B 2KZJA 1EDJA 3MHVA 2KIKA 1SS1A 3PH0A 1X0TA 4HKZH 2RKLA 5DJUB 2B87A 3MZWB 1U7JA 2I8DA
chains in the Genus database with same CATH superfamily
3H1LJ 3IFMA 3RK3D 4D6TG 2HYNA 1JTHA 1L2PA 1L0NJ 2YKOA 1LP1A 3H32B 4JF7A 1M1KQ 1BDDA 4JYCA 2R5DA 1BE3D 1DD3A 1X22A 1M7LA 4XA4A 1CW5A 1L0LK 1LTTC 3CD6P 2JR8A 2QRXA 4EIJA 5AVXB 3MP7B 1OWAA 3D70A 2KP8A 1PP9G 1MV8A 2XDJA 2WSFJ 1FC2C 3TK1A 3L73G 2HODA 3CCQP 3GLMA 3CX5H 3Q2YA 2CK3H 4GT1A 1N73B 1IJDB 1K73Q 1HUCA 3CC2P 1BCCG 2CPSA 2R3SA 2Q7CA 3M0DA 3CMAP 1DEBA 1LTJA 1IFDA 3L75G 1LNQA 3N7NA 3IAOA 2KZJA 1SS1A 3H1JE 4PD4H 2WPVB 3H1IJ 2WSCH 1HF9A 1W5CE 4N3YB 3AE4C 2M5AB 4DZOA 1NHLA 2K37A 1FOSF 5AW8B 3NTNA 3BCCJ 2BCCJ 2IX7C 2YIUC 4H0LD 1YJNP 1BE3J 1Q2NA 1NTMD 1GW3A 1ZMEC 2GUVA 2NPSC 5APSA 5KLVK 2AEFA 5KJ7C 1KILE 3GF3A 4DJGA 2WSEH 2I1JA 1S3JA 3A0HH 1SQPE 1SQXD 3HE4A 1NTZK 2AXTH 2AEJA 1EC5A 1OXZA 1S9KE 2FFDA 4IFFA 2LKMA 5GTHE 3CCEP 3WUUA 2JJLA 3GW6A 1YI2P 2JEEA 5APTA 2K88A 1JNMA 3CX5I 4Y28J 2MKVA 2N1TB 2QM7A 3HTKA 1RE3C 2N1TD 1PPJD 1AQTA 4DT0A 2IBZG 1S4XA 2FYUG 5CCHA 3PH0A 2QJYB 2ZXXA 3O8ZA 4Y99C 3M0AA 1VQNP 3H1KG 3CXHI 1YBKA 1OVRA 4EYYQ 2QIWA 1MFTA 5E79H 4NPDA 2IZ1A 1SVFA 1SQBD 1LT1A 3KPEA 2N9YB 1BDCA 2KXPB 2O01J 4JYBA 4WY4B 5KLVG 3JSVC 2FYZA 1M1JB 2WT7A 1YTZT 2RH0A 3AE8C 4ZMDA 3C1LA 2OYIB 5AVTB 2KI7B 3FGAD 2AEMA 1NTZG 2FXPA 3H1LE 2L91A 1FS0E 2KSJA 1MZ9A 1L0NE 1GL2C 3FWNA 1ZRTE 1JY2P 1MKMA 5CBOA 1VQ8P 2WTYA 1JY2N 3AEBC 3LIEA 1FOSE 1VQ9P 1FDOA 3F89A 3SSUA 2QSIA 3HUSB 1BGYJ 3L37A 2C9LY 2G3AA 3ITKA 3WU2E 4C46A 1S5LH 1Q82Q 3A0BH 3AE9C 3AE6C 1SQXK 1LGHB 4D6TD 3V2RA 1M57D 3P7KA 1LWUC 4YXDC 2KLVA 4IL6H 1URQB 1FZAA 3RBZA 1QL2A 1SQBJ 3B5NA 2FXOA 2QJKB 5B5EH 2KOGA 3H1HG 3BVHA 1OX3A 3RK2B 3U1CA 2IBZI 5DJTB 3RK2D 1NU1G 2R5BA 2JWAA 3RL0g 5GTIH 2OTKE 3L73D 3KZIH 3L74G 5KKZC 1SFCB 3JC22 1KYOD 3H1IE 3AEDC 3CXHD 2KNCA 3UIAA 3W68A 1BCCD 1P84E 2QA4P 1JOCA 5AVRB 3BRVB 3BCCE 2BCCE 3RBXA 2BEQD 1SQBK 3L72J 3L75D 1NTMG 1WMKA 1M56D 3I55P 1SQVG 5AW3B 3VMXA 1JTHB 3VTPC 4CPGA 1LP1B 3JCUH 2ZT9B 2D2CD 2NRGA 4W7YA 5APYA 4WB4A 2QJPC 3O6QA 1EZVE 2O01H 3GMAA 1SQXG 3GHGC 4ASVA 2WQYC 4D6TJ 4RKUJ 1VQ4P 1Q7YQ 5AVUB 3GF7A 1TU3F 5APQA 2HODB 3W67A 1PP9J 3SWYA 2KK7A 3CLQA 1VDFA 2ZYAA 1PPJG 2E76D 1KTMA 3L73J 1CI6A 1W2EA 1LTJB 1YHQP 3ZDMA 3V2PA 2W27A 3VYIA 2A06D 1BCCJ 5KAIH 3L71E 4U3FE 2E74B 2NPSA 2WPRA 2YMKA 2E5TA 5KJ7A 2E74D 3VP8A 3HD7D 2MJZA 3L75J 1S5LX 1OZHA 1ZOYC 1G2CA 4I7ZB 2JP3A 4AUWA 1YJ9P 2E75B 2IBZD 1IZNB 3E7KA 2FYUD 4RJTA 4PJ0E 2E75D 5CJ0A 3A2AA 3RL0D 4NPEA 2ZJSE 4IL6X 3H1KD 4PV1C 1S2EA 1RQUA 4H13D 4H0LC 1KZUB 2WSEJ 3VN0A 4RO0A 1L0LJ 1NAYA 2OARA 3HE4B 2Q3IA 1L4AC 2UWJE 1RE3A 2OGUA 2P67A 5BVZA 3SFEC 1BGYE 1GU5A 2FFDB 3V4QA 2HFED 2M0BA 4ZNCA 1DEEG 1EXIA 1M90Q 4DCKA 5KAFH 1S1CX 5AW9B 3AEGC 1N86A 2L5GB 1N2DC 3FXEA 4N78D 1OVVA 4AQRD 3HTKB 2OTLP 4OH8B 3WUVA 1SQBE 4EI2A 3M9HA 3CCJP 3D6YA 1ZR4A 2IFNA 1KQLA 3V2QA 1GD2E 4GOEA 5CCHD 1JY3O 3NXSA 1G1JA 3U1AA 3QH9A 3TDKA 3EQ2A 3OJAB 2FYUJ 1FZCB 4IOIH 2QJYC 3S1KA 3MD0A 2OTJP 2Q1KA 1J1DB 4N6JA 1YQ4C 1GL2A 3H1KJ 1FZGA 5TISE 1EDJA 2XU6A 2WITA 2WT7B 1SQPG 3M9BA 3MUDC 1X0TA 4HH2A 1HVVA 4EOTA 3CWBE 5KLVJ 2ZYGA 4O9BA 3H1HD 1KYOH 3L72E 3TGUD 1VF5B 4B86A 3CCLP 1M1JC 3CXHH 2OYHC 2JWDA 4L76A 1SQQG 1NU1D 3BASA 3B71A 3L74D 1K9MQ 2FYUK 1Y47A 2POHA 1R5LA 2C9NY 1NTZJ 3P8CD 1PFIA 5AVYB 1LWUA 3CCVP 4IFDK 1A02J 1T2KC 3PTZA 4GODA 2W90A 1KFNA 4UB6H 1IO4A 5KLIB 1YJWP 1KMIZ 1SQVD 1HGVA 1RF1C 4EDFA 1PL5A 3CX5E 2N9BA 2O01N 1PP9E 4YTPC 1FJPA 1YIJP 1JMBA 2IDBA 2K1AA 2IPPA 2SPZA 2P1JA 4TT3H 3TF5A 4WVZA 3B5NB 5H2FE 1RY3A 1ZW0A 3B5ND 3L36A 1NVOA 3Q3DA 3HE5A 3V4WA 1QVFO 2A06G 2B87B 3MHVA 1KB9H 3G4SP 4PD4E 5CHXA 1BSHA 3H1HJ 4L74A 1KQSO 3FWLA 2KNCB 1NU1J 1A02F 3BATA 1IC2A 3AE7C 3GHGA 3L74J 1EDLA 3MTUE 2W6AA 4BXLA 2YNYA 3V5BA 5L8RJ 1KYOI 2W8ZA 5TJHA 1USEA 3V6IA 5APWA 2H8PD 1RHZB 3MIWA 5KTBA 4GKGA 5K5GB 1QEXA 2FYNC 3AE3C 1NTMJ 2FXMA 1L0LE 3L70E 2E5YA 2PGDA 2GUSA 2AXTE 1SQVJ 2HG5D 3VMAA 4WY4D 4KJMA 2D2CC 3M91A 2Y9ZA 1R5SA 1H0TA 3T97A 1NTKG 2JDIH 5AW2B 1NU1K 3D6ZA 2FY8A 1Z56A 1SQXJ 1DD4A 1JEKA 1QVGO 1VQ7P 2B89A 3ABVC 1VQ6P 3S4RA 3EFGA 4JQ0D 4OWFA 3II6A 1NTMK 3PHLA 4XE5B 1SQVK 4L73A 1USDA 3M06A 2A45G 5CCGD 5AW5B 4WBAA 2YIUB 2E76C 5AW6B 2IBZE 5E79E 1KB9I 2P2UA 2E43A 5APUA 1JMMA 2NPSB 2H7HA 2YMYA 2PP6A 4YXWH 2M5AA 1N7SC 5AVVB 1OW8A 1T3JA 2NPSD 2VRSA 1X8YA 4GOFA 2A45H 5KJ7D 1GK4A 2PAJA 1G2CB 4K3AA 3H1JD 4OGQB 3HD7C 1L4AA 1EZVG 1ZXGA 4OGQD 5AW7B 3SFDC 1URQD 1YYCA 5KLVE 2H89C 3TGUG 4R4LA 4I7ZC 4AYCA 1LTBC 3RL0C 1KILB 3EFFK 3CC4P 1J1EC 4H44C 1KILD 1NTZE 3G3ZA 4H13C 2Z5IA 4WWIA 2LXCB 1QLED 1SFCD 2HPCA 3VOPA 1KN7A 3RK3E 1HJBA 1KQFB 2K3RA 1SQPD 1NJIQ 2M3BA 1S5LE 3CCSP 1BE3E 4KT0J 1LJ2A 1RH5B 1JM0A 4Y99B 1S9KD 2YXQB 1JB0J 4LC1A 4JPZB 1SQQD 4TLFA 1DIPA 1LT9C 3L71G 2I8DA 4U3FG 2W6BA 1KC8Q 4IL6E 3RK3C 2ZT9D 3AEAC 5B5EE 3L35A 1VL2A 4UB8H 3PLNA 5AVZB 2KS1A 2GM4A 3MUDA 2J59M 3TSIA 1Q90D 3B8EB 3U59A 5CMZA 2WPSA 5CBNA 2BASA 5GTIE 1M1JA 3KZIE 1FBMA 1PGOA 1KFMA 2OYHA 5B66H 3H1HE 1JCDA 2A45I 3FX0A 1GL2B 1MUUA 2YKQA 1CZQA 1GL2D 2M8RA 3IF4A 3F5HA 2OYOA 1KB9D 1FZCC 3L74E 1VQOP 1VQMP 5AW4B 2OQQA 1G1IA 1Q81Q 1YTZI 1JUNA 1SP4A 1N73C 1SQPJ 1HGZA 1RQVA 1E5WA 3JCUE 1EZVI 3I5CA 2V7QJ 1RF1A 3H1LD 1OIPA 3D71A 1NTME 5C39A 1EQ7A 1PV3A 2R32A 2Y0DA 2NZ2A 3IN6A 4ZKUA 1L0ND 1FAVA 2J5UA 1LWUB 1ZRTD 3LW5H 4ZKPA 1SQQJ 3Q5SA 1U7JA 1IK9A 1LTGC 1MFZA 1JO5A 1HTLC 1OFCX 1SQXE 3H6PA 3CPWO 2KLUA 1T8ZA 1VPCA 2Y9YA 1SQPK 2WPQA 3GG2A 3NFQA 5KKZB 2KB7P 1ZLLA 2FBWC 3A7OA 3HRNA 1WT6A 3KHUA 1N7LA 1LTIC 1NTKD 1IFMA 4W80A 1SQQK 3P8MC 1HWTC 3HE5B 1M8OB 2ITAA 5KAIE 4DOJA 1PPJE 3CWBG 2Q6QA 4I6MC 1KORA 1E79H 1GTWA 3WUTA 1EDIA 1GDTA 2LXBA 3H1JG 2KUBA 2QJPB 1RE4C 3GHGB 2H88C 3TNUA 1P84D 1HBWA 1GK6A 2N1TC 2RMZA 3BCCD 1K05A 5AVWB 2BCCD 4C7NA 3VMYA 1GU4A 2PRRA 5DJUB 1X9VA 3CCMP 1UIXA 3CL3D 2Q3EA 1AA0A 3C9IA 4HB1A 1EZVD 1H0TB 3T97B 3KYQA 4YPCA 1AJYA 4WY4C 5AW0B 5KAFE 3A3YB 1FDMA 1L0NK 3AEFC 2K9YA 2BEZF 2QVAA 1VF5D 4IFMA 2IFMA 1NTKJ 2QM8A 2PFXA 3N4XA 1N7SA 3H25A 2OYIC 2V7QH 2AXCA 1D7MA 4U7JA 5H2FH 3VP9A 3Q5RA 1HH0A 2K9JA 5BU8B 3NMDA 4D6TE 3HD7A 5GTHH 2IYOA 1K8AQ 4C7RA 3QWOC 3M9QA 4PV1B 2B9BA 5CCGC 1IFJA 1AV1A 4H0LB 3HUSC 4PV1D 3L71D 4A7PA 4U3FD 4M3LA 1NTKK 1NKZB 2Z4EA 4I1LA 4QMAA 1W2BO 1L0LG 3AE5C 3L70G 1LTAC 2YO2A 3L73E 3MZWB 1L4AB 1KYOE 1K04A 1AFOA 3OW2O 1X79B 1L4AD 1R8EA 2ZXEB 3CXHE 1BCCE 1KQGB 2YKPA 4K35A 5AVQB 4OGQC 1URQC 4HJGH 2M3EA 2QJKC 1DX7A 3H1LG 3TGUJ 3L75E 1LT9A 1OW6A 1L0NG 2HPCB 4ASWA 3RK2C 4BRYA 3CC7P 1SQQE 1EDKA 2V4HA 1KILC 3G71P 4XFJA 4UB6E 1SFCC 1IFIA 3H32A 4KHXA 1BGYD 3TYYA 1OW7A 1Q86Q 3C8VA 1IK7A 4Z1MH 1GW4A 1AQ5A 3SWKA 1OVUA 3A0HE 1AVOA 1IFNA 2R3CA 3USSA 1VQ5P 2R44A 4L75A 2W6JH 3O6QB 3KDPB 3AECC 3PP5A 2ZFCA 1T3UA 3OA7A 2XKMA 3L71J 3WU2H 1VQKP 3RGUA 4U3FJ 1FZCA 5AVSB 2KS1B 1CSBA 2ZVNB 2ZT9C 2QE7H 2KSEA 2WSFH 1DH3A 3PJSK 4PD4I 1H88A 1PGQA 3SWFA 1KB9E 2Z5HA 2O3JA 1N73A 2JKVA 1BSNA 1FU1A 2Y0EA 2OYHB 1EXJA 3E1IA 3KQGA 2WZ7A 2A06E 3R4YA 5CJ4A 1FZBA 1KV4A 1FDIA 1OMIA 2XZRA 1WRGA 3H1IG 1CI6B 3FXDA 3Q5PA 2XNXA 3PRJA 1T2KD 1Y8AA 3BCCG 2BCCG 1QX8A 1NYHA 3CWBD 1BE3G 2FYUE 3L72D 1NKNA 3L4FA 2GA1A 3M0DC 3EWKA 3AE1C 1YQ3C 1RF1B 1LTJC 4NPFX 1P84H 3AE2C 3H1KE 1YITP 5APXA 3LW5J 2WMMA 5APVA 1RF0A 4LLHA 2E74C 1AVYA 3KXDA 2G8YA 1VQLP 2XV5A 1NH4A 1PGPA 1Y9BA 1J2JB 1XTCC 1NTKE 2E75C 2O1JA 3K5BA 3S9OA 1GMJA 3LIDA 1QL1A 3CCUP 1T6AA 3R2PA 2W83C 2E42A 1NAFA 3CX5D 1JCCA 1PP9D 2RKLA 2CPBA 2B87A 2ZVOB 4GIFA 1RE4A 1JY3P 4N78E 4W7ZA 3V2NA 1FZEA 3A0BE 1JY3N 3G9RA 2JO1A 2N1TA 2O1KA 2YXRB 4MN4C 2FFDC 5BU5A 4PD4D 2FYNB 3CWBJ 1ZR2A 1GZLA 1UIIA 1U7MA 2HLOA 3TNUB 2D2CB 1PZQA 2RN0A 2P7JA 3H1JJ 4WY4A 4C7NB 4I2LC 2Q9IA 4RESB 5CCHC 1ZN5A 3OAKA 3AEEC 3TGUE 2KYVA 1P84I 2HR3A 1H89A 2C0WA 2P58A 1XTGB 4PJ0H 3Q1MA 1NO4A 2Q5UA 2OYIA 1H8AA 2WSSH 2C0XA 2QEXP 1NU1E 1L0LD 3L70D 2B88A 1LTSC 1NWQA 3I56P 1J1DC 2IZ0A 3P8CE 3G6EP 5M1BA 3CMEP 1BGYG 3WMM0 2E76B 3E1RA 2P10A 3B4SA 4R4MA 1N8RQ 5CCGA 1N7SB 4OVNF 2IYPA 3HUSA 1U57A 1PIXA 1N7SD 1VF5C 2LR2A 1SQVE 2K9JB 4UB8E 1ZP0C 1NGMB 3CCRP 3HD7B 3MGNA 1S72P 3A5TA 1FE6A 1SQBG 2DW3A 2YO3A 2WSCJ 1JY2O 1KD1Q 1HJ0A 5B66E 2KZIA 1URQA 1FJKA 3IR9A 1IFPA 3RL0B 5KLIC 1J1EB 4H44B 2H43A 1RF0C 2ZAEB 4H13B 1QGKB 4BWNA 4H44D 1VQPP 3BRTB 1KILA 4JBZA 4LGDE 1SFCA 3CI9A 1ZV8A 3L70J 5KLVD 5EFWB 3L72G 5TISH 2WVRA 1NOHA 3B5NC 1FZFA 2QG4A 1PGJA 2FKWB 1LT9B 2KIKA 2WWWA 1SLQA 2J58A 2XNDH 2ZYDA 2Y0CA 4HKZH 3VMZA 2I1KA 4HYTB 4BRYB 3P32A 1NTZD 3RK3B 4GDOA 3H1ID 5AW1B
chains in the Genus database with same CATH topology
1OVRA 2M5AB 4EYYQ 1MFTA 2UWJE 2JWDA 4NPDA 1LP1A 4K35A 2LR2A 1LT1A 1BDDA 2M5AA 4HJGH 1EDLA 1Q2NA 4BXLA 1BDCA 4HB1A 1Y47A 4GOFA 1H0TB 2M0BA 3FXDA 4ZNCA 1DEEG 4MN4C 4K3AA 2QRXA 5DJTB 5CBNA 4ZMDA 4ASWA 2OTKE 1EDKA 5K5GB 2QVAA 1U7MA 1ZXGA 1S3JA 2KI7B 3ZDMA 4GODA 3FXEA 2KZIA 1OVVA 4NPFX 1FC2C 2WMMA 4KJMA 1EC5A 2ZAEB 5CBOA 4GOEA 1H0TA 1JMBA 1OVUA 2SPZA 1EDIA 4WWIA 2LXCB 2HR3A 4JBZA 2P58A 2R44A 3QWOC 2LXBA 4IOIH 2K3RA 2KUBA 4CPGA 1LP1B 3S1KA 2B89A 5EFWB 2Q1KA 1ZW0A 2B88A 1NVOA 3RGUA 4NPEA 5C39A 2KS1B 4ASVA 1JM0A 2B87B 2KZJA 1EDJA 3MHVA 2KIKA 1SS1A 3PH0A 1X0TA 4HKZH 2RKLA 5DJUB 2B87A 3MZWB 1U7JA 2I8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OVR A;  2M5A B;  4EYY Q;  1MFT A;  2UWJ E;  2JWD A;  4NPD A;  1LP1 A;  4K35 A;  2LR2 A;  1LT1 A;  1BDD A;  2M5A A;  4HJG H;  1EDL A;  1Q2N A;  4BXL A;  1BDC A;  4HB1 A;  1Y47 A;  4GOF A;  1H0T B;  2M0B A;  3FXD A;  4ZNC A;  1DEE G;  4MN4 C;  4K3A A;  2QRX A;  5DJT B;  5CBN A;  4ZMD A;  4ASW A;  2OTK E;  1EDK A;  5K5G B;  2QVA A;  1U7M A;  1ZXG A;  1S3J A;  2KI7 B;  3ZDM A;  4GOD A;  3FXE A;  2KZI A;  1OVV A;  4NPF X;  1FC2 C;  2WMM A;  4KJM A;  1EC5 A;  2ZAE B;  5CBO A;  4GOE A;  1H0T A;  1JMB A;  1OVU A;  2SPZ A;  1EDI A;  4WWI A;  2LXC B;  2HR3 A;  4JBZ A;  2P58 A;  2R44 A;  3QWO C;  2LXB A;  4IOI H;  2K3R A;  2KUB A;  4CPG A;  1LP1 B;  3S1K A;  2B89 A;  5EFW B;  2Q1K A;  1ZW0 A;  2B88 A;  1NVO A;  3RGU A;  4NPE A;  5C39 A;  2KS1 B;  4ASV A;  1JM0 A;  2B87 B;  2KZJ A;  1EDJ A;  3MHV A;  2KIK A;  1SS1 A;  3PH0 A;  1X0T A;  4HKZ H;  2RKL A;  5DJU B;  2B87 A;  3MZW B;  1U7J A;  2I8D A; 
#chains in the Genus database with same CATH topology
 3H1L J;  3IFM A;  3RK3 D;  4D6T G;  2HYN A;  1JTH A;  1L2P A;  1L0N J;  2YKO A;  1LP1 A;  3H32 B;  4JF7 A;  1M1K Q;  1BDD A;  4JYC A;  2R5D A;  1BE3 D;  1DD3 A;  1X22 A;  1M7L A;  4XA4 A;  1CW5 A;  1L0L K;  1LTT C;  3CD6 P;  2JR8 A;  2QRX A;  4EIJ A;  5AVX B;  3MP7 B;  1OWA A;  3D70 A;  2KP8 A;  1PP9 G;  1MV8 A;  2XDJ A;  2WSF J;  1FC2 C;  3TK1 A;  3L73 G;  2HOD A;  3CCQ P;  3GLM A;  3CX5 H;  3Q2Y A;  2CK3 H;  4GT1 A;  1N73 B;  1IJD B;  1K73 Q;  1HUC A;  3CC2 P;  1BCC G;  2CPS A;  2R3S A;  2Q7C A;  3M0D A;  3CMA P;  1DEB A;  1LTJ A;  1IFD A;  3L75 G;  1LNQ A;  3N7N A;  3IAO A;  2KZJ A;  1SS1 A;  3H1J E;  4PD4 H;  2WPV B;  3H1I J;  2WSC H;  1HF9 A;  1W5C E;  4N3Y B;  3AE4 C;  2M5A B;  4DZO A;  1NHL A;  2K37 A;  1FOS F;  5AW8 B;  3NTN A;  3BCC J;  2BCC J;  2IX7 C;  2YIU C;  4H0L D;  1YJN P;  1BE3 J;  1Q2N A;  1NTM D;  1GW3 A;  1ZME C;  2GUV A;  2NPS C;  5APS A;  5KLV K;  2AEF A;  5KJ7 C;  1KIL E;  3GF3 A;  4DJG A;  2WSE H;  2I1J A;  1S3J A;  3A0H H;  1SQP E;  1SQX D;  3HE4 A;  1NTZ K;  2AXT H;  2AEJ A;  1EC5 A;  1OXZ A;  1S9K E;  2FFD A;  4IFF A;  2LKM A;  5GTH E;  3CCE P;  3WUU A;  2JJL A;  3GW6 A;  1YI2 P;  2JEE A;  5APT A;  2K88 A;  1JNM A;  3CX5 I;  4Y28 J;  2MKV A;  2N1T B;  2QM7 A;  3HTK A;  1RE3 C;  2N1T D;  1PPJ D;  1AQT A;  4DT0 A;  2IBZ G;  1S4X A;  2FYU G;  5CCH A;  3PH0 A;  2QJY B;  2ZXX A;  3O8Z A;  4Y99 C;  3M0A A;  1VQN P;  3H1K G;  3CXH I;  1YBK A;  1OVR A;  4EYY Q;  2QIW A;  1MFT A;  5E79 H;  4NPD A;  2IZ1 A;  1SVF A;  1SQB D;  1LT1 A;  3KPE A;  2N9Y B;  1BDC A;  2KXP B;  2O01 J;  4JYB A;  4WY4 B;  5KLV G;  3JSV C;  2FYZ A;  1M1J B;  2WT7 A;  1YTZ T;  2RH0 A;  3AE8 C;  4ZMD A;  3C1L A;  2OYI B;  5AVT B;  2KI7 B;  3FGA D;  2AEM A;  1NTZ G;  2FXP A;  3H1L E;  2L91 A;  1FS0 E;  2KSJ A;  1MZ9 A;  1L0N E;  1GL2 C;  3FWN A;  1ZRT E;  1JY2 P;  1MKM A;  5CBO A;  1VQ8 P;  2WTY A;  1JY2 N;  3AEB C;  3LIE A;  1FOS E;  1VQ9 P;  1FDO A;  3F89 A;  3SSU A;  2QSI A;  3HUS B;  1BGY J;  3L37 A;  2C9L Y;  2G3A A;  3ITK A;  3WU2 E;  4C46 A;  1S5L H;  1Q82 Q;  3A0B H;  3AE9 C;  3AE6 C;  1SQX K;  1LGH B;  4D6T D;  3V2R A;  1M57 D;  3P7K A;  1LWU C;  4YXD C;  2KLV A;  4IL6 H;  1URQ B;  1FZA A;  3RBZ A;  1QL2 A;  1SQB J;  3B5N A;  2FXO A;  2QJK B;  5B5E H;  2KOG A;  3H1H G;  3BVH A;  1OX3 A;  3RK2 B;  3U1C A;  2IBZ I;  5DJT B;  3RK2 D;  1NU1 G;  2R5B A;  2JWA A;  3RL0 g;  5GTI H;  2OTK E;  3L73 D;  3KZI H;  3L74 G;  5KKZ C;  1SFC B;  3JC2 2;  1KYO D;  3H1I E;  3AED C;  3CXH D;  2KNC A;  3UIA A;  3W68 A;  1BCC D;  1P84 E;  2QA4 P;  1JOC A;  5AVR B;  3BRV B;  3BCC E;  2BCC E;  3RBX A;  2BEQ D;  1SQB K;  3L72 J;  3L75 D;  1NTM G;  1WMK A;  1M56 D;  3I55 P;  1SQV G;  5AW3 B;  3VMX A;  1JTH B;  3VTP C;  4CPG A;  1LP1 B;  3JCU H;  2ZT9 B;  2D2C D;  2NRG A;  4W7Y A;  5APY A;  4WB4 A;  2QJP C;  3O6Q A;  1EZV E;  2O01 H;  3GMA A;  1SQX G;  3GHG C;  4ASV A;  2WQY C;  4D6T J;  4RKU J;  1VQ4 P;  1Q7Y Q;  5AVU B;  3GF7 A;  1TU3 F;  5APQ A;  2HOD B;  3W67 A;  1PP9 J;  3SWY A;  2KK7 A;  3CLQ A;  1VDF A;  2ZYA A;  1PPJ G;  2E76 D;  1KTM A;  3L73 J;  1CI6 A;  1W2E A;  1LTJ B;  1YHQ P;  3ZDM A;  3V2P A;  2W27 A;  3VYI A;  2A06 D;  1BCC J;  5KAI H;  3L71 E;  4U3F E;  2E74 B;  2NPS A;  2WPR A;  2YMK A;  2E5T A;  5KJ7 A;  2E74 D;  3VP8 A;  3HD7 D;  2MJZ A;  3L75 J;  1S5L X;  1OZH A;  1ZOY C;  1G2C A;  4I7Z B;  2JP3 A;  4AUW A;  1YJ9 P;  2E75 B;  2IBZ D;  1IZN B;  3E7K A;  2FYU D;  4RJT A;  4PJ0 E;  2E75 D;  5CJ0 A;  3A2A A;  3RL0 D;  4NPE A;  2ZJS E;  4IL6 X;  3H1K D;  4PV1 C;  1S2E A;  1RQU A;  4H13 D;  4H0L C;  1KZU B;  2WSE J;  3VN0 A;  4RO0 A;  1L0L J;  1NAY A;  2OAR A;  3HE4 B;  2Q3I A;  1L4A C;  2UWJ E;  1RE3 A;  2OGU A;  2P67 A;  5BVZ A;  3SFE C;  1BGY E;  1GU5 A;  2FFD B;  3V4Q A;  2HFE D;  2M0B A;  4ZNC A;  1DEE G;  1EXI A;  1M90 Q;  4DCK A;  5KAF H;  1S1C X;  5AW9 B;  3AEG C;  1N86 A;  2L5G B;  1N2D C;  3FXE A;  4N78 D;  1OVV A;  4AQR D;  3HTK B;  2OTL P;  4OH8 B;  3WUV A;  1SQB E;  4EI2 A;  3M9H A;  3CCJ P;  3D6Y A;  1ZR4 A;  2IFN A;  1KQL A;  3V2Q A;  1GD2 E;  4GOE A;  5CCH D;  1JY3 O;  3NXS A;  1G1J A;  3U1A A;  3QH9 A;  3TDK A;  3EQ2 A;  3OJA B;  2FYU J;  1FZC B;  4IOI H;  2QJY C;  3S1K A;  3MD0 A;  2OTJ P;  2Q1K A;  1J1D B;  4N6J A;  1YQ4 C;  1GL2 A;  3H1K J;  1FZG A;  5TIS E;  1EDJ A;  2XU6 A;  2WIT A;  2WT7 B;  1SQP G;  3M9B A;  3MUD C;  1X0T A;  4HH2 A;  1HVV A;  4EOT A;  3CWB E;  5KLV J;  2ZYG A;  4O9B A;  3H1H D;  1KYO H;  3L72 E;  3TGU D;  1VF5 B;  4B86 A;  3CCL P;  1M1J C;  3CXH H;  2OYH C;  2JWD A;  4L76 A;  1SQQ G;  1NU1 D;  3BAS A;  3B71 A;  3L74 D;  1K9M Q;  2FYU K;  1Y47 A;  2POH A;  1R5L A;  2C9N Y;  1NTZ J;  3P8C D;  1PFI A;  5AVY B;  1LWU A;  3CCV P;  4IFD K;  1A02 J;  1T2K C;  3PTZ A;  4GOD A;  2W90 A;  1KFN A;  4UB6 H;  1IO4 A;  5KLI B;  1YJW P;  1KMI Z;  1SQV D;  1HGV A;  1RF1 C;  4EDF A;  1PL5 A;  3CX5 E;  2N9B A;  2O01 N;  1PP9 E;  4YTP C;  1FJP A;  1YIJ P;  1JMB A;  2IDB A;  2K1A A;  2IPP A;  2SPZ A;  2P1J A;  4TT3 H;  3TF5 A;  4WVZ A;  3B5N B;  5H2F E;  1RY3 A;  1ZW0 A;  3B5N D;  3L36 A;  1NVO A;  3Q3D A;  3HE5 A;  3V4W A;  1QVF O;  2A06 G;  2B87 B;  3MHV A;  1KB9 H;  3G4S P;  4PD4 E;  5CHX A;  1BSH A;  3H1H J;  4L74 A;  1KQS O;  3FWL A;  2KNC B;  1NU1 J;  1A02 F;  3BAT A;  1IC2 A;  3AE7 C;  3GHG A;  3L74 J;  1EDL A;  3MTU E;  2W6A A;  4BXL A;  2YNY A;  3V5B A;  5L8R J;  1KYO I;  2W8Z A;  5TJH A;  1USE A;  3V6I A;  5APW A;  2H8P D;  1RHZ B;  3MIW A;  5KTB A;  4GKG A;  5K5G B;  1QEX A;  2FYN C;  3AE3 C;  1NTM J;  2FXM A;  1L0L E;  3L70 E;  2E5Y A;  2PGD A;  2GUS A;  2AXT E;  1SQV J;  2HG5 D;  3VMA A;  4WY4 D;  4KJM A;  2D2C C;  3M91 A;  2Y9Z A;  1R5S A;  1H0T A;  3T97 A;  1NTK G;  2JDI H;  5AW2 B;  1NU1 K;  3D6Z A;  2FY8 A;  1Z56 A;  1SQX J;  1DD4 A;  1JEK A;  1QVG O;  1VQ7 P;  2B89 A;  3ABV C;  1VQ6 P;  3S4R A;  3EFG A;  4JQ0 D;  4OWF A;  3II6 A;  1NTM K;  3PHL A;  4XE5 B;  1SQV K;  4L73 A;  1USD A;  3M06 A;  2A45 G;  5CCG D;  5AW5 B;  4WBA A;  2YIU B;  2E76 C;  5AW6 B;  2IBZ E;  5E79 E;  1KB9 I;  2P2U A;  2E43 A;  5APU A;  1JMM A;  2NPS B;  2H7H A;  2YMY A;  2PP6 A;  4YXW H;  2M5A A;  1N7S C;  5AVV B;  1OW8 A;  1T3J A;  2NPS D;  2VRS A;  1X8Y A;  4GOF A;  2A45 H;  5KJ7 D;  1GK4 A;  2PAJ A;  1G2C B;  4K3A A;  3H1J D;  4OGQ B;  3HD7 C;  1L4A A;  1EZV G;  1ZXG A;  4OGQ D;  5AW7 B;  3SFD C;  1URQ D;  1YYC A;  5KLV E;  2H89 C;  3TGU G;  4R4L A;  4I7Z C;  4AYC A;  1LTB C;  3RL0 C;  1KIL B;  3EFF K;  3CC4 P;  1J1E C;  4H44 C;  1KIL D;  1NTZ E;  3G3Z A;  4H13 C;  2Z5I A;  4WWI A;  2LXC B;  1QLE D;  1SFC D;  2HPC A;  3VOP A;  1KN7 A;  3RK3 E;  1HJB A;  1KQF B;  2K3R A;  1SQP D;  1NJI Q;  2M3B A;  1S5L E;  3CCS P;  1BE3 E;  4KT0 J;  1LJ2 A;  1RH5 B;  1JM0 A;  4Y99 B;  1S9K D;  2YXQ B;  1JB0 J;  4LC1 A;  4JPZ B;  1SQQ D;  4TLF A;  1DIP A;  1LT9 C;  3L71 G;  2I8D A;  4U3F G;  2W6B A;  1KC8 Q;  4IL6 E;  3RK3 C;  2ZT9 D;  3AEA C;  5B5E E;  3L35 A;  1VL2 A;  4UB8 H;  3PLN A;  5AVZ B;  2KS1 A;  2GM4 A;  3MUD A;  2J59 M;  3TSI A;  1Q90 D;  3B8E B;  3U59 A;  5CMZ A;  2WPS A;  5CBN A;  2BAS A;  5GTI E;  1M1J A;  3KZI E;  1FBM A;  1PGO A;  1KFM A;  2OYH A;  5B66 H;  3H1H E;  1JCD A;  2A45 I;  3FX0 A;  1GL2 B;  1MUU A;  2YKQ A;  1CZQ A;  1GL2 D;  2M8R A;  3IF4 A;  3F5H A;  2OYO A;  1KB9 D;  1FZC C;  3L74 E;  1VQO P;  1VQM P;  5AW4 B;  2OQQ A;  1G1I A;  1Q81 Q;  1YTZ I;  1JUN A;  1SP4 A;  1N73 C;  1SQP J;  1HGZ A;  1RQV A;  1E5W A;  3JCU E;  1EZV I;  3I5C A;  2V7Q J;  1RF1 A;  3H1L D;  1OIP A;  3D71 A;  1NTM E;  5C39 A;  1EQ7 A;  1PV3 A;  2R32 A;  2Y0D A;  2NZ2 A;  3IN6 A;  4ZKU A;  1L0N D;  1FAV A;  2J5U A;  1LWU B;  1ZRT D;  3LW5 H;  4ZKP A;  1SQQ J;  3Q5S A;  1U7J A;  1IK9 A;  1LTG C;  1MFZ A;  1JO5 A;  1HTL C;  1OFC X;  1SQX E;  3H6P A;  3CPW O;  2KLU A;  1T8Z A;  1VPC A;  2Y9Y A;  1SQP K;  2WPQ A;  3GG2 A;  3NFQ A;  5KKZ B;  2KB7 P;  1ZLL A;  2FBW C;  3A7O A;  3HRN A;  1WT6 A;  3KHU A;  1N7L A;  1LTI C;  1NTK D;  1IFM A;  4W80 A;  1SQQ K;  3P8M C;  1HWT C;  3HE5 B;  1M8O B;  2ITA A;  5KAI E;  4DOJ A;  1PPJ E;  3CWB G;  2Q6Q A;  4I6M C;  1KOR A;  1E79 H;  1GTW A;  3WUT A;  1EDI A;  1GDT A;  2LXB A;  3H1J G;  2KUB A;  2QJP B;  1RE4 C;  3GHG B;  2H88 C;  3TNU A;  1P84 D;  1HBW A;  1GK6 A;  2N1T C;  2RMZ A;  3BCC D;  1K05 A;  5AVW B;  2BCC D;  4C7N A;  3VMY A;  1GU4 A;  2PRR A;  5DJU B;  1X9V A;  3CCM P;  1UIX A;  3CL3 D;  2Q3E A;  1AA0 A;  3C9I A;  4HB1 A;  1EZV D;  1H0T B;  3T97 B;  3KYQ A;  4YPC A;  1AJY A;  4WY4 C;  5AW0 B;  5KAF E;  3A3Y B;  1FDM A;  1L0N K;  3AEF C;  2K9Y A;  2BEZ F;  2QVA A;  1VF5 D;  4IFM A;  2IFM A;  1NTK J;  2QM8 A;  2PFX A;  3N4X A;  1N7S A;  3H25 A;  2OYI C;  2V7Q H;  2AXC A;  1D7M A;  4U7J A;  5H2F H;  3VP9 A;  3Q5R A;  1HH0 A;  2K9J A;  5BU8 B;  3NMD A;  4D6T E;  3HD7 A;  5GTH H;  2IYO A;  1K8A Q;  4C7R A;  3QWO C;  3M9Q A;  4PV1 B;  2B9B A;  5CCG C;  1IFJ A;  1AV1 A;  4H0L B;  3HUS C;  4PV1 D;  3L71 D;  4A7P A;  4U3F D;  4M3L A;  1NTK K;  1NKZ B;  2Z4E A;  4I1L A;  4QMA A;  1W2B O;  1L0L G;  3AE5 C;  3L70 G;  1LTA C;  2YO2 A;  3L73 E;  3MZW B;  1L4A B;  1KYO E;  1K04 A;  1AFO A;  3OW2 O;  1X79 B;  1L4A D;  1R8E A;  2ZXE B;  3CXH E;  1BCC E;  1KQG B;  2YKP A;  4K35 A;  5AVQ B;  4OGQ C;  1URQ C;  4HJG H;  2M3E A;  2QJK C;  1DX7 A;  3H1L G;  3TGU J;  3L75 E;  1LT9 A;  1OW6 A;  1L0N G;  2HPC B;  4ASW A;  3RK2 C;  4BRY A;  3CC7 P;  1SQQ E;  1EDK A;  2V4H A;  1KIL C;  3G71 P;  4XFJ A;  4UB6 E;  1SFC C;  1IFI A;  3H32 A;  4KHX A;  1BGY D;  3TYY A;  1OW7 A;  1Q86 Q;  3C8V A;  1IK7 A;  4Z1M H;  1GW4 A;  1AQ5 A;  3SWK A;  1OVU A;  3A0H E;  1AVO A;  1IFN A;  2R3C A;  3USS A;  1VQ5 P;  2R44 A;  4L75 A;  2W6J H;  3O6Q B;  3KDP B;  3AEC C;  3PP5 A;  2ZFC A;  1T3U A;  3OA7 A;  2XKM A;  3L71 J;  3WU2 H;  1VQK P;  3RGU A;  4U3F J;  1FZC A;  5AVS B;  2KS1 B;  1CSB A;  2ZVN B;  2ZT9 C;  2QE7 H;  2KSE A;  2WSF H;  1DH3 A;  3PJS K;  4PD4 I;  1H88 A;  1PGQ A;  3SWF A;  1KB9 E;  2Z5H A;  2O3J A;  1N73 A;  2JKV A;  1BSN A;  1FU1 A;  2Y0E A;  2OYH B;  1EXJ A;  3E1I A;  3KQG A;  2WZ7 A;  2A06 E;  3R4Y A;  5CJ4 A;  1FZB A;  1KV4 A;  1FDI A;  1OMI A;  2XZR A;  1WRG A;  3H1I G;  1CI6 B;  3FXD A;  3Q5P A;  2XNX A;  3PRJ A;  1T2K D;  1Y8A A;  3BCC G;  2BCC G;  1QX8 A;  1NYH A;  3CWB D;  1BE3 G;  2FYU E;  3L72 D;  1NKN A;  3L4F A;  2GA1 A;  3M0D C;  3EWK A;  3AE1 C;  1YQ3 C;  1RF1 B;  1LTJ C;  4NPF X;  1P84 H;  3AE2 C;  3H1K E;  1YIT P;  5APX A;  3LW5 J;  2WMM A;  5APV A;  1RF0 A;  4LLH A;  2E74 C;  1AVY A;  3KXD A;  2G8Y A;  1VQL P;  2XV5 A;  1NH4 A;  1PGP A;  1Y9B A;  1J2J B;  1XTC C;  1NTK E;  2E75 C;  2O1J A;  3K5B A;  3S9O A;  1GMJ A;  3LID A;  1QL1 A;  3CCU P;  1T6A A;  3R2P A;  2W83 C;  2E42 A;  1NAF A;  3CX5 D;  1JCC A;  1PP9 D;  2RKL A;  2CPB A;  2B87 A;  2ZVO B;  4GIF A;  1RE4 A;  1JY3 P;  4N78 E;  4W7Z A;  3V2N A;  1FZE A;  3A0B E;  1JY3 N;  3G9R A;  2JO1 A;  2N1T A;  2O1K A;  2YXR B;  4MN4 C;  2FFD C;  5BU5 A;  4PD4 D;  2FYN B;  3CWB J;  1ZR2 A;  1GZL A;  1UII A;  1U7M A;  2HLO A;  3TNU B;  2D2C B;  1PZQ A;  2RN0 A;  2P7J A;  3H1J J;  4WY4 A;  4C7N B;  4I2L C;  2Q9I A;  4RES B;  5CCH C;  1ZN5 A;  3OAK A;  3AEE C;  3TGU E;  2KYV A;  1P84 I;  2HR3 A;  1H89 A;  2C0W A;  2P58 A;  1XTG B;  4PJ0 H;  3Q1M A;  1NO4 A;  2Q5U A;  2OYI A;  1H8A A;  2WSS H;  2C0X A;  2QEX P;  1NU1 E;  1L0L D;  3L70 D;  2B88 A;  1LTS C;  1NWQ A;  3I56 P;  1J1D C;  2IZ0 A;  3P8C E;  3G6E P;  5M1B A;  3CME P;  1BGY G;  3WMM 0;  2E76 B;  3E1R A;  2P10 A;  3B4S A;  4R4M A;  1N8R Q;  5CCG A;  1N7S B;  4OVN F;  2IYP A;  3HUS A;  1U57 A;  1PIX A;  1N7S D;  1VF5 C;  2LR2 A;  1SQV E;  2K9J B;  4UB8 E;  1ZP0 C;  1NGM B;  3CCR P;  3HD7 B;  3MGN A;  1S72 P;  3A5T A;  1FE6 A;  1SQB G;  2DW3 A;  2YO3 A;  2WSC J;  1JY2 O;  1KD1 Q;  1HJ0 A;  5B66 E;  2KZI A;  1URQ A;  1FJK A;  3IR9 A;  1IFP A;  3RL0 B;  5KLI C;  1J1E B;  4H44 B;  2H43 A;  1RF0 C;  2ZAE B;  4H13 B;  1QGK B;  4BWN A;  4H44 D;  1VQP P;  3BRT B;  1KIL A;  4JBZ A;  4LGD E;  1SFC A;  3CI9 A;  1ZV8 A;  3L70 J;  5KLV D;  5EFW B;  3L72 G;  5TIS H;  2WVR A;  1NOH A;  3B5N C;  1FZF A;  2QG4 A;  1PGJ A;  2FKW B;  1LT9 B;  2KIK A;  2WWW A;  1SLQ A;  2J58 A;  2XND H;  2ZYD A;  2Y0C A;  4HKZ H;  3VMZ A;  2I1K A;  4HYT B;  4BRY B;  3P32 A;  1NTZ D;  3RK3 B;  4GDO A;  3H1I D;  5AW1 B; 
#chains in the Genus database with same CATH homology
 1OVR A;  2M5A B;  4EYY Q;  1MFT A;  2UWJ E;  2JWD A;  4NPD A;  1LP1 A;  4K35 A;  2LR2 A;  1LT1 A;  1BDD A;  2M5A A;  4HJG H;  1EDL A;  1Q2N A;  4BXL A;  1BDC A;  4HB1 A;  1Y47 A;  4GOF A;  1H0T B;  2M0B A;  3FXD A;  4ZNC A;  1DEE G;  4MN4 C;  4K3A A;  2QRX A;  5DJT B;  5CBN A;  4ZMD A;  4ASW A;  2OTK E;  1EDK A;  5K5G B;  2QVA A;  1U7M A;  1ZXG A;  1S3J A;  2KI7 B;  3ZDM A;  4GOD A;  3FXE A;  2KZI A;  1OVV A;  4NPF X;  1FC2 C;  2WMM A;  4KJM A;  1EC5 A;  2ZAE B;  5CBO A;  4GOE A;  1H0T A;  1JMB A;  1OVU A;  2SPZ A;  1EDI A;  4WWI A;  2LXC B;  2HR3 A;  4JBZ A;  2P58 A;  2R44 A;  3QWO C;  2LXB A;  4IOI H;  2K3R A;  2KUB A;  4CPG A;  1LP1 B;  3S1K A;  2B89 A;  5EFW B;  2Q1K A;  1ZW0 A;  2B88 A;  1NVO A;  3RGU A;  4NPE A;  5C39 A;  2KS1 B;  4ASV A;  1JM0 A;  2B87 B;  2KZJ A;  1EDJ A;  3MHV A;  2KIK A;  1SS1 A;  3PH0 A;  1X0T A;  4HKZ H;  2RKL A;  5DJU B;  2B87 A;  3MZW B;  1U7J A;  2I8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...