1FC2C

Crystallographic refinement and atomic models of a human fc fragment and its complex with fragment b of protein a from staphylococcus aureus at 2.9-and 2.8-angstroms resolution
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
43
structure length
43
Chain Sequence
FNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic refinement and atomic models of a human Fc fragment and its complex with fragment B of protein A from Staphylococcus aureus at 2.9- and 2.8-A resolution.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Immunoglobulin
molecule keywords FRAGMENT B OF PROTEIN A COMPLEX
total genus 9
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 1981-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1fc2C00
2KIKA 1H0TB 1X0TA 1EC5A 4GOFA 5CBNA 5DJUB 4CPGA 1JMBA 2KZJA 3FXEA 2HR3A 3RGUA 3ZDMA 2B88A 4ZMDA 3S1KA 1BDDA 2KZIA 3FXDA 2M0BA 4ZNCA 3MHVA 2KS1B 2R44A 1H0TA 2M5AB 2P58A 4NPDA 5DJTB 1U7MA 1OVVA 3QWOC 4EYYQ 2SPZA 2B87A 1JM0A 3MZWB 4MN4C 2K3RA 2M5AA 2LR2A 4JBZA 1LP1B 4NPFX 5CBOA 4K3AA 4GOEA 4IOIH 4K35A 2Q1KA 1OVUA 2QVAA 1ZW0A 1NVOA 1S3JA 1Q2NA 3PH0A 4KJMA 1BDCA 2KI7B 4GODA 4HB1A 1SS1A 1ZXGA 1U7JA 1MFTA 4ASWA 5K5GB 1FC2C 5C39A 4NPEA 1EDJA 4HKZH 2LXCB 1EDKA 2OTKE 2ZAEB 1LP1A 1EDLA 1OVRA 2QRXA 4ASVA 2LXBA 1DEEG 2WMMA 1LT1A 4HJGH 4BXLA 2B87B 2JWDA 2UWJE 2I8DA 5EFWB 2KUBA 1EDIA 1Y47A 2RKLA 2B89A 4WWIA
chains in the Genus database with same CATH superfamily
2KIKA 3HD7B 3CWBG 5CJ0A 2A06D 1EC5A 1ZRTD 1RH5B 1E5WA 4OWFA 2LKMA 4XA4A 5L8RJ 3G71P 3AE3C 1RF0C 5DJUB 2C0WA 3V4WA 2Y9ZA 3P8MC 3WUVA 3L37A 3CCMP 2W6AA 2Z4EA 1SQXE 3AE5C 1N73A 2YIUB 4I7ZC 2ZXXA 5AW6B 4U3FD 4DT0A 4EI2A 4RJTA 3CX5D 1PIXA 1M56D 1HTLC 1KILB 1SQXJ 3AE6C 3CCQP 2JDIH 1W2BO 1UIXA 3S1KA 1M7LA 3WMM0 1FE6A 4AYCA 3CCUP 3IN6A 3M9HA 2HPCA 1AA0A 3V2NA 5KAIH 1JTHB 1WMKA 4Y99C 1YITP 3H1HE 1YBKA 2WZ7A 3Q5PA 3FXDA 3GW6A 4IL6X 2JO1A 1VQ7P 3O8ZA 1N7SD 4BWNA 4L74A 3WUTA 5APVA 1NKNA 2P67A 1L0LK 3CCVP 2BEQD 1URQB 3Q5RA 1PGOA 3Q2YA 2V7QH 4OGQB 1VF5B 1K05A 2KXPB 1DD4A 4U3FG 2P58A 4GT1A 3VP9A 3Q5SA 4PD4H 3CMEP 1DX7A 3B5NB 1MUUA 3I5CA 4PJ0E 5KTBA 1NOHA 3RL0g 1BSHA 1SQBJ 3G6EP 1S9KD 3MUDC 3N7NA 3NXSA 5AVTB 2ZT9C 3G9RA 2E74B 2YXQB 3H1LD 4EYYQ 3HTKA 1QVFO 5APUA 3WUUA 1JM0A 1RY3A 3MZWB 3NMDA 5CMZA 3CWBJ 3H1HD 3L70D 4MN4C 2Y0DA 1NTKE 3RK2C 3VTPC 1NU1J 3SWFA 1N8RQ 2NZ2A 3C9IA 1ZN5A 1LTSC 1L2PA 2E75D 1VQ8P 4RESB 4H44C 2BASA 1GL2B 1FJKA 1M57D 1QL2A 1HBWA 2FYUG 3RK2B 4OGQC 2MKVA 1LP1B 3H1LG 4NPFX 1SQBG 5B66H 4U3FE 1OX3A 1YTZT 2ZYAA 3H32A 4RKUJ 3CI9A 4BRYB 2QA4P 1AJYA 4K3AA 2K9JB 3RK3B 1GZLA 2Z5IA 3U1CA 3CX5E 1AVYA 1JY2P 2PAJA 3V5BA 3PJSK 1BE3G 2HPCB 4UB8E 2NPSC 2OYIB 2Q1KA 1HJBA 2RMZA 2OYHC 1HGVA 2H7HA 4JYCA 1OWAA 1ZW0A 2IX7C 2QE7H 1KC8Q 1Q2NA 1L4AC 3BCCG 1LTBC 1NAFA 2D2CD 4H13C 4KJMA 1JUNA 1NU1E 3LIEA 2KI7B 1M1KQ 1L0NK 1NTMK 1ZRTE 1NTKJ 2XDJA 1A02J 1FS0E 1RHZB 4ASWA 1USDA 5K5GB 4W7YA 2FXPA 4PD4I 1LJ2A 4NPEA 1HGZA 2YKPA 1CZQA 3W68A 4EOTA 4HKZH 2OARA 1Q90D 4H0LB 1SQBE 2Q6QA 2V7QJ 2ZT9B 4EIJA 2WWWA 2ITAA 3AEEC 2YO2A 3KZIE 3H1KG 4WVZA 3L71D 4D6TG 1H88A 2N1TB 5AVXB 4H0LD 2XU6A 1QEXA 2YNYA 1EZVI 3L73G 1LTTC 1GW3A 1M1JA 1VF5C 1JY3N 5AW4B 3WU2E 3HE4B 1LTJB 1H89A 2WPSA 3CC2P 4I2LC 1GTWA 1DEEG 2WMMA 2IBZI 2IDBA 1CI6A 1SQXK 3L75G 5KLVG 1ZR2A 3CWBD 3CXHE 4BXLA 3H1HJ 4TT3H 3P8CD 1X79B 5AW0B 1RF1C 2WVRA 1SQPK 3HE4A 5GTIH 2ZJSE 3RK3C 1Q81Q 1KD1Q 1EDIA 2JKVA 1L0LD 2K88A 2O1JA 2RKLA 3VMZA 2B89A 3WU2H 3M06A 5BU8B 2OYHB 1U57A 1BCCG 3P7KA 5APSA 3RK3D 3CCEP 1X0TA 4W7ZA 3H1KE 4QMAA 1JEKA 3CLQA 2ZYDA 1ZLLA 1IFJA 1S5LX 2QG4A 3H1IE 1JB0J 3JCUH 1GL2D 1ZP0C 1SQQD 1KILD 2KS1A 1J2JB 2E75B 2KSJA 1YJ9P 3L75J 5KLVJ 3CX5H 3TGUE 1JMBA 1PP9D 1KB9H 1LWUC 2Y9YA 1NWQA 1CI6B 2FBWC 4YTPC 1K73Q 1LT9A 3RGUA 3ZDMA 1NTKK 2B88A 2N9BA 2Q5UA 2O01N 1S5LE 3VOPA 3I55P 1YJNP 2WSCJ 3NFQA 4JYBA 5CCHD 3OW2O 1PPJE 1JNMA 1L4AB 4WBAA 5AW1B 3H1JE 1LT9B 2N1TA 1G2CA 1SFCC 2BCCJ 1MFZA 1NTZE 1BCCE 1PGQA 2E76D 2WQYC 1NAYA 4GKGA 4HYTB 3S9OA 3SSUA 1H8AA 1FOSE 1FOSF 3H32B 4IL6E 2KS1B 3VN0A 2QEXP 1EXIA 2W8ZA 2HG5D 2OGUA 1SFCD 1GW4A 1HVVA 1IZNB 4IFDK 3P8CE 2K37A 4UB6E 3S4RA 5H2FH 2R44A 3CMAP 2WSSH 1YYCA 5CHXA 2D2CB 5AW9B 1KYOI 1HWTC 3VMYA 4NPDA 4Z1MH 3AE9C 2FY8A 2V4HA 3VMAA 3D71A 1QL1A 4PD4E 2PP6A 3BCCJ 1H0TA 1W2EA 3QWOC 3LIDA 1IFPA 1P84I 1FZEA 3F5HA 4H44D 2CPSA 3GHGB 5KKZC 1EZVE 3C1LA 3L71E 1Q86Q 1JO5A 3AEFC 1PPJG 1KQLA 4YXDC 3PP5A 1N7SA 3H1JG 3L74E 1HH0A 2A45H 1GMJA 4H0LC 2XV5A 2Z5HA 1L0NG 1NTMG 1BGYG 1J1EB 2ZFCA 3HUSA 1N86A 1BGYD 1FZGA 1L0ND 1NTMD 2VRSA 3CXHI 3GG2A 4LGDE 3Q3DA 3L4FA 1JCCA 1M1JB 1GL2A 1SQQJ 2KP8A 1URQA 5APYA 3QH9A 1FBMA 1YI2P 1KB9I 1SQPE 4W80A 1FZAA 1IFIA 3FGAD 3KQGA 3L75D 5KLVD 1NU1D 3SFDC 1RE4A 1AQ5A 3EFFK 2XNXA 5B5EE 2FXOA 1SQVJ 4K35A 1YTZI 1GDTA 1IFNA 1LTAC 1T3JA 4IFFA 2FYUK 1RF1B 3A0BE 4WY4A 2QVAA 3L71G 3GHGA 2RH0A 5H2FE 1SQPD 1HJ0A 1RQUA 1S3JA 4H44B 4JF7A 2E42A 4AUWA 4D6TJ 1VF5D 3N4XA 2XNDH 2NPSD 1VPCA 1QVGO 1NGMB 4GODA 3TDKA 1BDCA 1XTCC 1URQD 1L0NE 1G1IA 1BGYE 1NTME 1J1EC 2P2UA 3A0BH 2BCCG 3AE4C 3M9BA 1U7JA 2AEJA 2QJPB 2JEEA 1AV1A 1YQ3C 1IK9A 3L74D 1RF1A 5C39A 1JOCA 2AEFA 2I1KA 1EDJA 2H88C 3L70E 1EZVD 5KKZB 3A5TA 1LTGC 2E5YA 3B8EB 3HD7A 4LC1A 2IPPA 2ZAEB 2E5TA 3BCCD 3V4QA 1VL2A 4PD4D 2K1AA 3IFMA 1OMIA 1JTHA 1OIPA 5KLIC 3RK2D 2I1JA 4H13D 4ASVA 1BE3D 1L4AA 1L4AD 2QM7A 1WRGA 2R32A 3AE7C 2D2CC 2R5BA 4O9BA 1S9KE 1SQQG 2C0XA 1OW8A 1NU1K 1WT6A 1TU3F 5KAIE 3TNUA 1S4XA 2CPBA 1X22A 1R8EA 1KQGB 1PZQA 1IC2A 1R5SA 2WT7B 4JPZB 2FYUJ 1N73B 2AXTH 3AE1C 2JWDA 3AE2C 3HTKB 4IFMA 1HUCA 4H13B 4I6MC 2M3EA 5APQA 1L0LG 2KUBA 3D70A 5GTHE 1S72P 1FAVA 4WWIA 1VQPP 4KT0J 1SQVD 2YMKA 1IFMA 1KFMA 3BRVB 1VQLP 3AE8C 1KILC 2N1TC 1M1JC 3V6IA 2O01J 3GF3A 5CBNA 1PP9E 3GMAA 5APWA 2YIUC 1AFOA 1A02F 5CCGC 1YHQP 1VQKP 1S2EA 4LLHA 1K04A 3HUSB 5E79H 2A45I 5GTIE 3MGNA 2R5DA 3FXEA 4D6TD 2YKOA 3RK3E 2Y0EA 1T2KC 2E76C 5KLIB 2A06E 1MV8A 2OYOA 3A0HE 1L0LE 2L91A 2XZRA 5E79E 3L72D 5KJ7C 3KPEA 2QM8A 3SWYA 2E74C 3L36A 3R4YA 1NTKG 2KZIA 1JCDA 2M0BA 3W67A 2JJLA 1KYOD 5AVQB 5AVRB 1FJPA 3FWNA 4N3YB 2NRGA 3ITKA 3SWKA 1KMIZ 3RBZA 3E7KA 3U1AA 1NKZB 2XKMA 2FYUE 3OJAB 4N78E 1BE3J 2WSEJ 1URQC 2KLVA 3FX0A 5AW8B 1LT9C 3GF7A 5DJTB 3AEGC 2JWAA 4C46A 4ZKUA 2WITA 3MP7B 3O6QA 1G2CB 1OVVA 2K9YA 2ZXEB 1MZ9A 3H6PA 3H1LJ 3V2PA 2H43A 1VQOP 1USEA 2O3JA 2FYNB 4GDOA 1SQBD 4Y99B 1NHLA 2IYOA 2SPZA 1LGHB 1IK7A 1SFCA 1ZV8A 2A06G 1LWUB 2B87A 2L5GB 2R3CA 2KYVA 4IL6H 3RBXA 3BVHA 1NO4A 1PGPA 1SQVG 1T6AA 3IF4A 4M3LA 3O6QB 3TK1A 3TYYA 1JY3O 1P84D 1LTIC 1T3UA 2K3RA 2IYPA 3HE5A 3MTUE 3R2PA 1KYOE 4EDFA 1X9VA 3H25A 1W5CE 1R5LA 2M5AA 3VMXA 2GUVA 1FZCC 1M8OB 2CK3H 3D6ZA 3L72E 1VQMP 3A0HH 3P32A 4JBZA 3CXHH 2N9YB 5APXA 3L73J 3CPWO 1L0NJ 1NTMJ 1Z56A 2E76B 2J58A 1PFIA 2IBZD 4DJGA 4GOEA 2IFMA 1S1CX 1SQVK 1SVFA 1KORA 3M91A 4R4MA 3M0DC 4D6TE 3HD7C 5CCHC 3L73E 5AVYB 2KB7P 2JP3A 1N7SC 3HRNA 4U7JA 5M1BA 2FFDA 1OVUA 2RN0A 1J1DC 3A7OA 3AEDC 3L72J 3CCSP 2A45G 2KK7A 3EWKA 3K5BA 3PH0A 3HUSC 3USSA 2AXCA 2GUSA 1SQVE 3A2AA 1FZBA 4RO0A 1KN7A 1FDOA 3B5ND 1MKMA 1GL2C 1OZHA 4C7NA 1GU5A 1ZXGA 1NTKD 3CC4P 1SQPJ 3VYIA 1FDMA 3UIAA 1K8AQ 1LNQA 1RQVA 5B5EH 1FC2C 1RE4C 3L72G 1VQ6P 2WSEH 4OH8B 3NTNA 3H1LE 2LXCB 4UB6H 2AXTE 2OTLP 3LW5J 1P84H 2OTKE 5AW7B 2OYIC 1Q82Q 3CCLP 2QIWA 3BRTB 5KJ7D 1GU4A 4L75A 3F89A 1LP1A 3C8VA 4WY4C 1NH4A 2HODA 2WSFH 1SP4A 3GHGC 3E1IA 1BE3E 3PHLA 3FWLA 3L71J 4YXWH 1ZMEC 2LXBA 2Y0CA 3B4SA 5TJHA 1VQ5P 3BASA 1GD2E 5AVUB 2C9LY 1RF0A 2KNCB 3EQ2A 3KZIH 5AW3B 3BCCE 4KHXA 2C9NY 2P7JA 3KDPB 5APTA 3M9QA 1NU1G 4N6JA 5CCGD 1LTJC 3CCRP 2FXMA 3G4SP 5AVSB 2B9BA 5B66E 1N73C 1KTMA 1FDIA 1BSNA 1IFDA 2WPRA 4UB8H 2KLUA 1D7MA 2OQQA 2QSIA 1L0LJ 2Q3IA 3TNUB 4I1LA 1VDFA 2I8DA 2N1TD 2YXRB 1Y47A 3I56P 2HODB 2POHA 1EQ7A 1KYOH 1J1DB 5AVVB 1K9MQ 4OVNF 2K9JA 2HLOA 1FZFA 2W90A 2ZT9D 1BCCJ 3B5NA 3HD7D 4BRYA 2H8PD 3VP8A 1JY3P 2W83C 5BVZA 1H0TB 3H1JJ 3RL0C 2P1JA 4GOFA 1HF9A 5AVWB 3CX5I 3BATA 3D6YA 1SQXD 5AW5B 2YO3A 2PFXA 1SLQA 4Y28J 3T97A 1PP9J 4HH2A 1GK4A 3L35A 3CC7P 4CPGA 2YKQA 3U59A 1DEBA 2KZJA 2AEMA 3L75E 2G8YA 3TGUJ 4B86A 5KLVE 1RE3A 2HR3A 1N7SB 2O1KA 1PL5A 4WY4D 4XE5B 1EZVG 1T8ZA 3H1IJ 3OAKA 4TLFA 4WY4B 4ZMDA 2M8RA 3MUDA 3L74G 1E79H 3H1KJ 1DD3A 1KB9D 1KILA 2W6BA 1EXJA 2HFED 2O01H 1BDDA 2KOGA 3G3ZA 1YJWP 5KLVK 2BCCD 3JSVC 4ZNCA 3MIWA 3MHVA 3T97B 2WTYA 2GM4A 1OW6A 5CCGA 5KAFH 2KSEA 3H1IG 1FZCA 3CL3D 1IO4A 1SQPG 1Q7YQ 1FU1A 2Q9IA 2W27A 2J59M 3PTZA 2QJKC 3OA7A 4PJ0H 2M5AB 3TGUG 1AVOA 3LW5H 4C7NB 1KQSO 2W6JH 3HE5B 1U7MA 2HYNA 3V2QA 1G1JA 3L70J 3MD0A 5KJ7A 1ZOYC 2E74D 1ZR4A 2G3AA 2WSCH 5KAFE 1OW7A 2FKWB 1PGJA 3TSIA 4C7RA 1XTGB 4R4LA 5CCHA 5CJ4A 2NPSA 5AVZB 1M90Q 2FFDB 2OTJP 1BCCD 2ZYGA 1OFCX 1NTZG 4A7PA 1BGYJ 3RL0D 1KZUB 1Y9BA 1SQBK 4OGQD 1KFNA 2KNCA 4PV1D 1NTZD 3KHUA 1CSBA 3M0AA 1KQFB 1S5LH 2LR2A 1QGKB 3H1JD 1PPJD 1SQQK 3TF5A 2M3BA 5CBOA 4PV1B 1YIJP 4XFJA 2QJYB 1JMMA 4IOIH 3RL0B 4DOJA 4L73A 1KILE 2R3SA 3II6A 5BU5A 1DH3A 5TISE 3JCUE 2FYNC 2J5UA 1NJIQ 3TGUD 3L73D 4PV1C 3PLNA 1SQQE 3H1KD 1JY2O 3AECC 2Q7CA 1NVOA 2IBZE 2QJYC 3B71A 4GIFA 3H1ID 1KV4A 1JY2N 4DZOA 2BEZF 1N2DC 2IZ1A 2QJKB 2WPVB 3IAOA 4HB1A 3EFGA 4U3FJ 1SS1A 3CD6P 1AQTA 1OXZA 4WB4A 1LTJA 3L74J 5TISH 1CW5A 1MFTA 2JR8A 2PGDA 4I7ZB 1FZCB 3KYQA 2ZVNB 3PRJA 1P84E 3AEBC 2Q3EA 3M0DA 4DCKA 1EDKA 2GA1A 3AEAC 1VQ4P 2WPQA 2MJZA 3CWBE 3CXHD 4L76A 1YQ4C 4AQRD 1T2KD 2OYHA 2FFDC 2PRRA 1PP9G 3B5NC 1GK6A 2P10A 1OVRA 2QRXA 3CCJP 2E43A 3E1RA 1VQNP 3V2RA 1EDLA 2IFNA 3SFEC 4ZKPA 3KXDA 5GTHH 1SQXG 1N7LA 2IBZG 1QLED 2DW3A 3ABVC 2WT7A 1X8YA 1PV3A 2YMYA 1IJDB 2E75C 2QJPC 1QX8A 4N78D 1LT1A 2FYUD 2IZ0A 3A3YB 2FYZA 4HJGH 1NTZK 5AW2B 1NTZJ 3IR9A 2BCCE 2NPSB 3JC22 1LWUA 1Y8AA 2B87B 3GLMA 2ZVOB 1SFCB 1NYHA 1VQ9P 2H89C 1RE3C 2UWJE 4JQ0D 1KB9E 5EFWB 4YPCA 2OYIA 1DIPA 2WSFJ 3L70G 1UIIA 3H1HG 3Q1MA
chains in the Genus database with same CATH topology
2KIKA 1H0TB 1X0TA 1EC5A 4GOFA 5CBNA 5DJUB 4CPGA 1JMBA 2KZJA 3FXEA 2HR3A 3RGUA 3ZDMA 2B88A 4ZMDA 3S1KA 1BDDA 2KZIA 3FXDA 2M0BA 4ZNCA 3MHVA 2KS1B 2R44A 1H0TA 2M5AB 2P58A 4NPDA 5DJTB 1U7MA 1OVVA 3QWOC 4EYYQ 2SPZA 2B87A 1JM0A 3MZWB 4MN4C 2K3RA 2M5AA 2LR2A 4JBZA 1LP1B 4NPFX 5CBOA 4K3AA 4GOEA 4IOIH 4K35A 2Q1KA 1OVUA 2QVAA 1ZW0A 1NVOA 1S3JA 1Q2NA 3PH0A 4KJMA 1BDCA 2KI7B 4GODA 4HB1A 1SS1A 1ZXGA 1U7JA 1MFTA 4ASWA 5K5GB 1FC2C 5C39A 4NPEA 1EDJA 4HKZH 2LXCB 1EDKA 2OTKE 2ZAEB 1LP1A 1EDLA 1OVRA 2QRXA 4ASVA 2LXBA 1DEEG 2WMMA 1LT1A 4HJGH 4BXLA 2B87B 2JWDA 2UWJE 2I8DA 5EFWB 2KUBA 1EDIA 1Y47A 2RKLA 2B89A 4WWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIK A;  1H0T B;  1X0T A;  1EC5 A;  4GOF A;  5CBN A;  5DJU B;  4CPG A;  1JMB A;  2KZJ A;  3FXE A;  2HR3 A;  3RGU A;  3ZDM A;  2B88 A;  4ZMD A;  3S1K A;  1BDD A;  2KZI A;  3FXD A;  2M0B A;  4ZNC A;  3MHV A;  2KS1 B;  2R44 A;  1H0T A;  2M5A B;  2P58 A;  4NPD A;  5DJT B;  1U7M A;  1OVV A;  3QWO C;  4EYY Q;  2SPZ A;  2B87 A;  1JM0 A;  3MZW B;  4MN4 C;  2K3R A;  2M5A A;  2LR2 A;  4JBZ A;  1LP1 B;  4NPF X;  5CBO A;  4K3A A;  4GOE A;  4IOI H;  4K35 A;  2Q1K A;  1OVU A;  2QVA A;  1ZW0 A;  1NVO A;  1S3J A;  1Q2N A;  3PH0 A;  4KJM A;  1BDC A;  2KI7 B;  4GOD A;  4HB1 A;  1SS1 A;  1ZXG A;  1U7J A;  1MFT A;  4ASW A;  5K5G B;  1FC2 C;  5C39 A;  4NPE A;  1EDJ A;  4HKZ H;  2LXC B;  1EDK A;  2OTK E;  2ZAE B;  1LP1 A;  1EDL A;  1OVR A;  2QRX A;  4ASV A;  2LXB A;  1DEE G;  2WMM A;  1LT1 A;  4HJG H;  4BXL A;  2B87 B;  2JWD A;  2UWJ E;  2I8D A;  5EFW B;  2KUB A;  1EDI A;  1Y47 A;  2RKL A;  2B89 A;  4WWI A; 
#chains in the Genus database with same CATH topology
 2KIK A;  3HD7 B;  3CWB G;  5CJ0 A;  2A06 D;  1EC5 A;  1ZRT D;  1RH5 B;  1E5W A;  4OWF A;  2LKM A;  4XA4 A;  5L8R J;  3G71 P;  3AE3 C;  1RF0 C;  5DJU B;  2C0W A;  3V4W A;  2Y9Z A;  3P8M C;  3WUV A;  3L37 A;  3CCM P;  2W6A A;  2Z4E A;  1SQX E;  3AE5 C;  1N73 A;  2YIU B;  4I7Z C;  2ZXX A;  5AW6 B;  4U3F D;  4DT0 A;  4EI2 A;  4RJT A;  3CX5 D;  1PIX A;  1M56 D;  1HTL C;  1KIL B;  1SQX J;  3AE6 C;  3CCQ P;  2JDI H;  1W2B O;  1UIX A;  3S1K A;  1M7L A;  3WMM 0;  1FE6 A;  4AYC A;  3CCU P;  3IN6 A;  3M9H A;  2HPC A;  1AA0 A;  3V2N A;  5KAI H;  1JTH B;  1WMK A;  4Y99 C;  1YIT P;  3H1H E;  1YBK A;  2WZ7 A;  3Q5P A;  3FXD A;  3GW6 A;  4IL6 X;  2JO1 A;  1VQ7 P;  3O8Z A;  1N7S D;  4BWN A;  4L74 A;  3WUT A;  5APV A;  1NKN A;  2P67 A;  1L0L K;  3CCV P;  2BEQ D;  1URQ B;  3Q5R A;  1PGO A;  3Q2Y A;  2V7Q H;  4OGQ B;  1VF5 B;  1K05 A;  2KXP B;  1DD4 A;  4U3F G;  2P58 A;  4GT1 A;  3VP9 A;  3Q5S A;  4PD4 H;  3CME P;  1DX7 A;  3B5N B;  1MUU A;  3I5C A;  4PJ0 E;  5KTB A;  1NOH A;  3RL0 g;  1BSH A;  1SQB J;  3G6E P;  1S9K D;  3MUD C;  3N7N A;  3NXS A;  5AVT B;  2ZT9 C;  3G9R A;  2E74 B;  2YXQ B;  3H1L D;  4EYY Q;  3HTK A;  1QVF O;  5APU A;  3WUU A;  1JM0 A;  1RY3 A;  3MZW B;  3NMD A;  5CMZ A;  3CWB J;  3H1H D;  3L70 D;  4MN4 C;  2Y0D A;  1NTK E;  3RK2 C;  3VTP C;  1NU1 J;  3SWF A;  1N8R Q;  2NZ2 A;  3C9I A;  1ZN5 A;  1LTS C;  1L2P A;  2E75 D;  1VQ8 P;  4RES B;  4H44 C;  2BAS A;  1GL2 B;  1FJK A;  1M57 D;  1QL2 A;  1HBW A;  2FYU G;  3RK2 B;  4OGQ C;  2MKV A;  1LP1 B;  3H1L G;  4NPF X;  1SQB G;  5B66 H;  4U3F E;  1OX3 A;  1YTZ T;  2ZYA A;  3H32 A;  4RKU J;  3CI9 A;  4BRY B;  2QA4 P;  1AJY A;  4K3A A;  2K9J B;  3RK3 B;  1GZL A;  2Z5I A;  3U1C A;  3CX5 E;  1AVY A;  1JY2 P;  2PAJ A;  3V5B A;  3PJS K;  1BE3 G;  2HPC B;  4UB8 E;  2NPS C;  2OYI B;  2Q1K A;  1HJB A;  2RMZ A;  2OYH C;  1HGV A;  2H7H A;  4JYC A;  1OWA A;  1ZW0 A;  2IX7 C;  2QE7 H;  1KC8 Q;  1Q2N A;  1L4A C;  3BCC G;  1LTB C;  1NAF A;  2D2C D;  4H13 C;  4KJM A;  1JUN A;  1NU1 E;  3LIE A;  2KI7 B;  1M1K Q;  1L0N K;  1NTM K;  1ZRT E;  1NTK J;  2XDJ A;  1A02 J;  1FS0 E;  1RHZ B;  4ASW A;  1USD A;  5K5G B;  4W7Y A;  2FXP A;  4PD4 I;  1LJ2 A;  4NPE A;  1HGZ A;  2YKP A;  1CZQ A;  3W68 A;  4EOT A;  4HKZ H;  2OAR A;  1Q90 D;  4H0L B;  1SQB E;  2Q6Q A;  2V7Q J;  2ZT9 B;  4EIJ A;  2WWW A;  2ITA A;  3AEE C;  2YO2 A;  3KZI E;  3H1K G;  4WVZ A;  3L71 D;  4D6T G;  1H88 A;  2N1T B;  5AVX B;  4H0L D;  2XU6 A;  1QEX A;  2YNY A;  1EZV I;  3L73 G;  1LTT C;  1GW3 A;  1M1J A;  1VF5 C;  1JY3 N;  5AW4 B;  3WU2 E;  3HE4 B;  1LTJ B;  1H89 A;  2WPS A;  3CC2 P;  4I2L C;  1GTW A;  1DEE G;  2WMM A;  2IBZ I;  2IDB A;  1CI6 A;  1SQX K;  3L75 G;  5KLV G;  1ZR2 A;  3CWB D;  3CXH E;  4BXL A;  3H1H J;  4TT3 H;  3P8C D;  1X79 B;  5AW0 B;  1RF1 C;  2WVR A;  1SQP K;  3HE4 A;  5GTI H;  2ZJS E;  3RK3 C;  1Q81 Q;  1KD1 Q;  1EDI A;  2JKV A;  1L0L D;  2K88 A;  2O1J A;  2RKL A;  3VMZ A;  2B89 A;  3WU2 H;  3M06 A;  5BU8 B;  2OYH B;  1U57 A;  1BCC G;  3P7K A;  5APS A;  3RK3 D;  3CCE P;  1X0T A;  4W7Z A;  3H1K E;  4QMA A;  1JEK A;  3CLQ A;  2ZYD A;  1ZLL A;  1IFJ A;  1S5L X;  2QG4 A;  3H1I E;  1JB0 J;  3JCU H;  1GL2 D;  1ZP0 C;  1SQQ D;  1KIL D;  2KS1 A;  1J2J B;  2E75 B;  2KSJ A;  1YJ9 P;  3L75 J;  5KLV J;  3CX5 H;  3TGU E;  1JMB A;  1PP9 D;  1KB9 H;  1LWU C;  2Y9Y A;  1NWQ A;  1CI6 B;  2FBW C;  4YTP C;  1K73 Q;  1LT9 A;  3RGU A;  3ZDM A;  1NTK K;  2B88 A;  2N9B A;  2Q5U A;  2O01 N;  1S5L E;  3VOP A;  3I55 P;  1YJN P;  2WSC J;  3NFQ A;  4JYB A;  5CCH D;  3OW2 O;  1PPJ E;  1JNM A;  1L4A B;  4WBA A;  5AW1 B;  3H1J E;  1LT9 B;  2N1T A;  1G2C A;  1SFC C;  2BCC J;  1MFZ A;  1NTZ E;  1BCC E;  1PGQ A;  2E76 D;  2WQY C;  1NAY A;  4GKG A;  4HYT B;  3S9O A;  3SSU A;  1H8A A;  1FOS E;  1FOS F;  3H32 B;  4IL6 E;  2KS1 B;  3VN0 A;  2QEX P;  1EXI A;  2W8Z A;  2HG5 D;  2OGU A;  1SFC D;  1GW4 A;  1HVV A;  1IZN B;  4IFD K;  3P8C E;  2K37 A;  4UB6 E;  3S4R A;  5H2F H;  2R44 A;  3CMA P;  2WSS H;  1YYC A;  5CHX A;  2D2C B;  5AW9 B;  1KYO I;  1HWT C;  3VMY A;  4NPD A;  4Z1M H;  3AE9 C;  2FY8 A;  2V4H A;  3VMA A;  3D71 A;  1QL1 A;  4PD4 E;  2PP6 A;  3BCC J;  1H0T A;  1W2E A;  3QWO C;  3LID A;  1IFP A;  1P84 I;  1FZE A;  3F5H A;  4H44 D;  2CPS A;  3GHG B;  5KKZ C;  1EZV E;  3C1L A;  3L71 E;  1Q86 Q;  1JO5 A;  3AEF C;  1PPJ G;  1KQL A;  4YXD C;  3PP5 A;  1N7S A;  3H1J G;  3L74 E;  1HH0 A;  2A45 H;  1GMJ A;  4H0L C;  2XV5 A;  2Z5H A;  1L0N G;  1NTM G;  1BGY G;  1J1E B;  2ZFC A;  3HUS A;  1N86 A;  1BGY D;  1FZG A;  1L0N D;  1NTM D;  2VRS A;  3CXH I;  3GG2 A;  4LGD E;  3Q3D A;  3L4F A;  1JCC A;  1M1J B;  1GL2 A;  1SQQ J;  2KP8 A;  1URQ A;  5APY A;  3QH9 A;  1FBM A;  1YI2 P;  1KB9 I;  1SQP E;  4W80 A;  1FZA A;  1IFI A;  3FGA D;  3KQG A;  3L75 D;  5KLV D;  1NU1 D;  3SFD C;  1RE4 A;  1AQ5 A;  3EFF K;  2XNX A;  5B5E E;  2FXO A;  1SQV J;  4K35 A;  1YTZ I;  1GDT A;  1IFN A;  1LTA C;  1T3J A;  4IFF A;  2FYU K;  1RF1 B;  3A0B E;  4WY4 A;  2QVA A;  3L71 G;  3GHG A;  2RH0 A;  5H2F E;  1SQP D;  1HJ0 A;  1RQU A;  1S3J A;  4H44 B;  4JF7 A;  2E42 A;  4AUW A;  4D6T J;  1VF5 D;  3N4X A;  2XND H;  2NPS D;  1VPC A;  1QVG O;  1NGM B;  4GOD A;  3TDK A;  1BDC A;  1XTC C;  1URQ D;  1L0N E;  1G1I A;  1BGY E;  1NTM E;  1J1E C;  2P2U A;  3A0B H;  2BCC G;  3AE4 C;  3M9B A;  1U7J A;  2AEJ A;  2QJP B;  2JEE A;  1AV1 A;  1YQ3 C;  1IK9 A;  3L74 D;  1RF1 A;  5C39 A;  1JOC A;  2AEF A;  2I1K A;  1EDJ A;  2H88 C;  3L70 E;  1EZV D;  5KKZ B;  3A5T A;  1LTG C;  2E5Y A;  3B8E B;  3HD7 A;  4LC1 A;  2IPP A;  2ZAE B;  2E5T A;  3BCC D;  3V4Q A;  1VL2 A;  4PD4 D;  2K1A A;  3IFM A;  1OMI A;  1JTH A;  1OIP A;  5KLI C;  3RK2 D;  2I1J A;  4H13 D;  4ASV A;  1BE3 D;  1L4A A;  1L4A D;  2QM7 A;  1WRG A;  2R32 A;  3AE7 C;  2D2C C;  2R5B A;  4O9B A;  1S9K E;  1SQQ G;  2C0X A;  1OW8 A;  1NU1 K;  1WT6 A;  1TU3 F;  5KAI E;  3TNU A;  1S4X A;  2CPB A;  1X22 A;  1R8E A;  1KQG B;  1PZQ A;  1IC2 A;  1R5S A;  2WT7 B;  4JPZ B;  2FYU J;  1N73 B;  2AXT H;  3AE1 C;  2JWD A;  3AE2 C;  3HTK B;  4IFM A;  1HUC A;  4H13 B;  4I6M C;  2M3E A;  5APQ A;  1L0L G;  2KUB A;  3D70 A;  5GTH E;  1S72 P;  1FAV A;  4WWI A;  1VQP P;  4KT0 J;  1SQV D;  2YMK A;  1IFM A;  1KFM A;  3BRV B;  1VQL P;  3AE8 C;  1KIL C;  2N1T C;  1M1J C;  3V6I A;  2O01 J;  3GF3 A;  5CBN A;  1PP9 E;  3GMA A;  5APW A;  2YIU C;  1AFO A;  1A02 F;  5CCG C;  1YHQ P;  1VQK P;  1S2E A;  4LLH A;  1K04 A;  3HUS B;  5E79 H;  2A45 I;  5GTI E;  3MGN A;  2R5D A;  3FXE A;  4D6T D;  2YKO A;  3RK3 E;  2Y0E A;  1T2K C;  2E76 C;  5KLI B;  2A06 E;  1MV8 A;  2OYO A;  3A0H E;  1L0L E;  2L91 A;  2XZR A;  5E79 E;  3L72 D;  5KJ7 C;  3KPE A;  2QM8 A;  3SWY A;  2E74 C;  3L36 A;  3R4Y A;  1NTK G;  2KZI A;  1JCD A;  2M0B A;  3W67 A;  2JJL A;  1KYO D;  5AVQ B;  5AVR B;  1FJP A;  3FWN A;  4N3Y B;  2NRG A;  3ITK A;  3SWK A;  1KMI Z;  3RBZ A;  3E7K A;  3U1A A;  1NKZ B;  2XKM A;  2FYU E;  3OJA B;  4N78 E;  1BE3 J;  2WSE J;  1URQ C;  2KLV A;  3FX0 A;  5AW8 B;  1LT9 C;  3GF7 A;  5DJT B;  3AEG C;  2JWA A;  4C46 A;  4ZKU A;  2WIT A;  3MP7 B;  3O6Q A;  1G2C B;  1OVV A;  2K9Y A;  2ZXE B;  1MZ9 A;  3H6P A;  3H1L J;  3V2P A;  2H43 A;  1VQO P;  1USE A;  2O3J A;  2FYN B;  4GDO A;  1SQB D;  4Y99 B;  1NHL A;  2IYO A;  2SPZ A;  1LGH B;  1IK7 A;  1SFC A;  1ZV8 A;  2A06 G;  1LWU B;  2B87 A;  2L5G B;  2R3C A;  2KYV A;  4IL6 H;  3RBX A;  3BVH A;  1NO4 A;  1PGP A;  1SQV G;  1T6A A;  3IF4 A;  4M3L A;  3O6Q B;  3TK1 A;  3TYY A;  1JY3 O;  1P84 D;  1LTI C;  1T3U A;  2K3R A;  2IYP A;  3HE5 A;  3MTU E;  3R2P A;  1KYO E;  4EDF A;  1X9V A;  3H25 A;  1W5C E;  1R5L A;  2M5A A;  3VMX A;  2GUV A;  1FZC C;  1M8O B;  2CK3 H;  3D6Z A;  3L72 E;  1VQM P;  3A0H H;  3P32 A;  4JBZ A;  3CXH H;  2N9Y B;  5APX A;  3L73 J;  3CPW O;  1L0N J;  1NTM J;  1Z56 A;  2E76 B;  2J58 A;  1PFI A;  2IBZ D;  4DJG A;  4GOE A;  2IFM A;  1S1C X;  1SQV K;  1SVF A;  1KOR A;  3M91 A;  4R4M A;  3M0D C;  4D6T E;  3HD7 C;  5CCH C;  3L73 E;  5AVY B;  2KB7 P;  2JP3 A;  1N7S C;  3HRN A;  4U7J A;  5M1B A;  2FFD A;  1OVU A;  2RN0 A;  1J1D C;  3A7O A;  3AED C;  3L72 J;  3CCS P;  2A45 G;  2KK7 A;  3EWK A;  3K5B A;  3PH0 A;  3HUS C;  3USS A;  2AXC A;  2GUS A;  1SQV E;  3A2A A;  1FZB A;  4RO0 A;  1KN7 A;  1FDO A;  3B5N D;  1MKM A;  1GL2 C;  1OZH A;  4C7N A;  1GU5 A;  1ZXG A;  1NTK D;  3CC4 P;  1SQP J;  3VYI A;  1FDM A;  3UIA A;  1K8A Q;  1LNQ A;  1RQV A;  5B5E H;  1FC2 C;  1RE4 C;  3L72 G;  1VQ6 P;  2WSE H;  4OH8 B;  3NTN A;  3H1L E;  2LXC B;  4UB6 H;  2AXT E;  2OTL P;  3LW5 J;  1P84 H;  2OTK E;  5AW7 B;  2OYI C;  1Q82 Q;  3CCL P;  2QIW A;  3BRT B;  5KJ7 D;  1GU4 A;  4L75 A;  3F89 A;  1LP1 A;  3C8V A;  4WY4 C;  1NH4 A;  2HOD A;  2WSF H;  1SP4 A;  3GHG C;  3E1I A;  1BE3 E;  3PHL A;  3FWL A;  3L71 J;  4YXW H;  1ZME C;  2LXB A;  2Y0C A;  3B4S A;  5TJH A;  1VQ5 P;  3BAS A;  1GD2 E;  5AVU B;  2C9L Y;  1RF0 A;  2KNC B;  3EQ2 A;  3KZI H;  5AW3 B;  3BCC E;  4KHX A;  2C9N Y;  2P7J A;  3KDP B;  5APT A;  3M9Q A;  1NU1 G;  4N6J A;  5CCG D;  1LTJ C;  3CCR P;  2FXM A;  3G4S P;  5AVS B;  2B9B A;  5B66 E;  1N73 C;  1KTM A;  1FDI A;  1BSN A;  1IFD A;  2WPR A;  4UB8 H;  2KLU A;  1D7M A;  2OQQ A;  2QSI A;  1L0L J;  2Q3I A;  3TNU B;  4I1L A;  1VDF A;  2I8D A;  2N1T D;  2YXR B;  1Y47 A;  3I56 P;  2HOD B;  2POH A;  1EQ7 A;  1KYO H;  1J1D B;  5AVV B;  1K9M Q;  4OVN F;  2K9J A;  2HLO A;  1FZF A;  2W90 A;  2ZT9 D;  1BCC J;  3B5N A;  3HD7 D;  4BRY A;  2H8P D;  3VP8 A;  1JY3 P;  2W83 C;  5BVZ A;  1H0T B;  3H1J J;  3RL0 C;  2P1J A;  4GOF A;  1HF9 A;  5AVW B;  3CX5 I;  3BAT A;  3D6Y A;  1SQX D;  5AW5 B;  2YO3 A;  2PFX A;  1SLQ A;  4Y28 J;  3T97 A;  1PP9 J;  4HH2 A;  1GK4 A;  3L35 A;  3CC7 P;  4CPG A;  2YKQ A;  3U59 A;  1DEB A;  2KZJ A;  2AEM A;  3L75 E;  2G8Y A;  3TGU J;  4B86 A;  5KLV E;  1RE3 A;  2HR3 A;  1N7S B;  2O1K A;  1PL5 A;  4WY4 D;  4XE5 B;  1EZV G;  1T8Z A;  3H1I J;  3OAK A;  4TLF A;  4WY4 B;  4ZMD A;  2M8R A;  3MUD A;  3L74 G;  1E79 H;  3H1K J;  1DD3 A;  1KB9 D;  1KIL A;  2W6B A;  1EXJ A;  2HFE D;  2O01 H;  1BDD A;  2KOG A;  3G3Z A;  1YJW P;  5KLV K;  2BCC D;  3JSV C;  4ZNC A;  3MIW A;  3MHV A;  3T97 B;  2WTY A;  2GM4 A;  1OW6 A;  5CCG A;  5KAF H;  2KSE A;  3H1I G;  1FZC A;  3CL3 D;  1IO4 A;  1SQP G;  1Q7Y Q;  1FU1 A;  2Q9I A;  2W27 A;  2J59 M;  3PTZ A;  2QJK C;  3OA7 A;  4PJ0 H;  2M5A B;  3TGU G;  1AVO A;  3LW5 H;  4C7N B;  1KQS O;  2W6J H;  3HE5 B;  1U7M A;  2HYN A;  3V2Q A;  1G1J A;  3L70 J;  3MD0 A;  5KJ7 A;  1ZOY C;  2E74 D;  1ZR4 A;  2G3A A;  2WSC H;  5KAF E;  1OW7 A;  2FKW B;  1PGJ A;  3TSI A;  4C7R A;  1XTG B;  4R4L A;  5CCH A;  5CJ4 A;  2NPS A;  5AVZ B;  1M90 Q;  2FFD B;  2OTJ P;  1BCC D;  2ZYG A;  1OFC X;  1NTZ G;  4A7P A;  1BGY J;  3RL0 D;  1KZU B;  1Y9B A;  1SQB K;  4OGQ D;  1KFN A;  2KNC A;  4PV1 D;  1NTZ D;  3KHU A;  1CSB A;  3M0A A;  1KQF B;  1S5L H;  2LR2 A;  1QGK B;  3H1J D;  1PPJ D;  1SQQ K;  3TF5 A;  2M3B A;  5CBO A;  4PV1 B;  1YIJ P;  4XFJ A;  2QJY B;  1JMM A;  4IOI H;  3RL0 B;  4DOJ A;  4L73 A;  1KIL E;  2R3S A;  3II6 A;  5BU5 A;  1DH3 A;  5TIS E;  3JCU E;  2FYN C;  2J5U A;  1NJI Q;  3TGU D;  3L73 D;  4PV1 C;  3PLN A;  1SQQ E;  3H1K D;  1JY2 O;  3AEC C;  2Q7C A;  1NVO A;  2IBZ E;  2QJY C;  3B71 A;  4GIF A;  3H1I D;  1KV4 A;  1JY2 N;  4DZO A;  2BEZ F;  1N2D C;  2IZ1 A;  2QJK B;  2WPV B;  3IAO A;  4HB1 A;  3EFG A;  4U3F J;  1SS1 A;  3CD6 P;  1AQT A;  1OXZ A;  4WB4 A;  1LTJ A;  3L74 J;  5TIS H;  1CW5 A;  1MFT A;  2JR8 A;  2PGD A;  4I7Z B;  1FZC B;  3KYQ A;  2ZVN B;  3PRJ A;  1P84 E;  3AEB C;  2Q3E A;  3M0D A;  4DCK A;  1EDK A;  2GA1 A;  3AEA C;  1VQ4 P;  2WPQ A;  2MJZ A;  3CWB E;  3CXH D;  4L76 A;  1YQ4 C;  4AQR D;  1T2K D;  2OYH A;  2FFD C;  2PRR A;  1PP9 G;  3B5N C;  1GK6 A;  2P10 A;  1OVR A;  2QRX A;  3CCJ P;  2E43 A;  3E1R A;  1VQN P;  3V2R A;  1EDL A;  2IFN A;  3SFE C;  4ZKP A;  3KXD A;  5GTH H;  1SQX G;  1N7L A;  2IBZ G;  1QLE D;  2DW3 A;  3ABV C;  2WT7 A;  1X8Y A;  1PV3 A;  2YMY A;  1IJD B;  2E75 C;  2QJP C;  1QX8 A;  4N78 D;  1LT1 A;  2FYU D;  2IZ0 A;  3A3Y B;  2FYZ A;  4HJG H;  1NTZ K;  5AW2 B;  1NTZ J;  3IR9 A;  2BCC E;  2NPS B;  3JC2 2;  1LWU A;  1Y8A A;  2B87 B;  3GLM A;  2ZVO B;  1SFC B;  1NYH A;  1VQ9 P;  2H89 C;  1RE3 C;  2UWJ E;  4JQ0 D;  1KB9 E;  5EFW B;  4YPC A;  2OYI A;  1DIP A;  2WSF J;  3L70 G;  1UII A;  3H1H G;  3Q1M A; 
#chains in the Genus database with same CATH homology
 2KIK A;  1H0T B;  1X0T A;  1EC5 A;  4GOF A;  5CBN A;  5DJU B;  4CPG A;  1JMB A;  2KZJ A;  3FXE A;  2HR3 A;  3RGU A;  3ZDM A;  2B88 A;  4ZMD A;  3S1K A;  1BDD A;  2KZI A;  3FXD A;  2M0B A;  4ZNC A;  3MHV A;  2KS1 B;  2R44 A;  1H0T A;  2M5A B;  2P58 A;  4NPD A;  5DJT B;  1U7M A;  1OVV A;  3QWO C;  4EYY Q;  2SPZ A;  2B87 A;  1JM0 A;  3MZW B;  4MN4 C;  2K3R A;  2M5A A;  2LR2 A;  4JBZ A;  1LP1 B;  4NPF X;  5CBO A;  4K3A A;  4GOE A;  4IOI H;  4K35 A;  2Q1K A;  1OVU A;  2QVA A;  1ZW0 A;  1NVO A;  1S3J A;  1Q2N A;  3PH0 A;  4KJM A;  1BDC A;  2KI7 B;  4GOD A;  4HB1 A;  1SS1 A;  1ZXG A;  1U7J A;  1MFT A;  4ASW A;  5K5G B;  1FC2 C;  5C39 A;  4NPE A;  1EDJ A;  4HKZ H;  2LXC B;  1EDK A;  2OTK E;  2ZAE B;  1LP1 A;  1EDL A;  1OVR A;  2QRX A;  4ASV A;  2LXB A;  1DEE G;  2WMM A;  1LT1 A;  4HJG H;  4BXL A;  2B87 B;  2JWD A;  2UWJ E;  2I8D A;  5EFW B;  2KUB A;  1EDI A;  1Y47 A;  2RKL A;  2B89 A;  4WWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...