1U57A

Nmr structure of the (345-392)gag sequence from hiv-1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
48
structure length
48
Chain Sequence
LEEMMTACQGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRNQRKIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Gag polyprotein
publication title Helical structure determined by NMR of the HIV-1 (345-392)Gag sequence, surrounding p2: Implications for particle assembly and RNA packaging
pubmed doi rcsb
total genus 14
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2004-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.760 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1u57A00
1U57A
chains in the Genus database with same CATH superfamily
3IR9A 3L73D 2O3JA 2HODB 1PGQA 3G3ZA 1BE3D 1P84E 1IFIA 4OVNF 1PIXA 2JO1A 3AEFC 1K05A 4KHXA 3AEEC 1USEA 3G6EP 1LTJC 1ZW0A 1YITP 3H1IJ 4UB8E 2Y9YA 3LW5J 5APVA 2OYIC 4Y28J 1GU5A 2YKPA 3TK1A 1N2DC 3R4YA 2ZYGA 3V6IA 1LGHB 1RH5B 1IFJA 1M1JB 2KSJA 3H1LE 2W90A 3KZIE 3SWFA 2WSSH 3VOPA 4IL6H 1MZ9A 2AXTE 2WPQA 4H0LC 5TJHA 3L74G 2BCCJ 2MJZA 2WWWA 5TISH 5AW9B 1URQB 1KYOI 1LWUB 1JMBA 1HTLC 3CC2P 4GIFA 1BE3G 1X0TA 1BSHA 1P84I 4AUWA 4AQRD 4ZKUA 3H1HE 2E75C 2HR3A 1SQXD 4WB4A 2R32A 3CWBD 3H1JE 1GL2A 1SFCD 3CD6P 1PP9D 3KXDA 2AEJA 1ZR4A 2KNCB 1JY2P 3H6PA 1J1DB 1XTGB 5KAIE 3MUDA 1R8EA 3E7KA 1E5WA 1N7SC 3A0HE 3H1HJ 1EDIA 1K8AQ 1N7LA 2YO3A 3B8EB 1IFMA 1NH4A 4H44C 2G8YA 2XDJA 3BRVB 1N73B 1QL2A 2Q6QA 1JY2O 5AW5B 1NKNA 2O1KA 5B66H 2LR2A 1VQ9P 1S72P 1WRGA 4WY4C 3S4RA 1OX3A 2KB7P 4ZKPA 1NYHA 1KYOD 4PJ0E 2YNYA 1W2EA 1KYOH 5M1BA 3CCLP 2IBZE 1IFNA 2N1TD 2WSEH 3I5CA 2BEZF 1P84D 1SQXG 5KJ7C 2C9LY 1A02J 3MGNA 2XNDH 3EWKA 5H2FH 1BDCA 4H13B 1PP9G 3CCVP 2RMZA 4UB8H 1PV3A 1QEXA 2KI7B 3WUUA 1DEBA 2IPPA 1YJ9P 3H1LD 1EC5A 2KP8A 4WBAA 4L76A 1AFOA 1NTKE 2ZVOB 1U7JA 3NMDA 1U57A 2R3CA 2YKQA 2QJPB 3L75D 3C9IA 4C46A 2OTJP 3TSIA 3G71P 4EYYQ 1DEEG 3VMAA 1LP1B 5AVQB 1ZLLA 1NTKJ 2FYNC 2B88A 4QMAA 3H1JD 1Q82Q 2K3RA 2JWDA 1SFCB 4ASWA 2KS1A 1L0NK 2E5YA 1H0TA 5AW4B 4IL6X 5GTHE 1RF1C 2NPSC 1LTJA 3H1LG 3KDPB 2I1JA 2RH0A 2OYOA 4OWFA 2FFDC 2W8ZA 4U3FD 5APTA 2OARA 1R5LA 5AW6B 3BASA 1EZVI 3H1KJ 1SQBD 3SWYA 3V5BA 3WUTA 2M3EA 1LT9B 1UIXA 1MFZA 1WMKA 2IBZD 3HTKA 2HLOA 2JKVA 1MKMA 2N1TB 3H1HG 1AV1A 5AVSB 1LNQA 3L71E 1OZHA 1KILC 2JP3A 3L4FA 4L75A 3H1JG 3HE5B 5KLIB 2JDIH 3L36A 1J2JB 2AXCA 5AW1B 1Y9BA 1K73Q 4I6MC 1BCCD 3M0DA 3RL0D 3PJSK 4LGDE 3BCCD 3L71J 4GOEA 3AE4C 2QJKC 1KB9I 2I8DA 1NTKD 2B87B 4PD4I 2L5GB 3KHUA 1EZVD 2E43A 2HYNA 3N4XA 1KD1Q 2R44A 2D2CC 3CX5E 2CPSA 1Q81Q 2IBZG 4BRYB 3CPWO 2OYHB 2Q7CA 1S1CX 1EXJA 1OIPA 1H89A 2QSIA 5B5EH 3L70E 2M8RA 1M56D 1TU3F 2QEXP 1CSBA 2QJYB 4PV1C 3HD7A 2RKLA 3L35A 1KQLA 3H32B 3CL3D 1NU1J 3P8CE 5AW8B 2H43A 1KFNA 4NPFX 1G2CB 1GMJA 1T2KC 1EDKA 1FZCC 1NTKG 1JY2N 2WMMA 1KB9D 1SQQK 3K5BA 3AE8C 1KB9H 4PD4D 4EI2A 4PD4H 4H0LD 3CX5I 4KJMA 2WT7B 1CZQA 3PLNA 1L0LE 1GL2C 2Q3IA 2E74C 2V7QJ 4NPEA 3RK2C 3L71D 3L72J 2E75D 1XTCC 2ZVNB 3MUDC 3AE9C 3M0AA 1N73A 2Q5UA 3JCUE 1L0LJ 1NJIQ 4TLFA 1L0NE 4XE5B 4C7RA 1FJPA 1N7SD 1SVFA 1IJDB 1HJBA 2JWAA 1FDIA 3QWOC 3AEBC 4H44D 1RE3A 2ZAEB 3MIWA 2K37A 2WSCJ 2Z5HA 5KKZB 1RF1A 2NPSA 5L8RJ 2O01J 3B5NB 3RK3C 4RO0A 1BGYE 4WY4D 3CX5D 2YO2A 3CX5H 3IF4A 1K9MQ 2NRGA 4RKUJ 1Q7YQ 3L71G 5CJ0A 3L70D 3O6QB 2QVAA 5KJ7D 2XNXA 1AQ5A 1KILE 3TYYA 1BGYJ 2IYOA 5AVVB 1OW8A 2FYUK 2OYIB 1SQVE 1KILA 1GDTA 3V2PA 3P8CD 1Q90D 4YXDC 1NTZK 1LTAC 1USDA 1VL2A 1IO4A 2FXPA 4MN4C 2H89C 1M1KQ 2K9JB 4W80A 1SQVJ 4H0LB 3V2RA 1FDMA 1AVOA 4L74A 1WT6A 1JCCA 3H1IE 3V4QA 2ZXEB 3L70G 1DD3A 3MP7B 1Q86Q 2P10A 2YXRB 4O9BA 2WPVB 1L4AA 4HB1A 3SFDC 2E75B 3M9QA 2B89A 3BVHA 4N78E 3EQ2A 3TNUB 2IX7C 4OGQB 2YMYA 1S5LE 1L0ND 1GW4A 1JY3P 3U1AA 1YIJP 1KFMA 2BCCE 1FAVA 5DJUB 1EDLA 2NPSD 5AVUB 1N7SB 5E79E 1T3UA 1T8ZA 2IZ0A 4R4MA 2FXMA 1KORA 1PGOA 1PZQA 1JNMA 2POHA 3IFMA 4N3YB 1X9VA 2P67A 1LTBC 3Q3DA 1JB0J 4IFFA 1SQQE 4YXWH 2W6JH 4KT0J 5APYA 1SQPE 1AA0A 1JY3O 1VQPP 1L0LG 4WY4B 1OFCX 2R5DA 5CMZA 2N9YB 1FZCA 2Y0DA 3PHLA 3P32A 1VQ5P 1HJ0A 2OTKE 1NKZB 1N86A 3C1LA 1KILD 1SQQJ 1KQFB 3M0DC 2WVRA 1RF0A 2W6BA 1SQPJ 3P8MC 2P7JA 5CCGA 3T97B 1ZRTD 2ZT9B 3CCMP 1L0NG 3RBXA 3WU2H 3D6ZA 2A45G 3HUSB 5CHXA 5AVRB 5CCHC 3M06A 4UB6E 4A7PA 2KIKA 1NO4A 1BGYG 3RK3E 2C0XA 3CC7P 2D2CD 3H1ID 2N9BA 1M1JC 1DX7A 1HWTC 3LW5H 2L91A 5C39A 1NU1K 3HD7C 3D6YA 2FYNB 1P84H 4N78D 2R5BA 1NVOA 1SQVG 1URQC 4PV1D 3RGUA 2M5AA 3E1RA 3KQGA 2CPBA 2FYUE 2QG4A 1S9KE 5APUA 2BCCD 3S1KA 3EFGA 3GHGA 2WT7A 3CXHE 3CCRP 1IK7A 1FZFA 1NTZE 2QRXA 3II6A 1YQ3C 1T2KD 4DZOA 4DJGA 1VQ4P 1EQ7A 2FFDB 1U7MA 1SQQD 3HE4A 1VQLP 3S9OA 3KZIH 2FYUJ 2AXTH 3H1IG 3CC4P 1MFTA 1L0LK 1QLED 1H88A 1J1EC 2IBZI 3ZDMA 1NTZJ 1GL2D 2E74D 3Q5PA 5AVXB 1N73C 2E76C 1CI6B 3RK2D 3H1HD 3AEDC 2PRRA 1K04A 4NPDA 1ZMEC 3HRNA 4B86A 1LTIC 1YJWP 2ZXXA 3MTUE 2BCCG 1JTHA 1RE3C 3H1KE 2YXQB 3BATA 2IDBA 5KAIH 4JYBA 1RQVA 1E79H 3A7OA 2ZFCA 3A0HH 1JMMA 5CBNA 2QJKB 4H13C 2WSFJ 5KAFE 1SQQG 2B9BA 3PRJA 5GTIE 1GD2E 1SQPG 3RK3D 2D2CB 2XU6A 2SPZA 4PJ0H 3CCQP 3Q2YA 2QE7H 1VDFA 3TF5A 2WTYA 1SP4A 2H88C 2IFMA 1CW5A 1HUCA 1HH0A 1G1JA 2QJPC 2WPSA 2YIUB 1SQVK 1NOHA 2FYUD 1PFIA 2PP6A 3ABVC 3F89A 1S9KD 2UWJE 1FOSE 1GTWA 3CCUP 2J59M 1NTZD 1GU4A 2WITA 4HJGH 3WUVA 2HODA 5DJTB 1LTGC 2M0BA 4K35A 1JY3N 5CCHA 1L4AC 1VQNP 1GK6A 1KMIZ 1W5CE 2KOGA 1GL2B 2DW3A 1OXZA 3B71A 4GDOA 1NU1E 1VQOP 2W6AA 4I7ZC 5BU5A 2Q9IA 2KLVA 2A06E 3MZWB 3GF3A 1M1JA 3I55P 2FYUG 4HH2A 3LIEA 2JJLA 1ZP0C 3H1KD 1VF5C 2PGDA 4GT1A 4D6TJ 3SSUA 3A0BE 1NTZG 5GTHH 1R5SA 4DCKA 1URQA 4L73A 2J58A 1LWUA 3TGUE 1HGVA 2M3BA 3L72E 1Z56A 3A5TA 2WPRA 3RK3B 1SQPK 2HFED 2KZIA 1S2EA 1BSNA 1RF0C 4BWNA 1NWQA 2KNCA 2YKOA 3TGUJ 3V2NA 1LJ2A 4JQ0D 5CCGC 1X22A 1HBWA 1ZR2A 2KK7A 1PGPA 1QVFO 3QH9A 2O1JA 2V4HA 2J5UA 1D7MA 3LIDA 1KZUB 2ZJSE 3H1KG 3AE3C 3L73E 4W7YA 4CPGA 3G4SP 3RL0B 3OAKA 1ZN5A 1YHQP 3JC22 4IFMA 5CCHD 5KLVK 1W2BO 2GA1A 2KSEA 1N8RQ 1FDOA 2QJYC 2G3AA 2PFXA 3L74J 3KYQA 5BVZA 1FZAA 3OW2O 3L73J 2AEFA 1M7LA 3FGAD 3ITKA 4M3LA 2P1JA 3HD7D 2KS1B 1NU1D 4JYCA 1OW7A 3AEGC 2KUBA 1RQUA 4IL6E 1H0TB 5TISE 1LTJB 3GHGC 1URQD 1YTZT 4GODA 3Q1MA 1HF9A 4EIJA 3E1IA 3RL0g 2C9NY 1NTMK 2KXPB 2A45I 3TGUD 1ZV8A 1Q2NA 1X8YA 3CWBE 4BXLA 2V7QH 3L72D 3HTKB 1LP1A 1VPCA 3U59A 3P7KA 4ASVA 1X79B 3UIAA 1L2PA 3OJAB 4ZMDA 3B4SA 1L0LD 1SFCA 2P58A 3FXDA 2RN0A 2Z5IA 1NU1G 2NZ2A 2ZYAA 3CWBJ 2E76D 2WZ7A 2ZYDA 2A06G 3CI9A 5KKZC 4Y99C 5B66E 3B5NC 2H7HA 3W67A 4I1LA 3CLQA 1YJNP 1EXIA 2FBWC 1KYOE 1AQTA 3V2QA 3A3YB 2WSCH 3JCUH 1LT1A 2O01H 2WQYC 1M57D 3TGUG 1LT9A 2I1KA 1YBKA 2KYVA 5H2FE 3GW6A 2A45H 4H13D 3L72G 3H25A 1PPJE 4H44B 3BRTB 2N1TA 1JO5A 2K88A 1GW3A 3FX0A 2WSEJ 4R4LA 1BGYD 1FC2C 2Q1KA 3AECC 3HE5A 3L37A 3MD0A 1FS0E 3VMYA 1JM0A 3VTPC 3HD7B 2JEEA 1NAYA 4RJTA 4EOTA 3VP8A 1RE4A 3G9RA 1QVGO 3L75E 3L73G 3NXSA 1SQVD 2IYPA 2B87A 3NTNA 3VN0A 3H1LJ 2QA4P 3PTZA 5AW7B 1JOCA 4BRYA 2OYHA 5KLVE 3SFEC 1OMIA 4OGQC 3L75J 5AVTB 1JUNA 3MHVA 2O01N 2C0WA 1L4AD 2LXBA 1DD4A 1J1EB 4GKGA 5KLVJ 3H1JJ 2E76B 1SS1A 3D71A 2XZRA 3H32A 4U3FE 5BU8B 3C8VA 1VQ7P 1SQBE 1NGMB 1G2CA 2KZJA 2FXOA 2HPCB 1LWUC 3Q5SA 3V4WA 2OTLP 3IAOA 1S5LH 3N7NA 1VF5D 3CMAP 4WVZA 2XKMA 2BEQD 4U3FJ 1RF1B 2NPSB 1FBMA 5E79H 3CWBG 1NTME 1SQBJ 1PPJD 5AVZB 1FZGA 4WWIA 5APXA 3KPEA 3VMZA 2ZT9C 1KQSO 2K9YA 1J1DC 2QM8A 2Q3EA 1SQPD 1BCCE 1HGZA 3HUSC 1SLQA 3R2PA 3BCCE 1NTMJ 5CCGD 3O8ZA 3AE7C 1T3JA 4LLHA 1LTSC 2E42A 1KILB 1QX8A 1EZVE 1BCCJ 2W83C 1AJYA 5CJ4A 1S3JA 3BCCJ 3TDKA 1UIIA 3F5HA 3PH0A 4C7NB 1EDJA 5B5EE 3B5NA 4OH8B 4TT3H 3CXHI 2QIWA 5KLVD 1PPJG 1GK4A 3GF7A 1DH3A 4UB6H 4YTPC 1S4XA 5APQA 3M91A 3O6QA 3CCSP 1OW6A 3VMXA 3AEAC 1L4AB 2PAJA 3GMAA 3CCJP 4GOFA 1M90Q 2LKMA 2OYIA 2BASA 3VP9A 1QL1A 1KB9E 4I7ZB 4PD4E 3OA7A 1OVRA 2R3SA 3L75G 3JSVC 5APSA 3RBZA 4PV1B 2FKWB 1H8AA 2K9JA 1VF5B 1A02F 4JPZB 4JF7A 2H8PD 1LTTC 3EFFK 2FY8A 5KLVG 1SQXK 5AW3B 3CXHD 1MV8A 1NTMD 2ITAA 2OQQA 3CXHH 2KLUA 1Y47A 4IFDK 2FYZA 1FZCB 1SFCC 1YYCA 1YTZI 3M9HA 4LC1A 3Q5RA 5APWA 5AVWB 1M8OB 4ZNCA 1OWAA 3TNUA 5K5GB 5EFWB 4IOIH 2CK3H 1VQ8P 3AE6C 4U3FG 1S5LX 1IK9A 2E74B 3RK2B 4D6TE 3FWLA 1SQBG 1KN7A 2QM7A 3B5ND 1N7SA 3AE2C 3U1CA 1LT9C 2WSFH 1JCDA 1NAFA 4DOJA 4Z1MH 3GG2A 2VRSA 2N1TC 4U7JA 1NHLA 1NTMG 4WY4A 1FE6A 1ZXGA 1FU1A 2XV5A 2YIUC 2IFNA 1PGJA 5KLIC 1VQMP 5KAFH 2IZ1A 5GTIH 2Y0CA 1BCCG 5KJ7A 1GZLA 1HVVA 3BCCG 1IZNB 3L70J 2OGUA 1RE4C 1OVVA 3T97A 3VYIA 3GLMA 2M5AB 4XFJA 1EZVG 3HUSA 2MKVA 2LXCB 3W68A 4N6JA 3GHGB 3L74E 2GUVA 5KTBA 2OYHC 3WMM0 1RHZB 1OVUA 3AE5C 1MUUA 3HE4B 1YQ4C 5AW0B 1BE3E 2JR8A 2GM4A 3AE1C 1PL5A 4W7ZA 4OGQD 5CBOA 1IFDA 2K1AA 1IC2A 3IN6A 2HPCA 1BE3J 1KTMA 1FZBA 4AYCA 4D6TD 1KQGB 3CMEP 2E5TA 1FOSF 4Y99B 2AEMA 1JTHB 2A06D 4DT0A 3D70A 1SQBK 2Y0EA 1L0NJ 1Y8AA 3M9BA 4RESB 2YMKA 1G1IA 4I2LC 1FZEA 2FFDA 4JBZA 1YI2P 5AVYB 4HYTB 3USSA 3A0BH 3PP5A 1AVYA 1BDDA 1SQXE 2Z4EA 5AW2B 4K3AA 3SWKA 2GUSA 2ZT9D 3I56P 1ZRTE 1CI6A 1PP9E 1FJKA 3FXEA 3WU2E 1IFPA 3A2AA 3RL0C 3FWNA 1KV4A 2W27A 4EDFA 1RY3A 1SQXJ 4D6TG 4C7NA 1DIPA 4XA4A 1QGKB 1NTKK 1VQKP 1ZOYC 1PP9J 1KC8Q 2HG5D 2P2UA 1VQ6P 4YPCA 1JEKA 3L74D 3NFQA 3CCEP 4HKZH 2Y9ZA 1T6AA
chains in the Genus database with same CATH topology
2H88C 2V7QJ 2E74C 1YQ3C 1R8EA 1NGMB 1OW6A 1VL2A 2FXPA 3AE4C 3AEAC 3IN6A 1KQFB 2H89C 2QJPC 2QJKC 4Z1MH 3Q5SA 2E75D 2WSEJ 4R4LA 3S9OA 3IAOA 1VF5D 4U7JA 2FYNC 3AECC 3GMAA 3Q1MA 1HF9A 4H44C 2G8YA 3ABVC 1PIXA 2JO1A 3T97B 3AEFC 1K05A 3AE9C 4H0LB 3RL0g 1KTMA 2ZT9B 3AEEC 1KQGB 2BEQD 3D6ZA 2YIUC 2D2CC 3D70A 4I7ZB 5KLIC 3LW5J 2E74D 3Q5PA 4Y28J 1S1CX 2E76C 1DD3A 1NYHA 2ZT9C 3G9RA 2YMKA 4IL6X 1EXJA 2P10A 2K9YA 3AEDC 5M1BA 1K04A 2WPVB 4PV1B 2QSIA 3R4YA 1FDIA 3SFDC 1ZMEC 2E75B 3AEBC 4H44D 1VF5B 2J5UA 2BEZF 1TU3F 3EWKA 2WSCJ 3AE3C 3GLMA 3RK3E 5L8RJ 2O01J 4OGQB 4XFJA 4PV1C 4H13B 2D2CD 2OQQA 1KMIZ 3AE7C 2NZ2A 2IDBA 4H0LC 2E76D 1RQVA 2MKVA 2ZT9D 3SFEC 1ZRTE 5KKZC 4RKUJ 1PV3A 3B71A 1OMIA 4GDOA 1UIXA 4OGQC 1WMKA 1FDOA 2QJYC 4R4MA 2G3AA 4I7ZC 4H13C 1AJYA 2WSFJ 3Q5RA 1MKMA 3D6YA 1KORA 3AE5C 3GF3A 1GMJA 1KILE 1EXIA 2JP3A 2FBWC 3Q3DA 1JB0J 4PV1D 2E75C 1YQ4C 3AE8C 4KT0J 1DD4A 1ZP0C 1VF5C 4TT3H 1OW8A 1DIPA 3AE6C 2D2CB 3FGAD 4H0LD 3AE1C 1S5LX 2E74B 2WQYC 1PL5A 1ZOYC 2QIWA 2E76B 3GF7A 1U57A 3D71A 1HJ0A 1Y9BA 3Q2YA 4OGQD 3AE2C 4YTPC 4H13D 1OW7A 3AEGC 3C8VA 3H25A 1Q90D 4YXDC 1RQUA 1IK7A 4H44B 3O6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U57 A; 
#chains in the Genus database with same CATH topology
 3IR9 A;  3L73 D;  2O3J A;  2HOD B;  1PGQ A;  3G3Z A;  1BE3 D;  1P84 E;  1IFI A;  4OVN F;  1PIX A;  2JO1 A;  3AEF C;  1K05 A;  4KHX A;  3AEE C;  1USE A;  3G6E P;  1LTJ C;  1ZW0 A;  1YIT P;  3H1I J;  4UB8 E;  2Y9Y A;  3LW5 J;  5APV A;  2OYI C;  4Y28 J;  1GU5 A;  2YKP A;  3TK1 A;  1N2D C;  3R4Y A;  2ZYG A;  3V6I A;  1LGH B;  1RH5 B;  1IFJ A;  1M1J B;  2KSJ A;  3H1L E;  2W90 A;  3KZI E;  3SWF A;  2WSS H;  3VOP A;  4IL6 H;  1MZ9 A;  2AXT E;  2WPQ A;  4H0L C;  5TJH A;  3L74 G;  2BCC J;  2MJZ A;  2WWW A;  5TIS H;  5AW9 B;  1URQ B;  1KYO I;  1LWU B;  1JMB A;  1HTL C;  3CC2 P;  4GIF A;  1BE3 G;  1X0T A;  1BSH A;  1P84 I;  4AUW A;  4AQR D;  4ZKU A;  3H1H E;  2E75 C;  2HR3 A;  1SQX D;  4WB4 A;  2R32 A;  3CWB D;  3H1J E;  1GL2 A;  1SFC D;  3CD6 P;  1PP9 D;  3KXD A;  2AEJ A;  1ZR4 A;  2KNC B;  1JY2 P;  3H6P A;  1J1D B;  1XTG B;  5KAI E;  3MUD A;  1R8E A;  3E7K A;  1E5W A;  1N7S C;  3A0H E;  3H1H J;  1EDI A;  1K8A Q;  1N7L A;  2YO3 A;  3B8E B;  1IFM A;  1NH4 A;  4H44 C;  2G8Y A;  2XDJ A;  3BRV B;  1N73 B;  1QL2 A;  2Q6Q A;  1JY2 O;  5AW5 B;  1NKN A;  2O1K A;  5B66 H;  2LR2 A;  1VQ9 P;  1S72 P;  1WRG A;  4WY4 C;  3S4R A;  1OX3 A;  2KB7 P;  4ZKP A;  1NYH A;  1KYO D;  4PJ0 E;  2YNY A;  1W2E A;  1KYO H;  5M1B A;  3CCL P;  2IBZ E;  1IFN A;  2N1T D;  2WSE H;  3I5C A;  2BEZ F;  1P84 D;  1SQX G;  5KJ7 C;  2C9L Y;  1A02 J;  3MGN A;  2XND H;  3EWK A;  5H2F H;  1BDC A;  4H13 B;  1PP9 G;  3CCV P;  2RMZ A;  4UB8 H;  1PV3 A;  1QEX A;  2KI7 B;  3WUU A;  1DEB A;  2IPP A;  1YJ9 P;  3H1L D;  1EC5 A;  2KP8 A;  4WBA A;  4L76 A;  1AFO A;  1NTK E;  2ZVO B;  1U7J A;  3NMD A;  1U57 A;  2R3C A;  2YKQ A;  2QJP B;  3L75 D;  3C9I A;  4C46 A;  2OTJ P;  3TSI A;  3G71 P;  4EYY Q;  1DEE G;  3VMA A;  1LP1 B;  5AVQ B;  1ZLL A;  1NTK J;  2FYN C;  2B88 A;  4QMA A;  3H1J D;  1Q82 Q;  2K3R A;  2JWD A;  1SFC B;  4ASW A;  2KS1 A;  1L0N K;  2E5Y A;  1H0T A;  5AW4 B;  4IL6 X;  5GTH E;  1RF1 C;  2NPS C;  1LTJ A;  3H1L G;  3KDP B;  2I1J A;  2RH0 A;  2OYO A;  4OWF A;  2FFD C;  2W8Z A;  4U3F D;  5APT A;  2OAR A;  1R5L A;  5AW6 B;  3BAS A;  1EZV I;  3H1K J;  1SQB D;  3SWY A;  3V5B A;  3WUT A;  2M3E A;  1LT9 B;  1UIX A;  1MFZ A;  1WMK A;  2IBZ D;  3HTK A;  2HLO A;  2JKV A;  1MKM A;  2N1T B;  3H1H G;  1AV1 A;  5AVS B;  1LNQ A;  3L71 E;  1OZH A;  1KIL C;  2JP3 A;  3L4F A;  4L75 A;  3H1J G;  3HE5 B;  5KLI B;  2JDI H;  3L36 A;  1J2J B;  2AXC A;  5AW1 B;  1Y9B A;  1K73 Q;  4I6M C;  1BCC D;  3M0D A;  3RL0 D;  3PJS K;  4LGD E;  3BCC D;  3L71 J;  4GOE A;  3AE4 C;  2QJK C;  1KB9 I;  2I8D A;  1NTK D;  2B87 B;  4PD4 I;  2L5G B;  3KHU A;  1EZV D;  2E43 A;  2HYN A;  3N4X A;  1KD1 Q;  2R44 A;  2D2C C;  3CX5 E;  2CPS A;  1Q81 Q;  2IBZ G;  4BRY B;  3CPW O;  2OYH B;  2Q7C A;  1S1C X;  1EXJ A;  1OIP A;  1H89 A;  2QSI A;  5B5E H;  3L70 E;  2M8R A;  1M56 D;  1TU3 F;  2QEX P;  1CSB A;  2QJY B;  4PV1 C;  3HD7 A;  2RKL A;  3L35 A;  1KQL A;  3H32 B;  3CL3 D;  1NU1 J;  3P8C E;  5AW8 B;  2H43 A;  1KFN A;  4NPF X;  1G2C B;  1GMJ A;  1T2K C;  1EDK A;  1FZC C;  1NTK G;  1JY2 N;  2WMM A;  1KB9 D;  1SQQ K;  3K5B A;  3AE8 C;  1KB9 H;  4PD4 D;  4EI2 A;  4PD4 H;  4H0L D;  3CX5 I;  4KJM A;  2WT7 B;  1CZQ A;  3PLN A;  1L0L E;  1GL2 C;  2Q3I A;  2E74 C;  2V7Q J;  4NPE A;  3RK2 C;  3L71 D;  3L72 J;  2E75 D;  1XTC C;  2ZVN B;  3MUD C;  3AE9 C;  3M0A A;  1N73 A;  2Q5U A;  3JCU E;  1L0L J;  1NJI Q;  4TLF A;  1L0N E;  4XE5 B;  4C7R A;  1FJP A;  1N7S D;  1SVF A;  1IJD B;  1HJB A;  2JWA A;  1FDI A;  3QWO C;  3AEB C;  4H44 D;  1RE3 A;  2ZAE B;  3MIW A;  2K37 A;  2WSC J;  2Z5H A;  5KKZ B;  1RF1 A;  2NPS A;  5L8R J;  2O01 J;  3B5N B;  3RK3 C;  4RO0 A;  1BGY E;  4WY4 D;  3CX5 D;  2YO2 A;  3CX5 H;  3IF4 A;  1K9M Q;  2NRG A;  4RKU J;  1Q7Y Q;  3L71 G;  5CJ0 A;  3L70 D;  3O6Q B;  2QVA A;  5KJ7 D;  2XNX A;  1AQ5 A;  1KIL E;  3TYY A;  1BGY J;  2IYO A;  5AVV B;  1OW8 A;  2FYU K;  2OYI B;  1SQV E;  1KIL A;  1GDT A;  3V2P A;  3P8C D;  1Q90 D;  4YXD C;  1NTZ K;  1LTA C;  1USD A;  1VL2 A;  1IO4 A;  2FXP A;  4MN4 C;  2H89 C;  1M1K Q;  2K9J B;  4W80 A;  1SQV J;  4H0L B;  3V2R A;  1FDM A;  1AVO A;  4L74 A;  1WT6 A;  1JCC A;  3H1I E;  3V4Q A;  2ZXE B;  3L70 G;  1DD3 A;  3MP7 B;  1Q86 Q;  2P10 A;  2YXR B;  4O9B A;  2WPV B;  1L4A A;  4HB1 A;  3SFD C;  2E75 B;  3M9Q A;  2B89 A;  3BVH A;  4N78 E;  3EQ2 A;  3TNU B;  2IX7 C;  4OGQ B;  2YMY A;  1S5L E;  1L0N D;  1GW4 A;  1JY3 P;  3U1A A;  1YIJ P;  1KFM A;  2BCC E;  1FAV A;  5DJU B;  1EDL A;  2NPS D;  5AVU B;  1N7S B;  5E79 E;  1T3U A;  1T8Z A;  2IZ0 A;  4R4M A;  2FXM A;  1KOR A;  1PGO A;  1PZQ A;  1JNM A;  2POH A;  3IFM A;  4N3Y B;  1X9V A;  2P67 A;  1LTB C;  3Q3D A;  1JB0 J;  4IFF A;  1SQQ E;  4YXW H;  2W6J H;  4KT0 J;  5APY A;  1SQP E;  1AA0 A;  1JY3 O;  1VQP P;  1L0L G;  4WY4 B;  1OFC X;  2R5D A;  5CMZ A;  2N9Y B;  1FZC A;  2Y0D A;  3PHL A;  3P32 A;  1VQ5 P;  1HJ0 A;  2OTK E;  1NKZ B;  1N86 A;  3C1L A;  1KIL D;  1SQQ J;  1KQF B;  3M0D C;  2WVR A;  1RF0 A;  2W6B A;  1SQP J;  3P8M C;  2P7J A;  5CCG A;  3T97 B;  1ZRT D;  2ZT9 B;  3CCM P;  1L0N G;  3RBX A;  3WU2 H;  3D6Z A;  2A45 G;  3HUS B;  5CHX A;  5AVR B;  5CCH C;  3M06 A;  4UB6 E;  4A7P A;  2KIK A;  1NO4 A;  1BGY G;  3RK3 E;  2C0X A;  3CC7 P;  2D2C D;  3H1I D;  2N9B A;  1M1J C;  1DX7 A;  1HWT C;  3LW5 H;  2L91 A;  5C39 A;  1NU1 K;  3HD7 C;  3D6Y A;  2FYN B;  1P84 H;  4N78 D;  2R5B A;  1NVO A;  1SQV G;  1URQ C;  4PV1 D;  3RGU A;  2M5A A;  3E1R A;  3KQG A;  2CPB A;  2FYU E;  2QG4 A;  1S9K E;  5APU A;  2BCC D;  3S1K A;  3EFG A;  3GHG A;  2WT7 A;  3CXH E;  3CCR P;  1IK7 A;  1FZF A;  1NTZ E;  2QRX A;  3II6 A;  1YQ3 C;  1T2K D;  4DZO A;  4DJG A;  1VQ4 P;  1EQ7 A;  2FFD B;  1U7M A;  1SQQ D;  3HE4 A;  1VQL P;  3S9O A;  3KZI H;  2FYU J;  2AXT H;  3H1I G;  3CC4 P;  1MFT A;  1L0L K;  1QLE D;  1H88 A;  1J1E C;  2IBZ I;  3ZDM A;  1NTZ J;  1GL2 D;  2E74 D;  3Q5P A;  5AVX B;  1N73 C;  2E76 C;  1CI6 B;  3RK2 D;  3H1H D;  3AED C;  2PRR A;  1K04 A;  4NPD A;  1ZME C;  3HRN A;  4B86 A;  1LTI C;  1YJW P;  2ZXX A;  3MTU E;  2BCC G;  1JTH A;  1RE3 C;  3H1K E;  2YXQ B;  3BAT A;  2IDB A;  5KAI H;  4JYB A;  1RQV A;  1E79 H;  3A7O A;  2ZFC A;  3A0H H;  1JMM A;  5CBN A;  2QJK B;  4H13 C;  2WSF J;  5KAF E;  1SQQ G;  2B9B A;  3PRJ A;  5GTI E;  1GD2 E;  1SQP G;  3RK3 D;  2D2C B;  2XU6 A;  2SPZ A;  4PJ0 H;  3CCQ P;  3Q2Y A;  2QE7 H;  1VDF A;  3TF5 A;  2WTY A;  1SP4 A;  2H88 C;  2IFM A;  1CW5 A;  1HUC A;  1HH0 A;  1G1J A;  2QJP C;  2WPS A;  2YIU B;  1SQV K;  1NOH A;  2FYU D;  1PFI A;  2PP6 A;  3ABV C;  3F89 A;  1S9K D;  2UWJ E;  1FOS E;  1GTW A;  3CCU P;  2J59 M;  1NTZ D;  1GU4 A;  2WIT A;  4HJG H;  3WUV A;  2HOD A;  5DJT B;  1LTG C;  2M0B A;  4K35 A;  1JY3 N;  5CCH A;  1L4A C;  1VQN P;  1GK6 A;  1KMI Z;  1W5C E;  2KOG A;  1GL2 B;  2DW3 A;  1OXZ A;  3B71 A;  4GDO A;  1NU1 E;  1VQO P;  2W6A A;  4I7Z C;  5BU5 A;  2Q9I A;  2KLV A;  2A06 E;  3MZW B;  3GF3 A;  1M1J A;  3I55 P;  2FYU G;  4HH2 A;  3LIE A;  2JJL A;  1ZP0 C;  3H1K D;  1VF5 C;  2PGD A;  4GT1 A;  4D6T J;  3SSU A;  3A0B E;  1NTZ G;  5GTH H;  1R5S A;  4DCK A;  1URQ A;  4L73 A;  2J58 A;  1LWU A;  3TGU E;  1HGV A;  2M3B A;  3L72 E;  1Z56 A;  3A5T A;  2WPR A;  3RK3 B;  1SQP K;  2HFE D;  2KZI A;  1S2E A;  1BSN A;  1RF0 C;  4BWN A;  1NWQ A;  2KNC A;  2YKO A;  3TGU J;  3V2N A;  1LJ2 A;  4JQ0 D;  5CCG C;  1X22 A;  1HBW A;  1ZR2 A;  2KK7 A;  1PGP A;  1QVF O;  3QH9 A;  2O1J A;  2V4H A;  2J5U A;  1D7M A;  3LID A;  1KZU B;  2ZJS E;  3H1K G;  3AE3 C;  3L73 E;  4W7Y A;  4CPG A;  3G4S P;  3RL0 B;  3OAK A;  1ZN5 A;  1YHQ P;  3JC2 2;  4IFM A;  5CCH D;  5KLV K;  1W2B O;  2GA1 A;  2KSE A;  1N8R Q;  1FDO A;  2QJY C;  2G3A A;  2PFX A;  3L74 J;  3KYQ A;  5BVZ A;  1FZA A;  3OW2 O;  3L73 J;  2AEF A;  1M7L A;  3FGA D;  3ITK A;  4M3L A;  2P1J A;  3HD7 D;  2KS1 B;  1NU1 D;  4JYC A;  1OW7 A;  3AEG C;  2KUB A;  1RQU A;  4IL6 E;  1H0T B;  5TIS E;  1LTJ B;  3GHG C;  1URQ D;  1YTZ T;  4GOD A;  3Q1M A;  1HF9 A;  4EIJ A;  3E1I A;  3RL0 g;  2C9N Y;  1NTM K;  2KXP B;  2A45 I;  3TGU D;  1ZV8 A;  1Q2N A;  1X8Y A;  3CWB E;  4BXL A;  2V7Q H;  3L72 D;  3HTK B;  1LP1 A;  1VPC A;  3U59 A;  3P7K A;  4ASV A;  1X79 B;  3UIA A;  1L2P A;  3OJA B;  4ZMD A;  3B4S A;  1L0L D;  1SFC A;  2P58 A;  3FXD A;  2RN0 A;  2Z5I A;  1NU1 G;  2NZ2 A;  2ZYA A;  3CWB J;  2E76 D;  2WZ7 A;  2ZYD A;  2A06 G;  3CI9 A;  5KKZ C;  4Y99 C;  5B66 E;  3B5N C;  2H7H A;  3W67 A;  4I1L A;  3CLQ A;  1YJN P;  1EXI A;  2FBW C;  1KYO E;  1AQT A;  3V2Q A;  3A3Y B;  2WSC H;  3JCU H;  1LT1 A;  2O01 H;  2WQY C;  1M57 D;  3TGU G;  1LT9 A;  2I1K A;  1YBK A;  2KYV A;  5H2F E;  3GW6 A;  2A45 H;  4H13 D;  3L72 G;  3H25 A;  1PPJ E;  4H44 B;  3BRT B;  2N1T A;  1JO5 A;  2K88 A;  1GW3 A;  3FX0 A;  2WSE J;  4R4L A;  1BGY D;  1FC2 C;  2Q1K A;  3AEC C;  3HE5 A;  3L37 A;  3MD0 A;  1FS0 E;  3VMY A;  1JM0 A;  3VTP C;  3HD7 B;  2JEE A;  1NAY A;  4RJT A;  4EOT A;  3VP8 A;  1RE4 A;  3G9R A;  1QVG O;  3L75 E;  3L73 G;  3NXS A;  1SQV D;  2IYP A;  2B87 A;  3NTN A;  3VN0 A;  3H1L J;  2QA4 P;  3PTZ A;  5AW7 B;  1JOC A;  4BRY A;  2OYH A;  5KLV E;  3SFE C;  1OMI A;  4OGQ C;  3L75 J;  5AVT B;  1JUN A;  3MHV A;  2O01 N;  2C0W A;  1L4A D;  2LXB A;  1DD4 A;  1J1E B;  4GKG A;  5KLV J;  3H1J J;  2E76 B;  1SS1 A;  3D71 A;  2XZR A;  3H32 A;  4U3F E;  5BU8 B;  3C8V A;  1VQ7 P;  1SQB E;  1NGM B;  1G2C A;  2KZJ A;  2FXO A;  2HPC B;  1LWU C;  3Q5S A;  3V4W A;  2OTL P;  3IAO A;  1S5L H;  3N7N A;  1VF5 D;  3CMA P;  4WVZ A;  2XKM A;  2BEQ D;  4U3F J;  1RF1 B;  2NPS B;  1FBM A;  5E79 H;  3CWB G;  1NTM E;  1SQB J;  1PPJ D;  5AVZ B;  1FZG A;  4WWI A;  5APX A;  3KPE A;  3VMZ A;  2ZT9 C;  1KQS O;  2K9Y A;  1J1D C;  2QM8 A;  2Q3E A;  1SQP D;  1BCC E;  1HGZ A;  3HUS C;  1SLQ A;  3R2P A;  3BCC E;  1NTM J;  5CCG D;  3O8Z A;  3AE7 C;  1T3J A;  4LLH A;  1LTS C;  2E42 A;  1KIL B;  1QX8 A;  1EZV E;  1BCC J;  2W83 C;  1AJY A;  5CJ4 A;  1S3J A;  3BCC J;  3TDK A;  1UII A;  3F5H A;  3PH0 A;  4C7N B;  1EDJ A;  5B5E E;  3B5N A;  4OH8 B;  4TT3 H;  3CXH I;  2QIW A;  5KLV D;  1PPJ G;  1GK4 A;  3GF7 A;  1DH3 A;  4UB6 H;  4YTP C;  1S4X A;  5APQ A;  3M91 A;  3O6Q A;  3CCS P;  1OW6 A;  3VMX A;  3AEA C;  1L4A B;  2PAJ A;  3GMA A;  3CCJ P;  4GOF A;  1M90 Q;  2LKM A;  2OYI A;  2BAS A;  3VP9 A;  1QL1 A;  1KB9 E;  4I7Z B;  4PD4 E;  3OA7 A;  1OVR A;  2R3S A;  3L75 G;  3JSV C;  5APS A;  3RBZ A;  4PV1 B;  2FKW B;  1H8A A;  2K9J A;  1VF5 B;  1A02 F;  4JPZ B;  4JF7 A;  2H8P D;  1LTT C;  3EFF K;  2FY8 A;  5KLV G;  1SQX K;  5AW3 B;  3CXH D;  1MV8 A;  1NTM D;  2ITA A;  2OQQ A;  3CXH H;  2KLU A;  1Y47 A;  4IFD K;  2FYZ A;  1FZC B;  1SFC C;  1YYC A;  1YTZ I;  3M9H A;  4LC1 A;  3Q5R A;  5APW A;  5AVW B;  1M8O B;  4ZNC A;  1OWA A;  3TNU A;  5K5G B;  5EFW B;  4IOI H;  2CK3 H;  1VQ8 P;  3AE6 C;  4U3F G;  1S5L X;  1IK9 A;  2E74 B;  3RK2 B;  4D6T E;  3FWL A;  1SQB G;  1KN7 A;  2QM7 A;  3B5N D;  1N7S A;  3AE2 C;  3U1C A;  1LT9 C;  2WSF H;  1JCD A;  1NAF A;  4DOJ A;  4Z1M H;  3GG2 A;  2VRS A;  2N1T C;  4U7J A;  1NHL A;  1NTM G;  4WY4 A;  1FE6 A;  1ZXG A;  1FU1 A;  2XV5 A;  2YIU C;  2IFN A;  1PGJ A;  5KLI C;  1VQM P;  5KAF H;  2IZ1 A;  5GTI H;  2Y0C A;  1BCC G;  5KJ7 A;  1GZL A;  1HVV A;  3BCC G;  1IZN B;  3L70 J;  2OGU A;  1RE4 C;  1OVV A;  3T97 A;  3VYI A;  3GLM A;  2M5A B;  4XFJ A;  1EZV G;  3HUS A;  2MKV A;  2LXC B;  3W68 A;  4N6J A;  3GHG B;  3L74 E;  2GUV A;  5KTB A;  2OYH C;  3WMM 0;  1RHZ B;  1OVU A;  3AE5 C;  1MUU A;  3HE4 B;  1YQ4 C;  5AW0 B;  1BE3 E;  2JR8 A;  2GM4 A;  3AE1 C;  1PL5 A;  4W7Z A;  4OGQ D;  5CBO A;  1IFD A;  2K1A A;  1IC2 A;  3IN6 A;  2HPC A;  1BE3 J;  1KTM A;  1FZB A;  4AYC A;  4D6T D;  1KQG B;  3CME P;  2E5T A;  1FOS F;  4Y99 B;  2AEM A;  1JTH B;  2A06 D;  4DT0 A;  3D70 A;  1SQB K;  2Y0E A;  1L0N J;  1Y8A A;  3M9B A;  4RES B;  2YMK A;  1G1I A;  4I2L C;  1FZE A;  2FFD A;  4JBZ A;  1YI2 P;  5AVY B;  4HYT B;  3USS A;  3A0B H;  3PP5 A;  1AVY A;  1BDD A;  1SQX E;  2Z4E A;  5AW2 B;  4K3A A;  3SWK A;  2GUS A;  2ZT9 D;  3I56 P;  1ZRT E;  1CI6 A;  1PP9 E;  1FJK A;  3FXE A;  3WU2 E;  1IFP A;  3A2A A;  3RL0 C;  3FWN A;  1KV4 A;  2W27 A;  4EDF A;  1RY3 A;  1SQX J;  4D6T G;  4C7N A;  1DIP A;  4XA4 A;  1QGK B;  1NTK K;  1VQK P;  1ZOY C;  1PP9 J;  1KC8 Q;  2HG5 D;  2P2U A;  1VQ6 P;  4YPC A;  1JEK A;  3L74 D;  3NFQ A;  3CCE P;  4HKZ H;  2Y9Z A;  1T6A A; 
#chains in the Genus database with same CATH homology
 2H88 C;  2V7Q J;  2E74 C;  1YQ3 C;  1R8E A;  1NGM B;  1OW6 A;  1VL2 A;  2FXP A;  3AE4 C;  3AEA C;  3IN6 A;  1KQF B;  2H89 C;  2QJP C;  2QJK C;  4Z1M H;  3Q5S A;  2E75 D;  2WSE J;  4R4L A;  3S9O A;  3IAO A;  1VF5 D;  4U7J A;  2FYN C;  3AEC C;  3GMA A;  3Q1M A;  1HF9 A;  4H44 C;  2G8Y A;  3ABV C;  1PIX A;  2JO1 A;  3T97 B;  3AEF C;  1K05 A;  3AE9 C;  4H0L B;  3RL0 g;  1KTM A;  2ZT9 B;  3AEE C;  1KQG B;  2BEQ D;  3D6Z A;  2YIU C;  2D2C C;  3D70 A;  4I7Z B;  5KLI C;  3LW5 J;  2E74 D;  3Q5P A;  4Y28 J;  1S1C X;  2E76 C;  1DD3 A;  1NYH A;  2ZT9 C;  3G9R A;  2YMK A;  4IL6 X;  1EXJ A;  2P10 A;  2K9Y A;  3AED C;  5M1B A;  1K04 A;  2WPV B;  4PV1 B;  2QSI A;  3R4Y A;  1FDI A;  3SFD C;  1ZME C;  2E75 B;  3AEB C;  4H44 D;  1VF5 B;  2J5U A;  2BEZ F;  1TU3 F;  3EWK A;  2WSC J;  3AE3 C;  3GLM A;  3RK3 E;  5L8R J;  2O01 J;  4OGQ B;  4XFJ A;  4PV1 C;  4H13 B;  2D2C D;  2OQQ A;  1KMI Z;  3AE7 C;  2NZ2 A;  2IDB A;  4H0L C;  2E76 D;  1RQV A;  2MKV A;  2ZT9 D;  3SFE C;  1ZRT E;  5KKZ C;  4RKU J;  1PV3 A;  3B71 A;  1OMI A;  4GDO A;  1UIX A;  4OGQ C;  1WMK A;  1FDO A;  2QJY C;  4R4M A;  2G3A A;  4I7Z C;  4H13 C;  1AJY A;  2WSF J;  3Q5R A;  1MKM A;  3D6Y A;  1KOR A;  3AE5 C;  3GF3 A;  1GMJ A;  1KIL E;  1EXI A;  2JP3 A;  2FBW C;  3Q3D A;  1JB0 J;  4PV1 D;  2E75 C;  1YQ4 C;  3AE8 C;  4KT0 J;  1DD4 A;  1ZP0 C;  1VF5 C;  4TT3 H;  1OW8 A;  1DIP A;  3AE6 C;  2D2C B;  3FGA D;  4H0L D;  3AE1 C;  1S5L X;  2E74 B;  2WQY C;  1PL5 A;  1ZOY C;  2QIW A;  2E76 B;  3GF7 A;  1U57 A;  3D71 A;  1HJ0 A;  1Y9B A;  3Q2Y A;  4OGQ D;  3AE2 C;  4YTP C;  4H13 D;  1OW7 A;  3AEG C;  3C8V A;  3H25 A;  1Q90 D;  4YXD C;  1RQU A;  1IK7 A;  4H44 B;  3O6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...