1U57A

Nmr structure of the (345-392)gag sequence from hiv-1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
48
structure length
48
Chain Sequence
LEEMMTACQGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRNQRKIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag polyprotein
publication title Helical structure determined by NMR of the HIV-1 (345-392)Gag sequence, surrounding p2: Implications for particle assembly and RNA packaging
pubmed doi rcsb
molecule tags Viral protein
total genus 14
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 2004-07-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.760 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1u57A00
1U57A
chains in the Genus database with same CATH superfamily
3B5NC 1SFCA 1SQBJ 2XNDH 5KJ7A 1RF1B 5AW6B 3BRVB 4JBZA 3CCMP 1PL5A 1SQBD 4C7NB 1YJ9P 1MFZA 2KS1A 1Y9BA 1NOHA 3GF7A 3CCLP 1J1EB 4H44D 2B87B 1JNMA 3TF5A 2FFDA 1IK7A 1BGYJ 1NTME 1NU1K 1BE3G 2IZ1A 3RL0B 4WB4A 4D6TJ 3N7NA 1BGYD 1K73Q 4MN4C 3W67A 4D6TD 2WWWA 1GTWA 3KPEA 2E5TA 5AVWB 4PD4E 2IBZD 2O1KA 1GL2A 1YYCA 1ZRTD 2E75B 3M9BA 2XKMA 1USDA 1PFIA 1P84I 2VRSA 4I7ZB 3FXDA 4JYBA 2ZXEB 3HUSC 5AVTB 3N4XA 3NTNA 2P67A 2JEEA 3CCSP 2WPQA 1SQPG 3UIAA 3CPWO 1PV3A 1HJBA 1OW8A 1FOSE 1IFMA 4XFJA 1A02J 1VQLP 1EZVD 3D71A 4UB6H 4WWIA 5AVSB 3PH0A 2ZXXA 3RBXA 2BCCG 2YIUB 2Y9YA 3G4SP 4OGQC 2KP8A 2WPVB 4H0LB 5CCGC 1BCCG 1OW7A 5APXA 1N73C 1T3UA 3LW5H 4YXWH 1NTZG 3CXHD 1ZLLA 1SQQJ 1R5LA 3S9OA 2A45G 2KNCA 2OYIC 1M90Q 2ZYGA 2ZT9B 1SQQD 1L4AC 1LTSC 5AW1B 1GW3A 4H13D 2HFED 1J1DB 1OVVA 2V7QH 4U3FE 1KQSO 3H1IJ 3L72E 2PAJA 1RQUA 2NPSC 1KILC 3V6IA 2M3EA 3R4YA 1PPJG 2B9BA 3CWBG 1WT6A 2KK7A 2M5AA 3H1ID 2K9JA 3JC22 2QJKC 3CX5D 1OXZA 2R3SA 2QRXA 4W7YA 2OARA 1U57A 2P10A 1KYOE 3HE5A 3RBZA 1SQVJ 2ZVOB 2KI7B 3MP7B 2G3AA 1OIPA 4AUWA 1SQVD 1FU1A 1N7SA 3CX5I 4HB1A 1VL2A 3PRJA 1H0TB 1RE4A 1LP1A 1SFCB 2N1TA 2OYOA 1GD2E 4I6MC 1LGHB 2ZVNB 3H1JE 3OAKA 5AW0B 4DT0A 5BU5A 4GKGA 3D6ZA 2O3JA 4XE5B 3TYYA 4GT1A 2LR2A 2L5GB 2FFDB 4HJGH 3WUVA 1S5LE 5KLVG 1GMJA 3E1IA 3AE7C 1FZGA 5BVZA 1CW5A 3JCUE 3Q3DA 2QM8A 3HD7C 3AE5C 1NWQA 2E76B 5KAIE 1YI2P 1GL2B 1L0LE 3B5NA 3AEAC 3L73G 3H1KE 4K3AA 2JDIH 1SVFA 5KAIH 4ZKPA 3L74E 1QX8A 5CCHC 1HWTC 2Z5IA 1PP9J 5GTIE 2AXCA 2CK3H 4OGQD 4BRYA 1KFMA 5CCGD 2ITAA 3TGUJ 2B89A 3G71P 1MKMA 3L71D 3TGUD 3C1LA 1IFIA 3NMDA 2W83C 1NTMK 1M8OB 5AVUB 5AVRB 2C0XA 3AEEC 1D7MA 2RKLA 1H88A 1HF9A 4AYCA 2YNYA 1KILD 1FAVA 4PJ0H 3GLMA 1YIJP 3H25A 3OW2O 4GOEA 3LIEA 2KNCB 2ZAEB 3A0HE 2V4HA 4H44C 2O01H 1XTGB 3CL3D 5AW8B 4JYCA 5APYA 3H1HG 3SSUA 2IFNA 2WMMA 1JM0A 2W90A 1NKNA 3M91A 3O8ZA 1S9KD 2SPZA 4RKUJ 4WY4D 4JQ0D 1XTCC 1YHQP 3II6A 3WMM0 3VN0A 2DW3A 1AVYA 2P2UA 1FZCB 1DD4A 2QJPB 4EOTA 1SQPE 2Q3IA 2JJLA 3L72G 2M5AB 2K9JB 1KORA 1IC2A 2P7JA 1AVOA 1EQ7A 1GU5A 1QEXA 1SQBG 2JKVA 4EI2A 3AECC 3HE5B 2RH0A 3U1AA 2WSCH 3VMYA 2OYIA 1JY2O 1ZP0C 2BCCE 2FXPA 5KLIC 4PD4D 3GHGC 1BDDA 3NFQA 5EFWB 1K9MQ 1L4AA 1BCCE 4DOJA 1BGYG 2YKOA 5AW5B 2N1TB 1Q7YQ 1NTZE 3GF3A 5E79H 1LNQA 4D6TG 3HD7D 2K88A 2H88C 2KZJA 4Y99B 3ZDMA 2NPSA 2QEXP 3G9RA 5AW7B 1JY2P 1KB9E 1HH0A 2OYHB 1HTLC 3RL0g 3CMEP 2WSEH 3TSIA 3CWBE 4H13B 2E74B 5CCHD 2H7HA 1FDMA 4NPEA 1PGJA 2J5UA 3PTZA 2PP6A 5KKZB 1AQ5A 4W80A 3AE6C 3FGAD 4IL6E 4W7ZA 4PV1C 3Q5SA 2MKVA 3B5NB 2M8RA 5TISH 2KYVA 3C9IA 3G6EP 1LWUC 3GG2A 3MTUE 2KB7P 2E43A 1EZVG 2QSIA 3AEBC 4KJMA 2XU6A 4IFDK 2O01N 1H0TA 4BRYB 2YKQA 3IR9A 3L70J 1KC8Q 3M0AA 2YXRB 4U3FD 3L70D 5APUA 5APSA 2OQQA 2Z4EA 3RK2D 3AEFC 1RF0A 5KLVE 1M1JC 2HODB 2FBWC 2H89C 2A06E 2IYOA 3AEDC 1EC5A 1P84D 4N78E 1SQXJ 3HUSB 4ZNCA 4XA4A 1M7LA 2HLOA 3RK3D 3SFDC 4ZMDA 2KSJA 3MUDC 1VQ8P 1LTBC 1SQXD 1L0LK 3H1IG 2FYUJ 2K9YA 4ZKUA 3L73E 3G3ZA 4LGDE 3M0DC 2FYUD 1VQ6P 3IFMA 3EWKA 3KQGA 1K04A 4ASWA 3H1JJ 3K5BA 1BDCA 1KYOI 5AW9B 1YITP 4NPFX 3H1JD 1NH4A 1SQVG 5DJTB 1JY3N 3BCCJ 1QL2A 4UB6E 3CCVP 3PJSK 5KAFE 1NU1J 4IL6X 4OGQB 1X22A 3BCCD 2J59M 3EQ2A 3R2PA 1ZR4A 1RQVA 1NU1D 1N73B 2XZRA 4WBAA 1MFTA 2WPRA 2I1JA 2Y0EA 3A3YB 2P1JA 1DD3A 2OYIB 1A02F 4IFFA 5KAFH 5B66H 1JMBA 1N2DC 4M3LA 3CC2P 1L4AB 2QJYC 2XDJA 3IN6A 3L74J 1RY3A 3S4RA 3V2PA 1GK4A 2NPSB 4PV1D 2KLUA 1URQC 1KILB 3L74D 4UB8H 4IFMA 2ZYDA 4K35A 3H1HE 2QJKB 1ZXGA 1GDTA 3AE1C 2POHA 3CCRP 1G2CA 3VP9A 2XV5A 3E1RA 1GU4A 4BWNA 1HGVA 1SQPK 1Q82Q 1BE3J 1FZCA 2H43A 5APVA 1ZMEC 1FZEA 1BE3D 3MD0A 1SQBE 1YQ3C 1PP9G 3KXDA 3O6QA 1EDJA 2NZ2A 4JPZB 3F5HA 3ABVC 2M3BA 3HRNA 3TGUG 5H2FH 1U7MA 1IFPA 2WTYA 4WY4C 1BGYE 1QL1A 4L73A 1J2JB 1NTZK 3M9HA 4D6TE 2FYNC 1P84H 4KHXA 2FYZA 2JR8A 2Q6QA 3HD7B 3IF4A 2WQYC 1UIXA 3H1LJ 2LXCB 5AW2B 1FZFA 1IK9A 2OYHA 5AVXB 1OFCX 3H1LD 1LWUA 2WSFJ 2Q7CA 5APWA 2A06G 1L0NG 2BCCJ 2AEJA 1SP4A 3RL0D 1T3JA 1YQ4C 4GDOA 2BCCD 3Q5PA 5KJ7C 1TU3F 5AVZB 2RMZA 2XNXA 1NTZJ 5CJ4A 1MZ9A 3SWKA 1EZVE 1LT9C 1NKZB 1S1CX 1NTZD 1Y8AA 2E75D 2JWAA 1X8YA 3D6YA 1IO4A 3V5BA 3CMAP 1JUNA 2WVRA 1L2PA 2WT7A 1M1JA 3P8MC 2QA4P 3A5TA 3CCEP 3L71J 2MJZA 1S72P 3CXHE 3CWBJ 1VDFA 1DEBA 2YMYA 1URQD 1RE3C 3B71A 2A45I 4ASVA 1PPJD 3CWBD 5GTHH 1SQQE 5KLVK 1NTKG 2D2CC 1AA0A 4PJ0E 3CXHH 3M0DA 2YXQB 2ZFCA 1KTMA 1YTZT 4H44B 2HODA 1W2EA 2K1AA 1VQ7P 3RK2B 3VYIA 5CMZA 3HUSA 1KB9I 2Y0DA 3AE8C 2AEFA 3SWYA 1GK6A 3H1IE 3T97A 2KSEA 3QH9A 3L75J 4H0LD 3AE2C 2IZ0A 2HPCA 2L91A 1DX7A 3L75D 4CPGA 3RK2C 1N86A 1R8EA 3CX5H 3L4FA 1G2CB 2ZT9D 1PGPA 2P58A 1SQVE 3MIWA 1FC2C 2HYNA 3RK3C 4KT0J 1DH3A 1N7LA 1JEKA 5KLIB 3GHGB 3V2NA 5KLVJ 1VF5C 1NTMJ 5B5EH 1EDKA 1KQFB 5KLVD 3O6QB 1NTMD 3KHUA 5CCGA 4N78D 1W2BO 1N73A 1FS0E 1NYHA 1USEA 3FWNA 1FDIA 1ZN5A 2OGUA 4L75A 5E79E 1H8AA 1Z56A 2I1KA 2GA1A 1X79B 3WUUA 4R4LA 1HJ0A 3CC4P 3WUTA 1BSNA 3RGUA 5AVQB 2UWJE 4DJGA 1JOCA 1YJNP 3SFEC 4EYYQ 4TT3H 2FXOA 1SQXG 2QM7A 4EIJA 1KILA 2QIWA 1Q90D 5KJ7D 1SFCD 2IBZG 1KD1Q 3BRTB 2WSFH 4PV1B 2FYUG 3GMAA 2K3RA 1Q2NA 3S1KA 4C46A 1JB0J 4Y28J 1OVUA 1LWUB 3VMAA 3I56P 2LXBA 5TISE 5APTA 2YKPA 5CBNA 1LTJC 1PP9E 1SQBK 4WY4A 3LW5J 1S3JA 1N7SC 1KMIZ 3A2AA 5L8RJ 3LIDA 3EFGA 3M9QA 4B86A 2YO2A 3H32B 3TGUE 1ZV8A 2E76D 3HE4B 1GL2D 1NU1G 1T2KD 2D2CD 1CI6A 1G1IA 1Q86Q 1NO4A 1FZBA 3H1HJ 2IFMA 3PP5A 1E5WA 3OA7A 1NVOA 1WMKA 3CLQA 5BU8B 1KILE 2BEZF 3H1HD 2WT7B 1M1JB 2GUSA 4HH2A 2HR3A 4U3FJ 1RHZB 1Y47A 2KIKA 3VMZA 3L72J 2BEQD 4I2LC 1KV4A 3Q1MA 1QLED 2W6BA 3HD7A 3L72D 4C7RA 1OZHA 5C39A 1SQQG 1S9KE 1OWAA 3H6PA 3KZIH 1JCCA 1L0NE 2QVAA 2AXTH 1LT9A 1JTHB 4GOFA 3HTKA 3CCQP 1FDOA 3T97B 1KYOD 1VF5D 1VQPP 5CCHA 3V2RA 1VQ9P 2LKMA 4DZOA 2BASA 1VQNP 1T8ZA 1JO5A 2HPCB 1RF1C 1X0TA 1JMMA 3W68A 1AJYA 5K5GB 1IFJA 3P8CE 1W5CE 1RE3A 4GODA 1J1EC 2I8DA 1PIXA 1NJIQ 3AE9C 2ZYAA 3RL0C 4PD4H 3Q5RA 2QJYB 3B8EB 5B66E 1S2EA 1SQQK 1NTKE 2IBZI 4Z1MH 1EXJA 1U7JA 1FZAA 3CI9A 3L36A 3VMXA 4U7JA 4JF7A 2E42A 1URQB 2E75C 1FJKA 3BATA 1L0LJ 3EFFK 1PGOA 4N6JA 4I7ZC 1QGKB 3H1KJ 1ZR2A 1IZNB 2W6AA 4UB8E 1L0LD 3H1LG 2N9YB 1YBKA 3Q2YA 1GZLA 3H1KD 1M57D 2GM4A 4IOIH 1AFOA 1LTGC 1MUUA 2W6JH 1N7SD 1SS1A 2N1TD 2PFXA 3C8VA 4QMAA 3F89A 4I1LA 2C9NY 2IX7C 1SQVK 2G8YA 2Q3EA 3MGNA 2IYPA 1EZVI 2Y9ZA 2M0BA 5TJHA 3OJAB 1M56D 3GHGA 4OH8B 1IJDB 2HG5D 4WY4B 5H2FE 2YIUC 2E74D 2R44A 3PLNA 1OX3A 3CCJP 4H0LC 1DEEG 1KN7A 1JY2N 3VOPA 3L70E 4HYTB 2O01J 2QG4A 3JSVC 2FYNB 3VTPC 3CXHI 3GW6A 3L71G 3MHVA 3B5ND 2J58A 2WSSH 3USSA 1CI6B 3I55P 3ITKA 5M1BA 1OW6A 1NHLA 3AEGC 1EXIA 2ZT9C 1P84E 2RN0A 1IFNA 4AQRD 4O9BA 1UIIA 3RK3E 1J1DC 2QE7H 1AQTA 1SQXE 1HUCA 1G1JA 2OTLP 3FWLA 1NAYA 3D70A 2IBZE 3TNUA 1K8AQ 1NGMB 1LTJA 1ZRTE 1KZUB 2FYUE 4YXDC 1SQPJ 1M1KQ 2B88A 1WRGA 5DJUB 1FE6A 1KYOH 2N9BA 2WSCJ 2H8PD 3A0BE 1R5SA 3L75G 1SQPD 5CBOA 2YO3A 4YPCA 3IAOA 3FXEA 4DCKA 3I5CA 2IPPA 1LT9B 3V4QA 2KS1B 1ZW0A 2WZ7A 3A0BH 1KFNA 3HTKB 3V4WA 2W27A 4HKZH 4EDFA 1OVRA 1LTIC 3BCCE 2R32A 1BCCJ 1SFCC 3B4SA 2W8ZA 3CCUP 3H32A 1NU1E 1CZQA 1NTMG 5AW4B 1BCCD 4RESB 3HE4A 1Q81Q 5AVVB 4RJTA 2Q9IA 1VQ5P 4WVZA 1MV8A 2WSEJ 1K05A 2KLVA 1S5LH 3TDKA 2JP3A 2FFDC 2D2CB 1RF0C 1HBWA 2R3CA 5GTHE 3JCUH 1H89A 1PGQA 2Y0CA 1KB9D 2JO1A 1VQKP 3MUDA 2E76C 2PRRA 1GL2C 3U1CA 2OTJP 1T2KC 1RF1A 1FBMA 1PP9D 1L0NK 2CPSA 4C7NA 5GTIH 1JY3O 4L74A 1JTHA 2WITA 3L35A 2WPSA 2KXPB 5AVYB 1SLQA 2FY8A 1BE3E 1L4AD 2B87A 1LTTC 3RK3B 1RH5B 1ZOYC 4RO0A 3CX5E 1CSBA 3P32A 1VF5B 2R5DA 1HVVA 2KUBA 1EDLA 2NPSD 1N8RQ 3V2QA 5B5EE 4LC1A 1BSHA 1VQOP 3AE3C 1NAFA 1JY3P 5AW3B 3A7OA 1L0NJ 3CC7P 2YMKA 3PHLA 1NTKK 1DIPA 3M06A 3A0HH 2A06D 1L0ND 1S5LX 3E7KA 4U3FG 3L70G 3CD6P 1VQMP 3MZWB 1URQA 2OTKE 3NXSA 3L73J 3FX0A 4OWFA 5KTBA 3H1LE 3P7KA 3L73D 2Z5HA 1LJ2A 2Q5UA 2C0WA 4YTPC 3BASA 2GUVA 4GIFA 3BVHA 3P8CD 3WU2E 1FZCC 1S4XA 2C9LY 3TNUB 2QJPC 1OMIA 3KDPB 2ZJSE 1LTJB 2PGDA 1VPCA 1N7SB 1HGZA 4TLFA 4R4MA 1LP1B 3U59A 2KOGA 4N3YB 3WU2H 1T6AA 2R5BA 4LLHA 2O1JA 1GW4A 1IFDA 1YJWP 2JWDA 1NTKJ 5APQA 1FJPA 1LT1A 1FOSF 1JCDA 1AV1A 4PD4I 1VQ4P 3TK1A 1NTKD 2AEMA 1LTAC 1E79H 2IDBA 3H1JG 3QWOC 3VP8A 2A45H 4L76A 1QVFO 3L37A 2Q1KA 1RE4C 2N1TC 1PZQA 3L71E 1PPJE 3BCCG 4Y99C 2E5YA 2K37A 2CPBA 5CHXA 4OVNF 1KB9H 2KZIA 4NPDA 2V7QJ 4BXLA 3KYQA 2FXMA 1SQXK 1YTZI 2OYHC 3AE4C 1L0LG 1EDIA 5CJ0A 3SWFA 4IL6H 1QVGO 4H13C 1KQLA 2E74C 1X9VA 3H1KG 4A7PA 1KQGB 2FKWB 2FYUK 5KKZC 2NRGA 3KZIE 3L74G 3L75E 2AXTE
chains in the Genus database with same CATH topology
1PV3A 1VF5D 3C8VA 1TU3F 3IAOA 1R8EA 1OW8A 1ZMEC 4OGQD 2ZT9D 1PL5A 1K04A 1YQ3C 1ZOYC 4R4MA 2G3AA 3LW5J 4XFJA 2G8YA 3O6QA 1KMIZ 3AECC 3D71A 1AJYA 4KT0J 1S1CX 2NZ2A 2E75D 5L8RJ 1VF5B 1VL2A 2QSIA 1Y9BA 3AEBC 3GF7A 3ABVC 4H44D 1ZP0C 1VF5C 1MKMA 4IL6X 4OGQB 2FXPA 5KLIC 3D6YA 2E76D 1IK7A 4OGQC 1KQFB 2WPVB 4H0LB 2YIUC 1RQVA 2E74D 2IDBA 1PIXA 2D2CD 3AE9C 1OW7A 4H0LC 3AEEC 3AE3C 3D6ZA 1DD3A 3GF3A 2O01J 1NYHA 1FDIA 2WSEJ 3S9OA 3Q5RA 1K05A 1HF9A 2H88C 2OQQA 3B71A 2JP3A 2FYNC 1WMKA 1KILE 2BEZF 2QJYC 2D2CB 2ZT9B 3IN6A 3AEFC 3G9RA 2YMKA 3GLMA 5M1BA 1OW6A 4Z1MH 2D2CC 3AEGC 3H25A 4R4LA 1EXJA 2ZT9C 1EXIA 2FBWC 1HJ0A 2H89C 1DIPA 4H13D 2E75B 1GMJA 3AEDC 3AE7C 2BEQD 4U7JA 2V7QJ 1KTMA 1S5LX 3RK3E 4H44B 2E75C 3Q1MA 4I7ZB 3Q3DA 3SFEC 2WQYC 4PV1D 3SFDC 2JO1A 1UIXA 3AE5C 4H44C 3RL0g 2E76B 1RQUA 4I7ZC 4TT3H 3AE8C 3R4YA 2E76C 3AE4C 2QIWA 2E74B 1Q90D 4H13B 3AEAC 2K9YA 3D70A 1NGMB 2J5UA 2WSFJ 2E74C 3AE1C 4H13C 3Q2YA 2QJKC 1ZRTE 4PV1B 4YTPC 4RKUJ 1KQGB 3AE6C 3FGAD 4YXDC 4H0LD 5KKZC 3AE2C 3EWKA 3GMAA 4PV1C 3Q5SA 1DD4A 2WSCJ 2MKVA 1JB0J 4Y28J 1U57A 1FDOA 1YQ4C 4GDOA 2P10A 3T97B 2QJPC 1OMIA 3Q5PA 1KORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U57 A; 
#chains in the Genus database with same CATH topology
 3B5N C;  1SFC A;  1SQB J;  2XND H;  5KJ7 A;  1RF1 B;  5AW6 B;  3BRV B;  4JBZ A;  3CCM P;  1PL5 A;  1SQB D;  4C7N B;  1YJ9 P;  1MFZ A;  2KS1 A;  1Y9B A;  1NOH A;  3GF7 A;  3CCL P;  1J1E B;  4H44 D;  2B87 B;  1JNM A;  3TF5 A;  2FFD A;  1IK7 A;  1BGY J;  1NTM E;  1NU1 K;  1BE3 G;  2IZ1 A;  3RL0 B;  4WB4 A;  4D6T J;  3N7N A;  1BGY D;  1K73 Q;  4MN4 C;  3W67 A;  4D6T D;  2WWW A;  1GTW A;  3KPE A;  2E5T A;  5AVW B;  4PD4 E;  2IBZ D;  2O1K A;  1GL2 A;  1YYC A;  1ZRT D;  2E75 B;  3M9B A;  2XKM A;  1USD A;  1PFI A;  1P84 I;  2VRS A;  4I7Z B;  3FXD A;  4JYB A;  2ZXE B;  3HUS C;  5AVT B;  3N4X A;  3NTN A;  2P67 A;  2JEE A;  3CCS P;  2WPQ A;  1SQP G;  3UIA A;  3CPW O;  1PV3 A;  1HJB A;  1OW8 A;  1FOS E;  1IFM A;  4XFJ A;  1A02 J;  1VQL P;  1EZV D;  3D71 A;  4UB6 H;  4WWI A;  5AVS B;  3PH0 A;  2ZXX A;  3RBX A;  2BCC G;  2YIU B;  2Y9Y A;  3G4S P;  4OGQ C;  2KP8 A;  2WPV B;  4H0L B;  5CCG C;  1BCC G;  1OW7 A;  5APX A;  1N73 C;  1T3U A;  3LW5 H;  4YXW H;  1NTZ G;  3CXH D;  1ZLL A;  1SQQ J;  1R5L A;  3S9O A;  2A45 G;  2KNC A;  2OYI C;  1M90 Q;  2ZYG A;  2ZT9 B;  1SQQ D;  1L4A C;  1LTS C;  5AW1 B;  1GW3 A;  4H13 D;  2HFE D;  1J1D B;  1OVV A;  2V7Q H;  4U3F E;  1KQS O;  3H1I J;  3L72 E;  2PAJ A;  1RQU A;  2NPS C;  1KIL C;  3V6I A;  2M3E A;  3R4Y A;  1PPJ G;  2B9B A;  3CWB G;  1WT6 A;  2KK7 A;  2M5A A;  3H1I D;  2K9J A;  3JC2 2;  2QJK C;  3CX5 D;  1OXZ A;  2R3S A;  2QRX A;  4W7Y A;  2OAR A;  1U57 A;  2P10 A;  1KYO E;  3HE5 A;  3RBZ A;  1SQV J;  2ZVO B;  2KI7 B;  3MP7 B;  2G3A A;  1OIP A;  4AUW A;  1SQV D;  1FU1 A;  1N7S A;  3CX5 I;  4HB1 A;  1VL2 A;  3PRJ A;  1H0T B;  1RE4 A;  1LP1 A;  1SFC B;  2N1T A;  2OYO A;  1GD2 E;  4I6M C;  1LGH B;  2ZVN B;  3H1J E;  3OAK A;  5AW0 B;  4DT0 A;  5BU5 A;  4GKG A;  3D6Z A;  2O3J A;  4XE5 B;  3TYY A;  4GT1 A;  2LR2 A;  2L5G B;  2FFD B;  4HJG H;  3WUV A;  1S5L E;  5KLV G;  1GMJ A;  3E1I A;  3AE7 C;  1FZG A;  5BVZ A;  1CW5 A;  3JCU E;  3Q3D A;  2QM8 A;  3HD7 C;  3AE5 C;  1NWQ A;  2E76 B;  5KAI E;  1YI2 P;  1GL2 B;  1L0L E;  3B5N A;  3AEA C;  3L73 G;  3H1K E;  4K3A A;  2JDI H;  1SVF A;  5KAI H;  4ZKP A;  3L74 E;  1QX8 A;  5CCH C;  1HWT C;  2Z5I A;  1PP9 J;  5GTI E;  2AXC A;  2CK3 H;  4OGQ D;  4BRY A;  1KFM A;  5CCG D;  2ITA A;  3TGU J;  2B89 A;  3G71 P;  1MKM A;  3L71 D;  3TGU D;  3C1L A;  1IFI A;  3NMD A;  2W83 C;  1NTM K;  1M8O B;  5AVU B;  5AVR B;  2C0X A;  3AEE C;  1D7M A;  2RKL A;  1H88 A;  1HF9 A;  4AYC A;  2YNY A;  1KIL D;  1FAV A;  4PJ0 H;  3GLM A;  1YIJ P;  3H25 A;  3OW2 O;  4GOE A;  3LIE A;  2KNC B;  2ZAE B;  3A0H E;  2V4H A;  4H44 C;  2O01 H;  1XTG B;  3CL3 D;  5AW8 B;  4JYC A;  5APY A;  3H1H G;  3SSU A;  2IFN A;  2WMM A;  1JM0 A;  2W90 A;  1NKN A;  3M91 A;  3O8Z A;  1S9K D;  2SPZ A;  4RKU J;  4WY4 D;  4JQ0 D;  1XTC C;  1YHQ P;  3II6 A;  3WMM 0;  3VN0 A;  2DW3 A;  1AVY A;  2P2U A;  1FZC B;  1DD4 A;  2QJP B;  4EOT A;  1SQP E;  2Q3I A;  2JJL A;  3L72 G;  2M5A B;  2K9J B;  1KOR A;  1IC2 A;  2P7J A;  1AVO A;  1EQ7 A;  1GU5 A;  1QEX A;  1SQB G;  2JKV A;  4EI2 A;  3AEC C;  3HE5 B;  2RH0 A;  3U1A A;  2WSC H;  3VMY A;  2OYI A;  1JY2 O;  1ZP0 C;  2BCC E;  2FXP A;  5KLI C;  4PD4 D;  3GHG C;  1BDD A;  3NFQ A;  5EFW B;  1K9M Q;  1L4A A;  1BCC E;  4DOJ A;  1BGY G;  2YKO A;  5AW5 B;  2N1T B;  1Q7Y Q;  1NTZ E;  3GF3 A;  5E79 H;  1LNQ A;  4D6T G;  3HD7 D;  2K88 A;  2H88 C;  2KZJ A;  4Y99 B;  3ZDM A;  2NPS A;  2QEX P;  3G9R A;  5AW7 B;  1JY2 P;  1KB9 E;  1HH0 A;  2OYH B;  1HTL C;  3RL0 g;  3CME P;  2WSE H;  3TSI A;  3CWB E;  4H13 B;  2E74 B;  5CCH D;  2H7H A;  1FDM A;  4NPE A;  1PGJ A;  2J5U A;  3PTZ A;  2PP6 A;  5KKZ B;  1AQ5 A;  4W80 A;  3AE6 C;  3FGA D;  4IL6 E;  4W7Z A;  4PV1 C;  3Q5S A;  2MKV A;  3B5N B;  2M8R A;  5TIS H;  2KYV A;  3C9I A;  3G6E P;  1LWU C;  3GG2 A;  3MTU E;  2KB7 P;  2E43 A;  1EZV G;  2QSI A;  3AEB C;  4KJM A;  2XU6 A;  4IFD K;  2O01 N;  1H0T A;  4BRY B;  2YKQ A;  3IR9 A;  3L70 J;  1KC8 Q;  3M0A A;  2YXR B;  4U3F D;  3L70 D;  5APU A;  5APS A;  2OQQ A;  2Z4E A;  3RK2 D;  3AEF C;  1RF0 A;  5KLV E;  1M1J C;  2HOD B;  2FBW C;  2H89 C;  2A06 E;  2IYO A;  3AED C;  1EC5 A;  1P84 D;  4N78 E;  1SQX J;  3HUS B;  4ZNC A;  4XA4 A;  1M7L A;  2HLO A;  3RK3 D;  3SFD C;  4ZMD A;  2KSJ A;  3MUD C;  1VQ8 P;  1LTB C;  1SQX D;  1L0L K;  3H1I G;  2FYU J;  2K9Y A;  4ZKU A;  3L73 E;  3G3Z A;  4LGD E;  3M0D C;  2FYU D;  1VQ6 P;  3IFM A;  3EWK A;  3KQG A;  1K04 A;  4ASW A;  3H1J J;  3K5B A;  1BDC A;  1KYO I;  5AW9 B;  1YIT P;  4NPF X;  3H1J D;  1NH4 A;  1SQV G;  5DJT B;  1JY3 N;  3BCC J;  1QL2 A;  4UB6 E;  3CCV P;  3PJS K;  5KAF E;  1NU1 J;  4IL6 X;  4OGQ B;  1X22 A;  3BCC D;  2J59 M;  3EQ2 A;  3R2P A;  1ZR4 A;  1RQV A;  1NU1 D;  1N73 B;  2XZR A;  4WBA A;  1MFT A;  2WPR A;  2I1J A;  2Y0E A;  3A3Y B;  2P1J A;  1DD3 A;  2OYI B;  1A02 F;  4IFF A;  5KAF H;  5B66 H;  1JMB A;  1N2D C;  4M3L A;  3CC2 P;  1L4A B;  2QJY C;  2XDJ A;  3IN6 A;  3L74 J;  1RY3 A;  3S4R A;  3V2P A;  1GK4 A;  2NPS B;  4PV1 D;  2KLU A;  1URQ C;  1KIL B;  3L74 D;  4UB8 H;  4IFM A;  2ZYD A;  4K35 A;  3H1H E;  2QJK B;  1ZXG A;  1GDT A;  3AE1 C;  2POH A;  3CCR P;  1G2C A;  3VP9 A;  2XV5 A;  3E1R A;  1GU4 A;  4BWN A;  1HGV A;  1SQP K;  1Q82 Q;  1BE3 J;  1FZC A;  2H43 A;  5APV A;  1ZME C;  1FZE A;  1BE3 D;  3MD0 A;  1SQB E;  1YQ3 C;  1PP9 G;  3KXD A;  3O6Q A;  1EDJ A;  2NZ2 A;  4JPZ B;  3F5H A;  3ABV C;  2M3B A;  3HRN A;  3TGU G;  5H2F H;  1U7M A;  1IFP A;  2WTY A;  4WY4 C;  1BGY E;  1QL1 A;  4L73 A;  1J2J B;  1NTZ K;  3M9H A;  4D6T E;  2FYN C;  1P84 H;  4KHX A;  2FYZ A;  2JR8 A;  2Q6Q A;  3HD7 B;  3IF4 A;  2WQY C;  1UIX A;  3H1L J;  2LXC B;  5AW2 B;  1FZF A;  1IK9 A;  2OYH A;  5AVX B;  1OFC X;  3H1L D;  1LWU A;  2WSF J;  2Q7C A;  5APW A;  2A06 G;  1L0N G;  2BCC J;  2AEJ A;  1SP4 A;  3RL0 D;  1T3J A;  1YQ4 C;  4GDO A;  2BCC D;  3Q5P A;  5KJ7 C;  1TU3 F;  5AVZ B;  2RMZ A;  2XNX A;  1NTZ J;  5CJ4 A;  1MZ9 A;  3SWK A;  1EZV E;  1LT9 C;  1NKZ B;  1S1C X;  1NTZ D;  1Y8A A;  2E75 D;  2JWA A;  1X8Y A;  3D6Y A;  1IO4 A;  3V5B A;  3CMA P;  1JUN A;  2WVR A;  1L2P A;  2WT7 A;  1M1J A;  3P8M C;  2QA4 P;  3A5T A;  3CCE P;  3L71 J;  2MJZ A;  1S72 P;  3CXH E;  3CWB J;  1VDF A;  1DEB A;  2YMY A;  1URQ D;  1RE3 C;  3B71 A;  2A45 I;  4ASV A;  1PPJ D;  3CWB D;  5GTH H;  1SQQ E;  5KLV K;  1NTK G;  2D2C C;  1AA0 A;  4PJ0 E;  3CXH H;  3M0D A;  2YXQ B;  2ZFC A;  1KTM A;  1YTZ T;  4H44 B;  2HOD A;  1W2E A;  2K1A A;  1VQ7 P;  3RK2 B;  3VYI A;  5CMZ A;  3HUS A;  1KB9 I;  2Y0D A;  3AE8 C;  2AEF A;  3SWY A;  1GK6 A;  3H1I E;  3T97 A;  2KSE A;  3QH9 A;  3L75 J;  4H0L D;  3AE2 C;  2IZ0 A;  2HPC A;  2L91 A;  1DX7 A;  3L75 D;  4CPG A;  3RK2 C;  1N86 A;  1R8E A;  3CX5 H;  3L4F A;  1G2C B;  2ZT9 D;  1PGP A;  2P58 A;  1SQV E;  3MIW A;  1FC2 C;  2HYN A;  3RK3 C;  4KT0 J;  1DH3 A;  1N7L A;  1JEK A;  5KLI B;  3GHG B;  3V2N A;  5KLV J;  1VF5 C;  1NTM J;  5B5E H;  1EDK A;  1KQF B;  5KLV D;  3O6Q B;  1NTM D;  3KHU A;  5CCG A;  4N78 D;  1W2B O;  1N73 A;  1FS0 E;  1NYH A;  1USE A;  3FWN A;  1FDI A;  1ZN5 A;  2OGU A;  4L75 A;  5E79 E;  1H8A A;  1Z56 A;  2I1K A;  2GA1 A;  1X79 B;  3WUU A;  4R4L A;  1HJ0 A;  3CC4 P;  3WUT A;  1BSN A;  3RGU A;  5AVQ B;  2UWJ E;  4DJG A;  1JOC A;  1YJN P;  3SFE C;  4EYY Q;  4TT3 H;  2FXO A;  1SQX G;  2QM7 A;  4EIJ A;  1KIL A;  2QIW A;  1Q90 D;  5KJ7 D;  1SFC D;  2IBZ G;  1KD1 Q;  3BRT B;  2WSF H;  4PV1 B;  2FYU G;  3GMA A;  2K3R A;  1Q2N A;  3S1K A;  4C46 A;  1JB0 J;  4Y28 J;  1OVU A;  1LWU B;  3VMA A;  3I56 P;  2LXB A;  5TIS E;  5APT A;  2YKP A;  5CBN A;  1LTJ C;  1PP9 E;  1SQB K;  4WY4 A;  3LW5 J;  1S3J A;  1N7S C;  1KMI Z;  3A2A A;  5L8R J;  3LID A;  3EFG A;  3M9Q A;  4B86 A;  2YO2 A;  3H32 B;  3TGU E;  1ZV8 A;  2E76 D;  3HE4 B;  1GL2 D;  1NU1 G;  1T2K D;  2D2C D;  1CI6 A;  1G1I A;  1Q86 Q;  1NO4 A;  1FZB A;  3H1H J;  2IFM A;  3PP5 A;  1E5W A;  3OA7 A;  1NVO A;  1WMK A;  3CLQ A;  5BU8 B;  1KIL E;  2BEZ F;  3H1H D;  2WT7 B;  1M1J B;  2GUS A;  4HH2 A;  2HR3 A;  4U3F J;  1RHZ B;  1Y47 A;  2KIK A;  3VMZ A;  3L72 J;  2BEQ D;  4I2L C;  1KV4 A;  3Q1M A;  1QLE D;  2W6B A;  3HD7 A;  3L72 D;  4C7R A;  1OZH A;  5C39 A;  1SQQ G;  1S9K E;  1OWA A;  3H6P A;  3KZI H;  1JCC A;  1L0N E;  2QVA A;  2AXT H;  1LT9 A;  1JTH B;  4GOF A;  3HTK A;  3CCQ P;  1FDO A;  3T97 B;  1KYO D;  1VF5 D;  1VQP P;  5CCH A;  3V2R A;  1VQ9 P;  2LKM A;  4DZO A;  2BAS A;  1VQN P;  1T8Z A;  1JO5 A;  2HPC B;  1RF1 C;  1X0T A;  1JMM A;  3W68 A;  1AJY A;  5K5G B;  1IFJ A;  3P8C E;  1W5C E;  1RE3 A;  4GOD A;  1J1E C;  2I8D A;  1PIX A;  1NJI Q;  3AE9 C;  2ZYA A;  3RL0 C;  4PD4 H;  3Q5R A;  2QJY B;  3B8E B;  5B66 E;  1S2E A;  1SQQ K;  1NTK E;  2IBZ I;  4Z1M H;  1EXJ A;  1U7J A;  1FZA A;  3CI9 A;  3L36 A;  3VMX A;  4U7J A;  4JF7 A;  2E42 A;  1URQ B;  2E75 C;  1FJK A;  3BAT A;  1L0L J;  3EFF K;  1PGO A;  4N6J A;  4I7Z C;  1QGK B;  3H1K J;  1ZR2 A;  1IZN B;  2W6A A;  4UB8 E;  1L0L D;  3H1L G;  2N9Y B;  1YBK A;  3Q2Y A;  1GZL A;  3H1K D;  1M57 D;  2GM4 A;  4IOI H;  1AFO A;  1LTG C;  1MUU A;  2W6J H;  1N7S D;  1SS1 A;  2N1T D;  2PFX A;  3C8V A;  4QMA A;  3F89 A;  4I1L A;  2C9N Y;  2IX7 C;  1SQV K;  2G8Y A;  2Q3E A;  3MGN A;  2IYP A;  1EZV I;  2Y9Z A;  2M0B A;  5TJH A;  3OJA B;  1M56 D;  3GHG A;  4OH8 B;  1IJD B;  2HG5 D;  4WY4 B;  5H2F E;  2YIU C;  2E74 D;  2R44 A;  3PLN A;  1OX3 A;  3CCJ P;  4H0L C;  1DEE G;  1KN7 A;  1JY2 N;  3VOP A;  3L70 E;  4HYT B;  2O01 J;  2QG4 A;  3JSV C;  2FYN B;  3VTP C;  3CXH I;  3GW6 A;  3L71 G;  3MHV A;  3B5N D;  2J58 A;  2WSS H;  3USS A;  1CI6 B;  3I55 P;  3ITK A;  5M1B A;  1OW6 A;  1NHL A;  3AEG C;  1EXI A;  2ZT9 C;  1P84 E;  2RN0 A;  1IFN A;  4AQR D;  4O9B A;  1UII A;  3RK3 E;  1J1D C;  2QE7 H;  1AQT A;  1SQX E;  1HUC A;  1G1J A;  2OTL P;  3FWL A;  1NAY A;  3D70 A;  2IBZ E;  3TNU A;  1K8A Q;  1NGM B;  1LTJ A;  1ZRT E;  1KZU B;  2FYU E;  4YXD C;  1SQP J;  1M1K Q;  2B88 A;  1WRG A;  5DJU B;  1FE6 A;  1KYO H;  2N9B A;  2WSC J;  2H8P D;  3A0B E;  1R5S A;  3L75 G;  1SQP D;  5CBO A;  2YO3 A;  4YPC A;  3IAO A;  3FXE A;  4DCK A;  3I5C A;  2IPP A;  1LT9 B;  3V4Q A;  2KS1 B;  1ZW0 A;  2WZ7 A;  3A0B H;  1KFN A;  3HTK B;  3V4W A;  2W27 A;  4HKZ H;  4EDF A;  1OVR A;  1LTI C;  3BCC E;  2R32 A;  1BCC J;  1SFC C;  3B4S A;  2W8Z A;  3CCU P;  3H32 A;  1NU1 E;  1CZQ A;  1NTM G;  5AW4 B;  1BCC D;  4RES B;  3HE4 A;  1Q81 Q;  5AVV B;  4RJT A;  2Q9I A;  1VQ5 P;  4WVZ A;  1MV8 A;  2WSE J;  1K05 A;  2KLV A;  1S5L H;  3TDK A;  2JP3 A;  2FFD C;  2D2C B;  1RF0 C;  1HBW A;  2R3C A;  5GTH E;  3JCU H;  1H89 A;  1PGQ A;  2Y0C A;  1KB9 D;  2JO1 A;  1VQK P;  3MUD A;  2E76 C;  2PRR A;  1GL2 C;  3U1C A;  2OTJ P;  1T2K C;  1RF1 A;  1FBM A;  1PP9 D;  1L0N K;  2CPS A;  4C7N A;  5GTI H;  1JY3 O;  4L74 A;  1JTH A;  2WIT A;  3L35 A;  2WPS A;  2KXP B;  5AVY B;  1SLQ A;  2FY8 A;  1BE3 E;  1L4A D;  2B87 A;  1LTT C;  3RK3 B;  1RH5 B;  1ZOY C;  4RO0 A;  3CX5 E;  1CSB A;  3P32 A;  1VF5 B;  2R5D A;  1HVV A;  2KUB A;  1EDL A;  2NPS D;  1N8R Q;  3V2Q A;  5B5E E;  4LC1 A;  1BSH A;  1VQO P;  3AE3 C;  1NAF A;  1JY3 P;  5AW3 B;  3A7O A;  1L0N J;  3CC7 P;  2YMK A;  3PHL A;  1NTK K;  1DIP A;  3M06 A;  3A0H H;  2A06 D;  1L0N D;  1S5L X;  3E7K A;  4U3F G;  3L70 G;  3CD6 P;  1VQM P;  3MZW B;  1URQ A;  2OTK E;  3NXS A;  3L73 J;  3FX0 A;  4OWF A;  5KTB A;  3H1L E;  3P7K A;  3L73 D;  2Z5H A;  1LJ2 A;  2Q5U A;  2C0W A;  4YTP C;  3BAS A;  2GUV A;  4GIF A;  3BVH A;  3P8C D;  3WU2 E;  1FZC C;  1S4X A;  2C9L Y;  3TNU B;  2QJP C;  1OMI A;  3KDP B;  2ZJS E;  1LTJ B;  2PGD A;  1VPC A;  1N7S B;  1HGZ A;  4TLF A;  4R4M A;  1LP1 B;  3U59 A;  2KOG A;  4N3Y B;  3WU2 H;  1T6A A;  2R5B A;  4LLH A;  2O1J A;  1GW4 A;  1IFD A;  1YJW P;  2JWD A;  1NTK J;  5APQ A;  1FJP A;  1LT1 A;  1FOS F;  1JCD A;  1AV1 A;  4PD4 I;  1VQ4 P;  3TK1 A;  1NTK D;  2AEM A;  1LTA C;  1E79 H;  2IDB A;  3H1J G;  3QWO C;  3VP8 A;  2A45 H;  4L76 A;  1QVF O;  3L37 A;  2Q1K A;  1RE4 C;  2N1T C;  1PZQ A;  3L71 E;  1PPJ E;  3BCC G;  4Y99 C;  2E5Y A;  2K37 A;  2CPB A;  5CHX A;  4OVN F;  1KB9 H;  2KZI A;  4NPD A;  2V7Q J;  4BXL A;  3KYQ A;  2FXM A;  1SQX K;  1YTZ I;  2OYH C;  3AE4 C;  1L0L G;  1EDI A;  5CJ0 A;  3SWF A;  4IL6 H;  1QVG O;  4H13 C;  1KQL A;  2E74 C;  1X9V A;  3H1K G;  4A7P A;  1KQG B;  2FKW B;  2FYU K;  5KKZ C;  2NRG A;  3KZI E;  3L74 G;  3L75 E;  2AXT E; 
#chains in the Genus database with same CATH homology
 1PV3 A;  1VF5 D;  3C8V A;  1TU3 F;  3IAO A;  1R8E A;  1OW8 A;  1ZME C;  4OGQ D;  2ZT9 D;  1PL5 A;  1K04 A;  1YQ3 C;  1ZOY C;  4R4M A;  2G3A A;  3LW5 J;  4XFJ A;  2G8Y A;  3O6Q A;  1KMI Z;  3AEC C;  3D71 A;  1AJY A;  4KT0 J;  1S1C X;  2NZ2 A;  2E75 D;  5L8R J;  1VF5 B;  1VL2 A;  2QSI A;  1Y9B A;  3AEB C;  3GF7 A;  3ABV C;  4H44 D;  1ZP0 C;  1VF5 C;  1MKM A;  4IL6 X;  4OGQ B;  2FXP A;  5KLI C;  3D6Y A;  2E76 D;  1IK7 A;  4OGQ C;  1KQF B;  2WPV B;  4H0L B;  2YIU C;  1RQV A;  2E74 D;  2IDB A;  1PIX A;  2D2C D;  3AE9 C;  1OW7 A;  4H0L C;  3AEE C;  3AE3 C;  3D6Z A;  1DD3 A;  3GF3 A;  2O01 J;  1NYH A;  1FDI A;  2WSE J;  3S9O A;  3Q5R A;  1K05 A;  1HF9 A;  2H88 C;  2OQQ A;  3B71 A;  2JP3 A;  2FYN C;  1WMK A;  1KIL E;  2BEZ F;  2QJY C;  2D2C B;  2ZT9 B;  3IN6 A;  3AEF C;  3G9R A;  2YMK A;  3GLM A;  5M1B A;  1OW6 A;  4Z1M H;  2D2C C;  3AEG C;  3H25 A;  4R4L A;  1EXJ A;  2ZT9 C;  1EXI A;  2FBW C;  1HJ0 A;  2H89 C;  1DIP A;  4H13 D;  2E75 B;  1GMJ A;  3AED C;  3AE7 C;  2BEQ D;  4U7J A;  2V7Q J;  1KTM A;  1S5L X;  3RK3 E;  4H44 B;  2E75 C;  3Q1M A;  4I7Z B;  3Q3D A;  3SFE C;  2WQY C;  4PV1 D;  3SFD C;  2JO1 A;  1UIX A;  3AE5 C;  4H44 C;  3RL0 g;  2E76 B;  1RQU A;  4I7Z C;  4TT3 H;  3AE8 C;  3R4Y A;  2E76 C;  3AE4 C;  2QIW A;  2E74 B;  1Q90 D;  4H13 B;  3AEA C;  2K9Y A;  3D70 A;  1NGM B;  2J5U A;  2WSF J;  2E74 C;  3AE1 C;  4H13 C;  3Q2Y A;  2QJK C;  1ZRT E;  4PV1 B;  4YTP C;  4RKU J;  1KQG B;  3AE6 C;  3FGA D;  4YXD C;  4H0L D;  5KKZ C;  3AE2 C;  3EWK A;  3GMA A;  4PV1 C;  3Q5S A;  1DD4 A;  2WSC J;  2MKV A;  1JB0 J;  4Y28 J;  1U57 A;  1FDO A;  1YQ4 C;  4GDO A;  2P10 A;  3T97 B;  2QJP C;  1OMI A;  3Q5P A;  1KOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...