1USDA

Human vasp tetramerisation domain l352m
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
41
structure length
41
Chain Sequence
SSDYSDLQRVKQELMEEVKKELQKVKEEIIEAFVQELRKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords VASODILATOR-STIMULATED PHOSPHOPROTEIN
publication title The Vasp Tetramerization Domain is a Right-Handed Coiled Coil Based on a 15-Residue Repeat
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08776 VASP_tetra VASP tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1160 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Vasodilator-stimulated phosphoprotein 1usdA00
1USEA 3SWKA 4YPCA 1USDA 3S4RA 3SSUA 3MUDC 3QH9A
chains in the Genus database with same CATH superfamily
2E75B 3RK2B 2CK3H 4EIJA 1OX3A 1E79H 5TISH 4H0LC 1YIJP 1R5LA 3A0HE 1L0ND 5TISE 2MKVA 2XNDH 3A3YB 4EYYQ 1EXJA 1VQ9P 2W83C 1NTKK 1MFTA 2B88A 1FZAA 1WMKA 1NAFA 4D6TD 1N7SD 3LW5H 3GW6A 3B5ND 3U59A 3WUUA 1U57A 2OYIC 1HF9A 3QH9A 1DD3A 1NGMB 2IBZE 2V7QJ 3E1IA 1BDCA 1HUCA 2AEFA 4PD4I 5DJUB 1R8EA 3HUSB 5APWA 1NAYA 1SQPJ 2RN0A 3L71G 2QJKC 2POHA 3AE6C 2Q6QA 2XKMA 3I56P 3A5TA 3AE4C 1JY2O 3VN0A 1J1EB 1L0LE 3CC2P 1KD1Q 1BSHA 1GW4A 3IN6A 3AE5C 3CLQA 5BVZA 2Q5UA 1EZVG 3TDKA 5B66H 1N73C 5AW5B 1DEEG 2SPZA 3CCUP 1Y9BA 2OYIA 3CMEP 5B66E 1SQPK 2K9JA 4L74A 2P58A 2Y0CA 2O3JA 4I7ZB 2H43A 1LP1A 1RY3A 2LXBA 4QMAA 4K3AA 2LKMA 3Q5PA 2QIWA 3IR9A 2R3SA 3OJAB 4OGQC 1UIXA 2HR3A 3HE4B 1AV1A 2E76D 1VQ8P 4JYBA 2KUBA 3CWBG 3MP7B 1OIPA 3PRJA 1M7LA 2JDIH 5CCGC 1CSBA 1SQQE 3OAKA 4U7JA 5B5EH 1SQVG 3AEAC 1DX7A 1N73A 4U3FE 1OVUA 2PP6A 1H89A 1NTME 2OARA 3R4YA 1BE3D 2Y0DA 5B5EE 1T2KC 1VQ7P 1LTJA 3A7OA 2A45G 2WT7B 1N7LA 1YQ4C 1Z56A 3Q5SA 2E43A 1L0NE 1YJ9P 3BRVB 3L74G 1JTHA 5KLIB 4I6MC 5KLVG 4PV1B 2K9YA 1GL2D 5GTIH 3L72D 1KILB 2FKWB 5AVUB 3GHGB 1NU1D 3II6A 1YJWP 4KT0J 1GU5A 4GODA 5CCGA 3L70D 5GTIE 3B71A 2R5DA 4XFJA 2ZAEB 1QEXA 2ZT9B 3EFFK 1MFZA 2P1JA 4Y28J 5M1BA 3HE5A 3AECC 1R5SA 2IX7C 3ITKA 2Q7CA 2QA4P 4R4LA 1VF5B 1BCCE 2CPSA 1N86A 1SQVJ 3RK3E 4L75A 3L4FA 4C7NB 3BCCG 4H44C 1NKZB 3AEFC 2I1JA 2QSIA 5DJTB 3OA7A 3CCVP 3PP5A 1L0LK 2FYNC 4JBZA 1S9KD 5KKZB 3H1KD 3AE9C 2W6AA 2J58A 2B9BA 1ZOYC 2P10A 1RH5B 2OYHC 4JYCA 2E74D 3OW2O 2FYUG 1G2CA 2HFED 1XTCC 3D71A 3L75J 3H1IE 2YNYA 3SSUA 1ZR4A 2B87A 1VQ4P 1PGOA 4U3FJ 1EXIA 4I1LA 4WY4A 1NO4A 2GM4A 1FZBA 3CC7P 1AVOA 1S3JA 3TK1A 3V4QA 4Y99B 3WUTA 2K37A 5CJ0A 5H2FH 1W2BO 3HD7B 5KJ7A 3BCCJ 1SQQK 1LWUB 1AFOA 2KYVA 2IFNA 3UIAA 3O6QA 2A06G 3U1AA 1JNMA 3P7KA 4PD4E 1NTMK 1L4AA 5APUA 5AVSB 3Q1MA 4EOTA 2GUSA 2I8DA 1NVOA 5AW9B 2P7JA 1KQSO 2KOGA 2PGDA 2ZXXA 1L0NK 2QE7H 2NPSA 5AW7B 1BCCJ 3AE3C 4GT1A 1S5LX 3L72E 4AUWA 3F89A 3MGNA 1N7SC 3CX5I 1NU1E 2HPCA 3B5NC 1GZLA 4GIFA 1U7JA 3L71D 2H89C 1SQBE 5KTBA 5L8RJ 2KI7B 2YMKA 2WPVB 1RF1C 1KB9I 2QVAA 1XTGB 2WSCJ 3C1LA 4W7ZA 3C8VA 1JEKA 4IL6X 5AVXB 2FYZA 1EZVD 1ZN5A 3RL0B 2HODA 1IK7A 1BGYG 2WSEH 3GMAA 2M5AA 2XNXA 4N78D 1SVFA 3JCUH 2L91A 1LTSC 3H1IJ 2Q3IA 1SFCD 3P8MC 1PGQA 3JCUE 4L76A 1NTZE 1KQFB 1S5LH 1N7SA 2ZXEB 3MUDC 2Y0EA 4ZKUA 1GK4A 2C9LY 5AW3B 1GD2E 3KDPB 1KFMA 1NKNA 1S5LE 4XE5B 1RF1A 2K9JB 2E5TA 3CWBD 1LP1B 3GG2A 1VQLP 1A02J 3H6PA 4ZKPA 2AEMA 1PPJD 4WB4A 2KIKA 1VPCA 1SQVD 2QJKB 2R5BA 4YPCA 2QG4A 3PHLA 1HVVA 2M8RA 2M3BA 2QJYC 1J1DB 2WQYC 2E76C 1RE4C 2FXMA 1FC2C 1M57D 1PFIA 4GOEA 1PP9G 1NTKJ 2BCCE 5AW2B 1SQPG 2C0WA 3L74D 5APXA 1Q86Q 3PLNA 1VQNP 5KLVD 1T6AA 1LGHB 2OQQA 1LTJB 1QX8A 2IDBA 1SQBJ 3R2PA 2KK7A 4KHXA 3MZWB 2J5UA 2Q3EA 5EFWB 4OGQB 2WPSA 1JTHB 2YXQB 3G4SP 4BRYA 4HJGH 3TSIA 1GL2C 4Z1MH 1RE4A 1AQTA 2KSEA 1Q7YQ 3BRTB 3VMAA 4GDOA 3JSVC 3GF7A 2HG5D 1QGKB 3B4SA 5KAFH 2QEXP 1CI6A 2FXPA 1NU1K 3H1HE 1OW8A 3BCCD 3U1CA 2G8YA 1T3JA 1ZXGA 3HE5B 1SQBK 5KAFE 1URQD 1RQVA 5CMZA 4L73A 3E1RA 1AVYA 1PP9J 1KV4A 1L2PA 2W90A 3CXHI 2WMMA 3CCRP 5AVWB 4YTPC 3AEDC 1UIIA 2Z4EA 2JWAA 4AQRD 1HGZA 2FYUD 1MV8A 1ZV8A 2JEEA 3HTKA 2AXTH 1YYCA 3L73E 1USEA 3H1LE 3M91A 1KQGB 3EWKA 1NTZK 2AXTE 2R3CA 2IBZG 3I5CA 3IF4A 3M0DC 2Z5HA 2E74C 2YIUC 2D2CD 2JWDA 2BCCJ 1MZ9A 2KSJA 2B87B 1PPJE 3LIEA 2CPBA 1W2EA 4WY4B 1KORA 3CX5H 4H44B 3LIDA 1YQ3C 3L37A 3TNUA 2A06D 3H1JE 3CX5E 2WZ7A 2KP8A 1KB9H 2JP3A 1A02F 1LNQA 1LJ2A 4I2LC 3D6YA 1X22A 1FE6A 2XDJA 5AVVB 1KB9E 3A2AA 1JCCA 3Q2YA 1X79B 2N1TD 3TGUD 2O1KA 3AE2C 3O6QB 3NTNA 3B8EB 3M0DA 1H0TA 1L4AB 3CPWO 1K04A 3CXHD 3FXEA 3H1HJ 2JKVA 2QJPB 3SWKA 3LW5J 1JOCA 1MUUA 4IFFA 3IAOA 3BASA 5AW8B 4JF7A 3D6ZA 3BATA 3CD6P 2NPSB 3KXDA 3RL0D 5BU5A 4IFDK 3V6IA 2XV5A 4D6TE 4HYTB 1RQUA 3L75G 4LGDE 3V2NA 1SQXD 1BGYD 4DJGA 4RKUJ 2KLUA 1IO4A 4U3FG 1DD4A 1L0LJ 1FZCC 2WWWA 1K73Q 1NTMG 1QL1A 2UWJE 2XZRA 4BWNA 3L73J 1KQLA 2J59M 2ZYDA 3CCMP 2Y9ZA 1RF0C 1P84I 2HODB 3CCSP 4NPEA 5C39A 1L0NG 3H25A 2K3RA 3VP8A 3VOPA 1KTMA 1JY2P 2YKPA 4YXDC 1FOSE 2IYPA 4I7ZC 3I55P 2FYUE 4UB8H 4B86A 4OWFA 4KJMA 1SFCC 2KZIA 1IFJA 1MKMA 1QLED 4UB8E 3CCQP 1FZGA 1FZCA 1RF1B 2R44A 3M9QA 2BEQD 4LC1A 1NH4A 2H8PD 1SQQJ 5AW6B 3SWYA 1BCCG 4N3YB 1PP9D 1VQMP 4WWIA 1RF0A 1SQPD 1EZVI 2AXCA 2E75D 3RK2D 1NTMJ 1YI2P 3RK3B 3N4XA 1H88A 1RE3C 2WITA 1N8RQ 1CW5A 4HKZH 1L0NJ 4WVZA 1SFCA 1M8OB 4H13B 5CCHD 1OVVA 5CHXA 1OWAA 2O01N 3HE4A 2H88C 3CXHH 3TGUE 1EQ7A 4D6TJ 1G1IA 5H2FE 4AYCA 3GHGC 1BE3E 1X8YA 4TLFA 2OYHA 2KS1A 3MD0A 1VQKP 1G1JA 1P84D 2B89A 3AEGC 3H1IG 1VL2A 3CXHE 3KPEA 5KLVK 3P8CD 4O9BA 3KQGA 2ITAA 5CBNA 2WSFH 5APTA 3VMXA 1RHZB 3PJSK 4BRYB 1S4XA 2QJYB 2YKOA 2E76B 4TT3H 1RE3A 1CZQA 1GDTA 2ZYAA 1CI6B 2ZFCA 1SQXE 3GLMA 2A45I 3L70E 1JY3O 1VQOP 2ZVOB 3EQ2A 4W7YA 1LT1A 5AW0B 2KXPB 1N2DC 5AW1B 4HB1A 4NPFX 4RJTA 1URQC 3KYQA 4DOJA 2WVRA 1HTLC 1ZP0C 4H0LB 4EI2A 1T3UA 3ABVC 1ZR2A 1JCDA 1NTKG 2IBZD 4K35A 1USDA 1T8ZA 2C0XA 2IYOA 3HTKB 4WY4D 1WT6A 1IFIA 1QVFO 5GTHH 1LTAC 2FYUK 1S9KE 2FFDC 4H44D 3H1KE 1LT9C 1SQBG 1K05A 2IPPA 4IOIH 2WSSH 2V7QH 1JO5A 3B5NA 1NHLA 5GTHE 2OYIB 2OGUA 3M9BA 5KJ7D 2HYNA 3FGAD 1TU3F 2D2CC 2OYOA 3MHVA 1YTZT 2VRSA 2Q9IA 1ZLLA 1URQA 2E42A 1X9VA 1YJNP 3GF3A 1BE3J 1L4AD 1S72P 1EDKA 3TNUB 4JPZB 1FZFA 2K88A 1PV3A 3VYIA 3A0BH 1NTZG 1GW3A 2HLOA 2YO3A 3M06A 4C46A 2NPSD 3CL3D 2FFDA 1LT9A 1Y8AA 1P84H 4GOFA 4PV1D 3G6EP 3MUDA 1LTIC 2P2UA 1N73B 3VTPC 3L72J 1KILD 2N1TC 1H0TB 1NU1J 1P84E 2YIUB 2OTLP 1WRGA 2K1AA 2ZT9D 2YO2A 3L35A 3L75D 4GKGA 1M1JC 5APSA 2Z5IA 3RL0g 4U3FD 3A0HH 2E5YA 1NTMD 2ZJSE 4DZOA 1LTTC 1VF5D 2KNCA 1FU1A 3RL0C 1VQ6P 5AVQB 3SFEC 2WPRA 2BCCG 3WU2H 1JY3P 1YITP 2O01H 5KAIH 2PAJA 1H8AA 3L71E 3HRNA 3NXSA 4WBAA 2WSEJ 1SQXK 2IZ1A 3WU2E 3S1KA 3K5BA 5KAIE 1Q90D 2L5GB 3H1KJ 2N1TA 4XA4A 1NTZJ 2W27A 1EZVE 1JMMA 1FOSF 3Q3DA 1M1JA 2W6JH 3N7NA 4N78E 1JMBA 5K5GB 2KLVA 5TJHA 3RBZA 2JO1A 1S2EA 3W68A 3H32A 1JY2N 1OW7A 3E7KA 1OW6A 1BCCD 3RK3D 1GL2A 3H1HG 1U7MA 4JQ0D 1IK9A 1J1DC 1EDJA 4RO0A 2RMZA 1FZCB 1FAVA 3S4RA 2BEZF 2YKQA 4H13D 1G2CB 3CWBE 3HD7D 5APQA 2IFMA 1IZNB 3G71P 2ZYGA 2KB7P 1SQVE 1HGVA 2E75C 3RK2C 1LTJC 2PRRA 1L0LG 2A45H 4IFMA 1FDOA 1IFNA 4ZNCA 1FZEA 1KFNA 3H1ID 3L73G 3H1LG 1SFCB 4OVNF 2FYNB 3CC4P 3TF5A 1OMIA 1VQPP 1M90Q 5CCHC 3L74E 1KILE 1E5WA 5BU8B 2OYHB 2KS1B 5KLVE 1PPJG 1FDIA 3L71J 1NWQA 3T97A 3L75E 2RH0A 5APVA 3PTZA 1VQ5P 3NFQA 2GA1A 1PGJA 2O01J 3AE7C 4ASWA 2P67A 4BXLA 2OTJP 2BASA 1PIXA 3H1JG 4PD4D 4H0LD 5APYA 1FJPA 1KYOI 3WMM0 1K9MQ 3HUSC 1SQQG 1Y47A 4OH8B 2QM7A 2HPCB 4YXWH 4W80A 3USSA 3AEBC 1KZUB 1NTKD 3AEEC 1J1EC 2G3AA 3BCCE 3Q5RA 4CPGA 1IC2A 5CCHA 2IZ0A 3M0AA 3CI9A 2MJZA 1GMJA 3H1LJ 3FWLA 3AE8C 1SQBD 3CCLP 1OZHA 3PH0A 4DT0A 1M1KQ 2KZJA 2M5AB 3IFMA 3CWBJ 1HH0A 4NPDA 3FXDA 2N9YB 4D6TG 3VP9A 1JUNA 1NOHA 3C9IA 4EDFA 4WY4C 4RESB 2LXCB 3HUSA 5AW4B 1N7SB 3M9HA 1ZRTD 1PGPA 3B5NB 4DCKA 2WSCH 2I1KA 3AE1C 2WPQA 3H1JJ 3VMZA 1EC5A 1S1CX 1NTZD 5KJ7C 1ZW0A 2N9BA 3RBXA 1URQB 1YTZI 4UB6H 3L74J 2FY8A 1EDIA 2YMYA 1M56D 4C7RA 2AEJA 5KLVJ 1KYOD 1L4AC 4UB6E 1SQVK 4M3LA 5AVTB 4LLHA 2IBZI 2QJPC 2A06E 3VMYA 3RGUA 3FX0A 1GK6A 2QRXA 3MIWA 1FS0E 4OGQD 1OVRA 2FFDB 1LT9B 1DH3A 2H7HA 1BDDA 2M0BA 2NPSC 3EFGA 1DEBA 3S9OA 1X0TA 1IJDB 5KLIC 4ZMDA 4PV1C 4ASVA 1J2JB 1KILC 4PJ0H 5CCGD 3W67A 3SWFA 2R32A 3O8ZA 1NYHA 2BCCD 2D2CB 2Y9YA 2ZT9C 2WTYA 3KZIH 4HH2A 4PD4H 4PJ0E 1IFPA 1JM0A 3FWNA 2LR2A 1QL2A 1T2KD 1JB0J 3KZIE 2KNCB 1VF5C 3G3ZA 5AVRB 2WT7A 1AJYA 3WUVA 3V2RA 1PZQA 4R4MA 1AA0A 1LTBC 1GU4A 1NTKE 1BGYE 3TGUG 2NRGA 1HJBA 1JY3N 1KN7A 2FYUJ 3JC22 1BE3G 1LTGC 1SS1A 2QM8A 2N1TB 3BVHA 5KKZC 5CJ4A 1KILA 1FDMA 3F5HA 3GHGA 2Q1KA 3H1HD 1AQ5A 2DW3A 1PL5A 3G9RA 3D70A 1M1JB 3P32A 2GUVA 1HWTC 1EDLA 2W8ZA 1NJIQ 3H32B 3L72G 3CCEP 2XU6A 3CMAP 2O1JA 1KC8Q 2C9NY 1W5CE 1NU1G 2FBWC 1D7MA 1SQXG 1GL2B 3L70G 1FJKA 5AVZB 3RK3C 1ZRTE 4C7NA 1L0LD 4MN4C 1BSNA 1OFCX 1KMIZ 1GTWA 4Y99C 4A7PA 3V2PA 2PFXA 1VDFA 4H13C 3L73D 3H1LD 2NZ2A 3HD7C 1Q2NA 3SFDC 2M3EA 1KYOH 1LWUC 1PP9E 1K8AQ 3TGUJ 1ZMEC 2FXOA 1SLQA 1SQPE 1YHQP 3MTUE 3V4WA 1KYOE 3CCJP 2RKLA 1QVGO 5E79H 3H1KG 3KHUA 5AVYB 1FBMA 1IFDA 1IFMA 1SP4A 4N6JA 4IL6H 2V4HA 1HBWA 1Q82Q 3V2QA 5E79E 3A0BE 2JR8A 2WSFJ 2OTKE 1DIPA 3V5BA 1YBKA 5CBOA 3H1JD 3CX5D 1HJ0A 4IL6E 1OXZA 3QWOC 2W6BA 3TYYA 1Q81Q 3NMDA 3ZDMA 2E74B 1SQQD 1SQXJ 1BGYJ 3T97B 3L70J 3P8CE 2YXRB 3HD7A 1KB9D 1LWUA 2ZVNB 2JJLA 3L36A
chains in the Genus database with same CATH topology
1USEA 3SWKA 4YPCA 1USDA 3S4RA 3SSUA 3MUDC 3QH9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USE A;  3SWK A;  4YPC A;  1USD A;  3S4R A;  3SSU A;  3MUD C;  3QH9 A; 
#chains in the Genus database with same CATH topology
 2E75 B;  3RK2 B;  2CK3 H;  4EIJ A;  1OX3 A;  1E79 H;  5TIS H;  4H0L C;  1YIJ P;  1R5L A;  3A0H E;  1L0N D;  5TIS E;  2MKV A;  2XND H;  3A3Y B;  4EYY Q;  1EXJ A;  1VQ9 P;  2W83 C;  1NTK K;  1MFT A;  2B88 A;  1FZA A;  1WMK A;  1NAF A;  4D6T D;  1N7S D;  3LW5 H;  3GW6 A;  3B5N D;  3U59 A;  3WUU A;  1U57 A;  2OYI C;  1HF9 A;  3QH9 A;  1DD3 A;  1NGM B;  2IBZ E;  2V7Q J;  3E1I A;  1BDC A;  1HUC A;  2AEF A;  4PD4 I;  5DJU B;  1R8E A;  3HUS B;  5APW A;  1NAY A;  1SQP J;  2RN0 A;  3L71 G;  2QJK C;  2POH A;  3AE6 C;  2Q6Q A;  2XKM A;  3I56 P;  3A5T A;  3AE4 C;  1JY2 O;  3VN0 A;  1J1E B;  1L0L E;  3CC2 P;  1KD1 Q;  1BSH A;  1GW4 A;  3IN6 A;  3AE5 C;  3CLQ A;  5BVZ A;  2Q5U A;  1EZV G;  3TDK A;  5B66 H;  1N73 C;  5AW5 B;  1DEE G;  2SPZ A;  3CCU P;  1Y9B A;  2OYI A;  3CME P;  5B66 E;  1SQP K;  2K9J A;  4L74 A;  2P58 A;  2Y0C A;  2O3J A;  4I7Z B;  2H43 A;  1LP1 A;  1RY3 A;  2LXB A;  4QMA A;  4K3A A;  2LKM A;  3Q5P A;  2QIW A;  3IR9 A;  2R3S A;  3OJA B;  4OGQ C;  1UIX A;  2HR3 A;  3HE4 B;  1AV1 A;  2E76 D;  1VQ8 P;  4JYB A;  2KUB A;  3CWB G;  3MP7 B;  1OIP A;  3PRJ A;  1M7L A;  2JDI H;  5CCG C;  1CSB A;  1SQQ E;  3OAK A;  4U7J A;  5B5E H;  1SQV G;  3AEA C;  1DX7 A;  1N73 A;  4U3F E;  1OVU A;  2PP6 A;  1H89 A;  1NTM E;  2OAR A;  3R4Y A;  1BE3 D;  2Y0D A;  5B5E E;  1T2K C;  1VQ7 P;  1LTJ A;  3A7O A;  2A45 G;  2WT7 B;  1N7L A;  1YQ4 C;  1Z56 A;  3Q5S A;  2E43 A;  1L0N E;  1YJ9 P;  3BRV B;  3L74 G;  1JTH A;  5KLI B;  4I6M C;  5KLV G;  4PV1 B;  2K9Y A;  1GL2 D;  5GTI H;  3L72 D;  1KIL B;  2FKW B;  5AVU B;  3GHG B;  1NU1 D;  3II6 A;  1YJW P;  4KT0 J;  1GU5 A;  4GOD A;  5CCG A;  3L70 D;  5GTI E;  3B71 A;  2R5D A;  4XFJ A;  2ZAE B;  1QEX A;  2ZT9 B;  3EFF K;  1MFZ A;  2P1J A;  4Y28 J;  5M1B A;  3HE5 A;  3AEC C;  1R5S A;  2IX7 C;  3ITK A;  2Q7C A;  2QA4 P;  4R4L A;  1VF5 B;  1BCC E;  2CPS A;  1N86 A;  1SQV J;  3RK3 E;  4L75 A;  3L4F A;  4C7N B;  3BCC G;  4H44 C;  1NKZ B;  3AEF C;  2I1J A;  2QSI A;  5DJT B;  3OA7 A;  3CCV P;  3PP5 A;  1L0L K;  2FYN C;  4JBZ A;  1S9K D;  5KKZ B;  3H1K D;  3AE9 C;  2W6A A;  2J58 A;  2B9B A;  1ZOY C;  2P10 A;  1RH5 B;  2OYH C;  4JYC A;  2E74 D;  3OW2 O;  2FYU G;  1G2C A;  2HFE D;  1XTC C;  3D71 A;  3L75 J;  3H1I E;  2YNY A;  3SSU A;  1ZR4 A;  2B87 A;  1VQ4 P;  1PGO A;  4U3F J;  1EXI A;  4I1L A;  4WY4 A;  1NO4 A;  2GM4 A;  1FZB A;  3CC7 P;  1AVO A;  1S3J A;  3TK1 A;  3V4Q A;  4Y99 B;  3WUT A;  2K37 A;  5CJ0 A;  5H2F H;  1W2B O;  3HD7 B;  5KJ7 A;  3BCC J;  1SQQ K;  1LWU B;  1AFO A;  2KYV A;  2IFN A;  3UIA A;  3O6Q A;  2A06 G;  3U1A A;  1JNM A;  3P7K A;  4PD4 E;  1NTM K;  1L4A A;  5APU A;  5AVS B;  3Q1M A;  4EOT A;  2GUS A;  2I8D A;  1NVO A;  5AW9 B;  2P7J A;  1KQS O;  2KOG A;  2PGD A;  2ZXX A;  1L0N K;  2QE7 H;  2NPS A;  5AW7 B;  1BCC J;  3AE3 C;  4GT1 A;  1S5L X;  3L72 E;  4AUW A;  3F89 A;  3MGN A;  1N7S C;  3CX5 I;  1NU1 E;  2HPC A;  3B5N C;  1GZL A;  4GIF A;  1U7J A;  3L71 D;  2H89 C;  1SQB E;  5KTB A;  5L8R J;  2KI7 B;  2YMK A;  2WPV B;  1RF1 C;  1KB9 I;  2QVA A;  1XTG B;  2WSC J;  3C1L A;  4W7Z A;  3C8V A;  1JEK A;  4IL6 X;  5AVX B;  2FYZ A;  1EZV D;  1ZN5 A;  3RL0 B;  2HOD A;  1IK7 A;  1BGY G;  2WSE H;  3GMA A;  2M5A A;  2XNX A;  4N78 D;  1SVF A;  3JCU H;  2L91 A;  1LTS C;  3H1I J;  2Q3I A;  1SFC D;  3P8M C;  1PGQ A;  3JCU E;  4L76 A;  1NTZ E;  1KQF B;  1S5L H;  1N7S A;  2ZXE B;  3MUD C;  2Y0E A;  4ZKU A;  1GK4 A;  2C9L Y;  5AW3 B;  1GD2 E;  3KDP B;  1KFM A;  1NKN A;  1S5L E;  4XE5 B;  1RF1 A;  2K9J B;  2E5T A;  3CWB D;  1LP1 B;  3GG2 A;  1VQL P;  1A02 J;  3H6P A;  4ZKP A;  2AEM A;  1PPJ D;  4WB4 A;  2KIK A;  1VPC A;  1SQV D;  2QJK B;  2R5B A;  4YPC A;  2QG4 A;  3PHL A;  1HVV A;  2M8R A;  2M3B A;  2QJY C;  1J1D B;  2WQY C;  2E76 C;  1RE4 C;  2FXM A;  1FC2 C;  1M57 D;  1PFI A;  4GOE A;  1PP9 G;  1NTK J;  2BCC E;  5AW2 B;  1SQP G;  2C0W A;  3L74 D;  5APX A;  1Q86 Q;  3PLN A;  1VQN P;  5KLV D;  1T6A A;  1LGH B;  2OQQ A;  1LTJ B;  1QX8 A;  2IDB A;  1SQB J;  3R2P A;  2KK7 A;  4KHX A;  3MZW B;  2J5U A;  2Q3E A;  5EFW B;  4OGQ B;  2WPS A;  1JTH B;  2YXQ B;  3G4S P;  4BRY A;  4HJG H;  3TSI A;  1GL2 C;  4Z1M H;  1RE4 A;  1AQT A;  2KSE A;  1Q7Y Q;  3BRT B;  3VMA A;  4GDO A;  3JSV C;  3GF7 A;  2HG5 D;  1QGK B;  3B4S A;  5KAF H;  2QEX P;  1CI6 A;  2FXP A;  1NU1 K;  3H1H E;  1OW8 A;  3BCC D;  3U1C A;  2G8Y A;  1T3J A;  1ZXG A;  3HE5 B;  1SQB K;  5KAF E;  1URQ D;  1RQV A;  5CMZ A;  4L73 A;  3E1R A;  1AVY A;  1PP9 J;  1KV4 A;  1L2P A;  2W90 A;  3CXH I;  2WMM A;  3CCR P;  5AVW B;  4YTP C;  3AED C;  1UII A;  2Z4E A;  2JWA A;  4AQR D;  1HGZ A;  2FYU D;  1MV8 A;  1ZV8 A;  2JEE A;  3HTK A;  2AXT H;  1YYC A;  3L73 E;  1USE A;  3H1L E;  3M91 A;  1KQG B;  3EWK A;  1NTZ K;  2AXT E;  2R3C A;  2IBZ G;  3I5C A;  3IF4 A;  3M0D C;  2Z5H A;  2E74 C;  2YIU C;  2D2C D;  2JWD A;  2BCC J;  1MZ9 A;  2KSJ A;  2B87 B;  1PPJ E;  3LIE A;  2CPB A;  1W2E A;  4WY4 B;  1KOR A;  3CX5 H;  4H44 B;  3LID A;  1YQ3 C;  3L37 A;  3TNU A;  2A06 D;  3H1J E;  3CX5 E;  2WZ7 A;  2KP8 A;  1KB9 H;  2JP3 A;  1A02 F;  1LNQ A;  1LJ2 A;  4I2L C;  3D6Y A;  1X22 A;  1FE6 A;  2XDJ A;  5AVV B;  1KB9 E;  3A2A A;  1JCC A;  3Q2Y A;  1X79 B;  2N1T D;  3TGU D;  2O1K A;  3AE2 C;  3O6Q B;  3NTN A;  3B8E B;  3M0D A;  1H0T A;  1L4A B;  3CPW O;  1K04 A;  3CXH D;  3FXE A;  3H1H J;  2JKV A;  2QJP B;  3SWK A;  3LW5 J;  1JOC A;  1MUU A;  4IFF A;  3IAO A;  3BAS A;  5AW8 B;  4JF7 A;  3D6Z A;  3BAT A;  3CD6 P;  2NPS B;  3KXD A;  3RL0 D;  5BU5 A;  4IFD K;  3V6I A;  2XV5 A;  4D6T E;  4HYT B;  1RQU A;  3L75 G;  4LGD E;  3V2N A;  1SQX D;  1BGY D;  4DJG A;  4RKU J;  2KLU A;  1IO4 A;  4U3F G;  1DD4 A;  1L0L J;  1FZC C;  2WWW A;  1K73 Q;  1NTM G;  1QL1 A;  2UWJ E;  2XZR A;  4BWN A;  3L73 J;  1KQL A;  2J59 M;  2ZYD A;  3CCM P;  2Y9Z A;  1RF0 C;  1P84 I;  2HOD B;  3CCS P;  4NPE A;  5C39 A;  1L0N G;  3H25 A;  2K3R A;  3VP8 A;  3VOP A;  1KTM A;  1JY2 P;  2YKP A;  4YXD C;  1FOS E;  2IYP A;  4I7Z C;  3I55 P;  2FYU E;  4UB8 H;  4B86 A;  4OWF A;  4KJM A;  1SFC C;  2KZI A;  1IFJ A;  1MKM A;  1QLE D;  4UB8 E;  3CCQ P;  1FZG A;  1FZC A;  1RF1 B;  2R44 A;  3M9Q A;  2BEQ D;  4LC1 A;  1NH4 A;  2H8P D;  1SQQ J;  5AW6 B;  3SWY A;  1BCC G;  4N3Y B;  1PP9 D;  1VQM P;  4WWI A;  1RF0 A;  1SQP D;  1EZV I;  2AXC A;  2E75 D;  3RK2 D;  1NTM J;  1YI2 P;  3RK3 B;  3N4X A;  1H88 A;  1RE3 C;  2WIT A;  1N8R Q;  1CW5 A;  4HKZ H;  1L0N J;  4WVZ A;  1SFC A;  1M8O B;  4H13 B;  5CCH D;  1OVV A;  5CHX A;  1OWA A;  2O01 N;  3HE4 A;  2H88 C;  3CXH H;  3TGU E;  1EQ7 A;  4D6T J;  1G1I A;  5H2F E;  4AYC A;  3GHG C;  1BE3 E;  1X8Y A;  4TLF A;  2OYH A;  2KS1 A;  3MD0 A;  1VQK P;  1G1J A;  1P84 D;  2B89 A;  3AEG C;  3H1I G;  1VL2 A;  3CXH E;  3KPE A;  5KLV K;  3P8C D;  4O9B A;  3KQG A;  2ITA A;  5CBN A;  2WSF H;  5APT A;  3VMX A;  1RHZ B;  3PJS K;  4BRY B;  1S4X A;  2QJY B;  2YKO A;  2E76 B;  4TT3 H;  1RE3 A;  1CZQ A;  1GDT A;  2ZYA A;  1CI6 B;  2ZFC A;  1SQX E;  3GLM A;  2A45 I;  3L70 E;  1JY3 O;  1VQO P;  2ZVO B;  3EQ2 A;  4W7Y A;  1LT1 A;  5AW0 B;  2KXP B;  1N2D C;  5AW1 B;  4HB1 A;  4NPF X;  4RJT A;  1URQ C;  3KYQ A;  4DOJ A;  2WVR A;  1HTL C;  1ZP0 C;  4H0L B;  4EI2 A;  1T3U A;  3ABV C;  1ZR2 A;  1JCD A;  1NTK G;  2IBZ D;  4K35 A;  1USD A;  1T8Z A;  2C0X A;  2IYO A;  3HTK B;  4WY4 D;  1WT6 A;  1IFI A;  1QVF O;  5GTH H;  1LTA C;  2FYU K;  1S9K E;  2FFD C;  4H44 D;  3H1K E;  1LT9 C;  1SQB G;  1K05 A;  2IPP A;  4IOI H;  2WSS H;  2V7Q H;  1JO5 A;  3B5N A;  1NHL A;  5GTH E;  2OYI B;  2OGU A;  3M9B A;  5KJ7 D;  2HYN A;  3FGA D;  1TU3 F;  2D2C C;  2OYO A;  3MHV A;  1YTZ T;  2VRS A;  2Q9I A;  1ZLL A;  1URQ A;  2E42 A;  1X9V A;  1YJN P;  3GF3 A;  1BE3 J;  1L4A D;  1S72 P;  1EDK A;  3TNU B;  4JPZ B;  1FZF A;  2K88 A;  1PV3 A;  3VYI A;  3A0B H;  1NTZ G;  1GW3 A;  2HLO A;  2YO3 A;  3M06 A;  4C46 A;  2NPS D;  3CL3 D;  2FFD A;  1LT9 A;  1Y8A A;  1P84 H;  4GOF A;  4PV1 D;  3G6E P;  3MUD A;  1LTI C;  2P2U A;  1N73 B;  3VTP C;  3L72 J;  1KIL D;  2N1T C;  1H0T B;  1NU1 J;  1P84 E;  2YIU B;  2OTL P;  1WRG A;  2K1A A;  2ZT9 D;  2YO2 A;  3L35 A;  3L75 D;  4GKG A;  1M1J C;  5APS A;  2Z5I A;  3RL0 g;  4U3F D;  3A0H H;  2E5Y A;  1NTM D;  2ZJS E;  4DZO A;  1LTT C;  1VF5 D;  2KNC A;  1FU1 A;  3RL0 C;  1VQ6 P;  5AVQ B;  3SFE C;  2WPR A;  2BCC G;  3WU2 H;  1JY3 P;  1YIT P;  2O01 H;  5KAI H;  2PAJ A;  1H8A A;  3L71 E;  3HRN A;  3NXS A;  4WBA A;  2WSE J;  1SQX K;  2IZ1 A;  3WU2 E;  3S1K A;  3K5B A;  5KAI E;  1Q90 D;  2L5G B;  3H1K J;  2N1T A;  4XA4 A;  1NTZ J;  2W27 A;  1EZV E;  1JMM A;  1FOS F;  3Q3D A;  1M1J A;  2W6J H;  3N7N A;  4N78 E;  1JMB A;  5K5G B;  2KLV A;  5TJH A;  3RBZ A;  2JO1 A;  1S2E A;  3W68 A;  3H32 A;  1JY2 N;  1OW7 A;  3E7K A;  1OW6 A;  1BCC D;  3RK3 D;  1GL2 A;  3H1H G;  1U7M A;  4JQ0 D;  1IK9 A;  1J1D C;  1EDJ A;  4RO0 A;  2RMZ A;  1FZC B;  1FAV A;  3S4R A;  2BEZ F;  2YKQ A;  4H13 D;  1G2C B;  3CWB E;  3HD7 D;  5APQ A;  2IFM A;  1IZN B;  3G71 P;  2ZYG A;  2KB7 P;  1SQV E;  1HGV A;  2E75 C;  3RK2 C;  1LTJ C;  2PRR A;  1L0L G;  2A45 H;  4IFM A;  1FDO A;  1IFN A;  4ZNC A;  1FZE A;  1KFN A;  3H1I D;  3L73 G;  3H1L G;  1SFC B;  4OVN F;  2FYN B;  3CC4 P;  3TF5 A;  1OMI A;  1VQP P;  1M90 Q;  5CCH C;  3L74 E;  1KIL E;  1E5W A;  5BU8 B;  2OYH B;  2KS1 B;  5KLV E;  1PPJ G;  1FDI A;  3L71 J;  1NWQ A;  3T97 A;  3L75 E;  2RH0 A;  5APV A;  3PTZ A;  1VQ5 P;  3NFQ A;  2GA1 A;  1PGJ A;  2O01 J;  3AE7 C;  4ASW A;  2P67 A;  4BXL A;  2OTJ P;  2BAS A;  1PIX A;  3H1J G;  4PD4 D;  4H0L D;  5APY A;  1FJP A;  1KYO I;  3WMM 0;  1K9M Q;  3HUS C;  1SQQ G;  1Y47 A;  4OH8 B;  2QM7 A;  2HPC B;  4YXW H;  4W80 A;  3USS A;  3AEB C;  1KZU B;  1NTK D;  3AEE C;  1J1E C;  2G3A A;  3BCC E;  3Q5R A;  4CPG A;  1IC2 A;  5CCH A;  2IZ0 A;  3M0A A;  3CI9 A;  2MJZ A;  1GMJ A;  3H1L J;  3FWL A;  3AE8 C;  1SQB D;  3CCL P;  1OZH A;  3PH0 A;  4DT0 A;  1M1K Q;  2KZJ A;  2M5A B;  3IFM A;  3CWB J;  1HH0 A;  4NPD A;  3FXD A;  2N9Y B;  4D6T G;  3VP9 A;  1JUN A;  1NOH A;  3C9I A;  4EDF A;  4WY4 C;  4RES B;  2LXC B;  3HUS A;  5AW4 B;  1N7S B;  3M9H A;  1ZRT D;  1PGP A;  3B5N B;  4DCK A;  2WSC H;  2I1K A;  3AE1 C;  2WPQ A;  3H1J J;  3VMZ A;  1EC5 A;  1S1C X;  1NTZ D;  5KJ7 C;  1ZW0 A;  2N9B A;  3RBX A;  1URQ B;  1YTZ I;  4UB6 H;  3L74 J;  2FY8 A;  1EDI A;  2YMY A;  1M56 D;  4C7R A;  2AEJ A;  5KLV J;  1KYO D;  1L4A C;  4UB6 E;  1SQV K;  4M3L A;  5AVT B;  4LLH A;  2IBZ I;  2QJP C;  2A06 E;  3VMY A;  3RGU A;  3FX0 A;  1GK6 A;  2QRX A;  3MIW A;  1FS0 E;  4OGQ D;  1OVR A;  2FFD B;  1LT9 B;  1DH3 A;  2H7H A;  1BDD A;  2M0B A;  2NPS C;  3EFG A;  1DEB A;  3S9O A;  1X0T A;  1IJD B;  5KLI C;  4ZMD A;  4PV1 C;  4ASV A;  1J2J B;  1KIL C;  4PJ0 H;  5CCG D;  3W67 A;  3SWF A;  2R32 A;  3O8Z A;  1NYH A;  2BCC D;  2D2C B;  2Y9Y A;  2ZT9 C;  2WTY A;  3KZI H;  4HH2 A;  4PD4 H;  4PJ0 E;  1IFP A;  1JM0 A;  3FWN A;  2LR2 A;  1QL2 A;  1T2K D;  1JB0 J;  3KZI E;  2KNC B;  1VF5 C;  3G3Z A;  5AVR B;  2WT7 A;  1AJY A;  3WUV A;  3V2R A;  1PZQ A;  4R4M A;  1AA0 A;  1LTB C;  1GU4 A;  1NTK E;  1BGY E;  3TGU G;  2NRG A;  1HJB A;  1JY3 N;  1KN7 A;  2FYU J;  3JC2 2;  1BE3 G;  1LTG C;  1SS1 A;  2QM8 A;  2N1T B;  3BVH A;  5KKZ C;  5CJ4 A;  1KIL A;  1FDM A;  3F5H A;  3GHG A;  2Q1K A;  3H1H D;  1AQ5 A;  2DW3 A;  1PL5 A;  3G9R A;  3D70 A;  1M1J B;  3P32 A;  2GUV A;  1HWT C;  1EDL A;  2W8Z A;  1NJI Q;  3H32 B;  3L72 G;  3CCE P;  2XU6 A;  3CMA P;  2O1J A;  1KC8 Q;  2C9N Y;  1W5C E;  1NU1 G;  2FBW C;  1D7M A;  1SQX G;  1GL2 B;  3L70 G;  1FJK A;  5AVZ B;  3RK3 C;  1ZRT E;  4C7N A;  1L0L D;  4MN4 C;  1BSN A;  1OFC X;  1KMI Z;  1GTW A;  4Y99 C;  4A7P A;  3V2P A;  2PFX A;  1VDF A;  4H13 C;  3L73 D;  3H1L D;  2NZ2 A;  3HD7 C;  1Q2N A;  3SFD C;  2M3E A;  1KYO H;  1LWU C;  1PP9 E;  1K8A Q;  3TGU J;  1ZME C;  2FXO A;  1SLQ A;  1SQP E;  1YHQ P;  3MTU E;  3V4W A;  1KYO E;  3CCJ P;  2RKL A;  1QVG O;  5E79 H;  3H1K G;  3KHU A;  5AVY B;  1FBM A;  1IFD A;  1IFM A;  1SP4 A;  4N6J A;  4IL6 H;  2V4H A;  1HBW A;  1Q82 Q;  3V2Q A;  5E79 E;  3A0B E;  2JR8 A;  2WSF J;  2OTK E;  1DIP A;  3V5B A;  1YBK A;  5CBO A;  3H1J D;  3CX5 D;  1HJ0 A;  4IL6 E;  1OXZ A;  3QWO C;  2W6B A;  3TYY A;  1Q81 Q;  3NMD A;  3ZDM A;  2E74 B;  1SQQ D;  1SQX J;  1BGY J;  3T97 B;  3L70 J;  3P8C E;  2YXR B;  3HD7 A;  1KB9 D;  1LWU A;  2ZVN B;  2JJL A;  3L36 A; 
#chains in the Genus database with same CATH homology
 1USE A;  3SWK A;  4YPC A;  1USD A;  3S4R A;  3SSU A;  3MUD C;  3QH9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...