1USDA

Human vasp tetramerisation domain l352m
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
41
structure length
41
Chain Sequence
SSDYSDLQRVKQELMEEVKKELQKVKEEIIEAFVQELRKRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VASODILATOR-STIMULATED PHOSPHOPROTEIN
publication title The Vasp Tetramerization Domain is a Right-Handed Coiled Coil Based on a 15-Residue Repeat
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 19
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2003-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08776 VASP_tetra VASP tetramerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1160 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Vasodilator-stimulated phosphoprotein 1usdA00
3MUDC 3S4RA 3QH9A 1USEA 3SSUA 4YPCA 3SWKA 1USDA
chains in the Genus database with same CATH superfamily
4PV1C 1BCCG 1RY3A 4JF7A 5KLVK 1R5SA 3H1HG 1SP4A 2KUBA 2YXRB 1OVUA 1Y47A 2FFDB 1URQD 5AW6B 2W27A 3MZWB 4ZNCA 1S5LX 1FBMA 3MIWA 4UB6E 2ZAEB 4YPCA 2E42A 3SFEC 4R4MA 1NTZJ 1RF1A 4HB1A 1H8AA 3MP7B 1JMBA 3HUSB 1BSNA 1GL2A 1P84H 5APTA 1N2DC 2BEQD 2ZVOB 2PP6A 4HYTB 2R3CA 4RO0A 5AW3B 4AYCA 3E1RA 1EQ7A 1RE4C 2K37A 3KHUA 5B66H 3IF4A 3ITKA 1QL1A 1ZP0C 2J59M 2HODA 5KAIH 1QEXA 1SFCC 1IFPA 1KFMA 5CJ4A 3CCLP 2N1TC 2K9JB 1ZR4A 2QIWA 3NTNA 2CK3H 3EFGA 1VQLP 2WSFJ 1PPJD 1FZEA 1KQGB 1R8EA 1NHLA 3PP5A 2ZVNB 2OYHB 1HJ0A 2YKOA 1KN7A 2A45H 3HD7C 2POHA 3V4WA 2H7HA 1CI6B 2QA4P 4WY4A 3AE8C 5KAFE 1SQPE 2FYUE 1JUNA 3RK3B 2WT7B 1RF0C 1JCDA 3WUTA 3JC22 1VQ5P 4NPDA 2O01N 1PGOA 1IO4A 1VDFA 2QEXP 1VQ6P 1RE3A 2YIUC 1S1CX 1S9KD 5CBOA 1N7SD 5AVSB 1VF5D 1KORA 1YTZI 1IK9A 3SWYA 3BCCD 1BDDA 1N73C 1JY3O 3TGUD 3SWKA 2LXCB 4OGQD 1ZXGA 1X0TA 1ZLLA 1GK4A 1NU1E 5AVXB 5AW0B 1PFIA 1JOCA 2QM8A 1SQPJ 2FYUJ 2YKQA 3CWBG 1RH5B 1FDMA 1OX3A 1EDJA 3AE9C 3HTKA 3H1JE 3BRVB 2RN0A 4I7ZC 1M7LA 2QRXA 1VQMP 4L76A 5AVTB 1BE3E 2FXOA 3OAKA 4K3AA 3B71A 1SQBK 1P84E 4GIFA 2P2UA 5CCHC 2WPVB 3H1HE 3L70E 5B66E 3TNUA 1NU1J 5AVZB 4PD4D 3CX5H 2ZT9B 2AEJA 2Q3EA 4GOFA 5AVRB 5APVA 3USSA 5KAIE 1LT9C 2WSSH 3H1JJ 2G3AA 2NPSA 4Y99B 3L71E 3M9HA 2E74C 1ZOYC 1BE3J 3AEFC 1SQXD 4A7PA 2AEMA 1RE4A 1SQPD 2FYUD 2WSCH 2YMKA 1MUUA 1T2KC 3FWLA 2GUSA 1NYHA 2XNXA 1L4AB 3C8VA 3H1HJ 3L70J 1JMMA 1KTMA 1SFCA 1HUCA 3OJAB 2H8PD 3TK1A 1CW5A 1OMIA 3RBZA 1L0LD 1GL2B 3M06A 5C39A 4XE5B 1FC2C 1P84I 2LXBA 2O3JA 3H1KE 2Y0EA 3L72D 3L71J 2KOGA 1NU1D 4KJMA 3H1LE 3HD7A 4N78E 2E75B 3W68A 3CCSP 2HODB 5KKZC 1YJWP 4I1LA 1DD3A 2ZXEB 2NPSD 1URQC 2B88A 3LW5H 1TU3F 1L2PA 3H32A 1KC8Q 1VQ9P 4I2LC 2K88A 3U1AA 3II6A 1Q90D 3P8CE 3IFMA 1IC2A 1BCCD 1P84D 1K8AQ 1XTCC 1NTZK 5AW8B 1G1JA 4Y28J 2WTYA 2P58A 3D71A 1NTZG 4DOJA 1QVFO 1NH4A 3H1HD 1N73A 3H1KJ 4YXWH 1SVFA 2IX7C 1LTJC 4WY4B 2C0WA 2A45I 5AW2B 1OW8A 3H1LJ 2ZJSE 2XDJA 3RL0B 2XNDH 3CCQP 1S5LH 1EZVD 4GT1A 2OYIB 2WPSA 3CWBE 2YO3A 3A7OA 2IDBA 2HPCB 3GHGC 3RK2D 1RQVA 3CX5E 1LTBC 1DH3A 4YXDC 3H6PA 3A3YB 3VTPC 4WVZA 3H1IE 4JYBA 5AW7B 5CCHA 4QMAA 2GUVA 2HYNA 3S1KA 3RK3E 4EYYQ 2Z5HA 1Q86Q 3A2AA 5APUA 4O9BA 3Q5PA 1T3UA 1ZN5A 2ZYAA 3HTKB 3VMAA 2OQQA 5CBNA 1FE6A 1M90Q 4DJGA 3R4YA 1LT9A 1LWUB 2IFMA 3CWBJ 3CC4P 3AE3C 4PV1B 4C46A 1E79H 1HTLC 1N7SC 1VF5C 2RKLA 2Z4EA 2IZ0A 3M9QA 2J58A 1KILA 4WB4A 3H1IJ 1JTHA 4Z1MH 3C1LA 4OGQC 2FXPA 2OTJP 2WSCJ 3GF3A 3O8ZA 3CC2P 3CX5I 4OH8B 2FXMA 1SQXK 2HG5D 4RKUJ 1SQPK 2FYUK 3TDKA 5KJ7D 2PGDA 3N7NA 4HH2A 2Q7CA 3MHVA 4I6MC 3Q3DA 2KI7B 1VQ7P 1JY3P 5AW5B 1HH0A 4H0LD 2IBZG 1EXJA 2CPBA 1L0LK 3CWBD 1LTAC 5APWA 1URQA 1KYOH 2N1TB 3PRJA 4BWNA 3ZDMA 2JDIH 1GU5A 1ZW0A 2KS1A 1YBKA 1S5LE 3GW6A 2E76D 1NU1K 1OZHA 1KILD 2Y9ZA 3LW5J 2KXPB 3EWKA 4WBAA 3HD7B 1SQBD 2D2CD 1LTJA 2W90A 2BEZF 1VPCA 3CXHH 4IFFA 5BU8B 4U3FG 3H1JG 2FBWC 3L4FA 4HJGH 1W2BO 4KHXA 1BE3G 1LTIC 3S9OA 2YIUB 1W2EA 2KLVA 1JM0A 2K3RA 3D6YA 1T8ZA 2KNCB 1YJ9P 1EXIA 3GHGA 2RH0A 1L0NE 1FZFA 3L73G 3L36A 3L70G 2ZYDA 1QLED 2IZ1A 1S72P 1NTKG 3AE2C 1N73B 2XKMA 3L75G 1EDIA 5GTIH 1HGVA 1NVOA 3A0HH 3AEDC 1IFDA 2Z5IA 4LGDE 2WWWA 1PIXA 2GA1A 2WPRA 1JY2O 1AA0A 2MKVA 3L71G 4EOTA 3L37A 3FWNA 4I7ZB 2NPSC 2Y9YA 4GODA 3Q5SA 1YIJP 1USEA 3ABVC 3GG2A 1N7SA 1L0NJ 1DEBA 2H89C 2A45G 3WU2H 1IFMA 1UIIA 4HKZH 5K5GB 1T3JA 4RJTA 1GW4A 4NPFX 3AE4C 2V7QH 3E1IA 1NJIQ 3V2QA 3HE4A 3GMAA 1FDOA 1ZMEC 3U1CA 3PTZA 2RMZA 4H13D 3H1KG 4L75A 1YQ4C 2Q6QA 5H2FH 1LT9B 1NO4A 5TJHA 3H1LG 3JSVC 3E7KA 3V6IA 2XU6A 1KYOE 1SQQG 1AVYA 2P67A 3F5HA 3AE7C 1VQ4P 3RK2C 3VP8A 3AECC 1NTZD 2E5TA 2QJYB 1WRGA 1KFNA 2JR8A 3K5BA 1JTHB 3RBXA 2NZ2A 3CXHE 1IFNA 1OW7A 2IBZE 4IL6H 3VMZA 1G2CA 4C7NB 1S2EA 1RQUA 1NGMB 2QSIA 1PGJA 3FX0A 2R5BA 1T6AA 1MFTA 3CMEP 3VYIA 2ITAA 5KKZB 2L5GB 3KDPB 4U3FE 1URQB 1J1DB 5GTIE 1GK6A 2AEFA 2W83C 1KYOI 2BCCG 3A0HE 2KS1B 4OWFA 3H1IG 1WMKA 3L74G 2Q5UA 2OGUA 3D6ZA 2WMMA 3L73E 2WZ7A 5KJ7C 1MZ9A 2C0XA 3M0DA 1OWAA 2LR2A 3LIEA 1NTKE 3M91A 2IFNA 2M3BA 3CXHI 4R4LA 3L75E 1IJDB 3WU2E 2IBZI 1M1JA 4H0LC 5KLVE 2JKVA 4U3FJ 2JJLA 4DCKA 3G6EP 2WITA 5H2FE 4BRYA 2E76C 1X22A 5CMZA 1KILC 3Q2YA 1H88A 2XZRA 2R32A 2GM4A 5CHXA 3L73J 2SPZA 4IOIH 4ZKPA 5KLIC 1NTKJ 2JEEA 2D2CC 1MFZA 4KT0J 2Y0DA 3L75J 1RF1B 3HE5A 3F89A 3CD6P 1HBWA 5KLVJ 3AE5C 1FU1A 3V2RA 2V7QJ 1A02J 5CJ0A 4IL6E 1N7SB 3PH0A 2KK7A 5E79H 1LP1A 1SQQE 1VF5B 4H44D 1IFIA 1BDCA 3KYQA 3G71P 4U3FD 3H1JD 1OFCX 3CCJP 1K04A 1D7MA 3BATA 3HE4B 1S3JA 4OGQB 1OXZA 3SFDC 1BSHA 3AEGC 1BE3D 2O1JA 1EDKA 1N7LA 3I55P 1NTME 1R5LA 1PV3A 3MD0A 1S4XA 2PRRA 3P8MC 1GDTA 2KB7P 2M5AA 1PGPA 3L73D 3KZIH 3L70D 4ASWA 3P7KA 4XA4A 1SS1A 1NTKD 4W7YA 2R44A 1KQFB 2W6BA 3L75D 1SQQJ 2QJPC 4IL6X 1IK7A 2M8RA 5DJUB 2JO1A 5B5EH 1L0NG 3IR9A 2UWJE 3PHLA 3TYYA 3L71D 5AVQB 2K1AA 2A06E 1JY2P 1FS0E 4H13C 5AW4B 1NTMJ 2N9YB 1J1EC 3HUSA 2AXTH 2BCCE 4W80A 1QX8A 3I56P 3AEAC 2W6JH 4AQRD 5KJ7A 2Y0CA 3L74E 3TGUG 3KXDA 3AEBC 4D6TG 3B5ND 2Q1KA 3EFFK 1NAFA 2MJZA 2OTLP 5APXA 1U7JA 3H1KD 1H0TA 1LTTC 3WUVA 4B86A 1HGZA 3H1LD 3O6QA 4N78D 1SQQD 3Q1MA 1EDLA 2WPQA 1FDIA 1QVGO 2BCCJ 4LLHA 2OYHA 1Q7YQ 2B89A 4JQ0D 2HFED 3B4SA 3TNUB 3L74J 5E79E 3TSIA 1CI6A 1JEKA 4AUWA 1DX7A 4N6JA 3V5BA 2WT7A 3P8CD 3CMAP 1E5WA 1KQLA 4WWIA 1YHQP 1SQVG 1GTWA 1W5CE 2NPSB 5GTHH 1LGHB 5APYA 3P32A 2KSEA 2YO2A 2YMYA 3L35A 5AW1B 1OVRA 1OIPA 3KZIE 1BGYG 2JWAA 1SFCB 2C9NY 3HE5B 4PD4H 3CX5D 5TISH 3RL0g 4JBZA 2VRSA 2OYIC 5B5EE 2BCCD 1JB0J 3H1ID 3PJSK 1LJ2A 3L74D 3RK2B 4DZOA 3RK3D 1KQSO 4JYCA 2WQYC 2AXTE 3CL3D 5AVWB 4L74A 4N3YB 3V4QA 3JCUH 2HR3A 2YNYA 1G1IA 3H32B 1RHZB 2OTKE 4IFMA 3SWFA 1VQKP 1NTKK 2M5AB 1LWUC 3QH9A 3M0DC 4UB8H 2KSJA 3KQGA 1JO5A 3FXDA 3CCMP 5KLVG 1M1JC 3BCCE 4H44C 3MUDC 2KP8A 1NOHA 1Q81Q 2DW3A 3TGUE 1L4AA 2I1KA 1PL5A 4DT0A 4D6TE 1K05A 1EZVG 4L73A 1JCCA 1IFJA 1JY3N 4YTPC 3CC7P 5DJTB 3BASA 5AVYB 5AVVB 1PP9G 3IAOA 5CCGD 1IZNB 1GMJA 1M8OB 2YKPA 5GTHE 3LIDA 2NRGA 3I5CA 2O1KA 2ZYGA 4ZMDA 2ZT9D 4M3LA 3BCCJ 2I8DA 2QJKC 3TGUJ 4H0LB 5KTBA 2J5UA 1PZQA 1SQQK 1JNMA 1H0TB 1DEEG 4D6TJ 2V4HA 1LTSC 1PGQA 3MTUE 1FJKA 4PD4E 2E74B 1SQVE 5TISE 3O6QB 3NFQA 2PFXA 1USDA 5BVZA 3CCUP 3VP9A 2E76B 1L4AD 1KILB 1YQ3C 2FYNC 1N8RQ 4ZKUA 1NTMK 1FZCC 1KV4A 1FOSE 1NTMG 1SQXE 5KLIB 3EQ2A 2D2CB 1BGYE 2JWDA 2P1JA 1GL2D 1L0ND 1LTGC 3D70A 3B5NC 1YYCA 1AQTA 2M0BA 5APQA 3JCUE 2KLUA 2OARA 1SLQA 3BRTB 2OYIA 2LKMA 3M0AA 3A0BH 1Y9BA 1KB9H 2HPCA 1SQVJ 1YI2P 2E75D 2B87A 3AEEC 1L0LE 2FFDC 3V2NA 5M1BA 2P10A 1U57A 3Q5RA 3UIAA 1X8YA 1AJYA 3NXSA 4UB8E 2A06G 3L72E 4K35A 4D6TD 3G3ZA 1AVOA 1SQXJ 2G8YA 4JPZB 1OVVA 1BGYJ 4PD4I 1LNQA 3HUSC 5APSA 1WT6A 1M57D 2QG4A 2WVRA 1LWUA 1HF9A 4WY4D 2AXCA 3WMM0 1GW3A 1LTJB 2QM7A 3RL0D 1L0LJ 1BCCE 3V2PA 3S4RA 1SQBG 3MUDA 2FKWB 3HRNA 2E5YA 2QJPB 3L72J 1QGKB 1KYOD 3NMDA 3MGNA 2R3SA 3U59A 1NWQA 3GHGB 1SQVD 2YXQB 4H13B 4PJ0H 1EZVE 5AVUB 1J1EB 2OYHC 1VQOP 1Q2NA 1FJPA 2B9BA 1PP9E 1DD4A 3SSUA 1NKZB 3T97A 1QL2A 2QJYC 3CXHD 3RK3C 2IBZD 1BGYD 1BCCJ 4PV1D 1X79B 2N1TA 3GF7A 1FZBA 2CPSA 3VOPA 1GU4A 3A5TA 2H88C 2Q3IA 3TF5A 1YITP 3A0BE 1KB9E 1PP9J 2O01H 1FZCA 1MV8A 1Y8AA 1KMIZ 4TT3H 2N9BA 1RF0A 3AE6C 3BVHA 4BXLA 3CI9A 2HLOA 2QE7H 3B5NA 2W8ZA 1EZVI 3VMXA 1J1DC 1N86A 1PPJG 1LT1A 4OVNF 3AE1C 2KNCA 1HVVA 1CSBA 2R5DA 1H89A 2WSEH 2IPPA 1KD1Q 4IFDK 4GOEA 5CCGC 2W6AA 2FFDA 2FYZA 1SFCD 3M9BA 5KLVD 1L0NK 4EI2A 1X9VA 1ZR2A 2N1TD 1U7MA 2ZT9C 1G2CB 1ZRTE 1VQ8P 3N4XA 3CPWO 2Q9IA 4U7JA 1J2JB 2E43A 4Y99C 3BCCG 3HD7D 1PP9D 1AFOA 1KB9I 2B87B 4NPEA 3G4SP 2BASA 1Z56A 2P7JA 4PJ0E 2M3EA 2KZJA 1KILE 3QWOC 2KYVA 1L4AC 3C9IA 2KIKA 2OYOA 4TLFA 3KPEA 2I1JA 2ZFCA 1SQBE 1RF1C 2K9JA 2L91A 1GL2C 1XTGB 2FY8A 3H25A 2JP3A 3CCVP 1GD2E 3PLNA 1K9MQ 2XV5A 3CCEP 2C9LY 1M56D 1KB9D 2K9YA 2H43A 4UB6H 2IYPA 4EDFA 2E75C 4GDOA 4MN4C 3W67A 1M1JB 4H44B 4ASVA 3CLQA 1NTMD 2WSFH 4EIJA 1SQVK 1FOSF 1CZQA 5EFWB 4GKGA 1VQNP 1VQPP 1AV1A 1FZAA 3CCRP 1YTZT 1SQBJ 1NAYA 1KZUB 3B8EB 4RESB 2ZXXA 3VN0A 3G9RA 4BRYB 1FAVA 3GLMA 3OA7A 4C7NA 1SQXG 5CCHD 1VL2A 4LC1A 3IN6A 1SQPG 2FYUG 2PAJA 1GZLA 3T97B 2IYOA 4WY4C 1JY2N 3WUUA 2KZIA 3RL0C 2A06D 2QVAA 1OW6A 1ZRTD 2QJKB 1RE3C 3RGUA 1K73Q 1HWTC 4W7ZA 1ZV8A 1M1KQ 4CPGA 3OW2O 2O01J 1L0LG 4XFJA 2E74D 1Q82Q 1LP1B 4C7RA 5L8RJ 1EC5A 1PPJE 5KAFH 3L72G 1T2KD 1UIXA 1NU1G 1FZGA 2FYNB 5CCGA 1FZCB 3VMYA 1NTZE 5BU5A 2WSEJ 5AW9B 1YJNP 1HJBA 3B5NB 1A02F 3FGAD 1DIPA 1S9KE 3FXEA 1AQ5A 1NKNA 3R2PA 1MKMA
chains in the Genus database with same CATH topology
3MUDC 3S4RA 3QH9A 1USEA 3SSUA 4YPCA 3SWKA 1USDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MUD C;  3S4R A;  3QH9 A;  1USE A;  3SSU A;  4YPC A;  3SWK A;  1USD A; 
#chains in the Genus database with same CATH topology
 4PV1 C;  1BCC G;  1RY3 A;  4JF7 A;  5KLV K;  1R5S A;  3H1H G;  1SP4 A;  2KUB A;  2YXR B;  1OVU A;  1Y47 A;  2FFD B;  1URQ D;  5AW6 B;  2W27 A;  3MZW B;  4ZNC A;  1S5L X;  1FBM A;  3MIW A;  4UB6 E;  2ZAE B;  4YPC A;  2E42 A;  3SFE C;  4R4M A;  1NTZ J;  1RF1 A;  4HB1 A;  1H8A A;  3MP7 B;  1JMB A;  3HUS B;  1BSN A;  1GL2 A;  1P84 H;  5APT A;  1N2D C;  2BEQ D;  2ZVO B;  2PP6 A;  4HYT B;  2R3C A;  4RO0 A;  5AW3 B;  4AYC A;  3E1R A;  1EQ7 A;  1RE4 C;  2K37 A;  3KHU A;  5B66 H;  3IF4 A;  3ITK A;  1QL1 A;  1ZP0 C;  2J59 M;  2HOD A;  5KAI H;  1QEX A;  1SFC C;  1IFP A;  1KFM A;  5CJ4 A;  3CCL P;  2N1T C;  2K9J B;  1ZR4 A;  2QIW A;  3NTN A;  2CK3 H;  3EFG A;  1VQL P;  2WSF J;  1PPJ D;  1FZE A;  1KQG B;  1R8E A;  1NHL A;  3PP5 A;  2ZVN B;  2OYH B;  1HJ0 A;  2YKO A;  1KN7 A;  2A45 H;  3HD7 C;  2POH A;  3V4W A;  2H7H A;  1CI6 B;  2QA4 P;  4WY4 A;  3AE8 C;  5KAF E;  1SQP E;  2FYU E;  1JUN A;  3RK3 B;  2WT7 B;  1RF0 C;  1JCD A;  3WUT A;  3JC2 2;  1VQ5 P;  4NPD A;  2O01 N;  1PGO A;  1IO4 A;  1VDF A;  2QEX P;  1VQ6 P;  1RE3 A;  2YIU C;  1S1C X;  1S9K D;  5CBO A;  1N7S D;  5AVS B;  1VF5 D;  1KOR A;  1YTZ I;  1IK9 A;  3SWY A;  3BCC D;  1BDD A;  1N73 C;  1JY3 O;  3TGU D;  3SWK A;  2LXC B;  4OGQ D;  1ZXG A;  1X0T A;  1ZLL A;  1GK4 A;  1NU1 E;  5AVX B;  5AW0 B;  1PFI A;  1JOC A;  2QM8 A;  1SQP J;  2FYU J;  2YKQ A;  3CWB G;  1RH5 B;  1FDM A;  1OX3 A;  1EDJ A;  3AE9 C;  3HTK A;  3H1J E;  3BRV B;  2RN0 A;  4I7Z C;  1M7L A;  2QRX A;  1VQM P;  4L76 A;  5AVT B;  1BE3 E;  2FXO A;  3OAK A;  4K3A A;  3B71 A;  1SQB K;  1P84 E;  4GIF A;  2P2U A;  5CCH C;  2WPV B;  3H1H E;  3L70 E;  5B66 E;  3TNU A;  1NU1 J;  5AVZ B;  4PD4 D;  3CX5 H;  2ZT9 B;  2AEJ A;  2Q3E A;  4GOF A;  5AVR B;  5APV A;  3USS A;  5KAI E;  1LT9 C;  2WSS H;  3H1J J;  2G3A A;  2NPS A;  4Y99 B;  3L71 E;  3M9H A;  2E74 C;  1ZOY C;  1BE3 J;  3AEF C;  1SQX D;  4A7P A;  2AEM A;  1RE4 A;  1SQP D;  2FYU D;  2WSC H;  2YMK A;  1MUU A;  1T2K C;  3FWL A;  2GUS A;  1NYH A;  2XNX A;  1L4A B;  3C8V A;  3H1H J;  3L70 J;  1JMM A;  1KTM A;  1SFC A;  1HUC A;  3OJA B;  2H8P D;  3TK1 A;  1CW5 A;  1OMI A;  3RBZ A;  1L0L D;  1GL2 B;  3M06 A;  5C39 A;  4XE5 B;  1FC2 C;  1P84 I;  2LXB A;  2O3J A;  3H1K E;  2Y0E A;  3L72 D;  3L71 J;  2KOG A;  1NU1 D;  4KJM A;  3H1L E;  3HD7 A;  4N78 E;  2E75 B;  3W68 A;  3CCS P;  2HOD B;  5KKZ C;  1YJW P;  4I1L A;  1DD3 A;  2ZXE B;  2NPS D;  1URQ C;  2B88 A;  3LW5 H;  1TU3 F;  1L2P A;  3H32 A;  1KC8 Q;  1VQ9 P;  4I2L C;  2K88 A;  3U1A A;  3II6 A;  1Q90 D;  3P8C E;  3IFM A;  1IC2 A;  1BCC D;  1P84 D;  1K8A Q;  1XTC C;  1NTZ K;  5AW8 B;  1G1J A;  4Y28 J;  2WTY A;  2P58 A;  3D71 A;  1NTZ G;  4DOJ A;  1QVF O;  1NH4 A;  3H1H D;  1N73 A;  3H1K J;  4YXW H;  1SVF A;  2IX7 C;  1LTJ C;  4WY4 B;  2C0W A;  2A45 I;  5AW2 B;  1OW8 A;  3H1L J;  2ZJS E;  2XDJ A;  3RL0 B;  2XND H;  3CCQ P;  1S5L H;  1EZV D;  4GT1 A;  2OYI B;  2WPS A;  3CWB E;  2YO3 A;  3A7O A;  2IDB A;  2HPC B;  3GHG C;  3RK2 D;  1RQV A;  3CX5 E;  1LTB C;  1DH3 A;  4YXD C;  3H6P A;  3A3Y B;  3VTP C;  4WVZ A;  3H1I E;  4JYB A;  5AW7 B;  5CCH A;  4QMA A;  2GUV A;  2HYN A;  3S1K A;  3RK3 E;  4EYY Q;  2Z5H A;  1Q86 Q;  3A2A A;  5APU A;  4O9B A;  3Q5P A;  1T3U A;  1ZN5 A;  2ZYA A;  3HTK B;  3VMA A;  2OQQ A;  5CBN A;  1FE6 A;  1M90 Q;  4DJG A;  3R4Y A;  1LT9 A;  1LWU B;  2IFM A;  3CWB J;  3CC4 P;  3AE3 C;  4PV1 B;  4C46 A;  1E79 H;  1HTL C;  1N7S C;  1VF5 C;  2RKL A;  2Z4E A;  2IZ0 A;  3M9Q A;  2J58 A;  1KIL A;  4WB4 A;  3H1I J;  1JTH A;  4Z1M H;  3C1L A;  4OGQ C;  2FXP A;  2OTJ P;  2WSC J;  3GF3 A;  3O8Z A;  3CC2 P;  3CX5 I;  4OH8 B;  2FXM A;  1SQX K;  2HG5 D;  4RKU J;  1SQP K;  2FYU K;  3TDK A;  5KJ7 D;  2PGD A;  3N7N A;  4HH2 A;  2Q7C A;  3MHV A;  4I6M C;  3Q3D A;  2KI7 B;  1VQ7 P;  1JY3 P;  5AW5 B;  1HH0 A;  4H0L D;  2IBZ G;  1EXJ A;  2CPB A;  1L0L K;  3CWB D;  1LTA C;  5APW A;  1URQ A;  1KYO H;  2N1T B;  3PRJ A;  4BWN A;  3ZDM A;  2JDI H;  1GU5 A;  1ZW0 A;  2KS1 A;  1YBK A;  1S5L E;  3GW6 A;  2E76 D;  1NU1 K;  1OZH A;  1KIL D;  2Y9Z A;  3LW5 J;  2KXP B;  3EWK A;  4WBA A;  3HD7 B;  1SQB D;  2D2C D;  1LTJ A;  2W90 A;  2BEZ F;  1VPC A;  3CXH H;  4IFF A;  5BU8 B;  4U3F G;  3H1J G;  2FBW C;  3L4F A;  4HJG H;  1W2B O;  4KHX A;  1BE3 G;  1LTI C;  3S9O A;  2YIU B;  1W2E A;  2KLV A;  1JM0 A;  2K3R A;  3D6Y A;  1T8Z A;  2KNC B;  1YJ9 P;  1EXI A;  3GHG A;  2RH0 A;  1L0N E;  1FZF A;  3L73 G;  3L36 A;  3L70 G;  2ZYD A;  1QLE D;  2IZ1 A;  1S72 P;  1NTK G;  3AE2 C;  1N73 B;  2XKM A;  3L75 G;  1EDI A;  5GTI H;  1HGV A;  1NVO A;  3A0H H;  3AED C;  1IFD A;  2Z5I A;  4LGD E;  2WWW A;  1PIX A;  2GA1 A;  2WPR A;  1JY2 O;  1AA0 A;  2MKV A;  3L71 G;  4EOT A;  3L37 A;  3FWN A;  4I7Z B;  2NPS C;  2Y9Y A;  4GOD A;  3Q5S A;  1YIJ P;  1USE A;  3ABV C;  3GG2 A;  1N7S A;  1L0N J;  1DEB A;  2H89 C;  2A45 G;  3WU2 H;  1IFM A;  1UII A;  4HKZ H;  5K5G B;  1T3J A;  4RJT A;  1GW4 A;  4NPF X;  3AE4 C;  2V7Q H;  3E1I A;  1NJI Q;  3V2Q A;  3HE4 A;  3GMA A;  1FDO A;  1ZME C;  3U1C A;  3PTZ A;  2RMZ A;  4H13 D;  3H1K G;  4L75 A;  1YQ4 C;  2Q6Q A;  5H2F H;  1LT9 B;  1NO4 A;  5TJH A;  3H1L G;  3JSV C;  3E7K A;  3V6I A;  2XU6 A;  1KYO E;  1SQQ G;  1AVY A;  2P67 A;  3F5H A;  3AE7 C;  1VQ4 P;  3RK2 C;  3VP8 A;  3AEC C;  1NTZ D;  2E5T A;  2QJY B;  1WRG A;  1KFN A;  2JR8 A;  3K5B A;  1JTH B;  3RBX A;  2NZ2 A;  3CXH E;  1IFN A;  1OW7 A;  2IBZ E;  4IL6 H;  3VMZ A;  1G2C A;  4C7N B;  1S2E A;  1RQU A;  1NGM B;  2QSI A;  1PGJ A;  3FX0 A;  2R5B A;  1T6A A;  1MFT A;  3CME P;  3VYI A;  2ITA A;  5KKZ B;  2L5G B;  3KDP B;  4U3F E;  1URQ B;  1J1D B;  5GTI E;  1GK6 A;  2AEF A;  2W83 C;  1KYO I;  2BCC G;  3A0H E;  2KS1 B;  4OWF A;  3H1I G;  1WMK A;  3L74 G;  2Q5U A;  2OGU A;  3D6Z A;  2WMM A;  3L73 E;  2WZ7 A;  5KJ7 C;  1MZ9 A;  2C0X A;  3M0D A;  1OWA A;  2LR2 A;  3LIE A;  1NTK E;  3M91 A;  2IFN A;  2M3B A;  3CXH I;  4R4L A;  3L75 E;  1IJD B;  3WU2 E;  2IBZ I;  1M1J A;  4H0L C;  5KLV E;  2JKV A;  4U3F J;  2JJL A;  4DCK A;  3G6E P;  2WIT A;  5H2F E;  4BRY A;  2E76 C;  1X22 A;  5CMZ A;  1KIL C;  3Q2Y A;  1H88 A;  2XZR A;  2R32 A;  2GM4 A;  5CHX A;  3L73 J;  2SPZ A;  4IOI H;  4ZKP A;  5KLI C;  1NTK J;  2JEE A;  2D2C C;  1MFZ A;  4KT0 J;  2Y0D A;  3L75 J;  1RF1 B;  3HE5 A;  3F89 A;  3CD6 P;  1HBW A;  5KLV J;  3AE5 C;  1FU1 A;  3V2R A;  2V7Q J;  1A02 J;  5CJ0 A;  4IL6 E;  1N7S B;  3PH0 A;  2KK7 A;  5E79 H;  1LP1 A;  1SQQ E;  1VF5 B;  4H44 D;  1IFI A;  1BDC A;  3KYQ A;  3G71 P;  4U3F D;  3H1J D;  1OFC X;  3CCJ P;  1K04 A;  1D7M A;  3BAT A;  3HE4 B;  1S3J A;  4OGQ B;  1OXZ A;  3SFD C;  1BSH A;  3AEG C;  1BE3 D;  2O1J A;  1EDK A;  1N7L A;  3I55 P;  1NTM E;  1R5L A;  1PV3 A;  3MD0 A;  1S4X A;  2PRR A;  3P8M C;  1GDT A;  2KB7 P;  2M5A A;  1PGP A;  3L73 D;  3KZI H;  3L70 D;  4ASW A;  3P7K A;  4XA4 A;  1SS1 A;  1NTK D;  4W7Y A;  2R44 A;  1KQF B;  2W6B A;  3L75 D;  1SQQ J;  2QJP C;  4IL6 X;  1IK7 A;  2M8R A;  5DJU B;  2JO1 A;  5B5E H;  1L0N G;  3IR9 A;  2UWJ E;  3PHL A;  3TYY A;  3L71 D;  5AVQ B;  2K1A A;  2A06 E;  1JY2 P;  1FS0 E;  4H13 C;  5AW4 B;  1NTM J;  2N9Y B;  1J1E C;  3HUS A;  2AXT H;  2BCC E;  4W80 A;  1QX8 A;  3I56 P;  3AEA C;  2W6J H;  4AQR D;  5KJ7 A;  2Y0C A;  3L74 E;  3TGU G;  3KXD A;  3AEB C;  4D6T G;  3B5N D;  2Q1K A;  3EFF K;  1NAF A;  2MJZ A;  2OTL P;  5APX A;  1U7J A;  3H1K D;  1H0T A;  1LTT C;  3WUV A;  4B86 A;  1HGZ A;  3H1L D;  3O6Q A;  4N78 D;  1SQQ D;  3Q1M A;  1EDL A;  2WPQ A;  1FDI A;  1QVG O;  2BCC J;  4LLH A;  2OYH A;  1Q7Y Q;  2B89 A;  4JQ0 D;  2HFE D;  3B4S A;  3TNU B;  3L74 J;  5E79 E;  3TSI A;  1CI6 A;  1JEK A;  4AUW A;  1DX7 A;  4N6J A;  3V5B A;  2WT7 A;  3P8C D;  3CMA P;  1E5W A;  1KQL A;  4WWI A;  1YHQ P;  1SQV G;  1GTW A;  1W5C E;  2NPS B;  5GTH H;  1LGH B;  5APY A;  3P32 A;  2KSE A;  2YO2 A;  2YMY A;  3L35 A;  5AW1 B;  1OVR A;  1OIP A;  3KZI E;  1BGY G;  2JWA A;  1SFC B;  2C9N Y;  3HE5 B;  4PD4 H;  3CX5 D;  5TIS H;  3RL0 g;  4JBZ A;  2VRS A;  2OYI C;  5B5E E;  2BCC D;  1JB0 J;  3H1I D;  3PJS K;  1LJ2 A;  3L74 D;  3RK2 B;  4DZO A;  3RK3 D;  1KQS O;  4JYC A;  2WQY C;  2AXT E;  3CL3 D;  5AVW B;  4L74 A;  4N3Y B;  3V4Q A;  3JCU H;  2HR3 A;  2YNY A;  1G1I A;  3H32 B;  1RHZ B;  2OTK E;  4IFM A;  3SWF A;  1VQK P;  1NTK K;  2M5A B;  1LWU C;  3QH9 A;  3M0D C;  4UB8 H;  2KSJ A;  3KQG A;  1JO5 A;  3FXD A;  3CCM P;  5KLV G;  1M1J C;  3BCC E;  4H44 C;  3MUD C;  2KP8 A;  1NOH A;  1Q81 Q;  2DW3 A;  3TGU E;  1L4A A;  2I1K A;  1PL5 A;  4DT0 A;  4D6T E;  1K05 A;  1EZV G;  4L73 A;  1JCC A;  1IFJ A;  1JY3 N;  4YTP C;  3CC7 P;  5DJT B;  3BAS A;  5AVY B;  5AVV B;  1PP9 G;  3IAO A;  5CCG D;  1IZN B;  1GMJ A;  1M8O B;  2YKP A;  5GTH E;  3LID A;  2NRG A;  3I5C A;  2O1K A;  2ZYG A;  4ZMD A;  2ZT9 D;  4M3L A;  3BCC J;  2I8D A;  2QJK C;  3TGU J;  4H0L B;  5KTB A;  2J5U A;  1PZQ A;  1SQQ K;  1JNM A;  1H0T B;  1DEE G;  4D6T J;  2V4H A;  1LTS C;  1PGQ A;  3MTU E;  1FJK A;  4PD4 E;  2E74 B;  1SQV E;  5TIS E;  3O6Q B;  3NFQ A;  2PFX A;  1USD A;  5BVZ A;  3CCU P;  3VP9 A;  2E76 B;  1L4A D;  1KIL B;  1YQ3 C;  2FYN C;  1N8R Q;  4ZKU A;  1NTM K;  1FZC C;  1KV4 A;  1FOS E;  1NTM G;  1SQX E;  5KLI B;  3EQ2 A;  2D2C B;  1BGY E;  2JWD A;  2P1J A;  1GL2 D;  1L0N D;  1LTG C;  3D70 A;  3B5N C;  1YYC A;  1AQT A;  2M0B A;  5APQ A;  3JCU E;  2KLU A;  2OAR A;  1SLQ A;  3BRT B;  2OYI A;  2LKM A;  3M0A A;  3A0B H;  1Y9B A;  1KB9 H;  2HPC A;  1SQV J;  1YI2 P;  2E75 D;  2B87 A;  3AEE C;  1L0L E;  2FFD C;  3V2N A;  5M1B A;  2P10 A;  1U57 A;  3Q5R A;  3UIA A;  1X8Y A;  1AJY A;  3NXS A;  4UB8 E;  2A06 G;  3L72 E;  4K35 A;  4D6T D;  3G3Z A;  1AVO A;  1SQX J;  2G8Y A;  4JPZ B;  1OVV A;  1BGY J;  4PD4 I;  1LNQ A;  3HUS C;  5APS A;  1WT6 A;  1M57 D;  2QG4 A;  2WVR A;  1LWU A;  1HF9 A;  4WY4 D;  2AXC A;  3WMM 0;  1GW3 A;  1LTJ B;  2QM7 A;  3RL0 D;  1L0L J;  1BCC E;  3V2P A;  3S4R A;  1SQB G;  3MUD A;  2FKW B;  3HRN A;  2E5Y A;  2QJP B;  3L72 J;  1QGK B;  1KYO D;  3NMD A;  3MGN A;  2R3S A;  3U59 A;  1NWQ A;  3GHG B;  1SQV D;  2YXQ B;  4H13 B;  4PJ0 H;  1EZV E;  5AVU B;  1J1E B;  2OYH C;  1VQO P;  1Q2N A;  1FJP A;  2B9B A;  1PP9 E;  1DD4 A;  3SSU A;  1NKZ B;  3T97 A;  1QL2 A;  2QJY C;  3CXH D;  3RK3 C;  2IBZ D;  1BGY D;  1BCC J;  4PV1 D;  1X79 B;  2N1T A;  3GF7 A;  1FZB A;  2CPS A;  3VOP A;  1GU4 A;  3A5T A;  2H88 C;  2Q3I A;  3TF5 A;  1YIT P;  3A0B E;  1KB9 E;  1PP9 J;  2O01 H;  1FZC A;  1MV8 A;  1Y8A A;  1KMI Z;  4TT3 H;  2N9B A;  1RF0 A;  3AE6 C;  3BVH A;  4BXL A;  3CI9 A;  2HLO A;  2QE7 H;  3B5N A;  2W8Z A;  1EZV I;  3VMX A;  1J1D C;  1N86 A;  1PPJ G;  1LT1 A;  4OVN F;  3AE1 C;  2KNC A;  1HVV A;  1CSB A;  2R5D A;  1H89 A;  2WSE H;  2IPP A;  1KD1 Q;  4IFD K;  4GOE A;  5CCG C;  2W6A A;  2FFD A;  2FYZ A;  1SFC D;  3M9B A;  5KLV D;  1L0N K;  4EI2 A;  1X9V A;  1ZR2 A;  2N1T D;  1U7M A;  2ZT9 C;  1G2C B;  1ZRT E;  1VQ8 P;  3N4X A;  3CPW O;  2Q9I A;  4U7J A;  1J2J B;  2E43 A;  4Y99 C;  3BCC G;  3HD7 D;  1PP9 D;  1AFO A;  1KB9 I;  2B87 B;  4NPE A;  3G4S P;  2BAS A;  1Z56 A;  2P7J A;  4PJ0 E;  2M3E A;  2KZJ A;  1KIL E;  3QWO C;  2KYV A;  1L4A C;  3C9I A;  2KIK A;  2OYO A;  4TLF A;  3KPE A;  2I1J A;  2ZFC A;  1SQB E;  1RF1 C;  2K9J A;  2L91 A;  1GL2 C;  1XTG B;  2FY8 A;  3H25 A;  2JP3 A;  3CCV P;  1GD2 E;  3PLN A;  1K9M Q;  2XV5 A;  3CCE P;  2C9L Y;  1M56 D;  1KB9 D;  2K9Y A;  2H43 A;  4UB6 H;  2IYP A;  4EDF A;  2E75 C;  4GDO A;  4MN4 C;  3W67 A;  1M1J B;  4H44 B;  4ASV A;  3CLQ A;  1NTM D;  2WSF H;  4EIJ A;  1SQV K;  1FOS F;  1CZQ A;  5EFW B;  4GKG A;  1VQN P;  1VQP P;  1AV1 A;  1FZA A;  3CCR P;  1YTZ T;  1SQB J;  1NAY A;  1KZU B;  3B8E B;  4RES B;  2ZXX A;  3VN0 A;  3G9R A;  4BRY B;  1FAV A;  3GLM A;  3OA7 A;  4C7N A;  1SQX G;  5CCH D;  1VL2 A;  4LC1 A;  3IN6 A;  1SQP G;  2FYU G;  2PAJ A;  1GZL A;  3T97 B;  2IYO A;  4WY4 C;  1JY2 N;  3WUU A;  2KZI A;  3RL0 C;  2A06 D;  2QVA A;  1OW6 A;  1ZRT D;  2QJK B;  1RE3 C;  3RGU A;  1K73 Q;  1HWT C;  4W7Z A;  1ZV8 A;  1M1K Q;  4CPG A;  3OW2 O;  2O01 J;  1L0L G;  4XFJ A;  2E74 D;  1Q82 Q;  1LP1 B;  4C7R A;  5L8R J;  1EC5 A;  1PPJ E;  5KAF H;  3L72 G;  1T2K D;  1UIX A;  1NU1 G;  1FZG A;  2FYN B;  5CCG A;  1FZC B;  3VMY A;  1NTZ E;  5BU5 A;  2WSE J;  5AW9 B;  1YJN P;  1HJB A;  3B5N B;  1A02 F;  3FGA D;  1DIP A;  1S9K E;  3FXE A;  1AQ5 A;  1NKN A;  3R2P A;  1MKM A; 
#chains in the Genus database with same CATH homology
 3MUD C;  3S4R A;  3QH9 A;  1USE A;  3SSU A;  4YPC A;  3SWK A;  1USD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...