1U7JA

Solution structure of a diiron protein model
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
49
structure length
49
Chain Sequence
MDYLRELYKLEQQAMKLYREASERVGDPVLAKILEDEEKHIEWLETING
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Four-helix bundle model
publication title Analysis and Design of Turns in alpha-Helical Hairpins
pubmed doi rcsb
source organism Escherichia coli
molecule tags De novo protein
total genus 15
structure length 49
sequence length 49
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1u7jA00
3FXDA 4HJGH 5CBOA 1JM0A 2KIKA 1U7JA 2B87A 1Q2NA 2K3RA 1MFTA 2OTKE 4NPEA 4CPGA 3ZDMA 2UWJE 4K35A 1X0TA 2ZAEB 4ZNCA 4EYYQ 2SPZA 1S3JA 2KI7B 2Q1KA 2KS1B 2B89A 2B88A 2KZIA 1ZXGA 1EDIA 2HR3A 1U7MA 2QVAA 5EFWB 1BDCA 3MHVA 1OVVA 1LP1A 4HB1A 3FXEA 4ZMDA 1DEEG 4BXLA 2JWDA 1OVRA 4ASVA 4ASWA 1NVOA 1ZW0A 2M5AA 1H0TA 1SS1A 1LP1B 2B87B 4MN4C 2RKLA 2P58A 4GODA 2LXBA 1OVUA 1Y47A 1EC5A 1BDDA 4WWIA 4KJMA 2M0BA 3QWOC 5DJUB 4K3AA 4NPFX 2LR2A 2WMMA 4GOFA 3MZWB 4IOIH 3PH0A 1EDJA 5K5GB 1FC2C 5DJTB 2I8DA 3S1KA 2QRXA 4GOEA 4JBZA 3RGUA 2M5AB 2KZJA 1EDLA 1LT1A 1H0TB 1EDKA 1JMBA 2R44A 2LXCB 4HKZH 4NPDA 2KUBA 5CBNA 5C39A
chains in the Genus database with same CATH superfamily
4IFFA 4AQRD 3H32B 4I2LC 3PHLA 2OYHA 3KXDA 3H1LG 2D2CC 4NPEA 5APXA 1A02F 2VRSA 1USDA 1RQUA 1H89A 1SFCA 4KHXA 4U3FG 1KILA 1HBWA 2HR3A 2HLOA 1BGYJ 3L37A 1IO4A 4YPCA 1K04A 5APTA 3GHGB 3VN0A 2Y0EA 1VQPP 5B66E 4H44B 4U3FJ 5AW2B 1L0ND 3BVHA 2OYOA 1GU4A 1K73Q 3CI9A 1NTMJ 5AW8B 3CCQP 1MFZA 1VQ9P 3M0AA 3L70G 1N2DC 3B5NA 4IOIH 1J1EC 4W7YA 4OWFA 1N8RQ 3M91A 3GHGC 4WY4A 3TNUB 3L71E 4UB6H 1JO5A 1JOCA 1H0TB 3MUDA 1GK6A 5KAIE 3L73D 4PD4H 5C39A 4IFDK 1KD1Q 1SQVJ 4Z1MH 2BASA 1Z56A 1BGYD 1YJWP 3L70J 3VYIA 1SQQG 3OJAB 1VQ7P 2UWJE 2ZAEB 1WMKA 2ZT9D 4AYCA 1LTGC 1H88A 1FS0E 2JO1A 2A06D 1SFCD 3LIDA 1NTMK 1KILD 3JSVC 1AA0A 1BGYE 1MV8A 2WPVB 1DEBA 1CW5A 3MHVA 4DCKA 1IC2A 4U3FD 2WPRA 3RL0g 4ZMDA 1Q7YQ 3H1LE 2M5AA 1DX7A 2E76B 1NTMD 3BRTB 3IN6A 1SQQJ 1URQA 4DJGA 1SQVK 2QG4A 4UB6E 1L2PA 4WWIA 2OYHC 5DJUB 3V6IA 2HODA 4PD4E 2FXMA 1T3JA 3S9OA 2ZT9C 3C9IA 2J59M 3B5ND 1NAYA 2QE7H 3EQ2A 1KILC 3WUTA 2B9BA 1SQVD 4WY4D 2R5BA 1IJDB 2XDJA 2ZXEB 1SQXJ 3IAOA 3B5NB 4AUWA 4YXDC 4WBAA 1JMBA 4N78D 3GLMA 4WY4B 2WT7A 1HJ0A 3L74G 4OGQD 2RMZA 2Y9YA 3L36A 1SQQK 4JPZB 3R2PA 3L70E 2IDBA 1IFJA 3RK2D 1JY3P 1HWTC 1KTMA 4M3LA 4K35A 1X0TA 5TJHA 3MD0A 1S3JA 2YXRB 1OMIA 1FAVA 2XV5A 2W6JH 2QEXP 3B5NC 1KB9I 1YTZT 3CXHI 4RKUJ 4C7NB 1NTKG 3NMDA 1OVVA 1OIPA 4JQ0D 4WY4C 5GTHH 3CCRP 1SQXK 2MJZA 1X79B 4I7ZB 2PP6A 5KLVJ 2N9YB 3MUDC 3SSUA 1SQQE 3HUSA 1LT9B 2R3CA 1URQD 4IL6X 3P7KA 2IZ0A 4GODA 2Z5IA 4OGQC 1FDMA 1SQXD 1URQB 3RK2C 2JDIH 3F89A 4GOFA 2KP8A 2QM7A 1NU1J 4DT0A 1QVFO 2KZJA 1SQPG 1LT9C 3D71A 5CJ0A 4H13B 3CCSP 1FZGA 5KLVK 2KIKA 1URQC 2GA1A 5GTHE 2B87A 1KFMA 5KTBA 3O6QB 3BCCG 1ZP0C 1NTZE 3KZIH 5AW9B 4GKGA 3CC7P 2H8PD 5KLVD 1FZAA 1SQPJ 2KS1B 3FX0A 3AE1C 3A2AA 1LJ2A 1M1JB 3VMYA 1M1KQ 1NU1K 3AE2C 1KQGB 3L74E 1P84E 4B86A 2FFDA 1L4AA 3OW2O 2KYVA 1ZRTE 2QIWA 2KB7P 3N4XA 2JWDA 1FDIA 1ZW0A 3CCVP 2WQYC 1BE3G 1PPJD 1NU1D 2KK7A 3BRVB 5KJ7A 3BATA 2WITA 2PGDA 1JTHA 4I6MC 3A0HH 2OQQA 2E5TA 1NTKE 2FKWB 2WPQA 2O1KA 1YIJP 3U1AA 3R4YA 1NGMB 3WU2H 2KLUA 5AVSB 1JCDA 1GW4A 1G2CA 4JBZA 5CCGA 3HTKB 2E5YA 4JF7A 4D6TG 2IYPA 1Q86Q 2QJPC 1N73A 3EFGA 3CWBG 1QVGO 2YXQB 1LTTC 4GDOA 1DD4A 2YO3A 1SQPE 1FZCB 4RESB 2JKVA 2KI7B 2E74B 1PP9G 2Y0CA 1FOSF 3PJSK 4RJTA 4RO0A 3TSIA 4D6TJ 2WSEJ 3G4SP 1NJIQ 4XFJA 1OZHA 1L4AD 3PRJA 3FXEA 1XTCC 1DEEG 1VF5B 2A45I 3HE5B 1S72P 3BCCE 3WU2E 3N7NA 1FOSE 1GW3A 5KAFH 1YYCA 3CL3D 1S2EA 1RF1B 2KSEA 3U59A 1BCCJ 2WSEH 1GU5A 5KJ7D 2P10A 1PP9J 3CCMP 1FZCC 3H1HG 2IPPA 3Q5RA 3AE6C 2ZJSE 2FBWC 3WUUA 1L0NG 2OYIA 2IX7C 3E1IA 2AEFA 1RE3A 2GM4A 1E5WA 4GOEA 5CCGD 1YQ4C 2E75D 2N1TD 1KB9D 1RE4C 1BE3E 3CXHD 3MIWA 1KQFB 1L4AC 1EZVI 1QX8A 3SWFA 3LW5J 3KQGA 1UIIA 5KLIC 2OTJP 1G2CB 5CBNA 2D2CB 3H1HJ 2WZ7A 2N1TB 1VQNP 4D6TD 2YKQA 3G71P 2YMYA 1L0NJ 3L73G 2JJLA 2K3RA 5KJ7C 1N73B 2ZFCA 5CHXA 3KYQA 2FYUG 2KNCA 3SFEC 2CPSA 1LTIC 5KAFE 2M8RA 2C0WA 3WMM0 2XZRA 2QVAA 1DIPA 1VQKP 1Q81Q 1BCCD 1BDCA 3CWBE 2A06G 1MKMA 1PP9D 5CCGC 1KN7A 2N1TC 2JP3A 3D6ZA 1KYOI 3TYYA 3QH9A 3L73J 3V2QA 1IFPA 3CCJP 4EOTA 1PL5A 2FYUJ 5AW3B 1N73C 1JUNA 2ZVOB 2R32A 1VL2A 1NTMG 2POHA 1L0NK 1J1EB 3I5CA 3KDPB 3CD6P 1RY3A 1L0LD 3PLNA 2HG5D 1K8AQ 5APSA 2M3BA 3W67A 3H1HD 2KXPB 3BASA 2W6BA 5AVTB 2P7JA 2A45G 4BRYB 2IYOA 1GL2A 1RH5B 1SQVG 3HE4A 2KUBA 3TK1A 3H1HE 4JYBA 3CX5I 2FYZA 2JEEA 1L0NE 2FYUK 2FY8A 1CI6A 1QGKB 1VQMP 3MGNA 1YHQP 1FZEA 2KLVA 2Q3EA 3L75D 3M06A 2Q1KA 3V4QA 1AFOA 1JMMA 2OYIC 2FYUD 1T6AA 1RE3C 1BSNA 1VQ6P 1EZVG 1VPCA 4O9BA 3AEFC 3V4WA 1OVRA 3L73E 4Y28J 2OYHB 2A45H 2FYUE 3LIEA 2V7QJ 2AEMA 2P1JA 1IK9A 2ZT9B 1SFCB 1Y9BA 1BDDA 1X9VA 1KILB 1SQBK 2A06E 3GG2A 1S5LX 1OW7A 5AVWB 1KILE 4IFMA 1SQXG 2P67A 3RK3D 1ZOYC 1LTSC 2V7QH 3AEEC 3S1KA 4U3FE 1EQ7A 2Q5UA 1EDLA 4Y99C 1SQBD 1UIXA 1GL2D 3RK3B 1ZR2A 1NTME 1JEKA 1N7SA 3FXDA 5AVRB 3B4SA 1SFCC 2J5UA 2IBZI 1Q90D 2O1JA 1GD2E 1HVVA 3AE9C 4XE5B 3RBXA 1PGPA 1OXZA 2W83C 2RH0A 4EYYQ 5AW5B 4OVNF 1AV1A 2B88A 1SQVE 3RK3C 3RL0D 3Q3DA 5KLVG 1OW6A 2FXOA 1VDFA 1HGZA 3JCUH 1MZ9A 4BXLA 4N78E 4EIJA 4HYTB 2N9BA 1U57A 4OGQB 2O3JA 1KQLA 1ZLLA 3AEAC 1GL2C 2W8ZA 3JC22 1EZVD 2XNDH 3O8ZA 3RK2B 3NTNA 3T97A 1EXJA 3V2PA 2PRRA 4OH8B 5M1BA 3M0DA 4KJMA 3VMZA 2GUSA 1K05A 1VQLP 2RN0A 1PPJG 1NU1G 3P8MC 2WWWA 1GZLA 1IFIA 1OW8A 1FC2C 2NPSA 2M5AB 3RL0C 2AXTH 1YJNP 1OWAA 3PP5A 2YO2A 1N7SD 4YTPC 1KYOD 2FYNC 1ZMEC 1W5CE 2HODB 1SQXE 1IFMA 3JCUE 1MFTA 1AVYA 3H1JD 3L72D 1BSHA 2OTKE 1GMJA 4PJ0H 2PAJA 1IZNB 1J1DC 4A7PA 3MP7B 2QJYC 2B89A 1U7MA 2GUVA 2H43A 4LLHA 2WT7B 3IFMA 3TGUD 1FJPA 5APUA 3AEGC 2Q3IA 1LTJA 2JWAA 3AECC 3VMXA 1N7SC 3CX5D 3TDKA 2OARA 2NZ2A 2AXTE 5APYA 2XU6A 2Q9IA 3GF3A 1RHZB 5KLVE 3L4FA 4WB4A 4PV1D 3AEDC 4I1LA 3VP8A 2WSCJ 4GT1A 2NPSD 2QJPB 2J58A 4PV1B 1S9KD 2W90A 3HUSB 3CPWO 1RF0A 2YKPA 4PJ0E 3A5TA 1NHLA 2NPSB 3H1KJ 3S4RA 3GW6A 3Q5SA 2OGUA 1PPJE 2H88C 1NU1E 3B8EB 3WUVA 2WSCH 3FWNA 2K9YA 1AJYA 1Q2NA 1LWUA 2QA4P 3KZIE 5APVA 3M0DC 2JR8A 3KPEA 1H8AA 4PV1C 4U7JA 3C8VA 3HUSC 4TLFA 4TT3H 5AW6B 2NPSC 4IL6H 2HYNA 1YJ9P 1WT6A 1FBMA 1FJKA 1BCCG 1NWQA 2B87B 4MN4C 1YTZI 2RKLA 3F5HA 1PZQA 3HRNA 3A0HE 1KB9H 1USEA 1KORA 2IBZD 3CXHH 4PD4I 4EDFA 2M0BA 1T8ZA 1M7LA 3H32A 4XA4A 3H1KD 3M9BA 2FFDB 1L4AB 1JCCA 3G3ZA 5KLIB 1L0LG 2I8DA 3AE5C 5AW1B 3CMAP 4KT0J 3VOPA 1FU1A 4HJGH 1JTHB 1AQTA 1LTJC 5AVZB 2QJKB 3C1LA 1KFNA 4IL6E 4H0LD 5L8RJ 1FE6A 2FFDC 3ZDMA 1L0LJ 1A02J 1MUUA 3AE4C 5AVXB 3CLQA 1NKZB 2E75B 2AXCA 1NKNA 3SWYA 1KB9E 3OA7A 2IZ1A 1LTBC 2WPSA 3CXHE 3L75G 4ZKPA 4ASWA 3P8CD 3LW5H 1NVOA 3TNUA 2BCCG 2QJKC 1H0TA 1M90Q 1R5LA 4D6TE 2W27A 1D7MA 2PFXA 3A7OA 2NRGA 1Y47A 3L71J 1QL2A 3VTPC 4H0LC 3V2NA 2E75C 1LWUC 2ZYGA 1L0LK 1N86A 3L75J 1PGQA 1W2EA 1T2KD 3PH0A 1BCCE 4N6JA 5APQA 2BCCJ 2QRXA 3M9QA 1PP9E 2HPCA 2BEZF 2Q6QA 4HKZH 4NPDA 3CCLP 5BU8B 5KAIH 1Y8AA 5CBOA 1SQBG 3GF7A 1SLQA 1CSBA 1FZBA 3L35A 3Q1MA 4H44D 1PGJA 1NOHA 2OYIB 1L0LE 4N3YB 1NH4A 2CPBA 3H1LJ 3D70A 5GTIH 3V2RA 3IF4A 3D6YA 1P84I 1T2KC 2WVRA 1KQSO 1LP1A 1SQBJ 3L71D 2ZYAA 3SWKA 5CMZA 2IFNA 2HFED 4L74A 3M9HA 2M3EA 2O01J 1HTLC 2C9LY 2G3AA 1LTAC 2BCCD 2KNCB 1GK4A 1G1IA 3I55P 2YNYA 1S4XA 2YKOA 4H44C 3USSA 3L75E 2K88A 3HD7A 3G9RA 4Y99B 2WSSH 1EDJA 2BCCE 2WSFJ 2O01H 3GMAA 3I56P 1DH3A 3AE3C 3RBZA 3RGUA 2XNXA 1LT1A 1LNQA 4C7NA 1FDOA 5BVZA 1HGVA 2I1JA 5GTIE 4EI2A 1SP4A 3H1LD 5TISH 2HPCB 4C46A 1JNMA 4DZOA 1U7JA 2WSFH 2E76D 4LGDE 2Z5HA 3G6EP 1LT9A 4BWNA 3IR9A 2Y9ZA 4CPGA 1PGOA 4R4MA 1ZN5A 3H25A 4PD4D 3RK3E 3H1JG 3L72G 3AE8C 1GL2B 3EWKA 4LC1A 3HE4B 1GTWA 2LKMA 4HB1A 1SQBE 2QM8A 2K1AA 2Y0DA 1M56D 4JYCA 3NXSA 1LP1B 1CI6B 3TGUG 1R8EA 5BU5A 2H7HA 1NTZG 1YITP 1M57D 2R5DA 1E79H 2E76C 1TU3F 3L70D 1EC5A 3H1JJ 2IFMA 3L72J 4K3AA 5CJ4A 1AVOA 3Q5PA 1OFCX 3HD7D 3CMEP 2OTLP 2LR2A 3O6QA 5TISE 3RL0B 1KYOH 1QLED 3W68A 2K9JA 1VQ5P 5AVYB 1JY2P 2Z4EA 3HD7B 1PV3A 2KS1A 2FYNB 3TGUJ 1M1JA 1NTZJ 1W2BO 3ABVC 1X8YA 1EZVE 1LGHB 1KZUB 1SQQD 4HH2A 2R3SA 2KSJA 2YIUB 1J1DB 1RQVA 2QJYB 3L74J 1HJBA 2ITAA 2H89C 2V4HA 2W6AA 3SFDC 4ZNCA 3PTZA 2C0XA 1ZR4A 3HD7C 1VQ8P 1PIXA 2KZIA 5CCHA 3CX5H 3H1IG 1P84H 1CZQA 1N7SB 2BEQD 1M8OB 4ASVA 5H2FH 1NTKJ 3HTKA 1NTZK 1KYOE 2YIUC 1QEXA 4H13D 3II6A 2YMKA 1S5LH 4R4LA 2L91A 4I7ZC 3H1JE 1OVUA 3Q2YA 3L72E 1S1CX 3QWOC 1KMIZ 4NPFX 5AVUB 5AW4B 1JY2N 1NTZD 3AEBC 3H1IJ 1IK7A 1SVFA 2WMMA 1X22A 1JY3N 2IBZG 3OAKA 1FZCA 5AVVB 1VQ4P 3ITKA 4ZKUA 3TGUE 3CC4P 3H1KG 3L74D 1DD3A 1P84D 1EDKA 1GDTA 3CC2P 1ZRTD 2K9JB 3T97B 1R5SA 1NTKK 1ZV8A 2C9NY 4L75A 3MTUE 1YBKA 3CX5E 1JM0A 3HE5A 1RE4A 3EFFK 2FXPA 4H13C 1J2JB 3A3YB 1NO4A 1RF1A 5H2FE 1N7LA 2Q7CA 2P2UA 1NTKD 2SPZA 3BCCJ 4C7RA 1XTGB 1VQOP 3E7KA 1S5LE 2WTYA 5CCHD 3VP9A 5EFWB 1S9KE 3VMAA 1OX3A 3NFQA 3H6PA 4W80A 1AQ5A 1NYHA 1KV4A 1M1JC 5B5EH 3H1ID 4GIFA 2QSIA 1SQPK 2ZYDA 2L5GB 1JY2O 2N1TA 3KHUA 4L73A 1BE3J 4UB8H 3A0BH 1JY3O 3E1RA 3H1IE 3FGAD 4YXWH 1SQPD 1HUCA 1IFDA 3MZWB 1HH0A 1EXIA 5DJTB 2MKVA 3FWLA 2E74D 5CCHC 1G1JA 2E42A 1LTJB 2DW3A 3AE7C 3TF5A 2ZXXA 2K37A 1K9MQ 1JB0J 3BCCD 1VF5D 1NAFA 2I1KA 3CWBJ 4W7ZA 1KC8Q 2IBZE 2XKMA 3V5BA 2KOGA 5B5EE 4WVZA 3H1KE 2ZVNB 5E79H 3UIAA 5AW7B 1ZXGA 3GHGA 1EDIA 1IFNA 3P32A 4QMAA 3CCEP 2AEJA 2O01N 4UB8E 3A0BE 2E74C 1BE3D 5KKZB 4L76A 4DOJA 1T3UA 1SS1A 1Q82Q 3CCUP 4BRYA 4H0LB 5AW0B 1LWUB 3L71G 2P58A 3B71A 5AVQB 1VF5C 2D2CD 2E43A 2LXBA 1RF1C 1YQ3C 3U1CA 1RF0C 1YI2P 5K5GB 1WRGA 5B66H 1QL1A 2G8YA 5KKZC 3CWBD 1FZFA 3K5BA 1HF9A 1PFIA 3P8CE 2CK3H 2R44A 2LXCB 5E79E 1BGYG 5APWA
chains in the Genus database with same CATH topology
3FXDA 4HJGH 5CBOA 1JM0A 2KIKA 1U7JA 2B87A 1Q2NA 2K3RA 1MFTA 2OTKE 4NPEA 4CPGA 3ZDMA 2UWJE 4K35A 1X0TA 2ZAEB 4ZNCA 4EYYQ 2SPZA 1S3JA 2KI7B 2Q1KA 2KS1B 2B89A 2B88A 2KZIA 1ZXGA 1EDIA 2HR3A 1U7MA 2QVAA 5EFWB 1BDCA 3MHVA 1OVVA 1LP1A 4HB1A 3FXEA 4ZMDA 1DEEG 4BXLA 2JWDA 1OVRA 4ASVA 4ASWA 1NVOA 1ZW0A 2M5AA 1H0TA 1SS1A 1LP1B 2B87B 4MN4C 2RKLA 2P58A 4GODA 2LXBA 1OVUA 1Y47A 1EC5A 1BDDA 4WWIA 4KJMA 2M0BA 3QWOC 5DJUB 4K3AA 4NPFX 2LR2A 2WMMA 4GOFA 3MZWB 4IOIH 3PH0A 1EDJA 5K5GB 1FC2C 5DJTB 2I8DA 3S1KA 2QRXA 4GOEA 4JBZA 3RGUA 2M5AB 2KZJA 1EDLA 1LT1A 1H0TB 1EDKA 1JMBA 2R44A 2LXCB 4HKZH 4NPDA 2KUBA 5CBNA 5C39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXD A;  4HJG H;  5CBO A;  1JM0 A;  2KIK A;  1U7J A;  2B87 A;  1Q2N A;  2K3R A;  1MFT A;  2OTK E;  4NPE A;  4CPG A;  3ZDM A;  2UWJ E;  4K35 A;  1X0T A;  2ZAE B;  4ZNC A;  4EYY Q;  2SPZ A;  1S3J A;  2KI7 B;  2Q1K A;  2KS1 B;  2B89 A;  2B88 A;  2KZI A;  1ZXG A;  1EDI A;  2HR3 A;  1U7M A;  2QVA A;  5EFW B;  1BDC A;  3MHV A;  1OVV A;  1LP1 A;  4HB1 A;  3FXE A;  4ZMD A;  1DEE G;  4BXL A;  2JWD A;  1OVR A;  4ASV A;  4ASW A;  1NVO A;  1ZW0 A;  2M5A A;  1H0T A;  1SS1 A;  1LP1 B;  2B87 B;  4MN4 C;  2RKL A;  2P58 A;  4GOD A;  2LXB A;  1OVU A;  1Y47 A;  1EC5 A;  1BDD A;  4WWI A;  4KJM A;  2M0B A;  3QWO C;  5DJU B;  4K3A A;  4NPF X;  2LR2 A;  2WMM A;  4GOF A;  3MZW B;  4IOI H;  3PH0 A;  1EDJ A;  5K5G B;  1FC2 C;  5DJT B;  2I8D A;  3S1K A;  2QRX A;  4GOE A;  4JBZ A;  3RGU A;  2M5A B;  2KZJ A;  1EDL A;  1LT1 A;  1H0T B;  1EDK A;  1JMB A;  2R44 A;  2LXC B;  4HKZ H;  4NPD A;  2KUB A;  5CBN A;  5C39 A; 
#chains in the Genus database with same CATH topology
 4IFF A;  4AQR D;  3H32 B;  4I2L C;  3PHL A;  2OYH A;  3KXD A;  3H1L G;  2D2C C;  4NPE A;  5APX A;  1A02 F;  2VRS A;  1USD A;  1RQU A;  1H89 A;  1SFC A;  4KHX A;  4U3F G;  1KIL A;  1HBW A;  2HR3 A;  2HLO A;  1BGY J;  3L37 A;  1IO4 A;  4YPC A;  1K04 A;  5APT A;  3GHG B;  3VN0 A;  2Y0E A;  1VQP P;  5B66 E;  4H44 B;  4U3F J;  5AW2 B;  1L0N D;  3BVH A;  2OYO A;  1GU4 A;  1K73 Q;  3CI9 A;  1NTM J;  5AW8 B;  3CCQ P;  1MFZ A;  1VQ9 P;  3M0A A;  3L70 G;  1N2D C;  3B5N A;  4IOI H;  1J1E C;  4W7Y A;  4OWF A;  1N8R Q;  3M91 A;  3GHG C;  4WY4 A;  3TNU B;  3L71 E;  4UB6 H;  1JO5 A;  1JOC A;  1H0T B;  3MUD A;  1GK6 A;  5KAI E;  3L73 D;  4PD4 H;  5C39 A;  4IFD K;  1KD1 Q;  1SQV J;  4Z1M H;  2BAS A;  1Z56 A;  1BGY D;  1YJW P;  3L70 J;  3VYI A;  1SQQ G;  3OJA B;  1VQ7 P;  2UWJ E;  2ZAE B;  1WMK A;  2ZT9 D;  4AYC A;  1LTG C;  1H88 A;  1FS0 E;  2JO1 A;  2A06 D;  1SFC D;  3LID A;  1NTM K;  1KIL D;  3JSV C;  1AA0 A;  1BGY E;  1MV8 A;  2WPV B;  1DEB A;  1CW5 A;  3MHV A;  4DCK A;  1IC2 A;  4U3F D;  2WPR A;  3RL0 g;  4ZMD A;  1Q7Y Q;  3H1L E;  2M5A A;  1DX7 A;  2E76 B;  1NTM D;  3BRT B;  3IN6 A;  1SQQ J;  1URQ A;  4DJG A;  1SQV K;  2QG4 A;  4UB6 E;  1L2P A;  4WWI A;  2OYH C;  5DJU B;  3V6I A;  2HOD A;  4PD4 E;  2FXM A;  1T3J A;  3S9O A;  2ZT9 C;  3C9I A;  2J59 M;  3B5N D;  1NAY A;  2QE7 H;  3EQ2 A;  1KIL C;  3WUT A;  2B9B A;  1SQV D;  4WY4 D;  2R5B A;  1IJD B;  2XDJ A;  2ZXE B;  1SQX J;  3IAO A;  3B5N B;  4AUW A;  4YXD C;  4WBA A;  1JMB A;  4N78 D;  3GLM A;  4WY4 B;  2WT7 A;  1HJ0 A;  3L74 G;  4OGQ D;  2RMZ A;  2Y9Y A;  3L36 A;  1SQQ K;  4JPZ B;  3R2P A;  3L70 E;  2IDB A;  1IFJ A;  3RK2 D;  1JY3 P;  1HWT C;  1KTM A;  4M3L A;  4K35 A;  1X0T A;  5TJH A;  3MD0 A;  1S3J A;  2YXR B;  1OMI A;  1FAV A;  2XV5 A;  2W6J H;  2QEX P;  3B5N C;  1KB9 I;  1YTZ T;  3CXH I;  4RKU J;  4C7N B;  1NTK G;  3NMD A;  1OVV A;  1OIP A;  4JQ0 D;  4WY4 C;  5GTH H;  3CCR P;  1SQX K;  2MJZ A;  1X79 B;  4I7Z B;  2PP6 A;  5KLV J;  2N9Y B;  3MUD C;  3SSU A;  1SQQ E;  3HUS A;  1LT9 B;  2R3C A;  1URQ D;  4IL6 X;  3P7K A;  2IZ0 A;  4GOD A;  2Z5I A;  4OGQ C;  1FDM A;  1SQX D;  1URQ B;  3RK2 C;  2JDI H;  3F89 A;  4GOF A;  2KP8 A;  2QM7 A;  1NU1 J;  4DT0 A;  1QVF O;  2KZJ A;  1SQP G;  1LT9 C;  3D71 A;  5CJ0 A;  4H13 B;  3CCS P;  1FZG A;  5KLV K;  2KIK A;  1URQ C;  2GA1 A;  5GTH E;  2B87 A;  1KFM A;  5KTB A;  3O6Q B;  3BCC G;  1ZP0 C;  1NTZ E;  3KZI H;  5AW9 B;  4GKG A;  3CC7 P;  2H8P D;  5KLV D;  1FZA A;  1SQP J;  2KS1 B;  3FX0 A;  3AE1 C;  3A2A A;  1LJ2 A;  1M1J B;  3VMY A;  1M1K Q;  1NU1 K;  3AE2 C;  1KQG B;  3L74 E;  1P84 E;  4B86 A;  2FFD A;  1L4A A;  3OW2 O;  2KYV A;  1ZRT E;  2QIW A;  2KB7 P;  3N4X A;  2JWD A;  1FDI A;  1ZW0 A;  3CCV P;  2WQY C;  1BE3 G;  1PPJ D;  1NU1 D;  2KK7 A;  3BRV B;  5KJ7 A;  3BAT A;  2WIT A;  2PGD A;  1JTH A;  4I6M C;  3A0H H;  2OQQ A;  2E5T A;  1NTK E;  2FKW B;  2WPQ A;  2O1K A;  1YIJ P;  3U1A A;  3R4Y A;  1NGM B;  3WU2 H;  2KLU A;  5AVS B;  1JCD A;  1GW4 A;  1G2C A;  4JBZ A;  5CCG A;  3HTK B;  2E5Y A;  4JF7 A;  4D6T G;  2IYP A;  1Q86 Q;  2QJP C;  1N73 A;  3EFG A;  3CWB G;  1QVG O;  2YXQ B;  1LTT C;  4GDO A;  1DD4 A;  2YO3 A;  1SQP E;  1FZC B;  4RES B;  2JKV A;  2KI7 B;  2E74 B;  1PP9 G;  2Y0C A;  1FOS F;  3PJS K;  4RJT A;  4RO0 A;  3TSI A;  4D6T J;  2WSE J;  3G4S P;  1NJI Q;  4XFJ A;  1OZH A;  1L4A D;  3PRJ A;  3FXE A;  1XTC C;  1DEE G;  1VF5 B;  2A45 I;  3HE5 B;  1S72 P;  3BCC E;  3WU2 E;  3N7N A;  1FOS E;  1GW3 A;  5KAF H;  1YYC A;  3CL3 D;  1S2E A;  1RF1 B;  2KSE A;  3U59 A;  1BCC J;  2WSE H;  1GU5 A;  5KJ7 D;  2P10 A;  1PP9 J;  3CCM P;  1FZC C;  3H1H G;  2IPP A;  3Q5R A;  3AE6 C;  2ZJS E;  2FBW C;  3WUU A;  1L0N G;  2OYI A;  2IX7 C;  3E1I A;  2AEF A;  1RE3 A;  2GM4 A;  1E5W A;  4GOE A;  5CCG D;  1YQ4 C;  2E75 D;  2N1T D;  1KB9 D;  1RE4 C;  1BE3 E;  3CXH D;  3MIW A;  1KQF B;  1L4A C;  1EZV I;  1QX8 A;  3SWF A;  3LW5 J;  3KQG A;  1UII A;  5KLI C;  2OTJ P;  1G2C B;  5CBN A;  2D2C B;  3H1H J;  2WZ7 A;  2N1T B;  1VQN P;  4D6T D;  2YKQ A;  3G71 P;  2YMY A;  1L0N J;  3L73 G;  2JJL A;  2K3R A;  5KJ7 C;  1N73 B;  2ZFC A;  5CHX A;  3KYQ A;  2FYU G;  2KNC A;  3SFE C;  2CPS A;  1LTI C;  5KAF E;  2M8R A;  2C0W A;  3WMM 0;  2XZR A;  2QVA A;  1DIP A;  1VQK P;  1Q81 Q;  1BCC D;  1BDC A;  3CWB E;  2A06 G;  1MKM A;  1PP9 D;  5CCG C;  1KN7 A;  2N1T C;  2JP3 A;  3D6Z A;  1KYO I;  3TYY A;  3QH9 A;  3L73 J;  3V2Q A;  1IFP A;  3CCJ P;  4EOT A;  1PL5 A;  2FYU J;  5AW3 B;  1N73 C;  1JUN A;  2ZVO B;  2R32 A;  1VL2 A;  1NTM G;  2POH A;  1L0N K;  1J1E B;  3I5C A;  3KDP B;  3CD6 P;  1RY3 A;  1L0L D;  3PLN A;  2HG5 D;  1K8A Q;  5APS A;  2M3B A;  3W67 A;  3H1H D;  2KXP B;  3BAS A;  2W6B A;  5AVT B;  2P7J A;  2A45 G;  4BRY B;  2IYO A;  1GL2 A;  1RH5 B;  1SQV G;  3HE4 A;  2KUB A;  3TK1 A;  3H1H E;  4JYB A;  3CX5 I;  2FYZ A;  2JEE A;  1L0N E;  2FYU K;  2FY8 A;  1CI6 A;  1QGK B;  1VQM P;  3MGN A;  1YHQ P;  1FZE A;  2KLV A;  2Q3E A;  3L75 D;  3M06 A;  2Q1K A;  3V4Q A;  1AFO A;  1JMM A;  2OYI C;  2FYU D;  1T6A A;  1RE3 C;  1BSN A;  1VQ6 P;  1EZV G;  1VPC A;  4O9B A;  3AEF C;  3V4W A;  1OVR A;  3L73 E;  4Y28 J;  2OYH B;  2A45 H;  2FYU E;  3LIE A;  2V7Q J;  2AEM A;  2P1J A;  1IK9 A;  2ZT9 B;  1SFC B;  1Y9B A;  1BDD A;  1X9V A;  1KIL B;  1SQB K;  2A06 E;  3GG2 A;  1S5L X;  1OW7 A;  5AVW B;  1KIL E;  4IFM A;  1SQX G;  2P67 A;  3RK3 D;  1ZOY C;  1LTS C;  2V7Q H;  3AEE C;  3S1K A;  4U3F E;  1EQ7 A;  2Q5U A;  1EDL A;  4Y99 C;  1SQB D;  1UIX A;  1GL2 D;  3RK3 B;  1ZR2 A;  1NTM E;  1JEK A;  1N7S A;  3FXD A;  5AVR B;  3B4S A;  1SFC C;  2J5U A;  2IBZ I;  1Q90 D;  2O1J A;  1GD2 E;  1HVV A;  3AE9 C;  4XE5 B;  3RBX A;  1PGP A;  1OXZ A;  2W83 C;  2RH0 A;  4EYY Q;  5AW5 B;  4OVN F;  1AV1 A;  2B88 A;  1SQV E;  3RK3 C;  3RL0 D;  3Q3D A;  5KLV G;  1OW6 A;  2FXO A;  1VDF A;  1HGZ A;  3JCU H;  1MZ9 A;  4BXL A;  4N78 E;  4EIJ A;  4HYT B;  2N9B A;  1U57 A;  4OGQ B;  2O3J A;  1KQL A;  1ZLL A;  3AEA C;  1GL2 C;  2W8Z A;  3JC2 2;  1EZV D;  2XND H;  3O8Z A;  3RK2 B;  3NTN A;  3T97 A;  1EXJ A;  3V2P A;  2PRR A;  4OH8 B;  5M1B A;  3M0D A;  4KJM A;  3VMZ A;  2GUS A;  1K05 A;  1VQL P;  2RN0 A;  1PPJ G;  1NU1 G;  3P8M C;  2WWW A;  1GZL A;  1IFI A;  1OW8 A;  1FC2 C;  2NPS A;  2M5A B;  3RL0 C;  2AXT H;  1YJN P;  1OWA A;  3PP5 A;  2YO2 A;  1N7S D;  4YTP C;  1KYO D;  2FYN C;  1ZME C;  1W5C E;  2HOD B;  1SQX E;  1IFM A;  3JCU E;  1MFT A;  1AVY A;  3H1J D;  3L72 D;  1BSH A;  2OTK E;  1GMJ A;  4PJ0 H;  2PAJ A;  1IZN B;  1J1D C;  4A7P A;  3MP7 B;  2QJY C;  2B89 A;  1U7M A;  2GUV A;  2H43 A;  4LLH A;  2WT7 B;  3IFM A;  3TGU D;  1FJP A;  5APU A;  3AEG C;  2Q3I A;  1LTJ A;  2JWA A;  3AEC C;  3VMX A;  1N7S C;  3CX5 D;  3TDK A;  2OAR A;  2NZ2 A;  2AXT E;  5APY A;  2XU6 A;  2Q9I A;  3GF3 A;  1RHZ B;  5KLV E;  3L4F A;  4WB4 A;  4PV1 D;  3AED C;  4I1L A;  3VP8 A;  2WSC J;  4GT1 A;  2NPS D;  2QJP B;  2J58 A;  4PV1 B;  1S9K D;  2W90 A;  3HUS B;  3CPW O;  1RF0 A;  2YKP A;  4PJ0 E;  3A5T A;  1NHL A;  2NPS B;  3H1K J;  3S4R A;  3GW6 A;  3Q5S A;  2OGU A;  1PPJ E;  2H88 C;  1NU1 E;  3B8E B;  3WUV A;  2WSC H;  3FWN A;  2K9Y A;  1AJY A;  1Q2N A;  1LWU A;  2QA4 P;  3KZI E;  5APV A;  3M0D C;  2JR8 A;  3KPE A;  1H8A A;  4PV1 C;  4U7J A;  3C8V A;  3HUS C;  4TLF A;  4TT3 H;  5AW6 B;  2NPS C;  4IL6 H;  2HYN A;  1YJ9 P;  1WT6 A;  1FBM A;  1FJK A;  1BCC G;  1NWQ A;  2B87 B;  4MN4 C;  1YTZ I;  2RKL A;  3F5H A;  1PZQ A;  3HRN A;  3A0H E;  1KB9 H;  1USE A;  1KOR A;  2IBZ D;  3CXH H;  4PD4 I;  4EDF A;  2M0B A;  1T8Z A;  1M7L A;  3H32 A;  4XA4 A;  3H1K D;  3M9B A;  2FFD B;  1L4A B;  1JCC A;  3G3Z A;  5KLI B;  1L0L G;  2I8D A;  3AE5 C;  5AW1 B;  3CMA P;  4KT0 J;  3VOP A;  1FU1 A;  4HJG H;  1JTH B;  1AQT A;  1LTJ C;  5AVZ B;  2QJK B;  3C1L A;  1KFN A;  4IL6 E;  4H0L D;  5L8R J;  1FE6 A;  2FFD C;  3ZDM A;  1L0L J;  1A02 J;  1MUU A;  3AE4 C;  5AVX B;  3CLQ A;  1NKZ B;  2E75 B;  2AXC A;  1NKN A;  3SWY A;  1KB9 E;  3OA7 A;  2IZ1 A;  1LTB C;  2WPS A;  3CXH E;  3L75 G;  4ZKP A;  4ASW A;  3P8C D;  3LW5 H;  1NVO A;  3TNU A;  2BCC G;  2QJK C;  1H0T A;  1M90 Q;  1R5L A;  4D6T E;  2W27 A;  1D7M A;  2PFX A;  3A7O A;  2NRG A;  1Y47 A;  3L71 J;  1QL2 A;  3VTP C;  4H0L C;  3V2N A;  2E75 C;  1LWU C;  2ZYG A;  1L0L K;  1N86 A;  3L75 J;  1PGQ A;  1W2E A;  1T2K D;  3PH0 A;  1BCC E;  4N6J A;  5APQ A;  2BCC J;  2QRX A;  3M9Q A;  1PP9 E;  2HPC A;  2BEZ F;  2Q6Q A;  4HKZ H;  4NPD A;  3CCL P;  5BU8 B;  5KAI H;  1Y8A A;  5CBO A;  1SQB G;  3GF7 A;  1SLQ A;  1CSB A;  1FZB A;  3L35 A;  3Q1M A;  4H44 D;  1PGJ A;  1NOH A;  2OYI B;  1L0L E;  4N3Y B;  1NH4 A;  2CPB A;  3H1L J;  3D70 A;  5GTI H;  3V2R A;  3IF4 A;  3D6Y A;  1P84 I;  1T2K C;  2WVR A;  1KQS O;  1LP1 A;  1SQB J;  3L71 D;  2ZYA A;  3SWK A;  5CMZ A;  2IFN A;  2HFE D;  4L74 A;  3M9H A;  2M3E A;  2O01 J;  1HTL C;  2C9L Y;  2G3A A;  1LTA C;  2BCC D;  2KNC B;  1GK4 A;  1G1I A;  3I55 P;  2YNY A;  1S4X A;  2YKO A;  4H44 C;  3USS A;  3L75 E;  2K88 A;  3HD7 A;  3G9R A;  4Y99 B;  2WSS H;  1EDJ A;  2BCC E;  2WSF J;  2O01 H;  3GMA A;  3I56 P;  1DH3 A;  3AE3 C;  3RBZ A;  3RGU A;  2XNX A;  1LT1 A;  1LNQ A;  4C7N A;  1FDO A;  5BVZ A;  1HGV A;  2I1J A;  5GTI E;  4EI2 A;  1SP4 A;  3H1L D;  5TIS H;  2HPC B;  4C46 A;  1JNM A;  4DZO A;  1U7J A;  2WSF H;  2E76 D;  4LGD E;  2Z5H A;  3G6E P;  1LT9 A;  4BWN A;  3IR9 A;  2Y9Z A;  4CPG A;  1PGO A;  4R4M A;  1ZN5 A;  3H25 A;  4PD4 D;  3RK3 E;  3H1J G;  3L72 G;  3AE8 C;  1GL2 B;  3EWK A;  4LC1 A;  3HE4 B;  1GTW A;  2LKM A;  4HB1 A;  1SQB E;  2QM8 A;  2K1A A;  2Y0D A;  1M56 D;  4JYC A;  3NXS A;  1LP1 B;  1CI6 B;  3TGU G;  1R8E A;  5BU5 A;  2H7H A;  1NTZ G;  1YIT P;  1M57 D;  2R5D A;  1E79 H;  2E76 C;  1TU3 F;  3L70 D;  1EC5 A;  3H1J J;  2IFM A;  3L72 J;  4K3A A;  5CJ4 A;  1AVO A;  3Q5P A;  1OFC X;  3HD7 D;  3CME P;  2OTL P;  2LR2 A;  3O6Q A;  5TIS E;  3RL0 B;  1KYO H;  1QLE D;  3W68 A;  2K9J A;  1VQ5 P;  5AVY B;  1JY2 P;  2Z4E A;  3HD7 B;  1PV3 A;  2KS1 A;  2FYN B;  3TGU J;  1M1J A;  1NTZ J;  1W2B O;  3ABV C;  1X8Y A;  1EZV E;  1LGH B;  1KZU B;  1SQQ D;  4HH2 A;  2R3S A;  2KSJ A;  2YIU B;  1J1D B;  1RQV A;  2QJY B;  3L74 J;  1HJB A;  2ITA A;  2H89 C;  2V4H A;  2W6A A;  3SFD C;  4ZNC A;  3PTZ A;  2C0X A;  1ZR4 A;  3HD7 C;  1VQ8 P;  1PIX A;  2KZI A;  5CCH A;  3CX5 H;  3H1I G;  1P84 H;  1CZQ A;  1N7S B;  2BEQ D;  1M8O B;  4ASV A;  5H2F H;  1NTK J;  3HTK A;  1NTZ K;  1KYO E;  2YIU C;  1QEX A;  4H13 D;  3II6 A;  2YMK A;  1S5L H;  4R4L A;  2L91 A;  4I7Z C;  3H1J E;  1OVU A;  3Q2Y A;  3L72 E;  1S1C X;  3QWO C;  1KMI Z;  4NPF X;  5AVU B;  5AW4 B;  1JY2 N;  1NTZ D;  3AEB C;  3H1I J;  1IK7 A;  1SVF A;  2WMM A;  1X22 A;  1JY3 N;  2IBZ G;  3OAK A;  1FZC A;  5AVV B;  1VQ4 P;  3ITK A;  4ZKU A;  3TGU E;  3CC4 P;  3H1K G;  3L74 D;  1DD3 A;  1P84 D;  1EDK A;  1GDT A;  3CC2 P;  1ZRT D;  2K9J B;  3T97 B;  1R5S A;  1NTK K;  1ZV8 A;  2C9N Y;  4L75 A;  3MTU E;  1YBK A;  3CX5 E;  1JM0 A;  3HE5 A;  1RE4 A;  3EFF K;  2FXP A;  4H13 C;  1J2J B;  3A3Y B;  1NO4 A;  1RF1 A;  5H2F E;  1N7L A;  2Q7C A;  2P2U A;  1NTK D;  2SPZ A;  3BCC J;  4C7R A;  1XTG B;  1VQO P;  3E7K A;  1S5L E;  2WTY A;  5CCH D;  3VP9 A;  5EFW B;  1S9K E;  3VMA A;  1OX3 A;  3NFQ A;  3H6P A;  4W80 A;  1AQ5 A;  1NYH A;  1KV4 A;  1M1J C;  5B5E H;  3H1I D;  4GIF A;  2QSI A;  1SQP K;  2ZYD A;  2L5G B;  1JY2 O;  2N1T A;  3KHU A;  4L73 A;  1BE3 J;  4UB8 H;  3A0B H;  1JY3 O;  3E1R A;  3H1I E;  3FGA D;  4YXW H;  1SQP D;  1HUC A;  1IFD A;  3MZW B;  1HH0 A;  1EXI A;  5DJT B;  2MKV A;  3FWL A;  2E74 D;  5CCH C;  1G1J A;  2E42 A;  1LTJ B;  2DW3 A;  3AE7 C;  3TF5 A;  2ZXX A;  2K37 A;  1K9M Q;  1JB0 J;  3BCC D;  1VF5 D;  1NAF A;  2I1K A;  3CWB J;  4W7Z A;  1KC8 Q;  2IBZ E;  2XKM A;  3V5B A;  2KOG A;  5B5E E;  4WVZ A;  3H1K E;  2ZVN B;  5E79 H;  3UIA A;  5AW7 B;  1ZXG A;  3GHG A;  1EDI A;  1IFN A;  3P32 A;  4QMA A;  3CCE P;  2AEJ A;  2O01 N;  4UB8 E;  3A0B E;  2E74 C;  1BE3 D;  5KKZ B;  4L76 A;  4DOJ A;  1T3U A;  1SS1 A;  1Q82 Q;  3CCU P;  4BRY A;  4H0L B;  5AW0 B;  1LWU B;  3L71 G;  2P58 A;  3B71 A;  5AVQ B;  1VF5 C;  2D2C D;  2E43 A;  2LXB A;  1RF1 C;  1YQ3 C;  3U1C A;  1RF0 C;  1YI2 P;  5K5G B;  1WRG A;  5B66 H;  1QL1 A;  2G8Y A;  5KKZ C;  3CWB D;  1FZF A;  3K5B A;  1HF9 A;  1PFI A;  3P8C E;  2CK3 H;  2R44 A;  2LXC B;  5E79 E;  1BGY G;  5APW A; 
#chains in the Genus database with same CATH homology
 3FXD A;  4HJG H;  5CBO A;  1JM0 A;  2KIK A;  1U7J A;  2B87 A;  1Q2N A;  2K3R A;  1MFT A;  2OTK E;  4NPE A;  4CPG A;  3ZDM A;  2UWJ E;  4K35 A;  1X0T A;  2ZAE B;  4ZNC A;  4EYY Q;  2SPZ A;  1S3J A;  2KI7 B;  2Q1K A;  2KS1 B;  2B89 A;  2B88 A;  2KZI A;  1ZXG A;  1EDI A;  2HR3 A;  1U7M A;  2QVA A;  5EFW B;  1BDC A;  3MHV A;  1OVV A;  1LP1 A;  4HB1 A;  3FXE A;  4ZMD A;  1DEE G;  4BXL A;  2JWD A;  1OVR A;  4ASV A;  4ASW A;  1NVO A;  1ZW0 A;  2M5A A;  1H0T A;  1SS1 A;  1LP1 B;  2B87 B;  4MN4 C;  2RKL A;  2P58 A;  4GOD A;  2LXB A;  1OVU A;  1Y47 A;  1EC5 A;  1BDD A;  4WWI A;  4KJM A;  2M0B A;  3QWO C;  5DJU B;  4K3A A;  4NPF X;  2LR2 A;  2WMM A;  4GOF A;  3MZW B;  4IOI H;  3PH0 A;  1EDJ A;  5K5G B;  1FC2 C;  5DJT B;  2I8D A;  3S1K A;  2QRX A;  4GOE A;  4JBZ A;  3RGU A;  2M5A B;  2KZJ A;  1EDL A;  1LT1 A;  1H0T B;  1EDK A;  1JMB A;  2R44 A;  2LXC B;  4HKZ H;  4NPD A;  2KUB A;  5CBN A;  5C39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...