1U7JA

Solution structure of a diiron protein model
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
49
structure length
49
Chain Sequence
MDYLRELYKLEQQAMKLYREASERVGDPVLAKILEDEEKHIEWLETING
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Four-helix bundle model
publication title Analysis and Design of Turns in alpha-Helical Hairpins
pubmed doi rcsb
source organism Escherichia coli
total genus 15
structure length 49
sequence length 49
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1u7jA00
2ZAEB 2I8DA 1DEEG 2B89A 1EC5A 2SPZA 1EDIA 4KJMA 4ZMDA 2Q1KA 4GOFA 3S1KA 4IOIH 3PH0A 4GOEA 5DJUB 4ASVA 2B87B 1U7MA 2QRXA 1X0TA 2QVAA 1EDJA 1ZXGA 4WWIA 3MHVA 1FC2C 2HR3A 1BDCA 3RGUA 1S3JA 3FXDA 5K5GB 1H0TA 5DJTB 2RKLA 4HKZH 3FXEA 2B88A 4EYYQ 2KZIA 2KI7B 1NVOA 1OVRA 2KS1B 1EDKA 2M0BA 2M5AB 3QWOC 1U7JA 4HJGH 2B87A 4K3AA 1EDLA 2LR2A 1LP1B 1ZW0A 1BDDA 4GODA 4BXLA 1LT1A 1SS1A 5EFWB 1JM0A 2UWJE 3ZDMA 2OTKE 2KUBA 4NPEA 4NPDA 2WMMA 1JMBA 4JBZA 4K35A 2JWDA 2P58A 1OVUA 4ZNCA 4ASWA 4CPGA 2R44A 2KIKA 2M5AA 2LXBA 1H0TB 5CBOA 1MFTA 1Y47A 2KZJA 2LXCB 5CBNA 5C39A 4HB1A 4NPFX 4MN4C 1LP1A 2K3RA 1Q2NA 3MZWB 1OVVA
chains in the Genus database with same CATH superfamily
2A06D 5KAFH 3USSA 1LT9B 2B89A 1PV3A 2SPZA 5AW7B 2FYZA 2QJYC 2K1AA 3HE4B 3S4RA 3HE5B 3CPWO 3BRTB 5DJUB 1T6AA 3IF4A 4LLHA 1N7SD 2N9YB 3D70A 2IBZD 2WWWA 2FYUD 2QM7A 1KZUB 2ZT9D 5KAFE 5CCHA 1EZVD 3TF5A 2YKPA 2B88A 5APYA 3U1AA 1HUCA 5L8RJ 1AFOA 3TGUJ 1OVRA 1URQC 3H1HE 5TISH 1FU1A 2B87A 2XZRA 1RF1A 2XKMA 2MJZA 1KYOD 4UB8E 1SQQK 3M0AA 4YTPC 3KDPB 2E42A 4QMAA 4JYCA 2E74B 1L0ND 3OW2O 1SQXK 2R3CA 2OTLP 3O8ZA 1LT9C 4Z1MH 1DH3A 1PIXA 3IAOA 2M8RA 1T2KD 2KIKA 3JC22 1JOCA 3CCRP 5TJHA 1FZBA 4YXWH 1CSBA 1PP9J 3L70G 1ZOYC 1SQVD 4OGQB 1P84D 3HD7B 3H1LJ 3B4SA 1GU5A 3L75D 5KLIB 1EDIA 2Q3EA 1NOHA 2A45G 3JCUH 1AVYA 5APVA 3B5NB 4UB6E 1U7MA 2OTJP 3AECC 5AVTB 1GDTA 2YKQA 2K9JB 1YTZI 5AVYB 5K5GB 5DJTB 2BEZF 5AW1B 2RKLA 3G3ZA 3VOPA 3VMAA 2POHA 3VMZA 2A45H 3CI9A 1QLED 3JCUE 1NTKD 3L4FA 4DOJA 3PHLA 1SLQA 5KKZB 2QIWA 1QEXA 5KJ7C 5CCGC 3CCJP 3L70E 2FYUJ 4OH8B 2NZ2A 1KC8Q 2P2UA 2XNDH 1UIIA 1NH4A 4XFJA 3RL0g 4D6TG 4OGQC 3M0DC 3HD7C 4H0LC 1D7MA 2BCCE 3AEFC 5GTIH 3BVHA 5B5EH 2JP3A 5KLIC 2P58A 3EWKA 3CX5E 3L37A 2CPBA 1E5WA 4N6JA 3WU2H 1JEKA 2P67A 3B5NC 2YMYA 2O1JA 1KB9I 1YQ3C 5C39A 4NPFX 3IR9A 2H7HA 1KFNA 3SWYA 2GUVA 1L0NJ 4TT3H 1BE3J 2YKOA 5GTIE 1LTBC 3W67A 1HH0A 3C9IA 5B5EE 1RQUA 3L35A 2NPSD 3MUDA 2I1KA 2CK3H 2O01H 3M06A 3H25A 1CW5A 1IJDB 3WU2E 1RE4A 3OJAB 1YJWP 1FDIA 3A3YB 5KKZC 1SQVJ 3CWBD 1AQ5A 2WT7A 2XV5A 4D6TE 1JCCA 3H1KD 3L36A 3U1CA 3P32A 1ZR2A 3RK3B 2E5YA 1S9KD 4C7NA 1SQQG 2PGDA 1EQ7A 3BATA 1S2EA 3QH9A 3A2AA 4N3YB 1SQXG 3D6YA 1NTMK 1JCDA 3UIAA 1K04A 2ZVNB 1NTKJ 1FAVA 2WSFJ 4K35A 2B9BA 1EXJA 2R5DA 2WTYA 1HF9A 1HJBA 4JYBA 1QX8A 2E74D 2Y9YA 3G6EP 1QVGO 2G8YA 3P8CD 5KLVD 3FWNA 2WPVB 2H88C 2IDBA 4Y28J 1SQQE 1KQFB 4OGQD 3RK3C 1IFPA 1LWUA 3H1JD 3L73G 1SQXE 4Y99B 1N86A 5KTBA 2OYOA 1NU1D 3L74G 3VMXA 3B5ND 3AEGC 5AVUB 2KI7B 3GG2A 2ZYAA 2R32A 1OMIA 2C9LY 4DCKA 3A0HH 2QSIA 3TYYA 1OXZA 2FFDA 4BXLA 1Q82Q 2HODB 3H1KJ 1MKMA 1G1JA 4L73A 1KB9D 3II6A 1WMKA 3L73E 3V6IA 1ZRTE 3A0HE 1L0NK 3M91A 2OYIB 3I5CA 1SVFA 2KZJA 3MP7B 4HB1A 1LP1A 3L74E 1PZQA 2KNCA 2M3BA 2I8DA 1L4AB 5B66H 1EC5A 1VQ6P 2HFED 1SQVK 2ZT9C 3HUSB 1ZLLA 3O6QB 2WSCH 1BDCA 1RE3C 5KLVJ 3A5TA 1L0LJ 4EI2A 5B66E 3KPEA 3CCSP 2V4HA 3BASA 1NTZG 4WY4B 1USDA 1BCCG 3H1JJ 2AEJA 3BCCJ 1NTMG 3FX0A 5AW5B 4WB4A 3E1IA 4U3FJ 4GODA 3RK3D 5BVZA 1LT1A 2OYIC 1GL2A 1VF5B 1HGZA 3WUUA 1ZP0C 1LTSC 2OTKE 3CCLP 4LGDE 4BRYA 1L4AC 1Q81Q 5E79H 2JWDA 1X22A 2PRRA 2OYHC 3L71D 3AE1C 2Z4EA 4RKUJ 2I1JA 1PP9D 5AVVB 3HUSC 2M5AA 3MGNA 3LIDA 4KT0J 1S4XA 2V7QJ 3H1LD 4WBAA 4WVZA 1K8AQ 1XTCC 2A45I 1Y9BA 2KP8A 1OVVA 3CC7P 5APXA 1GL2B 2A06G 2FXOA 1PPJE 2D2CB 2C0XA 1BCCE 1NTME 4ASVA 1CI6A 2QRXA 3CXHH 2IZ0A 4WY4C 1SFCA 1GK6A 1YHQP 3SFDC 1NAFA 1PGPA 4H13B 3GHGA 3FXEA 2QM8A 4I7ZB 1EZVG 1FZCB 2N1TA 1VF5C 1VQPP 3C8VA 4IL6E 1FBMA 1KN7A 1MUUA 1UIXA 2XDJA 2IYPA 3CXHE 3PRJA 1JUNA 4PD4H 1PGOA 1YITP 4UB8H 1RF0C 1SQPJ 5CJ0A 3H1HD 1H8AA 1LTGC 2A06E 4ZKPA 2J58A 3CMEP 3GHGB 1IFIA 2N1TB 1FE6A 5APTA 1USEA 3CL3D 4W7ZA 1HVVA 4L75A 4GT1A 2RN0A 2D2CC 4PD4E 3D6ZA 1A02F 2FYNB 2WPRA 2KK7A 1KORA 4R4LA 5AVXB 3ABVC 1LTIC 2NPSC 1KILE 4OWFA 4I6MC 1KFMA 5AW4B 1S72P 1K9MQ 2QJKC 1Q2NA 3L75G 1BE3D 1EZVE 1GK4A 1JY2O 5AW6B 2W6AA 3H1IJ 5AW8B 1M1KQ 4KJMA 4I7ZC 4JPZB 4UB6H 1FZCC 2KS1A 4IOIH 3L71J 1XTGB 3LW5H 2B87B 2JKVA 4DT0A 1RF1B 1QL1A 1L4AD 1DEBA 2HR3A 3U59A 1BGYJ 2FKWB 3R4YA 4JF7A 2QA4P 1YIJP 3NFQA 3H32A 2BCCG 2HG5D 1L0NE 3Q3DA 1HJ0A 3CC2P 1NU1K 1MZ9A 2XU6A 2KS1B 3WMM0 1NO4A 2FYNC 1SQVE 3VTPC 1L2PA 3L75E 2CPSA 3L70D 4O9BA 4WY4D 2E43A 3F5HA 2E74C 5CCHC 3FWLA 3CX5H 1JMBA 3CCEP 5H2FH 3OAKA 1VF5D 2Q7CA 2ZXXA 2VRSA 3AEAC 1MFTA 3H1HJ 1ZV8A 1RF1C 5CBNA 1OWAA 1VPCA 4R4MA 1JB0J 1DEEG 3M9HA 5AVZB 1BSHA 5APQA 4OVNF 2AEFA 2ZFCA 5H2FE 1HGVA 2PAJA 1FZEA 1GL2D 3OA7A 2MKVA 2FY8A 4C46A 2Y0CA 3CWBG 1ZMEC 1IFNA 1A02J 2D2CD 1OW6A 2ZYDA 3WUVA 2QG4A 4AYCA 3V4WA 5CJ4A 3H6PA 3V2NA 4D6TD 4DZOA 1MV8A 4H13D 1EDKA 3CC4P 2M0BA 1JY2P 4I1LA 5AVWB 3RK2D 4HJGH 1FJKA 4K3AA 4GIFA 3CMAP 2WVRA 1R5SA 1AQTA 2Y0DA 2H8PD 4NPEA 1PFIA 2AEMA 1MFZA 1LTJA 1Q90D 1W2EA 3KZIH 2C9NY 2WSEH 4W7YA 3AE8C 3CWBE 2W8ZA 2WT7B 1Y47A 1YJ9P 1M8OB 2N1TD 1QVFO 3L70J 1T3JA 3AE4C 1VQMP 1M57D 1TU3F 3EFGA 1T3UA 1VQKP 2KLUA 1YTZT 2QJPB 1S9KE 4C7NB 4L74A 3MIWA 4YXDC 3PH0A 3KZIE 5CCHD 2YO2A 4WWIA 3E1RA 1L0LD 4U7JA 2YIUB 2ZYGA 1VQOP 1M1JA 3T97A 1Q86Q 1NU1G 1SQXD 1N7SA 4N78D 1N8RQ 1KILA 3BCCD 2L5GB 2OARA 3AE5C 3L72G 3MUDC 5AVQB 3A0BH 4U3FD 1RE4C 2FXPA 1G2CA 2FBWC 1SS1A 4TLFA 1IFDA 2FYUK 3CXHI 4D6TJ 1LJ2A 3F89A 1N73A 3Q2YA 2JDIH 4IFMA 3I56P 1LWUB 1FZFA 1FOSE 2QJPC 3A0BE 3H1JE 2O01J 2H43A 1N7LA 1KD1Q 1PGJA 1AVOA 1NU1E 4M3LA 2NRGA 5AVRB 3MZWB 1DX7A 2ZAEB 1NJIQ 3M9QA 2KXPB 1VL2A 2E5TA 2QE7H 3N7NA 3L74D 4PD4I 3TNUA 1NKZB 1GU4A 2BASA 2HPCA 3V2PA 2K9YA 1IO4A 3L72E 4GOEA 1IK9A 1YYCA 1SQBD 3W68A 1X0TA 1R5LA 3MHVA 4DJGA 1EZVI 4Y99C 3IN6A 1FC2C 2FFDB 1S5LX 1VDFA 1H0TA 3TDKA 2WZ7A 1JMMA 2IPPA 3VP9A 1M7LA 1FS0E 1IZNB 3TGUG 1X9VA 3TNUB 1KB9E 2WITA 4IFDK 1GW3A 3VYIA 1SQQJ 3S9OA 1RY3A 2W90A 1SQPD 1LWUC 1LP1B 2W83C 3ITKA 3K5BA 2KNCB 1SQXJ 1OX3A 1X8YA 5AW3B 1FZAA 1OZHA 1PPJG 3NXSA 3G9RA 2Z5HA 1Y8AA 1OIPA 2Y0EA 1OVUA 4ASWA 4CPGA 2R44A 1NTKK 1PP9G 2LXBA 3P8MC 2IFMA 2XNXA 3RBXA 3H1LG 4MN4C 1K05A 1KQLA 5AW0B 2FFDC 3Q5SA 3H1ID 2N9BA 3TGUE 4B86A 3EFFK 5CMZA 1H89A 2JWAA 1URQA 2C0WA 4IFFA 3IFMA 1BGYD 1ZXGA 2YO3A 1NTZD 2O01N 2PFXA 4KHXA 3MTUE 3RK3E 3CX5I 1YI2P 4JQ0D 2KLVA 2R5BA 1ZN5A 4BRYB 4XE5B 4IL6H 3L74J 1LT9A 2K37A 3NTNA 5M1BA 4PJ0E 2IFNA 2IBZG 3HE5A 1AJYA 1SQBJ 1URQB 2WPQA 2ZJSE 2M5AB 3V4QA 2K88A 1PP9E 2FYUG 3H1LE 1DD4A 3CXHD 3RK2B 2HYNA 4RJTA 3AEDC 2Q3IA 1VQNP 2KSJA 3KYQA 2YXRB 1X79B 2YNYA 2QEXP 3WUTA 1CI6B 4EOTA 1YBKA 2J5UA 1SP4A 1SFCB 1KQSO 2YXQB 1M56D 5CBOA 4PD4D 3KHUA 2WSCJ 1L0NG 4H44B 2IX7C 1BE3G 1GL2C 4GKGA 1KILD 1LGHB 1VQ8P 3R2PA 2O1KA 1FZGA 2IBZE 5KJ7A 5CCGA 2FYUE 5AW9B 1W5CE 4LC1A 1KYOH 1EDJA 2BEQD 1SQVG 1VQ5P 2Y9ZA 1S1CX 3TSIA 2E75D 4BWNA 4H13C 5APSA 1KV4A 2P10A 3TK1A 5GTHH 1YJNP 3CCVP 1IFJA 3M0DA 3HD7A 4HYTB 3RK2C 1HWTC 5KLVK 1L0LK 3N4XA 3GLMA 1NWQA 2J59M 3VP8A 1KTMA 3Q5RA 1KYOE 1GD2E 1NTZJ 1BCCJ 1P84H 3B5NA 1EDLA 1NTMJ 2K9JA 5TISE 1J1EB 1N2DC 1SFCC 5EFWB 1J2JB 5GTHE 2RMZA 1BE3E 3PLNA 2GM4A 3GHGC 4H0LB 1NTKG 4NPDA 1NYHA 4H44C 3B71A 3M9BA 3EQ2A 2N1TC 1KQGB 2GA1A 1NHLA 1VQ4P 1QL2A 1JY3O 1P84E 3E7KA 2Q9IA 2LXCB 3H32B 2K3RA 2Q5UA 2G3AA 3V5BA 1U57A 2WSFH 2BCCD 1GZLA 2KOGA 1G1IA 4ZMDA 2Q1KA 1FDOA 4GOFA 1VQLP 3VN0A 3CX5D 2L91A 1GTWA 1Q7YQ 1DIPA 2W6BA 2PP6A 2JO1A 4HKZH 1SQBK 1J1EC 1NTKE 1LTAC 4RESB 4A7PA 2IYOA 3JSVC 1JY2N 2AXCA 1BSNA 1JO5A 2YMKA 3Q1MA 1ZW0A 4YPCA 3H1KG 4I2LC 2IZ1A 3ZDMA 5APUA 3V2RA 3HTKA 1URQD 1SQPK 1HBWA 1RHZB 2KB7P 2AXTH 4ZNCA 3RL0B 4C7RA 3KQGA 3LW5J 5BU8B 2FXMA 3I55P 1HTLC 3KXDA 3P7KA 3AE2C 3HRNA 2E76B 1JY3N 3L75J 3HTKB 1SFCD 4GDOA 2AXTE 1CZQA 3CLQA 4H44D 4PV1B 3B8EB 5KLVG 3H1KE 3SSUA 1FJPA 1L0LG 5AVSB 3FXDA 1LTTC 1GW4A 3VMYA 1VQ9P 4EIJA 2GUSA 1JY3P 1OFCX 2P7JA 4EDFA 3SWFA 1NTZK 1AV1A 2BCCJ 4EYYQ 2HLOA 1LNQA 1LTJB 1NKNA 2WPSA 1NVOA 3H1JG 3BCCG 1SQQD 3Q5PA 3CCMP 3SWKA 1AA0A 2OQQA 4U3FG 1EXIA 3RL0C 2LR2A 3AE7C 1JM0A 2KUBA 2OGUA 2W6JH 1FDMA 5KJ7D 5CCGD 2WMMA 1FOSF 2E76C 2Z5IA 2KSEA 1GMJA 4HH2A 3CD6P 3P8CE 5KLVE 2JEEA 3HD7D 1L0LE 1VQ7P 4H0LD 1M1JB 1R8EA 1RE3A 3T97B 1J1DB 3BRVB 4PV1C 1PL5A 1N7SB 3PTZA 1WT6A 2HODA 4N78E 1JTHA 3GF7A 2LKMA 2Q6QA 1KILB 1RQVA 2H89C 3BCCE 3S1KA 2ZT9B 1IC2A 3AE6C 3CCUP 1T8ZA 3L73D 1LTJC 4U3FE 1SQBG 2QVAA 2V7QH 1W2BO 1ZRTD 3L72D 1G2CB 3CCQP 2YIUC 1S3JA 2OYIA 3CWBJ 2E75B 2IBZI 1N73B 1KB9H 1L4AA 1JTHB 2KZIA 2OYHA 1OW8A 2JJLA 3HUSA 1U7JA 1YQ4C 2O3JA 1SQPG 3O6QA 2M3EA 2WSEJ 2JR8A 2ZVOB 1M1JC 2ZXEB 4W80A 2UWJE 1M90Q 1J1DC 1DD3A 2HPCB 1N7SC 1KYOI 2R3SA 3GMAA 1IFMA 2OYHB 3V2QA 1KILC 1SQBE 4WY4A 4AQRD 3G71P 1H0TB 4IL6X 1K73Q 1ZR4A 3PJSK 1PGQA 3RL0D 3LIEA 3H1IG 3GF3A 1IK7A 2E75C 1P84I 3L71G 2WSSH 1N73C 1H88A 3TGUD 3MD0A 1NAYA 1RH5B 3SFEC 1SQPE 4RO0A 1BGYG 1RF0A 2ITAA 3G4SP 5AW2B 2E76D 3RGUA 3AEEC 2KYVA 3C1LA 3PP5A 5KAIH 1NU1J 2QJYB 1JNMA 3GW6A 4PJ0H 3A7OA 5APWA 1T2KC 4PV1D 1PPJD 1KMIZ 1S5LH 1WRGA 3FGAD 4ZKUA 3AEBC 1BCCD 3L73J 2P1JA 1NTMD 3QWOC 3L72J 1Z56A 2NPSA 1BDDA 4AUWA 1OW7A 1NGMB 4XA4A 2WQYC 5KAIE 4L76A 3AE9C 3H1IE 3L71E 3HE4A 1FZCA 1QGKB 4JBZA 1E79H 1S5LE 3D71A 5CHXA 5BU5A 2W27A 3NMDA 5E79E 1BGYE 3RBZA 1NTZE 3H1HG 2RH0A 2NPSB 2DW3A 2QJKB 3AE3C
chains in the Genus database with same CATH topology
2ZAEB 2I8DA 1DEEG 2B89A 1EC5A 2SPZA 1EDIA 4KJMA 4ZMDA 2Q1KA 4GOFA 3S1KA 4IOIH 3PH0A 4GOEA 5DJUB 4ASVA 2B87B 1U7MA 2QRXA 1X0TA 2QVAA 1EDJA 1ZXGA 4WWIA 3MHVA 1FC2C 2HR3A 1BDCA 3RGUA 1S3JA 3FXDA 5K5GB 1H0TA 5DJTB 2RKLA 4HKZH 3FXEA 2B88A 4EYYQ 2KZIA 2KI7B 1NVOA 1OVRA 2KS1B 1EDKA 2M0BA 2M5AB 3QWOC 1U7JA 4HJGH 2B87A 4K3AA 1EDLA 2LR2A 1LP1B 1ZW0A 1BDDA 4GODA 4BXLA 1LT1A 1SS1A 5EFWB 1JM0A 2UWJE 3ZDMA 2OTKE 2KUBA 4NPEA 4NPDA 2WMMA 1JMBA 4JBZA 4K35A 2JWDA 2P58A 1OVUA 4ZNCA 4ASWA 4CPGA 2R44A 2KIKA 2M5AA 2LXBA 1H0TB 5CBOA 1MFTA 1Y47A 2KZJA 2LXCB 5CBNA 5C39A 4HB1A 4NPFX 4MN4C 1LP1A 2K3RA 1Q2NA 3MZWB 1OVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZAE B;  2I8D A;  1DEE G;  2B89 A;  1EC5 A;  2SPZ A;  1EDI A;  4KJM A;  4ZMD A;  2Q1K A;  4GOF A;  3S1K A;  4IOI H;  3PH0 A;  4GOE A;  5DJU B;  4ASV A;  2B87 B;  1U7M A;  2QRX A;  1X0T A;  2QVA A;  1EDJ A;  1ZXG A;  4WWI A;  3MHV A;  1FC2 C;  2HR3 A;  1BDC A;  3RGU A;  1S3J A;  3FXD A;  5K5G B;  1H0T A;  5DJT B;  2RKL A;  4HKZ H;  3FXE A;  2B88 A;  4EYY Q;  2KZI A;  2KI7 B;  1NVO A;  1OVR A;  2KS1 B;  1EDK A;  2M0B A;  2M5A B;  3QWO C;  1U7J A;  4HJG H;  2B87 A;  4K3A A;  1EDL A;  2LR2 A;  1LP1 B;  1ZW0 A;  1BDD A;  4GOD A;  4BXL A;  1LT1 A;  1SS1 A;  5EFW B;  1JM0 A;  2UWJ E;  3ZDM A;  2OTK E;  2KUB A;  4NPE A;  4NPD A;  2WMM A;  1JMB A;  4JBZ A;  4K35 A;  2JWD A;  2P58 A;  1OVU A;  4ZNC A;  4ASW A;  4CPG A;  2R44 A;  2KIK A;  2M5A A;  2LXB A;  1H0T B;  5CBO A;  1MFT A;  1Y47 A;  2KZJ A;  2LXC B;  5CBN A;  5C39 A;  4HB1 A;  4NPF X;  4MN4 C;  1LP1 A;  2K3R A;  1Q2N A;  3MZW B;  1OVV A; 
#chains in the Genus database with same CATH topology
 2A06 D;  5KAF H;  3USS A;  1LT9 B;  2B89 A;  1PV3 A;  2SPZ A;  5AW7 B;  2FYZ A;  2QJY C;  2K1A A;  3HE4 B;  3S4R A;  3HE5 B;  3CPW O;  3BRT B;  5DJU B;  1T6A A;  3IF4 A;  4LLH A;  1N7S D;  2N9Y B;  3D70 A;  2IBZ D;  2WWW A;  2FYU D;  2QM7 A;  1KZU B;  2ZT9 D;  5KAF E;  5CCH A;  1EZV D;  3TF5 A;  2YKP A;  2B88 A;  5APY A;  3U1A A;  1HUC A;  5L8R J;  1AFO A;  3TGU J;  1OVR A;  1URQ C;  3H1H E;  5TIS H;  1FU1 A;  2B87 A;  2XZR A;  1RF1 A;  2XKM A;  2MJZ A;  1KYO D;  4UB8 E;  1SQQ K;  3M0A A;  4YTP C;  3KDP B;  2E42 A;  4QMA A;  4JYC A;  2E74 B;  1L0N D;  3OW2 O;  1SQX K;  2R3C A;  2OTL P;  3O8Z A;  1LT9 C;  4Z1M H;  1DH3 A;  1PIX A;  3IAO A;  2M8R A;  1T2K D;  2KIK A;  3JC2 2;  1JOC A;  3CCR P;  5TJH A;  1FZB A;  4YXW H;  1CSB A;  1PP9 J;  3L70 G;  1ZOY C;  1SQV D;  4OGQ B;  1P84 D;  3HD7 B;  3H1L J;  3B4S A;  1GU5 A;  3L75 D;  5KLI B;  1EDI A;  2Q3E A;  1NOH A;  2A45 G;  3JCU H;  1AVY A;  5APV A;  3B5N B;  4UB6 E;  1U7M A;  2OTJ P;  3AEC C;  5AVT B;  1GDT A;  2YKQ A;  2K9J B;  1YTZ I;  5AVY B;  5K5G B;  5DJT B;  2BEZ F;  5AW1 B;  2RKL A;  3G3Z A;  3VOP A;  3VMA A;  2POH A;  3VMZ A;  2A45 H;  3CI9 A;  1QLE D;  3JCU E;  1NTK D;  3L4F A;  4DOJ A;  3PHL A;  1SLQ A;  5KKZ B;  2QIW A;  1QEX A;  5KJ7 C;  5CCG C;  3CCJ P;  3L70 E;  2FYU J;  4OH8 B;  2NZ2 A;  1KC8 Q;  2P2U A;  2XND H;  1UII A;  1NH4 A;  4XFJ A;  3RL0 g;  4D6T G;  4OGQ C;  3M0D C;  3HD7 C;  4H0L C;  1D7M A;  2BCC E;  3AEF C;  5GTI H;  3BVH A;  5B5E H;  2JP3 A;  5KLI C;  2P58 A;  3EWK A;  3CX5 E;  3L37 A;  2CPB A;  1E5W A;  4N6J A;  3WU2 H;  1JEK A;  2P67 A;  3B5N C;  2YMY A;  2O1J A;  1KB9 I;  1YQ3 C;  5C39 A;  4NPF X;  3IR9 A;  2H7H A;  1KFN A;  3SWY A;  2GUV A;  1L0N J;  4TT3 H;  1BE3 J;  2YKO A;  5GTI E;  1LTB C;  3W67 A;  1HH0 A;  3C9I A;  5B5E E;  1RQU A;  3L35 A;  2NPS D;  3MUD A;  2I1K A;  2CK3 H;  2O01 H;  3M06 A;  3H25 A;  1CW5 A;  1IJD B;  3WU2 E;  1RE4 A;  3OJA B;  1YJW P;  1FDI A;  3A3Y B;  5KKZ C;  1SQV J;  3CWB D;  1AQ5 A;  2WT7 A;  2XV5 A;  4D6T E;  1JCC A;  3H1K D;  3L36 A;  3U1C A;  3P32 A;  1ZR2 A;  3RK3 B;  2E5Y A;  1S9K D;  4C7N A;  1SQQ G;  2PGD A;  1EQ7 A;  3BAT A;  1S2E A;  3QH9 A;  3A2A A;  4N3Y B;  1SQX G;  3D6Y A;  1NTM K;  1JCD A;  3UIA A;  1K04 A;  2ZVN B;  1NTK J;  1FAV A;  2WSF J;  4K35 A;  2B9B A;  1EXJ A;  2R5D A;  2WTY A;  1HF9 A;  1HJB A;  4JYB A;  1QX8 A;  2E74 D;  2Y9Y A;  3G6E P;  1QVG O;  2G8Y A;  3P8C D;  5KLV D;  3FWN A;  2WPV B;  2H88 C;  2IDB A;  4Y28 J;  1SQQ E;  1KQF B;  4OGQ D;  3RK3 C;  1IFP A;  1LWU A;  3H1J D;  3L73 G;  1SQX E;  4Y99 B;  1N86 A;  5KTB A;  2OYO A;  1NU1 D;  3L74 G;  3VMX A;  3B5N D;  3AEG C;  5AVU B;  2KI7 B;  3GG2 A;  2ZYA A;  2R32 A;  1OMI A;  2C9L Y;  4DCK A;  3A0H H;  2QSI A;  3TYY A;  1OXZ A;  2FFD A;  4BXL A;  1Q82 Q;  2HOD B;  3H1K J;  1MKM A;  1G1J A;  4L73 A;  1KB9 D;  3II6 A;  1WMK A;  3L73 E;  3V6I A;  1ZRT E;  3A0H E;  1L0N K;  3M91 A;  2OYI B;  3I5C A;  1SVF A;  2KZJ A;  3MP7 B;  4HB1 A;  1LP1 A;  3L74 E;  1PZQ A;  2KNC A;  2M3B A;  2I8D A;  1L4A B;  5B66 H;  1EC5 A;  1VQ6 P;  2HFE D;  1SQV K;  2ZT9 C;  3HUS B;  1ZLL A;  3O6Q B;  2WSC H;  1BDC A;  1RE3 C;  5KLV J;  3A5T A;  1L0L J;  4EI2 A;  5B66 E;  3KPE A;  3CCS P;  2V4H A;  3BAS A;  1NTZ G;  4WY4 B;  1USD A;  1BCC G;  3H1J J;  2AEJ A;  3BCC J;  1NTM G;  3FX0 A;  5AW5 B;  4WB4 A;  3E1I A;  4U3F J;  4GOD A;  3RK3 D;  5BVZ A;  1LT1 A;  2OYI C;  1GL2 A;  1VF5 B;  1HGZ A;  3WUU A;  1ZP0 C;  1LTS C;  2OTK E;  3CCL P;  4LGD E;  4BRY A;  1L4A C;  1Q81 Q;  5E79 H;  2JWD A;  1X22 A;  2PRR A;  2OYH C;  3L71 D;  3AE1 C;  2Z4E A;  4RKU J;  2I1J A;  1PP9 D;  5AVV B;  3HUS C;  2M5A A;  3MGN A;  3LID A;  4KT0 J;  1S4X A;  2V7Q J;  3H1L D;  4WBA A;  4WVZ A;  1K8A Q;  1XTC C;  2A45 I;  1Y9B A;  2KP8 A;  1OVV A;  3CC7 P;  5APX A;  1GL2 B;  2A06 G;  2FXO A;  1PPJ E;  2D2C B;  2C0X A;  1BCC E;  1NTM E;  4ASV A;  1CI6 A;  2QRX A;  3CXH H;  2IZ0 A;  4WY4 C;  1SFC A;  1GK6 A;  1YHQ P;  3SFD C;  1NAF A;  1PGP A;  4H13 B;  3GHG A;  3FXE A;  2QM8 A;  4I7Z B;  1EZV G;  1FZC B;  2N1T A;  1VF5 C;  1VQP P;  3C8V A;  4IL6 E;  1FBM A;  1KN7 A;  1MUU A;  1UIX A;  2XDJ A;  2IYP A;  3CXH E;  3PRJ A;  1JUN A;  4PD4 H;  1PGO A;  1YIT P;  4UB8 H;  1RF0 C;  1SQP J;  5CJ0 A;  3H1H D;  1H8A A;  1LTG C;  2A06 E;  4ZKP A;  2J58 A;  3CME P;  3GHG B;  1IFI A;  2N1T B;  1FE6 A;  5APT A;  1USE A;  3CL3 D;  4W7Z A;  1HVV A;  4L75 A;  4GT1 A;  2RN0 A;  2D2C C;  4PD4 E;  3D6Z A;  1A02 F;  2FYN B;  2WPR A;  2KK7 A;  1KOR A;  4R4L A;  5AVX B;  3ABV C;  1LTI C;  2NPS C;  1KIL E;  4OWF A;  4I6M C;  1KFM A;  5AW4 B;  1S72 P;  1K9M Q;  2QJK C;  1Q2N A;  3L75 G;  1BE3 D;  1EZV E;  1GK4 A;  1JY2 O;  5AW6 B;  2W6A A;  3H1I J;  5AW8 B;  1M1K Q;  4KJM A;  4I7Z C;  4JPZ B;  4UB6 H;  1FZC C;  2KS1 A;  4IOI H;  3L71 J;  1XTG B;  3LW5 H;  2B87 B;  2JKV A;  4DT0 A;  1RF1 B;  1QL1 A;  1L4A D;  1DEB A;  2HR3 A;  3U59 A;  1BGY J;  2FKW B;  3R4Y A;  4JF7 A;  2QA4 P;  1YIJ P;  3NFQ A;  3H32 A;  2BCC G;  2HG5 D;  1L0N E;  3Q3D A;  1HJ0 A;  3CC2 P;  1NU1 K;  1MZ9 A;  2XU6 A;  2KS1 B;  3WMM 0;  1NO4 A;  2FYN C;  1SQV E;  3VTP C;  1L2P A;  3L75 E;  2CPS A;  3L70 D;  4O9B A;  4WY4 D;  2E43 A;  3F5H A;  2E74 C;  5CCH C;  3FWL A;  3CX5 H;  1JMB A;  3CCE P;  5H2F H;  3OAK A;  1VF5 D;  2Q7C A;  2ZXX A;  2VRS A;  3AEA C;  1MFT A;  3H1H J;  1ZV8 A;  1RF1 C;  5CBN A;  1OWA A;  1VPC A;  4R4M A;  1JB0 J;  1DEE G;  3M9H A;  5AVZ B;  1BSH A;  5APQ A;  4OVN F;  2AEF A;  2ZFC A;  5H2F E;  1HGV A;  2PAJ A;  1FZE A;  1GL2 D;  3OA7 A;  2MKV A;  2FY8 A;  4C46 A;  2Y0C A;  3CWB G;  1ZME C;  1IFN A;  1A02 J;  2D2C D;  1OW6 A;  2ZYD A;  3WUV A;  2QG4 A;  4AYC A;  3V4W A;  5CJ4 A;  3H6P A;  3V2N A;  4D6T D;  4DZO A;  1MV8 A;  4H13 D;  1EDK A;  3CC4 P;  2M0B A;  1JY2 P;  4I1L A;  5AVW B;  3RK2 D;  4HJG H;  1FJK A;  4K3A A;  4GIF A;  3CMA P;  2WVR A;  1R5S A;  1AQT A;  2Y0D A;  2H8P D;  4NPE A;  1PFI A;  2AEM A;  1MFZ A;  1LTJ A;  1Q90 D;  1W2E A;  3KZI H;  2C9N Y;  2WSE H;  4W7Y A;  3AE8 C;  3CWB E;  2W8Z A;  2WT7 B;  1Y47 A;  1YJ9 P;  1M8O B;  2N1T D;  1QVF O;  3L70 J;  1T3J A;  3AE4 C;  1VQM P;  1M57 D;  1TU3 F;  3EFG A;  1T3U A;  1VQK P;  2KLU A;  1YTZ T;  2QJP B;  1S9K E;  4C7N B;  4L74 A;  3MIW A;  4YXD C;  3PH0 A;  3KZI E;  5CCH D;  2YO2 A;  4WWI A;  3E1R A;  1L0L D;  4U7J A;  2YIU B;  2ZYG A;  1VQO P;  1M1J A;  3T97 A;  1Q86 Q;  1NU1 G;  1SQX D;  1N7S A;  4N78 D;  1N8R Q;  1KIL A;  3BCC D;  2L5G B;  2OAR A;  3AE5 C;  3L72 G;  3MUD C;  5AVQ B;  3A0B H;  4U3F D;  1RE4 C;  2FXP A;  1G2C A;  2FBW C;  1SS1 A;  4TLF A;  1IFD A;  2FYU K;  3CXH I;  4D6T J;  1LJ2 A;  3F89 A;  1N73 A;  3Q2Y A;  2JDI H;  4IFM A;  3I56 P;  1LWU B;  1FZF A;  1FOS E;  2QJP C;  3A0B E;  3H1J E;  2O01 J;  2H43 A;  1N7L A;  1KD1 Q;  1PGJ A;  1AVO A;  1NU1 E;  4M3L A;  2NRG A;  5AVR B;  3MZW B;  1DX7 A;  2ZAE B;  1NJI Q;  3M9Q A;  2KXP B;  1VL2 A;  2E5T A;  2QE7 H;  3N7N A;  3L74 D;  4PD4 I;  3TNU A;  1NKZ B;  1GU4 A;  2BAS A;  2HPC A;  3V2P A;  2K9Y A;  1IO4 A;  3L72 E;  4GOE A;  1IK9 A;  1YYC A;  1SQB D;  3W68 A;  1X0T A;  1R5L A;  3MHV A;  4DJG A;  1EZV I;  4Y99 C;  3IN6 A;  1FC2 C;  2FFD B;  1S5L X;  1VDF A;  1H0T A;  3TDK A;  2WZ7 A;  1JMM A;  2IPP A;  3VP9 A;  1M7L A;  1FS0 E;  1IZN B;  3TGU G;  1X9V A;  3TNU B;  1KB9 E;  2WIT A;  4IFD K;  1GW3 A;  3VYI A;  1SQQ J;  3S9O A;  1RY3 A;  2W90 A;  1SQP D;  1LWU C;  1LP1 B;  2W83 C;  3ITK A;  3K5B A;  2KNC B;  1SQX J;  1OX3 A;  1X8Y A;  5AW3 B;  1FZA A;  1OZH A;  1PPJ G;  3NXS A;  3G9R A;  2Z5H A;  1Y8A A;  1OIP A;  2Y0E A;  1OVU A;  4ASW A;  4CPG A;  2R44 A;  1NTK K;  1PP9 G;  2LXB A;  3P8M C;  2IFM A;  2XNX A;  3RBX A;  3H1L G;  4MN4 C;  1K05 A;  1KQL A;  5AW0 B;  2FFD C;  3Q5S A;  3H1I D;  2N9B A;  3TGU E;  4B86 A;  3EFF K;  5CMZ A;  1H89 A;  2JWA A;  1URQ A;  2C0W A;  4IFF A;  3IFM A;  1BGY D;  1ZXG A;  2YO3 A;  1NTZ D;  2O01 N;  2PFX A;  4KHX A;  3MTU E;  3RK3 E;  3CX5 I;  1YI2 P;  4JQ0 D;  2KLV A;  2R5B A;  1ZN5 A;  4BRY B;  4XE5 B;  4IL6 H;  3L74 J;  1LT9 A;  2K37 A;  3NTN A;  5M1B A;  4PJ0 E;  2IFN A;  2IBZ G;  3HE5 A;  1AJY A;  1SQB J;  1URQ B;  2WPQ A;  2ZJS E;  2M5A B;  3V4Q A;  2K88 A;  1PP9 E;  2FYU G;  3H1L E;  1DD4 A;  3CXH D;  3RK2 B;  2HYN A;  4RJT A;  3AED C;  2Q3I A;  1VQN P;  2KSJ A;  3KYQ A;  2YXR B;  1X79 B;  2YNY A;  2QEX P;  3WUT A;  1CI6 B;  4EOT A;  1YBK A;  2J5U A;  1SP4 A;  1SFC B;  1KQS O;  2YXQ B;  1M56 D;  5CBO A;  4PD4 D;  3KHU A;  2WSC J;  1L0N G;  4H44 B;  2IX7 C;  1BE3 G;  1GL2 C;  4GKG A;  1KIL D;  1LGH B;  1VQ8 P;  3R2P A;  2O1K A;  1FZG A;  2IBZ E;  5KJ7 A;  5CCG A;  2FYU E;  5AW9 B;  1W5C E;  4LC1 A;  1KYO H;  1EDJ A;  2BEQ D;  1SQV G;  1VQ5 P;  2Y9Z A;  1S1C X;  3TSI A;  2E75 D;  4BWN A;  4H13 C;  5APS A;  1KV4 A;  2P10 A;  3TK1 A;  5GTH H;  1YJN P;  3CCV P;  1IFJ A;  3M0D A;  3HD7 A;  4HYT B;  3RK2 C;  1HWT C;  5KLV K;  1L0L K;  3N4X A;  3GLM A;  1NWQ A;  2J59 M;  3VP8 A;  1KTM A;  3Q5R A;  1KYO E;  1GD2 E;  1NTZ J;  1BCC J;  1P84 H;  3B5N A;  1EDL A;  1NTM J;  2K9J A;  5TIS E;  1J1E B;  1N2D C;  1SFC C;  5EFW B;  1J2J B;  5GTH E;  2RMZ A;  1BE3 E;  3PLN A;  2GM4 A;  3GHG C;  4H0L B;  1NTK G;  4NPD A;  1NYH A;  4H44 C;  3B71 A;  3M9B A;  3EQ2 A;  2N1T C;  1KQG B;  2GA1 A;  1NHL A;  1VQ4 P;  1QL2 A;  1JY3 O;  1P84 E;  3E7K A;  2Q9I A;  2LXC B;  3H32 B;  2K3R A;  2Q5U A;  2G3A A;  3V5B A;  1U57 A;  2WSF H;  2BCC D;  1GZL A;  2KOG A;  1G1I A;  4ZMD A;  2Q1K A;  1FDO A;  4GOF A;  1VQL P;  3VN0 A;  3CX5 D;  2L91 A;  1GTW A;  1Q7Y Q;  1DIP A;  2W6B A;  2PP6 A;  2JO1 A;  4HKZ H;  1SQB K;  1J1E C;  1NTK E;  1LTA C;  4RES B;  4A7P A;  2IYO A;  3JSV C;  1JY2 N;  2AXC A;  1BSN A;  1JO5 A;  2YMK A;  3Q1M A;  1ZW0 A;  4YPC A;  3H1K G;  4I2L C;  2IZ1 A;  3ZDM A;  5APU A;  3V2R A;  3HTK A;  1URQ D;  1SQP K;  1HBW A;  1RHZ B;  2KB7 P;  2AXT H;  4ZNC A;  3RL0 B;  4C7R A;  3KQG A;  3LW5 J;  5BU8 B;  2FXM A;  3I55 P;  1HTL C;  3KXD A;  3P7K A;  3AE2 C;  3HRN A;  2E76 B;  1JY3 N;  3L75 J;  3HTK B;  1SFC D;  4GDO A;  2AXT E;  1CZQ A;  3CLQ A;  4H44 D;  4PV1 B;  3B8E B;  5KLV G;  3H1K E;  3SSU A;  1FJP A;  1L0L G;  5AVS B;  3FXD A;  1LTT C;  1GW4 A;  3VMY A;  1VQ9 P;  4EIJ A;  2GUS A;  1JY3 P;  1OFC X;  2P7J A;  4EDF A;  3SWF A;  1NTZ K;  1AV1 A;  2BCC J;  4EYY Q;  2HLO A;  1LNQ A;  1LTJ B;  1NKN A;  2WPS A;  1NVO A;  3H1J G;  3BCC G;  1SQQ D;  3Q5P A;  3CCM P;  3SWK A;  1AA0 A;  2OQQ A;  4U3F G;  1EXI A;  3RL0 C;  2LR2 A;  3AE7 C;  1JM0 A;  2KUB A;  2OGU A;  2W6J H;  1FDM A;  5KJ7 D;  5CCG D;  2WMM A;  1FOS F;  2E76 C;  2Z5I A;  2KSE A;  1GMJ A;  4HH2 A;  3CD6 P;  3P8C E;  5KLV E;  2JEE A;  3HD7 D;  1L0L E;  1VQ7 P;  4H0L D;  1M1J B;  1R8E A;  1RE3 A;  3T97 B;  1J1D B;  3BRV B;  4PV1 C;  1PL5 A;  1N7S B;  3PTZ A;  1WT6 A;  2HOD A;  4N78 E;  1JTH A;  3GF7 A;  2LKM A;  2Q6Q A;  1KIL B;  1RQV A;  2H89 C;  3BCC E;  3S1K A;  2ZT9 B;  1IC2 A;  3AE6 C;  3CCU P;  1T8Z A;  3L73 D;  1LTJ C;  4U3F E;  1SQB G;  2QVA A;  2V7Q H;  1W2B O;  1ZRT D;  3L72 D;  1G2C B;  3CCQ P;  2YIU C;  1S3J A;  2OYI A;  3CWB J;  2E75 B;  2IBZ I;  1N73 B;  1KB9 H;  1L4A A;  1JTH B;  2KZI A;  2OYH A;  1OW8 A;  2JJL A;  3HUS A;  1U7J A;  1YQ4 C;  2O3J A;  1SQP G;  3O6Q A;  2M3E A;  2WSE J;  2JR8 A;  2ZVO B;  1M1J C;  2ZXE B;  4W80 A;  2UWJ E;  1M90 Q;  1J1D C;  1DD3 A;  2HPC B;  1N7S C;  1KYO I;  2R3S A;  3GMA A;  1IFM A;  2OYH B;  3V2Q A;  1KIL C;  1SQB E;  4WY4 A;  4AQR D;  3G71 P;  1H0T B;  4IL6 X;  1K73 Q;  1ZR4 A;  3PJS K;  1PGQ A;  3RL0 D;  3LIE A;  3H1I G;  3GF3 A;  1IK7 A;  2E75 C;  1P84 I;  3L71 G;  2WSS H;  1N73 C;  1H88 A;  3TGU D;  3MD0 A;  1NAY A;  1RH5 B;  3SFE C;  1SQP E;  4RO0 A;  1BGY G;  1RF0 A;  2ITA A;  3G4S P;  5AW2 B;  2E76 D;  3RGU A;  3AEE C;  2KYV A;  3C1L A;  3PP5 A;  5KAI H;  1NU1 J;  2QJY B;  1JNM A;  3GW6 A;  4PJ0 H;  3A7O A;  5APW A;  1T2K C;  4PV1 D;  1PPJ D;  1KMI Z;  1S5L H;  1WRG A;  3FGA D;  4ZKU A;  3AEB C;  1BCC D;  3L73 J;  2P1J A;  1NTM D;  3QWO C;  3L72 J;  1Z56 A;  2NPS A;  1BDD A;  4AUW A;  1OW7 A;  1NGM B;  4XA4 A;  2WQY C;  5KAI E;  4L76 A;  3AE9 C;  3H1I E;  3L71 E;  3HE4 A;  1FZC A;  1QGK B;  4JBZ A;  1E79 H;  1S5L E;  3D71 A;  5CHX A;  5BU5 A;  2W27 A;  3NMD A;  5E79 E;  1BGY E;  3RBZ A;  1NTZ E;  3H1H G;  2RH0 A;  2NPS B;  2DW3 A;  2QJK B;  3AE3 C; 
#chains in the Genus database with same CATH homology
 2ZAE B;  2I8D A;  1DEE G;  2B89 A;  1EC5 A;  2SPZ A;  1EDI A;  4KJM A;  4ZMD A;  2Q1K A;  4GOF A;  3S1K A;  4IOI H;  3PH0 A;  4GOE A;  5DJU B;  4ASV A;  2B87 B;  1U7M A;  2QRX A;  1X0T A;  2QVA A;  1EDJ A;  1ZXG A;  4WWI A;  3MHV A;  1FC2 C;  2HR3 A;  1BDC A;  3RGU A;  1S3J A;  3FXD A;  5K5G B;  1H0T A;  5DJT B;  2RKL A;  4HKZ H;  3FXE A;  2B88 A;  4EYY Q;  2KZI A;  2KI7 B;  1NVO A;  1OVR A;  2KS1 B;  1EDK A;  2M0B A;  2M5A B;  3QWO C;  1U7J A;  4HJG H;  2B87 A;  4K3A A;  1EDL A;  2LR2 A;  1LP1 B;  1ZW0 A;  1BDD A;  4GOD A;  4BXL A;  1LT1 A;  1SS1 A;  5EFW B;  1JM0 A;  2UWJ E;  3ZDM A;  2OTK E;  2KUB A;  4NPE A;  4NPD A;  2WMM A;  1JMB A;  4JBZ A;  4K35 A;  2JWD A;  2P58 A;  1OVU A;  4ZNC A;  4ASW A;  4CPG A;  2R44 A;  2KIK A;  2M5A A;  2LXB A;  1H0T B;  5CBO A;  1MFT A;  1Y47 A;  2KZJ A;  2LXC B;  5CBN A;  5C39 A;  4HB1 A;  4NPF X;  4MN4 C;  1LP1 A;  2K3R A;  1Q2N A;  3MZW B;  1OVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...