4D6TE

Cytochrome bc1 bound to the 4(1h)-pyridone gw844520
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
73
structure length
73
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME B-C1 COMPLEX SUBUNIT 1, MITOCHONDRIAL
publication title Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
pubmed doi rcsb
total genus 22
structure length 73
sequence length 73
chains with identical sequence I, R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
E PF09165 Ubiq-Cytc-red_N Ubiquinol-cytochrome c reductase 8 kDa, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 4d6tE00
1SQBE 1PPJE 1BCCE 1PP9E 3L70E 1KYOE 3H1HE 3H1KE 1L0NE 3H1LE 5KLVE 2BCCE 1NTKE 4D6TE 3CX5E 1NTZE 2FYUE 3L71E 2IBZE 3TGUE 1SQXE 1BE3E 1BGYE 4PD4E 3CWBE 1KB9E 1EZVE 1NU1E 2A06E 1P84E 3H1IE 3L73E 3L75E 1SQVE 3L72E 3CXHE 1SQPE 1SQQE 3L74E 3H1JE 1L0LE 1NTME 3BCCE 4U3FE
chains in the Genus database with same CATH superfamily
3E1IA 3L70G 3P7KA 2BEQD 3TDKA 2B87A 3IAOA 1HWTC 2HODA 1DEEG 1M1KQ 2ZT9B 1X8YA 3P8CE 1S72P 1JTHB 3VMAA 4I1LA 4RESB 2E74B 3G9RA 1OW6A 1FZFA 1FDOA 5GTIH 3LIDA 5KLIC 1L0ND 1YTZT 4PJ0H 1RQUA 1LTIC 1ZXGA 4NPEA 1AA0A 2YO2A 3ZDMA 1NU1D 2FYNC 2ZYAA 1QL1A 2W6BA 3AE2C 5AW9B 3F89A 2ZFCA 1NTMK 4I6MC 2ZYGA 2AEFA 4BRYA 1LT9B 2R44A 2PP6A 4PD4D 3M0AA 2ZAEB 2FYUJ 2OARA 2NPSA 5C39A 1G1IA 3FWNA 4K3AA 3CXHD 1RF1A 4ZNCA 2KNCB 5B66H 1FZEA 1PZQA 1BE3E 1CI6B 2E76D 3L73J 1IZNB 3CMAP 3D71A 1GL2A 1SQVG 1KQGB 1VF5C 4N3YB 1PPJE 2Y0DA 2XDJA 2JR8A 3H1HG 1SFCB 3O8ZA 5B5EE 1KB9D 4AUWA 2HR3A 2OTJP 3AEEC 4XFJA 2KLVA 2B89A 1FJPA 1HJ0A 4H44D 3A0BH 1CZQA 2O01N 3RL0C 4H13D 1W2BO 3O6QB 2E5TA 2WSSH 1NAFA 1L4AA 1FZBA 2NPSD 1JY2O 2QIWA 2L5GB 4TT3H 1KILE 2WSEH 1L0NK 1MZ9A 1VL2A 1BCCJ 2FXOA 1VQOP 3TF5A 1EDJA 3Q5RA 1SQVD 2W83C 1JUNA 4RO0A 1SQQK 1U7JA 4OGQD 1YJNP 4YPCA 1SQQE 3H1HD 2QG4A 3A0HE 3BRVB 1FJKA 2Y0CA 2QJKC 2G3AA 2E42A 3TSIA 1S5LX 3CCUP 2A45G 1JMMA 2OTKE 1M90Q 3QWOC 1JO5A 1N7SA 1K8AQ 3CXHE 2KS1B 1GK4A 1SQBG 2BCCJ 2YMKA 2ZYDA 3HUSB 3RK2D 3KDPB 2JDIH 4H0LD 4C7RA 2WPSA 1QLED 3GG2A 3HD7C 1J1EC 3CD6P 1LT1A 3JCUE 2IBZI 2W6JH 1GZLA 3C1LA 3TNUB 2KLUA 2Q5UA 1KB9E 2E75C 1AVOA 1KV4A 3OA7A 3SWFA 4IFDK 1JY3O 1Y8AA 1KFNA 1VQ4P 2XKMA 5AVXB 2R3CA 5AW5B 1FC2C 4JF7A 1IFNA 1P84H 5KLIB 3L73G 2I1KA 1SQBD 4N78D 2AEMA 2P67A 1RY3A 5KAIE 4ZKUA 2M5AA 2I8DA 2KZIA 3TGUE 5CCGA 3WMM0 2GUVA 4IFMA 3P32A 2WTYA 1NGMB 1MFZA 4BWNA 1FDIA 4BRYB 1GDTA 1NWQA 3M91A 3H1HE 3CCEP 1G2CA 1RE4A 2JJLA 2WSCJ 1FAVA 3SFDC 1JY2N 3H1JD 4AQRD 1QVFO 1BSNA 1SQPJ 2IPPA 3BCCE 2OYIC 3WU2E 1BCCG 2Q6QA 2N1TD 2KUBA 2YXRB 1LT9A 5AVSB 3L73D 3FGAD 2P1JA 1ZLLA 1IK9A 5CBNA 1GL2B 1BDCA 1VQ9P 1VF5B 3C9IA 1S9KE 2SPZA 2FFDA 2UWJE 3B5ND 2PRRA 3Q5PA 1KYOE 3M0DC 3E7KA 3NMDA 3CCSP 1W2EA 3I5CA 4C46A 1EDLA 1ZV8A 4GOFA 1SS1A 2XZRA 1CI6A 2FXMA 3RL0B 5KJ7C 1KMIZ 1OXZA 1D7MA 5KJ7A 3W68A 3L35A 1L4AB 4ZMDA 2K1AA 2YO3A 2YNYA 3CWBG 1SFCA 1ZW0A 4JPZB 1SQBK 4DCKA 2H89C 1SQBE 3CX5I 2ZJSE 4N78E 2Y9ZA 3VOPA 3CCLP 5AW7B 2N9YB 4EDFA 3R2PA 5KKZC 4TLFA 3AECC 2KXPB 2M3BA 4A7PA 1DIPA 1WT6A 1ZP0C 3L75G 3MP7B 1JY3N 1MFTA 2LXCB 3Q2YA 3B8EB 1K04A 2IFNA 5B5EH 2QJPC 3VYIA 1XTCC 1S3JA 1M8OB 5M1BA 4L73A 3HTKB 2H8PD 1EZVG 5AVTB 3KZIE 2FYZA 1R8EA 3H1JE 1CSBA 1IFIA 2R5DA 5KLVJ 3CWBD 2Y9YA 1W5CE 4W80A 4EIJA 3GF3A 2M3EA 2E43A 3LW5H 1AJYA 2OYHA 2JEEA 1S4XA 3RK3D 3GW6A 4U3FJ 3S9OA 5AW1B 1NTZD 2KS1A 2OYOA 2RH0A 2W8ZA 3MZWB 1KILA 4WB4A 2E75B 1NKNA 3L75D 4Y99C 3WUVA 1M56D 1NKZB 3C8VA 2IZ0A 1KFMA 3A0HH 1UIIA 3VMYA 4GKGA 1QVGO 3L36A 2IX7C 3SSUA 3H1KG 4D6TE 1NTKG 1EZVD 2PGDA 3A7OA 3NFQA 2KI7B 2XNDH 5APQA 1YTZI 3TNUA 2A06G 2M5AB 3L72E 2H7HA 2WSEJ 2G8YA 1GW3A 3TK1A 3CX5D 1PP9J 1RQVA 3V2NA 1URQD 2IYOA 1T2KD 3MHVA 5AW8B 3S4RA 2MKVA 5TJHA 1EDKA 5AVZB 4HYTB 3AE6C 1G2CB 2Q7CA 3JCUH 3L74G 1MV8A 1KZUB 1SVFA 1BGYJ 3P8MC 1KB9H 1BDDA 2AEJA 1YITP 2WPRA 4W7YA 2D2CC 1LJ2A 3L70D 4HB1A 3H1KD 1JCCA 1NTME 1NTKD 4WY4C 1LTJC 4AYCA 4XE5B 4WY4A 2A06D 4RKUJ 4YXDC 2YKOA 4H44C 3AE1C 1KORA 2FFDB 2P58A 2K9JA 1PGJA 5KAIH 2Q1KA 2B88A 1L0LG 1N2DC 1NTZK 3RK3E 3H1LJ 2Z4EA 2WQYC 3PRJA 3U1AA 2O1JA 1NTZE 2Y0EA 1M57D 2W27A 1UIXA 1NO4A 3M06A 4UB8E 3H1IJ 1HJBA 3L74D 3L75E 1QGKB 2B9BA 3OAKA 1R5LA 3HRNA 3IN6A 1NVOA 1QEXA 2O1KA 1AQTA 1AV1A 5KLVG 3L71J 2JWAA 1IJDB 3ITKA 2QA4P 4WBAA 4LC1A 4OGQC 1E5WA 1EZVE 4JYCA 1N73C 1KYOI 3WUTA 3WU2H 2HG5D 1VQ5P 3CMEP 5H2FE 1ZR2A 1SQXJ 2KYVA 3CCVP 4I7ZC 3V4WA 5KAFH 1L0LD 3GHGC 3L37A 2NZ2A 2XNXA 3PJSK 3RK2C 1KYOH 4ASWA 3EFFK 1L0NE 4D6TJ 2QJPB 4H0LC 1YIJP 1JEKA 4I2LC 1U57A 1NU1K 3FX0A 1AVYA 4GOEA 1NU1E 1FS0E 3RL0g 2I1JA 1NTKK 1GL2D 3L70E 3H1KE 1PP9G 1Y9BA 3U59A 1NTKE 4DJGA 2O3JA 5KTBA 4PD4E 1JY3P 1RE3C 3PTZA 5AVYB 2OYHB 1HGVA 5BU8B 1DX7A 3VP8A 2JO1A 1OX3A 5AVVB 5CJ4A 3HTKA 3KPEA 1PGOA 1EXIA 1OMIA 2GUSA 2P7JA 5GTHE 3D6ZA 3V5BA 1KILB 3SWYA 3RL0D 1HTLC 2ITAA 1FZAA 1NOHA 1VQ7P 1AQ5A 1L4AD 1G1JA 4W7ZA 3RGUA 3M9QA 1VPCA 1N7LA 1OW8A 3L74E 4Y28J 3HD7A 1PGPA 2KK7A 2FBWC 2Q3IA 3AE5C 2FYUG 1P84I 3GF7A 4WWIA 1MUUA 1KQSO 4XA4A 1OFCX 2LXBA 3VN0A 3PLNA 2R3SA 3QH9A 3KHUA 1BE3J 1U7MA 1JNMA 2ZXXA 4U7JA 1FOSE 1ZOYC 1L0LK 3H1IG 1N7SD 2N1TC 4PV1D 2RMZA 3V4QA 2FYNB 1FE6A 1ZRTD 2IZ1A 3L71G 5AW3B 2IBZG 2D2CB 3I55P 1SQVK 3B5NC 1JOCA 1WMKA 5CCHC 5APSA 1SQVE 1JB0J 3V2PA 2C9NY 1M1JC 2FYUD 4WY4B 5APUA 1OIPA 3BASA 2O01H 4R4LA 2JWDA 2WSFJ 2BEZF 1SQXG 1NH4A 2K9JB 1X22A 3EFGA 3LW5J 1OWAA 2PFXA 2CPBA 1KD1Q 2HPCA 4K35A 4IFFA 2OYIA 3CC7P 2QVAA 1VQMP 3KXDA 5AW6B 5DJUB 1HGZA 1SQQJ 2W6AA 1BSHA 4IL6E 3E1RA 4DT0A 3H32A 2IBZD 1GW4A 3M0DA 5APTA 1OZHA 2ZT9D 3JC22 1IFDA 5CCGD 1YJWP 1PIXA 1NHLA 4EI2A 2AXTE 2J58A 3GMAA 3KYQA 2E74D 3Q1MA 1SQXD 1H0TB 1Q90D 2BCCG 1ZMEC 5AW4B 3G3ZA 1LTTC 3GHGB 3H25A 1Q81Q 2FKWB 2K3RA 1BCCD 3T97B 4Z1MH 5CHXA 4JYBA 2DW3A 2FXPA 4H0LB 3N7NA 1ZN5A 3RK3C 4UB8H 1X0TA 3A3YB 1ZRTE 3G4SP 2YIUC 3TYYA 5DJTB 2FYUK 3R4YA 2QJKB 5E79E 4KT0J 2FYUE 4EYYQ 2C9LY 1XTGB 2WVRA 2R32A 1T3JA 2BCCD 2FY8A 2H43A 4IOIH 1PPJG 2WWWA 5KJ7D 2IFMA 3AEAC 4GDOA 1VQPP 3OJAB 3TGUJ 3ABVC 2WSFH 3BVHA 1LWUC 3L73E 1J2JB 1S5LE 1SFCD 2VRSA 4MN4C 3PP5A 3HD7B 4N6JA 2N9BA 1J1EB 3GLMA 1URQC 1T2KC 3H1HJ 4PD4I 3MUDC 1KQFB 5APWA 3CPWO 2IBZE 1A02F 3CXHI 2WITA 1QX8A 3LIEA 1GMJA 1M7LA 1SQPG 3BCCJ 1SP4A 1TU3F 3WUUA 3HUSC 3Q5SA 4PD4H 3CC4P 3USSA 2KSJA 3IFMA 1SLQA 3V2QA 4L76A 2N1TB 4HKZH 1AFOA 3CXHH 3FXEA 1SQQG 5GTHH 2K37A 1BCCE 1Q86Q 1LP1A 2POHA 1KB9I 2XU6A 3S1KA 3SWKA 5AVWB 1KC8Q 2YMYA 3FXDA 2CPSA 3B5NB 2ZVOB 1LTSC 2MJZA 3KQGA 4O9BA 1VQ8P 1M1JB 2KZJA 1ZR4A 1N8RQ 1N86A 2YKPA 2E76C 4HJGH 1KQLA 1FDMA 1PGQA 4C7NA 3F5HA 1WRGA 4DZOA 3BATA 1YBKA 3BRTB 1LTGC 1KILD 1S1CX 1YYCA 1SQPD 2OTLP 1HVVA 1T8ZA 2HPCB 1FOSF 1DD3A 2OYIB 1SQBJ 1X9VA 2YKQA 2J59M 3EWKA 2BCCE 3AE4C 1Y47A 2KSEA 1K05A 1LTJA 2P10A 2YXQB 3CWBE 1SQQD 4H13C 2AXCA 2HYNA 3H32B 1QL2A 2XV5A 1MKMA 4NPFX 1T3UA 4BXLA 2V7QH 3B71A 2NPSC 1JY2P 5CBOA 3CCJP 1T6AA 1RF1C 3H6PA 4JBZA 4IL6X 2ZVNB 3UIAA 3NTNA 4UB6E 3H1JJ 3M9HA 2Q3EA 3HE4B 1LGHB 3A2AA 1GD2E 1LNQA 1NJIQ 2QJYC 3TGUG 2L91A 1GL2C 2J5UA 2NRGA 1YJ9P 3D70A 1N73A 2D2CD 1NAYA 1H89A 4U3FG 3RBXA 5AW0B 3CX5E 2WT7A 2M0BA 3AE7C 1VQLP 3RK3B 4L75A 5KKZB 1VQKP 2YIUB 4WY4D 4DOJA 1H0TA 3PH0A 4LGDE 3N4XA 3HE5B 4RJTA 3K5BA 2QRXA 3GHGA 1LTBC 4IL6H 5BVZA 3BCCG 2A45I 3T97A 3FWLA 1L4AC 1PL5A 5TISE 1J1DC 1KN7A 2O01J 1H88A 1JCDA 1R5SA 3A5TA 1SQPK 1HUCA 1JMBA 2CK3H 2WPQA 4ASVA 2QM8A 2AXTH 3L72J 3OW2O 1SQPE 3CCRP 1HBWA 5KLVD 1OW7A 3TGUD 1KTMA 1VF5D 2W90A 3CL3D 2A45H 2E5YA 1LWUB 4OWFA 1RE3A 2A06E 2ZXEB 4U3FD 1FBMA 1RH5B 1URQB 2Q9IA 5CJ0A 1X79B 1K73Q 5CMZA 1N7SC 4PV1C 1BGYG 4Y99B 3V2RA 1JM0A 3BCCD 1VQ6P 2GM4A 3AEGC 1NTMJ 3Q3DA 3RBZA 2C0XA 5E79H 2WZ7A 3CCMP 3IF4A 3CWBJ 3IR9A 3CC2P 1GU4A 3MTUE 3VMZA 1S9KD 2BASA 5GTIE 2V4HA 3KZIH 1KYOD 1VQNP 1PP9D 3MD0A 1LP1B 2B87B 2WPVB 4PJ0E 3AE9C 4GODA 3VMXA 1NTZJ 3H1LG 1PFIA 2HODB 2QE7H 1FZCC 2C0WA 3MIWA 1S5LH 1FZCA 2KIKA 3L75J 2QM7A 2M8RA 1USDA 1L0LE 3H1JG 2N1TA 2E76B 4C7NB 5APXA 1BGYD 4WVZA 1EXJA 1IC2A 1DD4A 3I56P 1RHZB 1Q7YQ 3W67A 3B5NA 5B66E 4OVNF 1HF9A 2H88C 5CCHA 5KLVK 4JQ0D 2ZT9C 1LTJB 5KLVE 2RN0A 5CCGC 3HD7D 1M1JA 4KHXA 3II6A 1YHQP 1IK7A 1JTHA 4H44B 4ZKPA 4H13B 2E74C 1H8AA 3AEBC 1Q2NA 2OQQA 5APYA 4KJMA 1FU1A 1EC5A 2E75D 3H1LD 1VDFA 4U3FE 2R5BA 2NPSB 1RE4C 3VP9A 5AW2B 1L0NJ 3V6IA 3AE3C 4D6TG 1OVRA 1RF1B 1K9MQ 3H1ID 1L2PA 1PV3A 1IFMA 2QSIA 1NU1J 2KOGA 2Z5HA 2JKVA 1FZGA 2PAJA 3A0BE 3L72G 3L4FA 2HLOA 1NYHA 3L70J 1Q82Q 3H1KJ 3L71D 2GA1A 1LT9C 1NTKJ 1A02J 2QJYB 3EQ2A 2IYPA 4OGQB 1GK6A 1P84D 2K88A 5KAFE 1N73B 3PHLA 2FFDC 1IFPA 2LKMA 2WT7B 1PP9E 1EDIA 3VTPC 1YQ4C 2JP3A 2KNCA 5CCHD 1E79H 3AEDC 1CW5A 3HE4A 4I7ZB 4R4MA 3AEFC 4OH8B 1OVVA 5EFWB 3L74J 3RK2B 1Z56A 3CLQA 4D6TD 5K5GB 5APVA 1NTMG 4EOTA 1J1DB 3M9BA 3JSVC 5AVUB 5L8RJ 1EZVI 1SFCC 1BGYE 4NPDA 1HH0A 3L72D 4M3LA 3P8CD 1LTAC 1IFJA 4UB6H 4GT1A 2HFED 3HE5A 1GU5A 2OGUA 3O6QA 4LLHA 1YQ3C 1NTZG 1BE3G 3SFEC 3B4SA 3D6YA 1EQ7A 1L0LJ 2RKLA 4B86A 4L74A 4QMAA 5AVQB 4YXWH 3MGNA 2V7QJ 3AE8C 3NXSA 3H1LE 4CPGA 3CX5H 5H2FH 1N7SB 4PV1B 1YI2P 1DH3A 3H1IE 3G6EP 1NTMD 2WMMA 2KB7P 1LWUA 1SQVJ 5AVRB 5BU5A 2K9YA 4YTPC 1URQA 5TISH 4HH2A 3L71E 2P2UA 1USEA 2WSCH 3MUDA 3G71P 1RF0C 1S2EA 2OYHC 3U1CA 1RF0A 1P84E 2LR2A 2KP8A 2IDBA 1GTWA 2QEXP 2Z5IA 1IO4A 3CI9A 1BE3D 1L0NG 1KILC 1SQXK 3CCQP 1SQXE 1FZCB 3HUSA 4GIFA 1NU1G 1OVUA 1PPJD 1DEBA
chains in the Genus database with same CATH topology
1SQBE 1PPJE 1BCCE 1PP9E 3L70E 1KYOE 3H1HE 3H1KE 1L0NE 3H1LE 5KLVE 2BCCE 1NTKE 4D6TE 3CX5E 1NTZE 2FYUE 3L71E 2IBZE 3TGUE 1SQXE 1BE3E 1BGYE 4PD4E 3CWBE 1KB9E 1EZVE 1NU1E 2A06E 1P84E 3H1IE 3L73E 3L75E 1SQVE 3L72E 3CXHE 1SQPE 1SQQE 3L74E 3H1JE 1L0LE 1NTME 3BCCE 4U3FE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQB E;  1PPJ E;  1BCC E;  1PP9 E;  3L70 E;  1KYO E;  3H1H E;  3H1K E;  1L0N E;  3H1L E;  5KLV E;  2BCC E;  1NTK E;  4D6T E;  3CX5 E;  1NTZ E;  2FYU E;  3L71 E;  2IBZ E;  3TGU E;  1SQX E;  1BE3 E;  1BGY E;  4PD4 E;  3CWB E;  1KB9 E;  1EZV E;  1NU1 E;  2A06 E;  1P84 E;  3H1I E;  3L73 E;  3L75 E;  1SQV E;  3L72 E;  3CXH E;  1SQP E;  1SQQ E;  3L74 E;  3H1J E;  1L0L E;  1NTM E;  3BCC E;  4U3F E; 
#chains in the Genus database with same CATH topology
 3E1I A;  3L70 G;  3P7K A;  2BEQ D;  3TDK A;  2B87 A;  3IAO A;  1HWT C;  2HOD A;  1DEE G;  1M1K Q;  2ZT9 B;  1X8Y A;  3P8C E;  1S72 P;  1JTH B;  3VMA A;  4I1L A;  4RES B;  2E74 B;  3G9R A;  1OW6 A;  1FZF A;  1FDO A;  5GTI H;  3LID A;  5KLI C;  1L0N D;  1YTZ T;  4PJ0 H;  1RQU A;  1LTI C;  1ZXG A;  4NPE A;  1AA0 A;  2YO2 A;  3ZDM A;  1NU1 D;  2FYN C;  2ZYA A;  1QL1 A;  2W6B A;  3AE2 C;  5AW9 B;  3F89 A;  2ZFC A;  1NTM K;  4I6M C;  2ZYG A;  2AEF A;  4BRY A;  1LT9 B;  2R44 A;  2PP6 A;  4PD4 D;  3M0A A;  2ZAE B;  2FYU J;  2OAR A;  2NPS A;  5C39 A;  1G1I A;  3FWN A;  4K3A A;  3CXH D;  1RF1 A;  4ZNC A;  2KNC B;  5B66 H;  1FZE A;  1PZQ A;  1BE3 E;  1CI6 B;  2E76 D;  3L73 J;  1IZN B;  3CMA P;  3D71 A;  1GL2 A;  1SQV G;  1KQG B;  1VF5 C;  4N3Y B;  1PPJ E;  2Y0D A;  2XDJ A;  2JR8 A;  3H1H G;  1SFC B;  3O8Z A;  5B5E E;  1KB9 D;  4AUW A;  2HR3 A;  2OTJ P;  3AEE C;  4XFJ A;  2KLV A;  2B89 A;  1FJP A;  1HJ0 A;  4H44 D;  3A0B H;  1CZQ A;  2O01 N;  3RL0 C;  4H13 D;  1W2B O;  3O6Q B;  2E5T A;  2WSS H;  1NAF A;  1L4A A;  1FZB A;  2NPS D;  1JY2 O;  2QIW A;  2L5G B;  4TT3 H;  1KIL E;  2WSE H;  1L0N K;  1MZ9 A;  1VL2 A;  1BCC J;  2FXO A;  1VQO P;  3TF5 A;  1EDJ A;  3Q5R A;  1SQV D;  2W83 C;  1JUN A;  4RO0 A;  1SQQ K;  1U7J A;  4OGQ D;  1YJN P;  4YPC A;  1SQQ E;  3H1H D;  2QG4 A;  3A0H E;  3BRV B;  1FJK A;  2Y0C A;  2QJK C;  2G3A A;  2E42 A;  3TSI A;  1S5L X;  3CCU P;  2A45 G;  1JMM A;  2OTK E;  1M90 Q;  3QWO C;  1JO5 A;  1N7S A;  1K8A Q;  3CXH E;  2KS1 B;  1GK4 A;  1SQB G;  2BCC J;  2YMK A;  2ZYD A;  3HUS B;  3RK2 D;  3KDP B;  2JDI H;  4H0L D;  4C7R A;  2WPS A;  1QLE D;  3GG2 A;  3HD7 C;  1J1E C;  3CD6 P;  1LT1 A;  3JCU E;  2IBZ I;  2W6J H;  1GZL A;  3C1L A;  3TNU B;  2KLU A;  2Q5U A;  1KB9 E;  2E75 C;  1AVO A;  1KV4 A;  3OA7 A;  3SWF A;  4IFD K;  1JY3 O;  1Y8A A;  1KFN A;  1VQ4 P;  2XKM A;  5AVX B;  2R3C A;  5AW5 B;  1FC2 C;  4JF7 A;  1IFN A;  1P84 H;  5KLI B;  3L73 G;  2I1K A;  1SQB D;  4N78 D;  2AEM A;  2P67 A;  1RY3 A;  5KAI E;  4ZKU A;  2M5A A;  2I8D A;  2KZI A;  3TGU E;  5CCG A;  3WMM 0;  2GUV A;  4IFM A;  3P32 A;  2WTY A;  1NGM B;  1MFZ A;  4BWN A;  1FDI A;  4BRY B;  1GDT A;  1NWQ A;  3M91 A;  3H1H E;  3CCE P;  1G2C A;  1RE4 A;  2JJL A;  2WSC J;  1FAV A;  3SFD C;  1JY2 N;  3H1J D;  4AQR D;  1QVF O;  1BSN A;  1SQP J;  2IPP A;  3BCC E;  2OYI C;  3WU2 E;  1BCC G;  2Q6Q A;  2N1T D;  2KUB A;  2YXR B;  1LT9 A;  5AVS B;  3L73 D;  3FGA D;  2P1J A;  1ZLL A;  1IK9 A;  5CBN A;  1GL2 B;  1BDC A;  1VQ9 P;  1VF5 B;  3C9I A;  1S9K E;  2SPZ A;  2FFD A;  2UWJ E;  3B5N D;  2PRR A;  3Q5P A;  1KYO E;  3M0D C;  3E7K A;  3NMD A;  3CCS P;  1W2E A;  3I5C A;  4C46 A;  1EDL A;  1ZV8 A;  4GOF A;  1SS1 A;  2XZR A;  1CI6 A;  2FXM A;  3RL0 B;  5KJ7 C;  1KMI Z;  1OXZ A;  1D7M A;  5KJ7 A;  3W68 A;  3L35 A;  1L4A B;  4ZMD A;  2K1A A;  2YO3 A;  2YNY A;  3CWB G;  1SFC A;  1ZW0 A;  4JPZ B;  1SQB K;  4DCK A;  2H89 C;  1SQB E;  3CX5 I;  2ZJS E;  4N78 E;  2Y9Z A;  3VOP A;  3CCL P;  5AW7 B;  2N9Y B;  4EDF A;  3R2P A;  5KKZ C;  4TLF A;  3AEC C;  2KXP B;  2M3B A;  4A7P A;  1DIP A;  1WT6 A;  1ZP0 C;  3L75 G;  3MP7 B;  1JY3 N;  1MFT A;  2LXC B;  3Q2Y A;  3B8E B;  1K04 A;  2IFN A;  5B5E H;  2QJP C;  3VYI A;  1XTC C;  1S3J A;  1M8O B;  5M1B A;  4L73 A;  3HTK B;  2H8P D;  1EZV G;  5AVT B;  3KZI E;  2FYZ A;  1R8E A;  3H1J E;  1CSB A;  1IFI A;  2R5D A;  5KLV J;  3CWB D;  2Y9Y A;  1W5C E;  4W80 A;  4EIJ A;  3GF3 A;  2M3E A;  2E43 A;  3LW5 H;  1AJY A;  2OYH A;  2JEE A;  1S4X A;  3RK3 D;  3GW6 A;  4U3F J;  3S9O A;  5AW1 B;  1NTZ D;  2KS1 A;  2OYO A;  2RH0 A;  2W8Z A;  3MZW B;  1KIL A;  4WB4 A;  2E75 B;  1NKN A;  3L75 D;  4Y99 C;  3WUV A;  1M56 D;  1NKZ B;  3C8V A;  2IZ0 A;  1KFM A;  3A0H H;  1UII A;  3VMY A;  4GKG A;  1QVG O;  3L36 A;  2IX7 C;  3SSU A;  3H1K G;  4D6T E;  1NTK G;  1EZV D;  2PGD A;  3A7O A;  3NFQ A;  2KI7 B;  2XND H;  5APQ A;  1YTZ I;  3TNU A;  2A06 G;  2M5A B;  3L72 E;  2H7H A;  2WSE J;  2G8Y A;  1GW3 A;  3TK1 A;  3CX5 D;  1PP9 J;  1RQV A;  3V2N A;  1URQ D;  2IYO A;  1T2K D;  3MHV A;  5AW8 B;  3S4R A;  2MKV A;  5TJH A;  1EDK A;  5AVZ B;  4HYT B;  3AE6 C;  1G2C B;  2Q7C A;  3JCU H;  3L74 G;  1MV8 A;  1KZU B;  1SVF A;  1BGY J;  3P8M C;  1KB9 H;  1BDD A;  2AEJ A;  1YIT P;  2WPR A;  4W7Y A;  2D2C C;  1LJ2 A;  3L70 D;  4HB1 A;  3H1K D;  1JCC A;  1NTM E;  1NTK D;  4WY4 C;  1LTJ C;  4AYC A;  4XE5 B;  4WY4 A;  2A06 D;  4RKU J;  4YXD C;  2YKO A;  4H44 C;  3AE1 C;  1KOR A;  2FFD B;  2P58 A;  2K9J A;  1PGJ A;  5KAI H;  2Q1K A;  2B88 A;  1L0L G;  1N2D C;  1NTZ K;  3RK3 E;  3H1L J;  2Z4E A;  2WQY C;  3PRJ A;  3U1A A;  2O1J A;  1NTZ E;  2Y0E A;  1M57 D;  2W27 A;  1UIX A;  1NO4 A;  3M06 A;  4UB8 E;  3H1I J;  1HJB A;  3L74 D;  3L75 E;  1QGK B;  2B9B A;  3OAK A;  1R5L A;  3HRN A;  3IN6 A;  1NVO A;  1QEX A;  2O1K A;  1AQT A;  1AV1 A;  5KLV G;  3L71 J;  2JWA A;  1IJD B;  3ITK A;  2QA4 P;  4WBA A;  4LC1 A;  4OGQ C;  1E5W A;  1EZV E;  4JYC A;  1N73 C;  1KYO I;  3WUT A;  3WU2 H;  2HG5 D;  1VQ5 P;  3CME P;  5H2F E;  1ZR2 A;  1SQX J;  2KYV A;  3CCV P;  4I7Z C;  3V4W A;  5KAF H;  1L0L D;  3GHG C;  3L37 A;  2NZ2 A;  2XNX A;  3PJS K;  3RK2 C;  1KYO H;  4ASW A;  3EFF K;  1L0N E;  4D6T J;  2QJP B;  4H0L C;  1YIJ P;  1JEK A;  4I2L C;  1U57 A;  1NU1 K;  3FX0 A;  1AVY A;  4GOE A;  1NU1 E;  1FS0 E;  3RL0 g;  2I1J A;  1NTK K;  1GL2 D;  3L70 E;  3H1K E;  1PP9 G;  1Y9B A;  3U59 A;  1NTK E;  4DJG A;  2O3J A;  5KTB A;  4PD4 E;  1JY3 P;  1RE3 C;  3PTZ A;  5AVY B;  2OYH B;  1HGV A;  5BU8 B;  1DX7 A;  3VP8 A;  2JO1 A;  1OX3 A;  5AVV B;  5CJ4 A;  3HTK A;  3KPE A;  1PGO A;  1EXI A;  1OMI A;  2GUS A;  2P7J A;  5GTH E;  3D6Z A;  3V5B A;  1KIL B;  3SWY A;  3RL0 D;  1HTL C;  2ITA A;  1FZA A;  1NOH A;  1VQ7 P;  1AQ5 A;  1L4A D;  1G1J A;  4W7Z A;  3RGU A;  3M9Q A;  1VPC A;  1N7L A;  1OW8 A;  3L74 E;  4Y28 J;  3HD7 A;  1PGP A;  2KK7 A;  2FBW C;  2Q3I A;  3AE5 C;  2FYU G;  1P84 I;  3GF7 A;  4WWI A;  1MUU A;  1KQS O;  4XA4 A;  1OFC X;  2LXB A;  3VN0 A;  3PLN A;  2R3S A;  3QH9 A;  3KHU A;  1BE3 J;  1U7M A;  1JNM A;  2ZXX A;  4U7J A;  1FOS E;  1ZOY C;  1L0L K;  3H1I G;  1N7S D;  2N1T C;  4PV1 D;  2RMZ A;  3V4Q A;  2FYN B;  1FE6 A;  1ZRT D;  2IZ1 A;  3L71 G;  5AW3 B;  2IBZ G;  2D2C B;  3I55 P;  1SQV K;  3B5N C;  1JOC A;  1WMK A;  5CCH C;  5APS A;  1SQV E;  1JB0 J;  3V2P A;  2C9N Y;  1M1J C;  2FYU D;  4WY4 B;  5APU A;  1OIP A;  3BAS A;  2O01 H;  4R4L A;  2JWD A;  2WSF J;  2BEZ F;  1SQX G;  1NH4 A;  2K9J B;  1X22 A;  3EFG A;  3LW5 J;  1OWA A;  2PFX A;  2CPB A;  1KD1 Q;  2HPC A;  4K35 A;  4IFF A;  2OYI A;  3CC7 P;  2QVA A;  1VQM P;  3KXD A;  5AW6 B;  5DJU B;  1HGZ A;  1SQQ J;  2W6A A;  1BSH A;  4IL6 E;  3E1R A;  4DT0 A;  3H32 A;  2IBZ D;  1GW4 A;  3M0D A;  5APT A;  1OZH A;  2ZT9 D;  3JC2 2;  1IFD A;  5CCG D;  1YJW P;  1PIX A;  1NHL A;  4EI2 A;  2AXT E;  2J58 A;  3GMA A;  3KYQ A;  2E74 D;  3Q1M A;  1SQX D;  1H0T B;  1Q90 D;  2BCC G;  1ZME C;  5AW4 B;  3G3Z A;  1LTT C;  3GHG B;  3H25 A;  1Q81 Q;  2FKW B;  2K3R A;  1BCC D;  3T97 B;  4Z1M H;  5CHX A;  4JYB A;  2DW3 A;  2FXP A;  4H0L B;  3N7N A;  1ZN5 A;  3RK3 C;  4UB8 H;  1X0T A;  3A3Y B;  1ZRT E;  3G4S P;  2YIU C;  3TYY A;  5DJT B;  2FYU K;  3R4Y A;  2QJK B;  5E79 E;  4KT0 J;  2FYU E;  4EYY Q;  2C9L Y;  1XTG B;  2WVR A;  2R32 A;  1T3J A;  2BCC D;  2FY8 A;  2H43 A;  4IOI H;  1PPJ G;  2WWW A;  5KJ7 D;  2IFM A;  3AEA C;  4GDO A;  1VQP P;  3OJA B;  3TGU J;  3ABV C;  2WSF H;  3BVH A;  1LWU C;  3L73 E;  1J2J B;  1S5L E;  1SFC D;  2VRS A;  4MN4 C;  3PP5 A;  3HD7 B;  4N6J A;  2N9B A;  1J1E B;  3GLM A;  1URQ C;  1T2K C;  3H1H J;  4PD4 I;  3MUD C;  1KQF B;  5APW A;  3CPW O;  2IBZ E;  1A02 F;  3CXH I;  2WIT A;  1QX8 A;  3LIE A;  1GMJ A;  1M7L A;  1SQP G;  3BCC J;  1SP4 A;  1TU3 F;  3WUU A;  3HUS C;  3Q5S A;  4PD4 H;  3CC4 P;  3USS A;  2KSJ A;  3IFM A;  1SLQ A;  3V2Q A;  4L76 A;  2N1T B;  4HKZ H;  1AFO A;  3CXH H;  3FXE A;  1SQQ G;  5GTH H;  2K37 A;  1BCC E;  1Q86 Q;  1LP1 A;  2POH A;  1KB9 I;  2XU6 A;  3S1K A;  3SWK A;  5AVW B;  1KC8 Q;  2YMY A;  3FXD A;  2CPS A;  3B5N B;  2ZVO B;  1LTS C;  2MJZ A;  3KQG A;  4O9B A;  1VQ8 P;  1M1J B;  2KZJ A;  1ZR4 A;  1N8R Q;  1N86 A;  2YKP A;  2E76 C;  4HJG H;  1KQL A;  1FDM A;  1PGQ A;  4C7N A;  3F5H A;  1WRG A;  4DZO A;  3BAT A;  1YBK A;  3BRT B;  1LTG C;  1KIL D;  1S1C X;  1YYC A;  1SQP D;  2OTL P;  1HVV A;  1T8Z A;  2HPC B;  1FOS F;  1DD3 A;  2OYI B;  1SQB J;  1X9V A;  2YKQ A;  2J59 M;  3EWK A;  2BCC E;  3AE4 C;  1Y47 A;  2KSE A;  1K05 A;  1LTJ A;  2P10 A;  2YXQ B;  3CWB E;  1SQQ D;  4H13 C;  2AXC A;  2HYN A;  3H32 B;  1QL2 A;  2XV5 A;  1MKM A;  4NPF X;  1T3U A;  4BXL A;  2V7Q H;  3B71 A;  2NPS C;  1JY2 P;  5CBO A;  3CCJ P;  1T6A A;  1RF1 C;  3H6P A;  4JBZ A;  4IL6 X;  2ZVN B;  3UIA A;  3NTN A;  4UB6 E;  3H1J J;  3M9H A;  2Q3E A;  3HE4 B;  1LGH B;  3A2A A;  1GD2 E;  1LNQ A;  1NJI Q;  2QJY C;  3TGU G;  2L91 A;  1GL2 C;  2J5U A;  2NRG A;  1YJ9 P;  3D70 A;  1N73 A;  2D2C D;  1NAY A;  1H89 A;  4U3F G;  3RBX A;  5AW0 B;  3CX5 E;  2WT7 A;  2M0B A;  3AE7 C;  1VQL P;  3RK3 B;  4L75 A;  5KKZ B;  1VQK P;  2YIU B;  4WY4 D;  4DOJ A;  1H0T A;  3PH0 A;  4LGD E;  3N4X A;  3HE5 B;  4RJT A;  3K5B A;  2QRX A;  3GHG A;  1LTB C;  4IL6 H;  5BVZ A;  3BCC G;  2A45 I;  3T97 A;  3FWL A;  1L4A C;  1PL5 A;  5TIS E;  1J1D C;  1KN7 A;  2O01 J;  1H88 A;  1JCD A;  1R5S A;  3A5T A;  1SQP K;  1HUC A;  1JMB A;  2CK3 H;  2WPQ A;  4ASV A;  2QM8 A;  2AXT H;  3L72 J;  3OW2 O;  1SQP E;  3CCR P;  1HBW A;  5KLV D;  1OW7 A;  3TGU D;  1KTM A;  1VF5 D;  2W90 A;  3CL3 D;  2A45 H;  2E5Y A;  1LWU B;  4OWF A;  1RE3 A;  2A06 E;  2ZXE B;  4U3F D;  1FBM A;  1RH5 B;  1URQ B;  2Q9I A;  5CJ0 A;  1X79 B;  1K73 Q;  5CMZ A;  1N7S C;  4PV1 C;  1BGY G;  4Y99 B;  3V2R A;  1JM0 A;  3BCC D;  1VQ6 P;  2GM4 A;  3AEG C;  1NTM J;  3Q3D A;  3RBZ A;  2C0X A;  5E79 H;  2WZ7 A;  3CCM P;  3IF4 A;  3CWB J;  3IR9 A;  3CC2 P;  1GU4 A;  3MTU E;  3VMZ A;  1S9K D;  2BAS A;  5GTI E;  2V4H A;  3KZI H;  1KYO D;  1VQN P;  1PP9 D;  3MD0 A;  1LP1 B;  2B87 B;  2WPV B;  4PJ0 E;  3AE9 C;  4GOD A;  3VMX A;  1NTZ J;  3H1L G;  1PFI A;  2HOD B;  2QE7 H;  1FZC C;  2C0W A;  3MIW A;  1S5L H;  1FZC A;  2KIK A;  3L75 J;  2QM7 A;  2M8R A;  1USD A;  1L0L E;  3H1J G;  2N1T A;  2E76 B;  4C7N B;  5APX A;  1BGY D;  4WVZ A;  1EXJ A;  1IC2 A;  1DD4 A;  3I56 P;  1RHZ B;  1Q7Y Q;  3W67 A;  3B5N A;  5B66 E;  4OVN F;  1HF9 A;  2H88 C;  5CCH A;  5KLV K;  4JQ0 D;  2ZT9 C;  1LTJ B;  5KLV E;  2RN0 A;  5CCG C;  3HD7 D;  1M1J A;  4KHX A;  3II6 A;  1YHQ P;  1IK7 A;  1JTH A;  4H44 B;  4ZKP A;  4H13 B;  2E74 C;  1H8A A;  3AEB C;  1Q2N A;  2OQQ A;  5APY A;  4KJM A;  1FU1 A;  1EC5 A;  2E75 D;  3H1L D;  1VDF A;  4U3F E;  2R5B A;  2NPS B;  1RE4 C;  3VP9 A;  5AW2 B;  1L0N J;  3V6I A;  3AE3 C;  4D6T G;  1OVR A;  1RF1 B;  1K9M Q;  3H1I D;  1L2P A;  1PV3 A;  1IFM A;  2QSI A;  1NU1 J;  2KOG A;  2Z5H A;  2JKV A;  1FZG A;  2PAJ A;  3A0B E;  3L72 G;  3L4F A;  2HLO A;  1NYH A;  3L70 J;  1Q82 Q;  3H1K J;  3L71 D;  2GA1 A;  1LT9 C;  1NTK J;  1A02 J;  2QJY B;  3EQ2 A;  2IYP A;  4OGQ B;  1GK6 A;  1P84 D;  2K88 A;  5KAF E;  1N73 B;  3PHL A;  2FFD C;  1IFP A;  2LKM A;  2WT7 B;  1PP9 E;  1EDI A;  3VTP C;  1YQ4 C;  2JP3 A;  2KNC A;  5CCH D;  1E79 H;  3AED C;  1CW5 A;  3HE4 A;  4I7Z B;  4R4M A;  3AEF C;  4OH8 B;  1OVV A;  5EFW B;  3L74 J;  3RK2 B;  1Z56 A;  3CLQ A;  4D6T D;  5K5G B;  5APV A;  1NTM G;  4EOT A;  1J1D B;  3M9B A;  3JSV C;  5AVU B;  5L8R J;  1EZV I;  1SFC C;  1BGY E;  4NPD A;  1HH0 A;  3L72 D;  4M3L A;  3P8C D;  1LTA C;  1IFJ A;  4UB6 H;  4GT1 A;  2HFE D;  3HE5 A;  1GU5 A;  2OGU A;  3O6Q A;  4LLH A;  1YQ3 C;  1NTZ G;  1BE3 G;  3SFE C;  3B4S A;  3D6Y A;  1EQ7 A;  1L0L J;  2RKL A;  4B86 A;  4L74 A;  4QMA A;  5AVQ B;  4YXW H;  3MGN A;  2V7Q J;  3AE8 C;  3NXS A;  3H1L E;  4CPG A;  3CX5 H;  5H2F H;  1N7S B;  4PV1 B;  1YI2 P;  1DH3 A;  3H1I E;  3G6E P;  1NTM D;  2WMM A;  2KB7 P;  1LWU A;  1SQV J;  5AVR B;  5BU5 A;  2K9Y A;  4YTP C;  1URQ A;  5TIS H;  4HH2 A;  3L71 E;  2P2U A;  1USE A;  2WSC H;  3MUD A;  3G71 P;  1RF0 C;  1S2E A;  2OYH C;  3U1C A;  1RF0 A;  1P84 E;  2LR2 A;  2KP8 A;  2IDB A;  1GTW A;  2QEX P;  2Z5I A;  1IO4 A;  3CI9 A;  1BE3 D;  1L0N G;  1KIL C;  1SQX K;  3CCQ P;  1SQX E;  1FZC B;  3HUS A;  4GIF A;  1NU1 G;  1OVU A;  1PPJ D;  1DEB A; 
#chains in the Genus database with same CATH homology
 1SQB E;  1PPJ E;  1BCC E;  1PP9 E;  3L70 E;  1KYO E;  3H1H E;  3H1K E;  1L0N E;  3H1L E;  5KLV E;  2BCC E;  1NTK E;  4D6T E;  3CX5 E;  1NTZ E;  2FYU E;  3L71 E;  2IBZ E;  3TGU E;  1SQX E;  1BE3 E;  1BGY E;  4PD4 E;  3CWB E;  1KB9 E;  1EZV E;  1NU1 E;  2A06 E;  1P84 E;  3H1I E;  3L73 E;  3L75 E;  1SQV E;  3L72 E;  3CXH E;  1SQP E;  1SQQ E;  3L74 E;  3H1J E;  1L0L E;  1NTM E;  3BCC E;  4U3F E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...