4D6TE

Cytochrome bc1 bound to the 4(1h)-pyridone gw844520
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
73
structure length
73
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B-C1 COMPLEX SUBUNIT 1, MITOCHONDRIAL
publication title Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
pubmed doi rcsb
molecule tags Electron transport
total genus 22
structure length 73
sequence length 73
chains with identical sequence I, R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
E PF09165 Ubiq-Cytc-red_N Ubiquinol-cytochrome c reductase 8 kDa, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 4d6tE00
3L72E 4U3FE 1SQQE 2IBZE 1BE3E 1PP9E 3CX5E 2BCCE 1EZVE 3BCCE 5KLVE 1BCCE 3H1HE 1NTKE 1KYOE 2FYUE 1NU1E 1BGYE 3L70E 1SQVE 3H1LE 4PD4E 3H1KE 1L0LE 1SQPE 3L75E 1NTME 1PPJE 3H1JE 1NTZE 1P84E 3CXHE 1SQXE 1KB9E 1L0NE 3H1IE 4D6TE 3L71E 3L74E 3TGUE 1SQBE 3CWBE 3L73E 2A06E
chains in the Genus database with same CATH superfamily
4Y28J 5TISH 1SQBG 3M9BA 4EDFA 5BU8B 2K37A 4H0LC 2OGUA 1IFPA 2BCCG 1EZVD 1QX8A 1X22A 2YKPA 1LTJB 4PJ0H 2PAJA 1N7SB 1OVRA 2HR3A 3V2RA 3O8ZA 2XNDH 4DT0A 1FOSE 1YTZI 2C0XA 4L74A 3AE4C 2P2UA 5AW2B 2UWJE 2H88C 1G2CB 2C9LY 1DH3A 2XDJA 1MV8A 4D6TD 4GT1A 2HODB 3V4WA 2ZYGA 1MFTA 1SQBD 1BE3E 2WPSA 1EZVE 5CCGD 2FYUK 4H13C 1OIPA 1USDA 3M0DC 1FDMA 2Q5UA 3RBXA 1FZBA 1ZP0C 2V4HA 3H1JG 1M8OB 5AW7B 2RKLA 3CX5H 1SS1A 1YHQP 1J2JB 1DEBA 1OXZA 2JDIH 3VN0A 4HH2A 1RF0C 1SFCB 1IC2A 4OWFA 1K05A 1L4AD 3AEGC 1GL2C 1PP9E 2L5GB 2LKMA 3KYQA 2M0BA 5GTHH 1NJIQ 3B71A 3H1JD 3GHGC 4NPEA 2WVRA 3SFDC 2K9JB 5AW5B 3VYIA 2M3EA 1DX7A 2IZ0A 2IBZD 1U7JA 2FXOA 1NU1J 2HG5D 2W6JH 4N6JA 1NTZK 1EDJA 1P84I 3CXHD 1FJPA 2YKOA 1VQ5P 1HTLC 1URQB 3L4FA 1QVFO 1MKMA 5AVSB 3TNUA 1OMIA 2NPSD 2OYOA 5AVYB 1RQUA 3AEDC 3A0HE 2WT7A 3H1JE 1SLQA 1ZLLA 5C39A 5CCHA 2WSSH 1IJDB 5GTIE 1FZGA 1LJ2A 2IBZE 3HTKA 2A06D 2FYNC 4WY4A 2Z4EA 3MTUE 1KTMA 2CPSA 2LXBA 2E75C 5K5GB 2WPQA 1KILB 4I7ZB 3CXHE 2JR8A 2YO3A 5GTIH 1RF1C 3AE7C 1LWUB 2WTYA 1FZCB 1GDTA 3EFFK 1OX3A 4R4LA 2ZJSE 3S1KA 3MZWB 2WPVB 2I1KA 2GUVA 1SQXJ 1VL2A 4GODA 1SQBK 3JCUE 3KQGA 2OARA 1SVFA 2A06E 2ZT9D 1M56D 3WMM0 1FS0E 2R32A 4AQRD 3CX5I 3Q2YA 3CCVP 1FZCC 5AW6B 1YTZT 3W68A 1J1DC 1VQ7P 1FZFA 2C0WA 2KUBA 1YYCA 4YPCA 1ZN5A 3JCUH 3RK3C 2KXPB 1LTTC 2G8YA 3RK3D 3T97B 3C9IA 1N73C 2VRSA 1VQPP 1LP1A 3WU2E 1K73Q 2C9NY 5CCGA 3V2QA 1RY3A 5KJ7D 1FC2C 4ASVA 3B5NB 3I55P 4OVNF 5L8RJ 1Q81Q 1VQMP 2LXCB 4YTPC 3CC2P 4W7YA 1QL2A 2AEJA 2J59M 4DOJA 2OYHA 1NTKG 4Y99C 3N4XA 1PPJG 3RK3E 1KORA 2KSJA 3HRNA 1L4AA 2QJKB 3E1IA 1KFNA 1PV3A 1NU1D 2N1TA 2OYIC 4PD4D 1K04A 2YKQA 2WITA 2CPBA 5KKZC 3MUDA 2RH0A 1BDDA 2O3JA 4W7ZA 1EC5A 2QA4P 1YQ3C 1AJYA 1Z56A 2O1KA 5DJTB 3CI9A 3LIEA 3ZDMA 5KLVJ 4TT3H 1AV1A 3H1KJ 5CMZA 1SQVG 1HGZA 1GTWA 1JY2N 1JMMA 2KP8A 1E79H 1SQXG 2QIWA 3L72J 1CW5A 2YXRB 5B5EH 4JPZB 1BE3J 3D71A 1X9VA 1NU1E 2Q3IA 4PD4E 1FOSF 1KQFB 3WUUA 2E76D 1JOCA 2WSEH 1KB9D 2JWDA 3PH0A 3FWLA 4K35A 1M1KQ 1PGJA 4GIFA 4DZOA 2FFDC 4HJGH 1AVOA 2E74D 2YMKA 4ZKPA 1KMIZ 1SQXD 1GW3A 1T2KD 1UIIA 1X0TA 5B66H 2K1AA 4CPGA 1PP9J 1IFDA 2YMYA 3HD7D 1QEXA 1VF5B 4BXLA 2BASA 1NO4A 1S72P 1ZXGA 2R5DA 3M06A 5E79E 3RBZA 3RL0D 1H8AA 3AE3C 5AVQB 1ZMEC 4W80A 5APUA 1JO5A 2HPCA 1ZW0A 1GK4A 3CWBG 3V6IA 4I6MC 2KK7A 5BU5A 3V2PA 3H1LJ 4IFDK 4PV1B 1OFCX 3KDPB 2WQYC 1KB9H 1VF5C 1SQXE 4B86A 2K9YA 5AW8B 3TYYA 1RE4C 3H25A 5EFWB 1M7LA 3TNUB 3M91A 4NPDA 2M8RA 1L0LE 3KZIE 1W2BO 2WT7B 4IL6E 1JM0A 1A02F 3L74E 2W6AA 1JY2O 5APSA 3L37A 2JEEA 5KJ7A 2O01H 3HTKB 1KC8Q 4WY4B 2Y0CA 4AYCA 1BE3G 1KZUB 2QRXA 4OH8B 3AE8C 3AEAC 1EZVG 2D2CB 3M9HA 1EXIA 3CCEP 3HUSC 3SWKA 1L0NJ 3S4RA 3VP9A 3RK2B 1GU4A 2FY8A 3AE9C 1EDKA 3QH9A 3A3YB 1NTKK 3G3ZA 2PP6A 5KLVD 3H1KD 3UIAA 5H2FE 3FXDA 3V2NA 2W83C 1USEA 1UIXA 3C8VA 5KAFE 3OJAB 3A7OA 3R4YA 3L72D 2QJYC 3AEEC 3CC4P 1PP9G 1BE3D 3CCSP 5AVZB 4H0LD 1KYOI 2YIUC 4R4MA 3PRJA 3U59A 5KAFH 3A2AA 3F89A 3CC7P 5CBOA 3A0BE 1HJ0A 1HF9A 4UB6E 5KLVE 1JB0J 2QM7A 1SQVK 2I1JA 3CCRP 5APVA 1LP1B 3H1KE 1FDOA 3VOPA 3H1LG 1LTIC 1SQXK 3G71P 1LTJC 3L72E 3PJSK 1N7SC 1YJ9P 3AE5C 2POHA 1PP9D 1W2EA 2OYHB 4H13D 4I2LC 1T6AA 5AVVB 1GU5A 1R5SA 2WSCH 1KB9I 3IR9A 3L73J 1CZQA 5M1BA 1YIJP 1AFOA 3RL0g 2IBZG 1JY3O 3MGNA 1Q90D 1L4AB 2B88A 1N8RQ 1S5LE 2E5YA 1J1EB 3H1LD 1ZR2A 2N1TB 3HD7A 4ASWA 1GW4A 1YJNP 4UB8E 4O9BA 2GA1A 3USSA 1AQ5A 1LT9A 3SWFA 1FZEA 3L35A 1PFIA 1RE3C 1KD1Q 3BRTB 1GL2D 5KAIE 3GG2A 2Y9YA 3L36A 3OW2O 2Y9ZA 3WUVA 1M1JA 3CMAP 1YITP 2A06G 1SFCC 3BCCE 4C7NA 3H1HJ 1LTGC 1SFCD 3H1LE 1PZQA 1NTMJ 2OTKE 2KZIA 3CD6P 1L0ND 1OWAA 3P32A 5KLVK 2W90A 3E1RA 4DCKA 1CI6A 2M3BA 2KI7B 3IN6A 4LGDE 1S1CX 1IFJA 1OVVA 2E5TA 3EFGA 1IO4A 3D6ZA 2R3CA 3P8MC 2KS1A 2QE7H 2ITAA 1URQC 1NWQA 1URQD 1HGVA 3A0HH 2E75D 4BWNA 1L0NE 2I8DA 3H1IJ 4JQ0D 3TGUE 1VPCA 3IAOA 5KLIB 3L73G 1SQQJ 2HPCB 3FXEA 3P7KA 4LLHA 5DJUB 4C46A 2ZT9B 3CXHH 2ZVOB 2JWAA 1IFNA 3II6A 3AE6C 3BVHA 1KILC 1NOHA 4I7ZC 2QJPB 3ITKA 3RGUA 4N78D 5TJHA 2MKVA 1LWUC 1EZVI 3LW5H 2IX7C 1L0LJ 1N86A 2WSFJ 2ZVNB 1E5WA 1MUUA 2ZXEB 2NRGA 2R44A 2V7QH 3L74J 1LTBC 3L73D 2GUSA 1MFZA 4EIJA 4I1LA 3H1HG 1IFIA 1NU1G 2YNYA 1H88A 4WWIA 2ZYAA 3GF3A 2XZRA 2G3AA 4IL6X 1VQ9P 4XA4A 4L73A 4N78E 3M0DA 5CJ4A 5KTBA 1N2DC 2QVAA 3AE1C 1NAFA 5CHXA 3WU2H 1EXJA 1RHZB 1ZR4A 1M57D 3L70D 1FZAA 1AA0A 1G1JA 3MD0A 1LTSC 3L73E 2OTLP 4JYCA 4KHXA 1RF0A 3B5NC 1WMKA 5APYA 1ZRTE 1G1IA 3H1HD 4WBAA 2JKVA 2R3SA 3B5ND 5CBNA 1NTMD 1GL2A 2IDBA 3KXDA 1IK7A 2AXCA 3TF5A 2Y0DA 2ZXXA 1FU1A 3FX0A 3OA7A 3O6QA 3L70E 5AW1B 3GHGA 2QJKC 2QEXP 1Q86Q 5AVXB 4C7RA 2ZYDA 2E76B 3PLNA 2IBZI 2Z5IA 3BATA 3H1HE 1XTCC 1JCCA 1NTME 3NMDA 1L0LG 3CCUP 2NPSA 2IYPA 3W67A 3CXHI 3H1ID 4HB1A 3L74G 5APTA 4JF7A 2MJZA 2E74B 1SQQD 4HKZH 4PD4H 4XE5B 4OGQB 3CCJP 1SQPJ 4RESB 1T8ZA 3HD7B 1FJKA 3VMZA 3PTZA 4EOTA 1JUNA 3RL0B 4Z1MH 1LT9B 2RMZA 1RF1A 1S5LX 4BRYA 1YJWP 1S9KD 1L0LD 4OGQC 3H1IE 4TLFA 3F5HA 1RH5B 3L74D 1SQQE 2B89A 1M1JB 4U7JA 2BCCJ 3BCCJ 2LR2A 1BGYE 4C7NB 1Y9BA 3P8CD 2FBWC 5E79H 2SPZA 4H44B 4A7PA 2PGDA 1L2PA 1VF5D 3SWYA 1PGOA 3EQ2A 1BCCJ 3AEBC 5KLVG 1A02J 5AW4B 1S9KE 1CI6B 3H1KG 4JBZA 4PV1C 1P84D 1N73A 3CCQP 4JYBA 3HE5A 4ZMDA 1JMBA 1IFMA 2IFMA 4YXWH 1JY3N 3L72G 1X8YA 1LTAC 3P8CE 1NU1K 2KS1B 3B4SA 5AW9B 2WSFH 3KZIH 3GLMA 4IL6H 4WVZA 2IPPA 3TGUJ 3Q3DA 3Q5SA 5CCHC 3CLQA 2GM4A 1HH0A 4WY4C 1SQPG 2IYOA 3V5BA 1P84E 2D2CC 1VQNP 3L71J 4H0LB 2K3RA 2YXQB 4QMAA 3SSUA 3Q5PA 5TISE 2J5UA 2OYIA 3RK2C 2CK3H 1Q82Q 5APXA 5APQA 1R8EA 2IFNA 4K3AA 4PD4I 5AVTB 5H2FH 2JO1A 2B87A 4PJ0E 2QG4A 2N9BA 2WMMA 1SQQK 1LGHB 1VDFA 3IFMA 3C1LA 3I56P 1VQ4P 3AECC 3BRVB 1FAVA 3E7KA 2KNCA 3CX5D 3R2PA 3MP7B 3BCCG 3HE4A 1OZHA 2W6BA 1SQPD 1NTZE 3GW6A 1H0TA 4LC1A 5AVWB 3IF4A 2WZ7A 2ZFCA 3A0BH 1JEKA 3TDKA 1GZLA 4H13B 1NGMB 4GOFA 4UB6H 2ZAEB 1HUCA 4KJMA 1VQKP 1BCCG 1L0LK 1N7SD 1AQTA 1IZNB 3GMAA 3L75J 2P58A 2M5AA 1FE6A 1K9MQ 5CCGC 4U3FJ 4XFJA 4WB4A 2KIKA 3GF7A 3CX5E 1KQLA 2FFDA 1EQ7A 2DW3A 2BCCD 2KLUA 3BCCD 1SQPE 3MHVA 2H43A 3MIWA 1GL2B 1NH4A 4IFMA 3H32A 2R5BA 2OYHC 1L0NG 3TGUG 5APWA 3VP8A 1S5LH 3O6QB 3L70J 1BCCD 3NFQA 2RN0A 1VQ6P 3GHGB 1KQGB 1L4AC 2IZ1A 4UB8H 5GTHE 4D6TE 1IK9A 1SQBE 1J1EC 3L71G 3VMXA 2N1TC 1JCDA 3TK1A 3MUDC 2QSIA 2N1TD 2BCCE 2KOGA 1QGKB 5KAIH 2AEFA 1KQSO 1RE4A 2KLVA 2XV5A 1S2EA 2NPSB 2AXTE 2WSEJ 3TGUD 2N9YB 1BCCE 3KPEA 4IOIH 1VQLP 1D7MA 1ZV8A 1RQVA 1S3JA 1YQ4C 2AXTH 2FYNB 4IFFA 3L71D 1DIPA 1SP4A 2E75B 2NPSC 1Q7YQ 1NYHA 3HUSA 4HYTB 2BEZF 1NTKJ 3G6EP 5AW0B 2HLOA 1RF1B 3CCLP 3L75G 2KSEA 4BRYB 4L76A 2W27A 1LT1A 1YI2P 1BSNA 4U3FG 1QL1A 4MN4C 1SQPK 2WPRA 1BGYJ 3V4QA 2A45G 1BSHA 1JTHA 5AW3B 1X79B 2K88A 1GMJA 3L71E 2FKWB 1KV4A 1DEEG 3JC22 1KILD 3ABVC 2PFXA 1J1DB 1S4XA 5KLIC 3H6PA 1SQVJ 3RK3B 3U1AA 3L70G 3CL3D 3L75D 1NVOA 2XKMA 3SFEC 3CPWO 2ZT9C 1OW6A 1N73B 1Q2NA 2WWWA 3HE5B 2H7HA 4U3FD 2O01J 2QJPC 3G4SP 2FYUJ 2Q6QA 3PP5A 3FWNA 1LTJA 2H89C 1ZRTD 1NTMG 1N7SA 1KILE 3NXSA 2XNXA 4Y99B 2KB7P 1G2CA 2OQQA 4RKUJ 3Q1MA 3L75E 5KJ7C 2H8PD 3LIDA 2P10A 1U57A 5BVZA 3FGAD 1W5CE 1OVUA 2J58A 2HODA 1R5LA 4U3FE 3U1CA 1T3JA 2OYIB 3WUTA 3QWOC 3B8EB 5KKZB 1EDIA 1PL5A 3JSVC 1L0NK 2B87B 3OAKA 1RE3A 3VMYA 3H1IG 3A5TA 3CWBJ 1FDIA 1NAYA 5AVUB 1FBMA 2A45H 1SQQG 4L75A 1HJBA 1K8AQ 2KNCB 1KYOD 1BGYG 3HE4B 1BDCA 1WRGA 2E42A 2W8ZA 1Y47A 2YO2A 1EDLA 1TU3F 1NTZJ 1SFCA 1H0TB 1PGPA 2BEQD 1PIXA 1XTGB 2NZ2A 5B5EE 1NTKD 1QVGO 4ZKUA 3NTNA 2Q9IA 1PPJD 3VTPC 2K9JA 2M5AB 2WSCJ 4AUWA 4RO0A 1OW8A 2Q3EA 4KT0J 1KYOE 2FFDB 1LNQA 1JY2P 2FYUG 2E76C 1BGYD 1DD3A 3CCMP 2P1JA 3TSIA 3H32B 1URQA 3EWKA 5B66E 1KYOH 1JNMA 3Q5RA 2FXPA 1NTKE 2Q7CA 2E74C 2Q1KA 1SQVD 3K5BA 1PPJE 4GDOA 1HWTC 1T2KC 1HVVA 2L91A 4D6TJ 3M0AA 3AE2C 1SQBJ 4OGQD 1GK6A 3HD7C 2P7JA 4M3LA 1CSBA 4NPFX 2FYZA 1H89A 2Z5HA 3RL0C 1LT9C 1KILA 2FYUD 2FXMA 3D6YA 3N7NA 1KB9E 1LWUA 1VQ8P 2HFED 2JP3A 1Y8AA 1FZCA 3VMAA 1SQVE 2O1JA 2JJLA 1N7LA 2E43A 1M1JC 1VQOP 1GD2E 4RJTA 3PHLA 1KFMA 1QLED 3I5CA 1NTZG 1M90Q 4H44C 2KYVA 4PV1D 2OTJP 1KN7A 4H44D 1OW7A 1T3UA 2P67A 2XU6A 4ZNCA 3HUSB 2FYUE 2A45I 1NTMK 1AVYA 2O01N 3AEFC 1MZ9A 1WT6A 1NKZB 3H1JJ 2KZJA 3KHUA 1NHLA 3CMEP 3T97A 2B9BA 4EYYQ 3D70A 1U7MA 3CWBD 4N3YB 3M9QA 1PGQA 5CCHD 2Y0EA 1JTHB 5CJ0A 2PRRA 1HBWA 1JY3P 4GKGA 4WY4D 2QJYB 2QM8A 2HYNA 1NTZD 3B5NA 1NKNA 3S9OA 2D2CD 4GOEA 1YBKA 1DD4A 2YIUB 4EI2A 5AVRB 4DJGA 3BASA 3RK2D 3LW5J 1P84H 4YXDC 3G9RA 1ZOYC 4D6TG 3CWBE 2V7QJ 2AEMA
chains in the Genus database with same CATH topology
3L72E 4U3FE 1SQQE 2IBZE 1BE3E 1PP9E 3CX5E 2BCCE 1EZVE 3BCCE 5KLVE 1BCCE 3H1HE 1NTKE 1KYOE 2FYUE 1NU1E 1BGYE 3L70E 1SQVE 3H1LE 4PD4E 3H1KE 1L0LE 1SQPE 3L75E 1NTME 1PPJE 3H1JE 1NTZE 1P84E 3CXHE 1SQXE 1KB9E 1L0NE 3H1IE 4D6TE 3L71E 3L74E 3TGUE 1SQBE 3CWBE 3L73E 2A06E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L72 E;  4U3F E;  1SQQ E;  2IBZ E;  1BE3 E;  1PP9 E;  3CX5 E;  2BCC E;  1EZV E;  3BCC E;  5KLV E;  1BCC E;  3H1H E;  1NTK E;  1KYO E;  2FYU E;  1NU1 E;  1BGY E;  3L70 E;  1SQV E;  3H1L E;  4PD4 E;  3H1K E;  1L0L E;  1SQP E;  3L75 E;  1NTM E;  1PPJ E;  3H1J E;  1NTZ E;  1P84 E;  3CXH E;  1SQX E;  1KB9 E;  1L0N E;  3H1I E;  4D6T E;  3L71 E;  3L74 E;  3TGU E;  1SQB E;  3CWB E;  3L73 E;  2A06 E; 
#chains in the Genus database with same CATH topology
 4Y28 J;  5TIS H;  1SQB G;  3M9B A;  4EDF A;  5BU8 B;  2K37 A;  4H0L C;  2OGU A;  1IFP A;  2BCC G;  1EZV D;  1QX8 A;  1X22 A;  2YKP A;  1LTJ B;  4PJ0 H;  2PAJ A;  1N7S B;  1OVR A;  2HR3 A;  3V2R A;  3O8Z A;  2XND H;  4DT0 A;  1FOS E;  1YTZ I;  2C0X A;  4L74 A;  3AE4 C;  2P2U A;  5AW2 B;  2UWJ E;  2H88 C;  1G2C B;  2C9L Y;  1DH3 A;  2XDJ A;  1MV8 A;  4D6T D;  4GT1 A;  2HOD B;  3V4W A;  2ZYG A;  1MFT A;  1SQB D;  1BE3 E;  2WPS A;  1EZV E;  5CCG D;  2FYU K;  4H13 C;  1OIP A;  1USD A;  3M0D C;  1FDM A;  2Q5U A;  3RBX A;  1FZB A;  1ZP0 C;  2V4H A;  3H1J G;  1M8O B;  5AW7 B;  2RKL A;  3CX5 H;  1SS1 A;  1YHQ P;  1J2J B;  1DEB A;  1OXZ A;  2JDI H;  3VN0 A;  4HH2 A;  1RF0 C;  1SFC B;  1IC2 A;  4OWF A;  1K05 A;  1L4A D;  3AEG C;  1GL2 C;  1PP9 E;  2L5G B;  2LKM A;  3KYQ A;  2M0B A;  5GTH H;  1NJI Q;  3B71 A;  3H1J D;  3GHG C;  4NPE A;  2WVR A;  3SFD C;  2K9J B;  5AW5 B;  3VYI A;  2M3E A;  1DX7 A;  2IZ0 A;  2IBZ D;  1U7J A;  2FXO A;  1NU1 J;  2HG5 D;  2W6J H;  4N6J A;  1NTZ K;  1EDJ A;  1P84 I;  3CXH D;  1FJP A;  2YKO A;  1VQ5 P;  1HTL C;  1URQ B;  3L4F A;  1QVF O;  1MKM A;  5AVS B;  3TNU A;  1OMI A;  2NPS D;  2OYO A;  5AVY B;  1RQU A;  3AED C;  3A0H E;  2WT7 A;  3H1J E;  1SLQ A;  1ZLL A;  5C39 A;  5CCH A;  2WSS H;  1IJD B;  5GTI E;  1FZG A;  1LJ2 A;  2IBZ E;  3HTK A;  2A06 D;  2FYN C;  4WY4 A;  2Z4E A;  3MTU E;  1KTM A;  2CPS A;  2LXB A;  2E75 C;  5K5G B;  2WPQ A;  1KIL B;  4I7Z B;  3CXH E;  2JR8 A;  2YO3 A;  5GTI H;  1RF1 C;  3AE7 C;  1LWU B;  2WTY A;  1FZC B;  1GDT A;  3EFF K;  1OX3 A;  4R4L A;  2ZJS E;  3S1K A;  3MZW B;  2WPV B;  2I1K A;  2GUV A;  1SQX J;  1VL2 A;  4GOD A;  1SQB K;  3JCU E;  3KQG A;  2OAR A;  1SVF A;  2A06 E;  2ZT9 D;  1M56 D;  3WMM 0;  1FS0 E;  2R32 A;  4AQR D;  3CX5 I;  3Q2Y A;  3CCV P;  1FZC C;  5AW6 B;  1YTZ T;  3W68 A;  1J1D C;  1VQ7 P;  1FZF A;  2C0W A;  2KUB A;  1YYC A;  4YPC A;  1ZN5 A;  3JCU H;  3RK3 C;  2KXP B;  1LTT C;  2G8Y A;  3RK3 D;  3T97 B;  3C9I A;  1N73 C;  2VRS A;  1VQP P;  1LP1 A;  3WU2 E;  1K73 Q;  2C9N Y;  5CCG A;  3V2Q A;  1RY3 A;  5KJ7 D;  1FC2 C;  4ASV A;  3B5N B;  3I55 P;  4OVN F;  5L8R J;  1Q81 Q;  1VQM P;  2LXC B;  4YTP C;  3CC2 P;  4W7Y A;  1QL2 A;  2AEJ A;  2J59 M;  4DOJ A;  2OYH A;  1NTK G;  4Y99 C;  3N4X A;  1PPJ G;  3RK3 E;  1KOR A;  2KSJ A;  3HRN A;  1L4A A;  2QJK B;  3E1I A;  1KFN A;  1PV3 A;  1NU1 D;  2N1T A;  2OYI C;  4PD4 D;  1K04 A;  2YKQ A;  2WIT A;  2CPB A;  5KKZ C;  3MUD A;  2RH0 A;  1BDD A;  2O3J A;  4W7Z A;  1EC5 A;  2QA4 P;  1YQ3 C;  1AJY A;  1Z56 A;  2O1K A;  5DJT B;  3CI9 A;  3LIE A;  3ZDM A;  5KLV J;  4TT3 H;  1AV1 A;  3H1K J;  5CMZ A;  1SQV G;  1HGZ A;  1GTW A;  1JY2 N;  1JMM A;  2KP8 A;  1E79 H;  1SQX G;  2QIW A;  3L72 J;  1CW5 A;  2YXR B;  5B5E H;  4JPZ B;  1BE3 J;  3D71 A;  1X9V A;  1NU1 E;  2Q3I A;  4PD4 E;  1FOS F;  1KQF B;  3WUU A;  2E76 D;  1JOC A;  2WSE H;  1KB9 D;  2JWD A;  3PH0 A;  3FWL A;  4K35 A;  1M1K Q;  1PGJ A;  4GIF A;  4DZO A;  2FFD C;  4HJG H;  1AVO A;  2E74 D;  2YMK A;  4ZKP A;  1KMI Z;  1SQX D;  1GW3 A;  1T2K D;  1UII A;  1X0T A;  5B66 H;  2K1A A;  4CPG A;  1PP9 J;  1IFD A;  2YMY A;  3HD7 D;  1QEX A;  1VF5 B;  4BXL A;  2BAS A;  1NO4 A;  1S72 P;  1ZXG A;  2R5D A;  3M06 A;  5E79 E;  3RBZ A;  3RL0 D;  1H8A A;  3AE3 C;  5AVQ B;  1ZME C;  4W80 A;  5APU A;  1JO5 A;  2HPC A;  1ZW0 A;  1GK4 A;  3CWB G;  3V6I A;  4I6M C;  2KK7 A;  5BU5 A;  3V2P A;  3H1L J;  4IFD K;  4PV1 B;  1OFC X;  3KDP B;  2WQY C;  1KB9 H;  1VF5 C;  1SQX E;  4B86 A;  2K9Y A;  5AW8 B;  3TYY A;  1RE4 C;  3H25 A;  5EFW B;  1M7L A;  3TNU B;  3M91 A;  4NPD A;  2M8R A;  1L0L E;  3KZI E;  1W2B O;  2WT7 B;  4IL6 E;  1JM0 A;  1A02 F;  3L74 E;  2W6A A;  1JY2 O;  5APS A;  3L37 A;  2JEE A;  5KJ7 A;  2O01 H;  3HTK B;  1KC8 Q;  4WY4 B;  2Y0C A;  4AYC A;  1BE3 G;  1KZU B;  2QRX A;  4OH8 B;  3AE8 C;  3AEA C;  1EZV G;  2D2C B;  3M9H A;  1EXI A;  3CCE P;  3HUS C;  3SWK A;  1L0N J;  3S4R A;  3VP9 A;  3RK2 B;  1GU4 A;  2FY8 A;  3AE9 C;  1EDK A;  3QH9 A;  3A3Y B;  1NTK K;  3G3Z A;  2PP6 A;  5KLV D;  3H1K D;  3UIA A;  5H2F E;  3FXD A;  3V2N A;  2W83 C;  1USE A;  1UIX A;  3C8V A;  5KAF E;  3OJA B;  3A7O A;  3R4Y A;  3L72 D;  2QJY C;  3AEE C;  3CC4 P;  1PP9 G;  1BE3 D;  3CCS P;  5AVZ B;  4H0L D;  1KYO I;  2YIU C;  4R4M A;  3PRJ A;  3U59 A;  5KAF H;  3A2A A;  3F89 A;  3CC7 P;  5CBO A;  3A0B E;  1HJ0 A;  1HF9 A;  4UB6 E;  5KLV E;  1JB0 J;  2QM7 A;  1SQV K;  2I1J A;  3CCR P;  5APV A;  1LP1 B;  3H1K E;  1FDO A;  3VOP A;  3H1L G;  1LTI C;  1SQX K;  3G71 P;  1LTJ C;  3L72 E;  3PJS K;  1N7S C;  1YJ9 P;  3AE5 C;  2POH A;  1PP9 D;  1W2E A;  2OYH B;  4H13 D;  4I2L C;  1T6A A;  5AVV B;  1GU5 A;  1R5S A;  2WSC H;  1KB9 I;  3IR9 A;  3L73 J;  1CZQ A;  5M1B A;  1YIJ P;  1AFO A;  3RL0 g;  2IBZ G;  1JY3 O;  3MGN A;  1Q90 D;  1L4A B;  2B88 A;  1N8R Q;  1S5L E;  2E5Y A;  1J1E B;  3H1L D;  1ZR2 A;  2N1T B;  3HD7 A;  4ASW A;  1GW4 A;  1YJN P;  4UB8 E;  4O9B A;  2GA1 A;  3USS A;  1AQ5 A;  1LT9 A;  3SWF A;  1FZE A;  3L35 A;  1PFI A;  1RE3 C;  1KD1 Q;  3BRT B;  1GL2 D;  5KAI E;  3GG2 A;  2Y9Y A;  3L36 A;  3OW2 O;  2Y9Z A;  3WUV A;  1M1J A;  3CMA P;  1YIT P;  2A06 G;  1SFC C;  3BCC E;  4C7N A;  3H1H J;  1LTG C;  1SFC D;  3H1L E;  1PZQ A;  1NTM J;  2OTK E;  2KZI A;  3CD6 P;  1L0N D;  1OWA A;  3P32 A;  5KLV K;  2W90 A;  3E1R A;  4DCK A;  1CI6 A;  2M3B A;  2KI7 B;  3IN6 A;  4LGD E;  1S1C X;  1IFJ A;  1OVV A;  2E5T A;  3EFG A;  1IO4 A;  3D6Z A;  2R3C A;  3P8M C;  2KS1 A;  2QE7 H;  2ITA A;  1URQ C;  1NWQ A;  1URQ D;  1HGV A;  3A0H H;  2E75 D;  4BWN A;  1L0N E;  2I8D A;  3H1I J;  4JQ0 D;  3TGU E;  1VPC A;  3IAO A;  5KLI B;  3L73 G;  1SQQ J;  2HPC B;  3FXE A;  3P7K A;  4LLH A;  5DJU B;  4C46 A;  2ZT9 B;  3CXH H;  2ZVO B;  2JWA A;  1IFN A;  3II6 A;  3AE6 C;  3BVH A;  1KIL C;  1NOH A;  4I7Z C;  2QJP B;  3ITK A;  3RGU A;  4N78 D;  5TJH A;  2MKV A;  1LWU C;  1EZV I;  3LW5 H;  2IX7 C;  1L0L J;  1N86 A;  2WSF J;  2ZVN B;  1E5W A;  1MUU A;  2ZXE B;  2NRG A;  2R44 A;  2V7Q H;  3L74 J;  1LTB C;  3L73 D;  2GUS A;  1MFZ A;  4EIJ A;  4I1L A;  3H1H G;  1IFI A;  1NU1 G;  2YNY A;  1H88 A;  4WWI A;  2ZYA A;  3GF3 A;  2XZR A;  2G3A A;  4IL6 X;  1VQ9 P;  4XA4 A;  4L73 A;  4N78 E;  3M0D A;  5CJ4 A;  5KTB A;  1N2D C;  2QVA A;  3AE1 C;  1NAF A;  5CHX A;  3WU2 H;  1EXJ A;  1RHZ B;  1ZR4 A;  1M57 D;  3L70 D;  1FZA A;  1AA0 A;  1G1J A;  3MD0 A;  1LTS C;  3L73 E;  2OTL P;  4JYC A;  4KHX A;  1RF0 A;  3B5N C;  1WMK A;  5APY A;  1ZRT E;  1G1I A;  3H1H D;  4WBA A;  2JKV A;  2R3S A;  3B5N D;  5CBN A;  1NTM D;  1GL2 A;  2IDB A;  3KXD A;  1IK7 A;  2AXC A;  3TF5 A;  2Y0D A;  2ZXX A;  1FU1 A;  3FX0 A;  3OA7 A;  3O6Q A;  3L70 E;  5AW1 B;  3GHG A;  2QJK C;  2QEX P;  1Q86 Q;  5AVX B;  4C7R A;  2ZYD A;  2E76 B;  3PLN A;  2IBZ I;  2Z5I A;  3BAT A;  3H1H E;  1XTC C;  1JCC A;  1NTM E;  3NMD A;  1L0L G;  3CCU P;  2NPS A;  2IYP A;  3W67 A;  3CXH I;  3H1I D;  4HB1 A;  3L74 G;  5APT A;  4JF7 A;  2MJZ A;  2E74 B;  1SQQ D;  4HKZ H;  4PD4 H;  4XE5 B;  4OGQ B;  3CCJ P;  1SQP J;  4RES B;  1T8Z A;  3HD7 B;  1FJK A;  3VMZ A;  3PTZ A;  4EOT A;  1JUN A;  3RL0 B;  4Z1M H;  1LT9 B;  2RMZ A;  1RF1 A;  1S5L X;  4BRY A;  1YJW P;  1S9K D;  1L0L D;  4OGQ C;  3H1I E;  4TLF A;  3F5H A;  1RH5 B;  3L74 D;  1SQQ E;  2B89 A;  1M1J B;  4U7J A;  2BCC J;  3BCC J;  2LR2 A;  1BGY E;  4C7N B;  1Y9B A;  3P8C D;  2FBW C;  5E79 H;  2SPZ A;  4H44 B;  4A7P A;  2PGD A;  1L2P A;  1VF5 D;  3SWY A;  1PGO A;  3EQ2 A;  1BCC J;  3AEB C;  5KLV G;  1A02 J;  5AW4 B;  1S9K E;  1CI6 B;  3H1K G;  4JBZ A;  4PV1 C;  1P84 D;  1N73 A;  3CCQ P;  4JYB A;  3HE5 A;  4ZMD A;  1JMB A;  1IFM A;  2IFM A;  4YXW H;  1JY3 N;  3L72 G;  1X8Y A;  1LTA C;  3P8C E;  1NU1 K;  2KS1 B;  3B4S A;  5AW9 B;  2WSF H;  3KZI H;  3GLM A;  4IL6 H;  4WVZ A;  2IPP A;  3TGU J;  3Q3D A;  3Q5S A;  5CCH C;  3CLQ A;  2GM4 A;  1HH0 A;  4WY4 C;  1SQP G;  2IYO A;  3V5B A;  1P84 E;  2D2C C;  1VQN P;  3L71 J;  4H0L B;  2K3R A;  2YXQ B;  4QMA A;  3SSU A;  3Q5P A;  5TIS E;  2J5U A;  2OYI A;  3RK2 C;  2CK3 H;  1Q82 Q;  5APX A;  5APQ A;  1R8E A;  2IFN A;  4K3A A;  4PD4 I;  5AVT B;  5H2F H;  2JO1 A;  2B87 A;  4PJ0 E;  2QG4 A;  2N9B A;  2WMM A;  1SQQ K;  1LGH B;  1VDF A;  3IFM A;  3C1L A;  3I56 P;  1VQ4 P;  3AEC C;  3BRV B;  1FAV A;  3E7K A;  2KNC A;  3CX5 D;  3R2P A;  3MP7 B;  3BCC G;  3HE4 A;  1OZH A;  2W6B A;  1SQP D;  1NTZ E;  3GW6 A;  1H0T A;  4LC1 A;  5AVW B;  3IF4 A;  2WZ7 A;  2ZFC A;  3A0B H;  1JEK A;  3TDK A;  1GZL A;  4H13 B;  1NGM B;  4GOF A;  4UB6 H;  2ZAE B;  1HUC A;  4KJM A;  1VQK P;  1BCC G;  1L0L K;  1N7S D;  1AQT A;  1IZN B;  3GMA A;  3L75 J;  2P58 A;  2M5A A;  1FE6 A;  1K9M Q;  5CCG C;  4U3F J;  4XFJ A;  4WB4 A;  2KIK A;  3GF7 A;  3CX5 E;  1KQL A;  2FFD A;  1EQ7 A;  2DW3 A;  2BCC D;  2KLU A;  3BCC D;  1SQP E;  3MHV A;  2H43 A;  3MIW A;  1GL2 B;  1NH4 A;  4IFM A;  3H32 A;  2R5B A;  2OYH C;  1L0N G;  3TGU G;  5APW A;  3VP8 A;  1S5L H;  3O6Q B;  3L70 J;  1BCC D;  3NFQ A;  2RN0 A;  1VQ6 P;  3GHG B;  1KQG B;  1L4A C;  2IZ1 A;  4UB8 H;  5GTH E;  4D6T E;  1IK9 A;  1SQB E;  1J1E C;  3L71 G;  3VMX A;  2N1T C;  1JCD A;  3TK1 A;  3MUD C;  2QSI A;  2N1T D;  2BCC E;  2KOG A;  1QGK B;  5KAI H;  2AEF A;  1KQS O;  1RE4 A;  2KLV A;  2XV5 A;  1S2E A;  2NPS B;  2AXT E;  2WSE J;  3TGU D;  2N9Y B;  1BCC E;  3KPE A;  4IOI H;  1VQL P;  1D7M A;  1ZV8 A;  1RQV A;  1S3J A;  1YQ4 C;  2AXT H;  2FYN B;  4IFF A;  3L71 D;  1DIP A;  1SP4 A;  2E75 B;  2NPS C;  1Q7Y Q;  1NYH A;  3HUS A;  4HYT B;  2BEZ F;  1NTK J;  3G6E P;  5AW0 B;  2HLO A;  1RF1 B;  3CCL P;  3L75 G;  2KSE A;  4BRY B;  4L76 A;  2W27 A;  1LT1 A;  1YI2 P;  1BSN A;  4U3F G;  1QL1 A;  4MN4 C;  1SQP K;  2WPR A;  1BGY J;  3V4Q A;  2A45 G;  1BSH A;  1JTH A;  5AW3 B;  1X79 B;  2K88 A;  1GMJ A;  3L71 E;  2FKW B;  1KV4 A;  1DEE G;  3JC2 2;  1KIL D;  3ABV C;  2PFX A;  1J1D B;  1S4X A;  5KLI C;  3H6P A;  1SQV J;  3RK3 B;  3U1A A;  3L70 G;  3CL3 D;  3L75 D;  1NVO A;  2XKM A;  3SFE C;  3CPW O;  2ZT9 C;  1OW6 A;  1N73 B;  1Q2N A;  2WWW A;  3HE5 B;  2H7H A;  4U3F D;  2O01 J;  2QJP C;  3G4S P;  2FYU J;  2Q6Q A;  3PP5 A;  3FWN A;  1LTJ A;  2H89 C;  1ZRT D;  1NTM G;  1N7S A;  1KIL E;  3NXS A;  2XNX A;  4Y99 B;  2KB7 P;  1G2C A;  2OQQ A;  4RKU J;  3Q1M A;  3L75 E;  5KJ7 C;  2H8P D;  3LID A;  2P10 A;  1U57 A;  5BVZ A;  3FGA D;  1W5C E;  1OVU A;  2J58 A;  2HOD A;  1R5L A;  4U3F E;  3U1C A;  1T3J A;  2OYI B;  3WUT A;  3QWO C;  3B8E B;  5KKZ B;  1EDI A;  1PL5 A;  3JSV C;  1L0N K;  2B87 B;  3OAK A;  1RE3 A;  3VMY A;  3H1I G;  3A5T A;  3CWB J;  1FDI A;  1NAY A;  5AVU B;  1FBM A;  2A45 H;  1SQQ G;  4L75 A;  1HJB A;  1K8A Q;  2KNC B;  1KYO D;  1BGY G;  3HE4 B;  1BDC A;  1WRG A;  2E42 A;  2W8Z A;  1Y47 A;  2YO2 A;  1EDL A;  1TU3 F;  1NTZ J;  1SFC A;  1H0T B;  1PGP A;  2BEQ D;  1PIX A;  1XTG B;  2NZ2 A;  5B5E E;  1NTK D;  1QVG O;  4ZKU A;  3NTN A;  2Q9I A;  1PPJ D;  3VTP C;  2K9J A;  2M5A B;  2WSC J;  4AUW A;  4RO0 A;  1OW8 A;  2Q3E A;  4KT0 J;  1KYO E;  2FFD B;  1LNQ A;  1JY2 P;  2FYU G;  2E76 C;  1BGY D;  1DD3 A;  3CCM P;  2P1J A;  3TSI A;  3H32 B;  1URQ A;  3EWK A;  5B66 E;  1KYO H;  1JNM A;  3Q5R A;  2FXP A;  1NTK E;  2Q7C A;  2E74 C;  2Q1K A;  1SQV D;  3K5B A;  1PPJ E;  4GDO A;  1HWT C;  1T2K C;  1HVV A;  2L91 A;  4D6T J;  3M0A A;  3AE2 C;  1SQB J;  4OGQ D;  1GK6 A;  3HD7 C;  2P7J A;  4M3L A;  1CSB A;  4NPF X;  2FYZ A;  1H89 A;  2Z5H A;  3RL0 C;  1LT9 C;  1KIL A;  2FYU D;  2FXM A;  3D6Y A;  3N7N A;  1KB9 E;  1LWU A;  1VQ8 P;  2HFE D;  2JP3 A;  1Y8A A;  1FZC A;  3VMA A;  1SQV E;  2O1J A;  2JJL A;  1N7L A;  2E43 A;  1M1J C;  1VQO P;  1GD2 E;  4RJT A;  3PHL A;  1KFM A;  1QLE D;  3I5C A;  1NTZ G;  1M90 Q;  4H44 C;  2KYV A;  4PV1 D;  2OTJ P;  1KN7 A;  4H44 D;  1OW7 A;  1T3U A;  2P67 A;  2XU6 A;  4ZNC A;  3HUS B;  2FYU E;  2A45 I;  1NTM K;  1AVY A;  2O01 N;  3AEF C;  1MZ9 A;  1WT6 A;  1NKZ B;  3H1J J;  2KZJ A;  3KHU A;  1NHL A;  3CME P;  3T97 A;  2B9B A;  4EYY Q;  3D70 A;  1U7M A;  3CWB D;  4N3Y B;  3M9Q A;  1PGQ A;  5CCH D;  2Y0E A;  1JTH B;  5CJ0 A;  2PRR A;  1HBW A;  1JY3 P;  4GKG A;  4WY4 D;  2QJY B;  2QM8 A;  2HYN A;  1NTZ D;  3B5N A;  1NKN A;  3S9O A;  2D2C D;  4GOE A;  1YBK A;  1DD4 A;  2YIU B;  4EI2 A;  5AVR B;  4DJG A;  3BAS A;  3RK2 D;  3LW5 J;  1P84 H;  4YXD C;  3G9R A;  1ZOY C;  4D6T G;  3CWB E;  2V7Q J;  2AEM A; 
#chains in the Genus database with same CATH homology
 3L72 E;  4U3F E;  1SQQ E;  2IBZ E;  1BE3 E;  1PP9 E;  3CX5 E;  2BCC E;  1EZV E;  3BCC E;  5KLV E;  1BCC E;  3H1H E;  1NTK E;  1KYO E;  2FYU E;  1NU1 E;  1BGY E;  3L70 E;  1SQV E;  3H1L E;  4PD4 E;  3H1K E;  1L0L E;  1SQP E;  3L75 E;  1NTM E;  1PPJ E;  3H1J E;  1NTZ E;  1P84 E;  3CXH E;  1SQX E;  1KB9 E;  1L0N E;  3H1I E;  4D6T E;  3L71 E;  3L74 E;  3TGU E;  1SQB E;  3CWB E;  3L73 E;  2A06 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...