4D6TE

Cytochrome bc1 bound to the 4(1h)-pyridone gw844520
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
73
structure length
73
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B-C1 COMPLEX SUBUNIT 1, MITOCHONDRIAL
publication title Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
pubmed doi rcsb
molecule tags Electron transport
total genus 22
structure length 73
sequence length 73
chains with identical sequence I, R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
E PF09165 Ubiq-Cytc-red_N Ubiquinol-cytochrome c reductase 8 kDa, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 4d6tE00
1NTZE 1SQPE 1PPJE 3H1HE 1SQVE 3L72E 3L73E 3TGUE 3CWBE 1NU1E 1NTKE 1KYOE 4D6TE 1EZVE 4U3FE 2BCCE 1SQQE 1KB9E 3CXHE 3H1IE 1SQBE 3H1LE 2FYUE 3L74E 1BCCE 1P84E 3CX5E 3L70E 1BGYE 3L75E 1SQXE 2A06E 3L71E 5KLVE 1NTME 3H1KE 1BE3E 1PP9E 1L0LE 1L0NE 4PD4E 3H1JE 2IBZE 3BCCE
chains in the Genus database with same CATH superfamily
3V4WA 3CX5H 1GL2B 1SQBJ 1J1EB 5KLVG 3H1KG 3G71P 3N4XA 3PP5A 1AQ5A 2YXRB 4I7ZC 1VF5C 2G8YA 3RK2B 1J1DB 5GTHE 2L91A 1M1KQ 4JQ0D 1TU3F 4H0LC 2QJPB 4D6TG 1JY3N 4LC1A 5APXA 3VOPA 1BGYG 1FDMA 1SQPK 2XZRA 5APYA 2NPSB 2FY8A 1SQVJ 2AEFA 5APVA 1P84D 1NTKJ 5GTIH 1IO4A 3CC4P 2KZIA 3M0AA 2W27A 5DJUB 2D2CB 1NTZD 3GG2A 4WB4A 3M0DA 2OARA 4XA4A 3H1JJ 2L5GB 2O01J 2WMMA 1T6AA 3MIWA 1KTMA 2A45I 3PHLA 1LTAC 3TGUE 1JEKA 1EZVE 1KFMA 2P2UA 2XV5A 3NFQA 1S5LE 2H88C 2V4HA 1KQGB 1VQ8P 1HUCA 2R5BA 2WT7B 1PPJE 3AE9C 3CCJP 1VF5D 1H8AA 4YXDC 2C0WA 4H0LD 2ZXEB 3AEFC 2E76C 3PLNA 3H32B 2OYHB 1G1JA 1BE3E 3RL0B 3H1ID 3HE5A 1OIPA 5AVTB 1Q90D 2Y0CA 3LW5J 1N86A 3S4RA 2FYUG 2GUVA 2R3CA 3R2PA 3H1LE 1H88A 1JCCA 1MFZA 2YMKA 5AVYB 4I1LA 4UB6H 2O01N 3CWBG 1E5WA 5KLVD 3H1HE 3USSA 3H1KD 1BDCA 4NPDA 1SFCA 2E5YA 1SQXG 1USDA 5BU5A 2OYIB 1M1JA 3L75E 4D6TD 2IZ1A 1PGQA 3K5BA 4OGQC 2HODB 3H6PA 1KD1Q 1BGYD 3ITKA 2WTYA 3M9QA 1KZUB 1JTHA 3KQGA 1QGKB 3HTKA 2HG5D 3FXDA 2B87B 1NU1K 3JCUH 4AYCA 2JKVA 3E1IA 1YJ9P 2QJKC 2E76D 2CPSA 1ZN5A 2NRGA 1SQPE 3OA7A 1QVFO 5KAIH 3H1IJ 2KYVA 1RF1B 1R5LA 4GOEA 1ZOYC 2QEXP 1M57D 3RK3C 1FZFA 2K9JA 3L73E 4KHXA 1EZVI 1HJBA 1LTBC 1YYCA 5B5EH 5KLVJ 3H1KJ 1ZLLA 3V2QA 3S1KA 4EDFA 1G1IA 3N7NA 3CCQP 4D6TJ 2AXTE 2O01H 3CL3D 5C39A 3P7KA 1T2KC 2WVRA 1GK6A 1SQQG 2E75B 3A0HE 4OGQD 2QG4A 3EFFK 1BGYJ 3V5BA 3CC2P 1X9VA 4JYBA 3MTUE 4IOIH 1VQOP 3GHGA 1YQ4C 3WUVA 2FYUD 1HGVA 3RK3B 2KI7B 1RQVA 5KLIC 4N6JA 3LIDA 1JOCA 2FKWB 3D6ZA 3G9RA 3Q2YA 3CWBD 4GKGA 3IFMA 3AEDC 4JF7A 1J2JB 4TLFA 1PZQA 2POHA 2FXMA 1HVVA 4I6MC 1FDOA 2YNYA 1SQXD 3FWNA 1KYOI 1ZW0A 3F89A 1AVYA 1LT9A 3L71G 1EDJA 3VTPC 3LW5H 3II6A 1P84H 2P67A 1CZQA 2WSEJ 1JMMA 1MKMA 3E7KA 1L4AC 1M8OB 4O9BA 1BCCG 2KIKA 5KLIB 3NMDA 1NO4A 2GUSA 1DH3A 3Q5RA 1FOSE 1JO5A 1T2KD 3HD7A 4M3LA 2JWAA 3B5NC 1VQ9P 1SQVG 2O1JA 2B89A 4WWIA 2WSSH 1VQ5P 2QVAA 5KJ7C 1NU1E 1A02F 3L36A 1K8AQ 2FYUJ 3CXHE 1CI6A 2QSIA 3H1JG 2KP8A 2KSEA 3CX5I 3CWBJ 1ZRTD 4K35A 5AVZB 3CCSP 3H25A 1AJYA 4U3FE 1NTZK 2AEJA 2A06E 3A0BE 1EDLA 1PP9E 1Q2NA 2Q3IA 1S9KD 2Q6QA 1URQD 4YTPC 4MN4C 4CPGA 2W90A 1X79B 1L4AD 1OVVA 3P32A 3L70E 2YIUB 4N78D 3RBXA 3A5TA 2KZJA 3CCUP 3AEEC 1FC2C 3B5ND 3HUSA 1QX8A 2Z5HA 5AVUB 1H89A 4K3AA 1ZR2A 2XKMA 2Q9IA 2W6JH 1NH4A 4AUWA 4C7NB 2R3SA 2P1JA 2XU6A 3TYYA 1RE4C 3V4QA 1IFMA 2QRXA 3L71D 1NTMD 1HF9A 1L0LD 1SFCB 1L0NK 2R32A 1LGHB 5CCGD 2ZYDA 2WSFJ 1M1JB 4B86A 3NTNA 3WU2E 2KB7P 2HFED 1BCCD 1GL2C 1VPCA 3CI9A 2K88A 1KQLA 1VQNP 1JTHB 3VN0A 2HPCA 3EFGA 2VRSA 3L72D 1KILA 3MHVA 1SQVD 1KB9H 2KSJA 3PTZA 3AE2C 5E79E 1GW4A 2QJPC 1LTJA 1FDIA 2MJZA 1DEBA 2WPSA 4KT0J 4PD4D 2WSEH 1HGZA 3U1CA 2NPSC 3L74E 2IBZG 2OQQA 1LWUA 1T3UA 3TGUG 2K9JB 1VQKP 1RF0C 3I5CA 2H7HA 2BASA 2D2CC 2WZ7A 2Z4EA 3L71J 1EXIA 1NTMJ 1L0LJ 3TK1A 1NKNA 2ZFCA 3O8ZA 3L35A 3PJSK 2RMZA 3I55P 1NTZE 1PIXA 3CLQA 1GZLA 3BRTB 4UB8E 1YQ3C 1BCCJ 3BCCD 1GL2D 4JPZB 2O3JA 2KNCA 1JY2N 1EQ7A 3GHGB 1UIIA 3L72J 1N7SA 1A02J 1WMKA 2Y0EA 2LXCB 3BRVB 1OW7A 3RK2D 2JJLA 5APWA 4ASVA 3G4SP 2IYOA 3H1LG 5BVZA 5B66E 5CCHA 4BRYB 2OYHC 4KJMA 3RL0C 5KAFH 2JEEA 2NPSD 1YI2P 1LT9B 2M0BA 1RE3A 3L75G 3IAOA 3L4FA 2QIWA 2D2CD 2XDJA 1L0NE 1URQA 4IL6E 1BDDA 4RKUJ 2HR3A 3EQ2A 1SQXK 2DW3A 3B8EB 4ZKPA 1FZCA 2W6AA 2FFDA 5AW4B 2OYIC 4Y28J 4L74A 2YO3A 3HD7B 3BCCJ 1SQPG 2H89C 5H2FE 2WSFH 4QMAA 2N1TC 1YTZT 3AEGC 3AEBC 1LP1B 1OW6A 1CI6B 2IBZD 2G3AA 2JWDA 4IFDK 3B4SA 2E5TA 3V2PA 3TGUD 1EZVD 5AVRB 3KZIE 3OJAB 3L73G 3RBZA 1HTLC 1QEXA 3AECC 5CCGA 1WT6A 2P7JA 2C0XA 2N9YB 3TSIA 1RF1C 1K04A 1KYOE 3BVHA 1PPJD 1FZBA 3CCLP 1OVRA 3C9IA 2M8RA 4DCKA 1X22A 5TJHA 5AW2B 2H8PD 1KMIZ 3E1RA 5CBNA 3KXDA 2BEQD 2N1TB 1T3JA 2YO2A 1SLQA 3D70A 2KXPB 1N73A 2C9LY 1IK7A 4RO0A 5TISH 2K9YA 1N7LA 5DJTB 2QE7H 4PJ0H 4U7JA 3T97B 4EI2A 1SQQK 2ZAEB 1FZEA 3H1LD 2IYPA 2K1AA 2IFNA 3HUSB 1H0TA 3CCEP 2E75C 1USEA 3H1HD 1GU5A 2SPZA 2AEMA 4WBAA 5CBOA 1YTZI 2W83C 2Y0DA 3IF4A 3Q5PA 2ZT9B 2QJYB 1KB9D 3KPEA 3IN6A 3TGUJ 3CX5E 1DD4A 3L75D 3MUDA 5AVQB 4RJTA 2YKPA 1KILE 3MD0A 1GMJA 1M56D 3S9OA 4WY4B 1GW3A 2FYUE 1NYHA 4GOFA 4PD4H 1SQBK 1NHLA 2HPCB 1W5CE 2A45H 5AW3B 1KILB 2KLUA 2W6BA 1SQPD 2BCCE 1BE3J 2H43A 1SQXE 3O6QA 1VQLP 2I1KA 2ZVOB 3G3ZA 5GTIE 1HWTC 1U57A 1U7JA 2WITA 1SP4A 3I56P 3H1LJ 3CC7P 2WPVB 1NAFA 3L73D 1SQVK 2E75D 2WPRA 4RESB 1MUUA 3U1AA 3SSUA 1NTKK 1M90Q 3H1HJ 4PV1C 3BASA 4Z1MH 2ITAA 2JDIH 2LKMA 4N3YB 1AQTA 1ZP0C 3M0DC 3VP8A 3L75J 3M9HA 3RK3D 2A06G 3V6IA 4TT3H 1PP9G 1NTMG 1L0LG 1VQPP 3GF7A 3QWOC 4WVZA 5CJ0A 4DT0A 4C46A 2RN0A 5EFWB 3L70G 1DD3A 2KNCB 3ABVC 1AVOA 1N7SB 1SQPJ 3GLMA 3LIEA 3L72G 4DZOA 3TF5A 4PV1B 5GTHH 3Q1MA 3C8VA 1VQ4P 1X8YA 4UB8H 1IK9A 2UWJE 1PGPA 2P10A 1SQQE 5AW0B 2YIUC 1ZV8A 1JY3P 4UB6E 1L2PA 4XFJA 2OYHA 3L73J 2A45G 3ZDMA 4BWNA 1N8RQ 2OTLP 3C1LA 4A7PA 4N78E 2V7QJ 4NPEA 5AW8B 4R4LA 4R4MA 3Q5SA 1KORA 1ZXGA 3WUTA 2RH0A 5BU8B 1MFTA 2E74B 1SFCC 2FFDB 4H13B 5KKZC 2HYNA 3SWFA 1M1JC 2QM8A 5AW7B 1SQBE 1S5LH 3JCUE 1NU1D 1PGOA 2FYNB 3BCCG 3JSVC 1OVUA 3HE5B 3CXHD 2B9BA 3FWLA 2ZXXA 2HODA 5K5GB 3M06A 3P8MC 5KAIE 1KC8Q 1ZMEC 2IDBA 4HB1A 3CPWO 3AE7C 1M7LA 5L8RJ 4W7YA 3A7OA 4H44B 3QH9A 5KJ7D 1S3JA 1ZR4A 1KQFB 4ZKUA 2A06D 1SQVE 1IFDA 1PP9D 3GF3A 1Q86Q 1NTKE 5B5EE 5KKZB 2JP3A 3P8CE 2IPPA 4EIJA 3H1JE 5AVWB 1YJNP 2FYZA 3L70D 1BSNA 5KLVK 1N73B 3HTKB 2Q3EA 4LGDE 2OGUA 1GU4A 3VP9A 1Q82Q 2JR8A 1D7MA 1NU1J 2JO1A 1H0TB 2R44A 5AW5B 3R4YA 4OH8B 5M1BA 3AEAC 4GT1A 3GW6A 3VMXA 1R8EA 1RY3A 3GHGC 4OVNF 4XE5B 1JCDA 2ZVNB 3VMYA 3FXEA 1EZVG 5CMZA 2N9BA 3CCRP 4IL6X 2NZ2A 1NOHA 1BSHA 1PP9J 1L0NG 1P84E 4LLHA 1LTSC 4Y99B 2HLOA 1PPJG 1VDFA 2K37A 2MKVA 1SVFA 1YJWP 1Y9BA 1EDKA 1LT9C 2XNDH 3M91A 2PP6A 4EOTA 5APTA 3L70J 4IFFA 1BE3G 1LJ2A 2WWWA 3AE5C 3O6QB 2V7QH 2R5DA 3WUUA 1IC2A 3L74D 2CK3H 3TNUA 3KHUA 1DX7A 2AXTH 2CPBA 1QLED 2K3RA 1QL1A 3A0HH 1LT1A 4W80A 2M3BA 3HD7C 1OFCX 1QVGO 1RH5B 2Q5UA 3W68A 1YBKA 1IFIA 3H1HG 2OYOA 2FYUK 2GA1A 1VQ7P 2ZYAA 1PFIA 1AA0A 3H1IE 3VMAA 4PD4I 4BXLA 4I7ZB 1OXZA 1NAYA 1VF5B 2IBZE 1G2CA 4GODA 1IFPA 3WMM0 1N2DC 4DOJA 4H0LB 3AE3C 2M3EA 2IFMA 2KOGA 1L4AA 1Z56A 1YIJP 2IX7C 1E79H 3VMZA 5KLVE 3H1KE 2AXCA 2FXOA 1Y8AA 1S2EA 1VQMP 1SS1A 3B5NA 3TDKA 3BATA 3L74J 1FJPA 5AW1B 4D6TE 1S72P 1HBWA 5KJ7A 1NKZB 4HKZH 4HH2A 3OW2O 1BGYE 4HYTB 3KYQA 1CW5A 2YMYA 3HD7D 2KS1A 3HUSC 3CCMP 3AE8C 3RL0D 1L0ND 3V2RA 1IFNA 2PRRA 5CJ4A 1P84I 3CXHH 2LR2A 2QA4P 2ZT9C 1NTZJ 4C7NA 2QJYC 1RHZB 1Q7YQ 2YKQA 3HE4A 2GM4A 2P58A 1FZGA 2KK7A 5KTBA 2BCCG 1BE3D 1FJKA 4WY4C 1KB9E 4HJGH 3NXSA 1DEEG 4L76A 1XTCC 2E76B 2FBWC 4JYCA 3A0BH 2PFXA 3CCVP 1UIXA 2I1JA 4YXWH 1AV1A 5AVSB 2J58A 1S4XA 1GTWA 3RGUA 1KILC 2N1TD 5CHXA 5APUA 1JNMA 2M5AA 3CMAP 5AVXB 1LTIC 1KYOD 1LTJC 4NPFX 1RE4A 1EXJA 3F5HA 1OWAA 1GD2E 3MGNA 3PRJA 5AW9B 1EDIA 1L0NJ 1LWUC 1WRGA 1KQSO 1FBMA 2IBZI 1AFOA 4DJGA 4OGQB 2J5UA 2WQYC 2PGDA 1PV3A 1RQUA 2W8ZA 2ZT9D 1NTMK 1GL2A 1L0LK 3CWBE 1OX3A 3U59A 2PAJA 4OWFA 1FOSF 1NWQA 3A2AA 4WY4D 1W2BO 1LTJB 3WU2H 3VYIA 2QJKB 3RK3E 5APSA 1LTGC 1NU1G 4GIFA 2ZYGA 1VL2A 3CX5D 3G6EP 1K73Q 2XNXA 3CD6P 5KAFE 1N7SC 1KILD 2NPSA 5AW6B 2QM7A 1LWUB 4L73A 2WSCJ 3PH0A 5E79H 2Q7CA 2BEZF 1W2EA 4U3FG 5CCHC 1YITP 3KDPB 1RF0A 3MZWB 1Y47A 2I8DA 3V2NA 3M9BA 3SWKA 3W67A 4BRYA 2BCCD 2E43A 1KV4A 1RE3C 3MP7B 1SQBG 1NJIQ 1KB9I 1OZHA 3UIAA 3AE6C 1ZRTE 1URQC 2Y9ZA 1MZ9A 3TNUB 3A3YB 3RL0g 2E74C 3OAKA 3SWYA 1FZCC 2FFDC 4H13C 2YKOA 2WT7A 1OW8A 1KN7A 3JC22 3L37A 2LXBA 1QL2A 2FYNC 1LNQA 2E42A 1S9KE 3H32A 3GMAA 3SFDC 1YHQP 4JBZA 1NTKG 1N7SD 1S1CX 1K05A 1JY2P 1EC5A 1LP1A 3Q3DA 1U7MA 4PV1D 2KUBA 5B66H 4H44C 1FAVA 5CCHD 3AE4C 1K9MQ 1X0TA 5APQA 2Y9YA 1URQB 2OTKE 1G2CB 5CCGC 2WPQA 1OMIA 1NGMB 1T8ZA 1NVOA 2BCCJ 1L4AB 1R5SA 1MV8A 1FZCB 5TISE 1SQXJ 1VQ6P 3CMEP 4PJ0E 2C9NY 1CSBA 3L71E 2B88A 1NTME 2OYIA 1L0LE 1FZAA 1SQQD 3B5NB 4IL6H 1N73C 2N1TA 3IR9A 1Q81Q 1JMBA 3EWKA 2E74D 1FE6A 3L74G 3FX0A 4IFMA 3D6YA 1HJ0A 4YPCA 4H13D 4AQRD 1BCCE 4U3FD 1IZNB 2B87A 2KS1B 5H2FH 3T97A 1PGJA 2RKLA 3L72E 2Z5IA 1JY3O 1IFJA 1FS0E 1RF1A 4L75A 3SFEC 1XTGB 4EYYQ 1FU1A 3HE4B 1JY2O 4PD4E 1NTZG 3KZIH 1SQBD 4H44D 2IZ0A 2KLVA 3MUDC 1JB0J 2WSCH 1GDTA 2O1KA 1KYOH 4WY4A 1SFCD 4C7RA 4Y99C 2YXQB 4W7ZA 2Q1KA 1J1EC 1SQQJ 2J59M 2M5AB 3AE1C 2OTJP 1JUNA 1NTKD 3RK2C 3D71A 1J1DC 4ZNCA 3P8CD 3BCCE 5AVVB 1IJDB 1PL5A 4U3FJ 1KFNA 1GK4A 4GDOA 3H1IG 2FXPA 4ASWA 3H1JD 3CXHI 1JM0A 3B71A 4ZMDA 1LTTC 4I2LC 2ZJSE 3FGAD 1DIPA 3HRNA 1S5LX 1HH0A
chains in the Genus database with same CATH topology
1NTZE 1SQPE 1PPJE 3H1HE 1SQVE 3L72E 3L73E 3TGUE 3CWBE 1NU1E 1NTKE 1KYOE 4D6TE 1EZVE 4U3FE 2BCCE 1SQQE 1KB9E 3CXHE 3H1IE 1SQBE 3H1LE 2FYUE 3L74E 1BCCE 1P84E 3CX5E 3L70E 1BGYE 3L75E 1SQXE 2A06E 3L71E 5KLVE 1NTME 3H1KE 1BE3E 1PP9E 1L0LE 1L0NE 4PD4E 3H1JE 2IBZE 3BCCE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTZ E;  1SQP E;  1PPJ E;  3H1H E;  1SQV E;  3L72 E;  3L73 E;  3TGU E;  3CWB E;  1NU1 E;  1NTK E;  1KYO E;  4D6T E;  1EZV E;  4U3F E;  2BCC E;  1SQQ E;  1KB9 E;  3CXH E;  3H1I E;  1SQB E;  3H1L E;  2FYU E;  3L74 E;  1BCC E;  1P84 E;  3CX5 E;  3L70 E;  1BGY E;  3L75 E;  1SQX E;  2A06 E;  3L71 E;  5KLV E;  1NTM E;  3H1K E;  1BE3 E;  1PP9 E;  1L0L E;  1L0N E;  4PD4 E;  3H1J E;  2IBZ E;  3BCC E; 
#chains in the Genus database with same CATH topology
 3V4W A;  3CX5 H;  1GL2 B;  1SQB J;  1J1E B;  5KLV G;  3H1K G;  3G71 P;  3N4X A;  3PP5 A;  1AQ5 A;  2YXR B;  4I7Z C;  1VF5 C;  2G8Y A;  3RK2 B;  1J1D B;  5GTH E;  2L91 A;  1M1K Q;  4JQ0 D;  1TU3 F;  4H0L C;  2QJP B;  4D6T G;  1JY3 N;  4LC1 A;  5APX A;  3VOP A;  1BGY G;  1FDM A;  1SQP K;  2XZR A;  5APY A;  2NPS B;  2FY8 A;  1SQV J;  2AEF A;  5APV A;  1P84 D;  1NTK J;  5GTI H;  1IO4 A;  3CC4 P;  2KZI A;  3M0A A;  2W27 A;  5DJU B;  2D2C B;  1NTZ D;  3GG2 A;  4WB4 A;  3M0D A;  2OAR A;  4XA4 A;  3H1J J;  2L5G B;  2O01 J;  2WMM A;  1T6A A;  3MIW A;  1KTM A;  2A45 I;  3PHL A;  1LTA C;  3TGU E;  1JEK A;  1EZV E;  1KFM A;  2P2U A;  2XV5 A;  3NFQ A;  1S5L E;  2H88 C;  2V4H A;  1KQG B;  1VQ8 P;  1HUC A;  2R5B A;  2WT7 B;  1PPJ E;  3AE9 C;  3CCJ P;  1VF5 D;  1H8A A;  4YXD C;  2C0W A;  4H0L D;  2ZXE B;  3AEF C;  2E76 C;  3PLN A;  3H32 B;  2OYH B;  1G1J A;  1BE3 E;  3RL0 B;  3H1I D;  3HE5 A;  1OIP A;  5AVT B;  1Q90 D;  2Y0C A;  3LW5 J;  1N86 A;  3S4R A;  2FYU G;  2GUV A;  2R3C A;  3R2P A;  3H1L E;  1H88 A;  1JCC A;  1MFZ A;  2YMK A;  5AVY B;  4I1L A;  4UB6 H;  2O01 N;  3CWB G;  1E5W A;  5KLV D;  3H1H E;  3USS A;  3H1K D;  1BDC A;  4NPD A;  1SFC A;  2E5Y A;  1SQX G;  1USD A;  5BU5 A;  2OYI B;  1M1J A;  3L75 E;  4D6T D;  2IZ1 A;  1PGQ A;  3K5B A;  4OGQ C;  2HOD B;  3H6P A;  1KD1 Q;  1BGY D;  3ITK A;  2WTY A;  3M9Q A;  1KZU B;  1JTH A;  3KQG A;  1QGK B;  3HTK A;  2HG5 D;  3FXD A;  2B87 B;  1NU1 K;  3JCU H;  4AYC A;  2JKV A;  3E1I A;  1YJ9 P;  2QJK C;  2E76 D;  2CPS A;  1ZN5 A;  2NRG A;  1SQP E;  3OA7 A;  1QVF O;  5KAI H;  3H1I J;  2KYV A;  1RF1 B;  1R5L A;  4GOE A;  1ZOY C;  2QEX P;  1M57 D;  3RK3 C;  1FZF A;  2K9J A;  3L73 E;  4KHX A;  1EZV I;  1HJB A;  1LTB C;  1YYC A;  5B5E H;  5KLV J;  3H1K J;  1ZLL A;  3V2Q A;  3S1K A;  4EDF A;  1G1I A;  3N7N A;  3CCQ P;  4D6T J;  2AXT E;  2O01 H;  3CL3 D;  5C39 A;  3P7K A;  1T2K C;  2WVR A;  1GK6 A;  1SQQ G;  2E75 B;  3A0H E;  4OGQ D;  2QG4 A;  3EFF K;  1BGY J;  3V5B A;  3CC2 P;  1X9V A;  4JYB A;  3MTU E;  4IOI H;  1VQO P;  3GHG A;  1YQ4 C;  3WUV A;  2FYU D;  1HGV A;  3RK3 B;  2KI7 B;  1RQV A;  5KLI C;  4N6J A;  3LID A;  1JOC A;  2FKW B;  3D6Z A;  3G9R A;  3Q2Y A;  3CWB D;  4GKG A;  3IFM A;  3AED C;  4JF7 A;  1J2J B;  4TLF A;  1PZQ A;  2POH A;  2FXM A;  1HVV A;  4I6M C;  1FDO A;  2YNY A;  1SQX D;  3FWN A;  1KYO I;  1ZW0 A;  3F89 A;  1AVY A;  1LT9 A;  3L71 G;  1EDJ A;  3VTP C;  3LW5 H;  3II6 A;  1P84 H;  2P67 A;  1CZQ A;  2WSE J;  1JMM A;  1MKM A;  3E7K A;  1L4A C;  1M8O B;  4O9B A;  1BCC G;  2KIK A;  5KLI B;  3NMD A;  1NO4 A;  2GUS A;  1DH3 A;  3Q5R A;  1FOS E;  1JO5 A;  1T2K D;  3HD7 A;  4M3L A;  2JWA A;  3B5N C;  1VQ9 P;  1SQV G;  2O1J A;  2B89 A;  4WWI A;  2WSS H;  1VQ5 P;  2QVA A;  5KJ7 C;  1NU1 E;  1A02 F;  3L36 A;  1K8A Q;  2FYU J;  3CXH E;  1CI6 A;  2QSI A;  3H1J G;  2KP8 A;  2KSE A;  3CX5 I;  3CWB J;  1ZRT D;  4K35 A;  5AVZ B;  3CCS P;  3H25 A;  1AJY A;  4U3F E;  1NTZ K;  2AEJ A;  2A06 E;  3A0B E;  1EDL A;  1PP9 E;  1Q2N A;  2Q3I A;  1S9K D;  2Q6Q A;  1URQ D;  4YTP C;  4MN4 C;  4CPG A;  2W90 A;  1X79 B;  1L4A D;  1OVV A;  3P32 A;  3L70 E;  2YIU B;  4N78 D;  3RBX A;  3A5T A;  2KZJ A;  3CCU P;  3AEE C;  1FC2 C;  3B5N D;  3HUS A;  1QX8 A;  2Z5H A;  5AVU B;  1H89 A;  4K3A A;  1ZR2 A;  2XKM A;  2Q9I A;  2W6J H;  1NH4 A;  4AUW A;  4C7N B;  2R3S A;  2P1J A;  2XU6 A;  3TYY A;  1RE4 C;  3V4Q A;  1IFM A;  2QRX A;  3L71 D;  1NTM D;  1HF9 A;  1L0L D;  1SFC B;  1L0N K;  2R32 A;  1LGH B;  5CCG D;  2ZYD A;  2WSF J;  1M1J B;  4B86 A;  3NTN A;  3WU2 E;  2KB7 P;  2HFE D;  1BCC D;  1GL2 C;  1VPC A;  3CI9 A;  2K88 A;  1KQL A;  1VQN P;  1JTH B;  3VN0 A;  2HPC A;  3EFG A;  2VRS A;  3L72 D;  1KIL A;  3MHV A;  1SQV D;  1KB9 H;  2KSJ A;  3PTZ A;  3AE2 C;  5E79 E;  1GW4 A;  2QJP C;  1LTJ A;  1FDI A;  2MJZ A;  1DEB A;  2WPS A;  4KT0 J;  4PD4 D;  2WSE H;  1HGZ A;  3U1C A;  2NPS C;  3L74 E;  2IBZ G;  2OQQ A;  1LWU A;  1T3U A;  3TGU G;  2K9J B;  1VQK P;  1RF0 C;  3I5C A;  2H7H A;  2BAS A;  2D2C C;  2WZ7 A;  2Z4E A;  3L71 J;  1EXI A;  1NTM J;  1L0L J;  3TK1 A;  1NKN A;  2ZFC A;  3O8Z A;  3L35 A;  3PJS K;  2RMZ A;  3I55 P;  1NTZ E;  1PIX A;  3CLQ A;  1GZL A;  3BRT B;  4UB8 E;  1YQ3 C;  1BCC J;  3BCC D;  1GL2 D;  4JPZ B;  2O3J A;  2KNC A;  1JY2 N;  1EQ7 A;  3GHG B;  1UII A;  3L72 J;  1N7S A;  1A02 J;  1WMK A;  2Y0E A;  2LXC B;  3BRV B;  1OW7 A;  3RK2 D;  2JJL A;  5APW A;  4ASV A;  3G4S P;  2IYO A;  3H1L G;  5BVZ A;  5B66 E;  5CCH A;  4BRY B;  2OYH C;  4KJM A;  3RL0 C;  5KAF H;  2JEE A;  2NPS D;  1YI2 P;  1LT9 B;  2M0B A;  1RE3 A;  3L75 G;  3IAO A;  3L4F A;  2QIW A;  2D2C D;  2XDJ A;  1L0N E;  1URQ A;  4IL6 E;  1BDD A;  4RKU J;  2HR3 A;  3EQ2 A;  1SQX K;  2DW3 A;  3B8E B;  4ZKP A;  1FZC A;  2W6A A;  2FFD A;  5AW4 B;  2OYI C;  4Y28 J;  4L74 A;  2YO3 A;  3HD7 B;  3BCC J;  1SQP G;  2H89 C;  5H2F E;  2WSF H;  4QMA A;  2N1T C;  1YTZ T;  3AEG C;  3AEB C;  1LP1 B;  1OW6 A;  1CI6 B;  2IBZ D;  2G3A A;  2JWD A;  4IFD K;  3B4S A;  2E5T A;  3V2P A;  3TGU D;  1EZV D;  5AVR B;  3KZI E;  3OJA B;  3L73 G;  3RBZ A;  1HTL C;  1QEX A;  3AEC C;  5CCG A;  1WT6 A;  2P7J A;  2C0X A;  2N9Y B;  3TSI A;  1RF1 C;  1K04 A;  1KYO E;  3BVH A;  1PPJ D;  1FZB A;  3CCL P;  1OVR A;  3C9I A;  2M8R A;  4DCK A;  1X22 A;  5TJH A;  5AW2 B;  2H8P D;  1KMI Z;  3E1R A;  5CBN A;  3KXD A;  2BEQ D;  2N1T B;  1T3J A;  2YO2 A;  1SLQ A;  3D70 A;  2KXP B;  1N73 A;  2C9L Y;  1IK7 A;  4RO0 A;  5TIS H;  2K9Y A;  1N7L A;  5DJT B;  2QE7 H;  4PJ0 H;  4U7J A;  3T97 B;  4EI2 A;  1SQQ K;  2ZAE B;  1FZE A;  3H1L D;  2IYP A;  2K1A A;  2IFN A;  3HUS B;  1H0T A;  3CCE P;  2E75 C;  1USE A;  3H1H D;  1GU5 A;  2SPZ A;  2AEM A;  4WBA A;  5CBO A;  1YTZ I;  2W83 C;  2Y0D A;  3IF4 A;  3Q5P A;  2ZT9 B;  2QJY B;  1KB9 D;  3KPE A;  3IN6 A;  3TGU J;  3CX5 E;  1DD4 A;  3L75 D;  3MUD A;  5AVQ B;  4RJT A;  2YKP A;  1KIL E;  3MD0 A;  1GMJ A;  1M56 D;  3S9O A;  4WY4 B;  1GW3 A;  2FYU E;  1NYH A;  4GOF A;  4PD4 H;  1SQB K;  1NHL A;  2HPC B;  1W5C E;  2A45 H;  5AW3 B;  1KIL B;  2KLU A;  2W6B A;  1SQP D;  2BCC E;  1BE3 J;  2H43 A;  1SQX E;  3O6Q A;  1VQL P;  2I1K A;  2ZVO B;  3G3Z A;  5GTI E;  1HWT C;  1U57 A;  1U7J A;  2WIT A;  1SP4 A;  3I56 P;  3H1L J;  3CC7 P;  2WPV B;  1NAF A;  3L73 D;  1SQV K;  2E75 D;  2WPR A;  4RES B;  1MUU A;  3U1A A;  3SSU A;  1NTK K;  1M90 Q;  3H1H J;  4PV1 C;  3BAS A;  4Z1M H;  2ITA A;  2JDI H;  2LKM A;  4N3Y B;  1AQT A;  1ZP0 C;  3M0D C;  3VP8 A;  3L75 J;  3M9H A;  3RK3 D;  2A06 G;  3V6I A;  4TT3 H;  1PP9 G;  1NTM G;  1L0L G;  1VQP P;  3GF7 A;  3QWO C;  4WVZ A;  5CJ0 A;  4DT0 A;  4C46 A;  2RN0 A;  5EFW B;  3L70 G;  1DD3 A;  2KNC B;  3ABV C;  1AVO A;  1N7S B;  1SQP J;  3GLM A;  3LIE A;  3L72 G;  4DZO A;  3TF5 A;  4PV1 B;  5GTH H;  3Q1M A;  3C8V A;  1VQ4 P;  1X8Y A;  4UB8 H;  1IK9 A;  2UWJ E;  1PGP A;  2P10 A;  1SQQ E;  5AW0 B;  2YIU C;  1ZV8 A;  1JY3 P;  4UB6 E;  1L2P A;  4XFJ A;  2OYH A;  3L73 J;  2A45 G;  3ZDM A;  4BWN A;  1N8R Q;  2OTL P;  3C1L A;  4A7P A;  4N78 E;  2V7Q J;  4NPE A;  5AW8 B;  4R4L A;  4R4M A;  3Q5S A;  1KOR A;  1ZXG A;  3WUT A;  2RH0 A;  5BU8 B;  1MFT A;  2E74 B;  1SFC C;  2FFD B;  4H13 B;  5KKZ C;  2HYN A;  3SWF A;  1M1J C;  2QM8 A;  5AW7 B;  1SQB E;  1S5L H;  3JCU E;  1NU1 D;  1PGO A;  2FYN B;  3BCC G;  3JSV C;  1OVU A;  3HE5 B;  3CXH D;  2B9B A;  3FWL A;  2ZXX A;  2HOD A;  5K5G B;  3M06 A;  3P8M C;  5KAI E;  1KC8 Q;  1ZME C;  2IDB A;  4HB1 A;  3CPW O;  3AE7 C;  1M7L A;  5L8R J;  4W7Y A;  3A7O A;  4H44 B;  3QH9 A;  5KJ7 D;  1S3J A;  1ZR4 A;  1KQF B;  4ZKU A;  2A06 D;  1SQV E;  1IFD A;  1PP9 D;  3GF3 A;  1Q86 Q;  1NTK E;  5B5E E;  5KKZ B;  2JP3 A;  3P8C E;  2IPP A;  4EIJ A;  3H1J E;  5AVW B;  1YJN P;  2FYZ A;  3L70 D;  1BSN A;  5KLV K;  1N73 B;  3HTK B;  2Q3E A;  4LGD E;  2OGU A;  1GU4 A;  3VP9 A;  1Q82 Q;  2JR8 A;  1D7M A;  1NU1 J;  2JO1 A;  1H0T B;  2R44 A;  5AW5 B;  3R4Y A;  4OH8 B;  5M1B A;  3AEA C;  4GT1 A;  3GW6 A;  3VMX A;  1R8E A;  1RY3 A;  3GHG C;  4OVN F;  4XE5 B;  1JCD A;  2ZVN B;  3VMY A;  3FXE A;  1EZV G;  5CMZ A;  2N9B A;  3CCR P;  4IL6 X;  2NZ2 A;  1NOH A;  1BSH A;  1PP9 J;  1L0N G;  1P84 E;  4LLH A;  1LTS C;  4Y99 B;  2HLO A;  1PPJ G;  1VDF A;  2K37 A;  2MKV A;  1SVF A;  1YJW P;  1Y9B A;  1EDK A;  1LT9 C;  2XND H;  3M91 A;  2PP6 A;  4EOT A;  5APT A;  3L70 J;  4IFF A;  1BE3 G;  1LJ2 A;  2WWW A;  3AE5 C;  3O6Q B;  2V7Q H;  2R5D A;  3WUU A;  1IC2 A;  3L74 D;  2CK3 H;  3TNU A;  3KHU A;  1DX7 A;  2AXT H;  2CPB A;  1QLE D;  2K3R A;  1QL1 A;  3A0H H;  1LT1 A;  4W80 A;  2M3B A;  3HD7 C;  1OFC X;  1QVG O;  1RH5 B;  2Q5U A;  3W68 A;  1YBK A;  1IFI A;  3H1H G;  2OYO A;  2FYU K;  2GA1 A;  1VQ7 P;  2ZYA A;  1PFI A;  1AA0 A;  3H1I E;  3VMA A;  4PD4 I;  4BXL A;  4I7Z B;  1OXZ A;  1NAY A;  1VF5 B;  2IBZ E;  1G2C A;  4GOD A;  1IFP A;  3WMM 0;  1N2D C;  4DOJ A;  4H0L B;  3AE3 C;  2M3E A;  2IFM A;  2KOG A;  1L4A A;  1Z56 A;  1YIJ P;  2IX7 C;  1E79 H;  3VMZ A;  5KLV E;  3H1K E;  2AXC A;  2FXO A;  1Y8A A;  1S2E A;  1VQM P;  1SS1 A;  3B5N A;  3TDK A;  3BAT A;  3L74 J;  1FJP A;  5AW1 B;  4D6T E;  1S72 P;  1HBW A;  5KJ7 A;  1NKZ B;  4HKZ H;  4HH2 A;  3OW2 O;  1BGY E;  4HYT B;  3KYQ A;  1CW5 A;  2YMY A;  3HD7 D;  2KS1 A;  3HUS C;  3CCM P;  3AE8 C;  3RL0 D;  1L0N D;  3V2R A;  1IFN A;  2PRR A;  5CJ4 A;  1P84 I;  3CXH H;  2LR2 A;  2QA4 P;  2ZT9 C;  1NTZ J;  4C7N A;  2QJY C;  1RHZ B;  1Q7Y Q;  2YKQ A;  3HE4 A;  2GM4 A;  2P58 A;  1FZG A;  2KK7 A;  5KTB A;  2BCC G;  1BE3 D;  1FJK A;  4WY4 C;  1KB9 E;  4HJG H;  3NXS A;  1DEE G;  4L76 A;  1XTC C;  2E76 B;  2FBW C;  4JYC A;  3A0B H;  2PFX A;  3CCV P;  1UIX A;  2I1J A;  4YXW H;  1AV1 A;  5AVS B;  2J58 A;  1S4X A;  1GTW A;  3RGU A;  1KIL C;  2N1T D;  5CHX A;  5APU A;  1JNM A;  2M5A A;  3CMA P;  5AVX B;  1LTI C;  1KYO D;  1LTJ C;  4NPF X;  1RE4 A;  1EXJ A;  3F5H A;  1OWA A;  1GD2 E;  3MGN A;  3PRJ A;  5AW9 B;  1EDI A;  1L0N J;  1LWU C;  1WRG A;  1KQS O;  1FBM A;  2IBZ I;  1AFO A;  4DJG A;  4OGQ B;  2J5U A;  2WQY C;  2PGD A;  1PV3 A;  1RQU A;  2W8Z A;  2ZT9 D;  1NTM K;  1GL2 A;  1L0L K;  3CWB E;  1OX3 A;  3U59 A;  2PAJ A;  4OWF A;  1FOS F;  1NWQ A;  3A2A A;  4WY4 D;  1W2B O;  1LTJ B;  3WU2 H;  3VYI A;  2QJK B;  3RK3 E;  5APS A;  1LTG C;  1NU1 G;  4GIF A;  2ZYG A;  1VL2 A;  3CX5 D;  3G6E P;  1K73 Q;  2XNX A;  3CD6 P;  5KAF E;  1N7S C;  1KIL D;  2NPS A;  5AW6 B;  2QM7 A;  1LWU B;  4L73 A;  2WSC J;  3PH0 A;  5E79 H;  2Q7C A;  2BEZ F;  1W2E A;  4U3F G;  5CCH C;  1YIT P;  3KDP B;  1RF0 A;  3MZW B;  1Y47 A;  2I8D A;  3V2N A;  3M9B A;  3SWK A;  3W67 A;  4BRY A;  2BCC D;  2E43 A;  1KV4 A;  1RE3 C;  3MP7 B;  1SQB G;  1NJI Q;  1KB9 I;  1OZH A;  3UIA A;  3AE6 C;  1ZRT E;  1URQ C;  2Y9Z A;  1MZ9 A;  3TNU B;  3A3Y B;  3RL0 g;  2E74 C;  3OAK A;  3SWY A;  1FZC C;  2FFD C;  4H13 C;  2YKO A;  2WT7 A;  1OW8 A;  1KN7 A;  3JC2 2;  3L37 A;  2LXB A;  1QL2 A;  2FYN C;  1LNQ A;  2E42 A;  1S9K E;  3H32 A;  3GMA A;  3SFD C;  1YHQ P;  4JBZ A;  1NTK G;  1N7S D;  1S1C X;  1K05 A;  1JY2 P;  1EC5 A;  1LP1 A;  3Q3D A;  1U7M A;  4PV1 D;  2KUB A;  5B66 H;  4H44 C;  1FAV A;  5CCH D;  3AE4 C;  1K9M Q;  1X0T A;  5APQ A;  2Y9Y A;  1URQ B;  2OTK E;  1G2C B;  5CCG C;  2WPQ A;  1OMI A;  1NGM B;  1T8Z A;  1NVO A;  2BCC J;  1L4A B;  1R5S A;  1MV8 A;  1FZC B;  5TIS E;  1SQX J;  1VQ6 P;  3CME P;  4PJ0 E;  2C9N Y;  1CSB A;  3L71 E;  2B88 A;  1NTM E;  2OYI A;  1L0L E;  1FZA A;  1SQQ D;  3B5N B;  4IL6 H;  1N73 C;  2N1T A;  3IR9 A;  1Q81 Q;  1JMB A;  3EWK A;  2E74 D;  1FE6 A;  3L74 G;  3FX0 A;  4IFM A;  3D6Y A;  1HJ0 A;  4YPC A;  4H13 D;  4AQR D;  1BCC E;  4U3F D;  1IZN B;  2B87 A;  2KS1 B;  5H2F H;  3T97 A;  1PGJ A;  2RKL A;  3L72 E;  2Z5I A;  1JY3 O;  1IFJ A;  1FS0 E;  1RF1 A;  4L75 A;  3SFE C;  1XTG B;  4EYY Q;  1FU1 A;  3HE4 B;  1JY2 O;  4PD4 E;  1NTZ G;  3KZI H;  1SQB D;  4H44 D;  2IZ0 A;  2KLV A;  3MUD C;  1JB0 J;  2WSC H;  1GDT A;  2O1K A;  1KYO H;  4WY4 A;  1SFC D;  4C7R A;  4Y99 C;  2YXQ B;  4W7Z A;  2Q1K A;  1J1E C;  1SQQ J;  2J59 M;  2M5A B;  3AE1 C;  2OTJ P;  1JUN A;  1NTK D;  3RK2 C;  3D71 A;  1J1D C;  4ZNC A;  3P8C D;  3BCC E;  5AVV B;  1IJD B;  1PL5 A;  4U3F J;  1KFN A;  1GK4 A;  4GDO A;  3H1I G;  2FXP A;  4ASW A;  3H1J D;  3CXH I;  1JM0 A;  3B71 A;  4ZMD A;  1LTT C;  4I2L C;  2ZJS E;  3FGA D;  1DIP A;  3HRN A;  1S5L X;  1HH0 A; 
#chains in the Genus database with same CATH homology
 1NTZ E;  1SQP E;  1PPJ E;  3H1H E;  1SQV E;  3L72 E;  3L73 E;  3TGU E;  3CWB E;  1NU1 E;  1NTK E;  1KYO E;  4D6T E;  1EZV E;  4U3F E;  2BCC E;  1SQQ E;  1KB9 E;  3CXH E;  3H1I E;  1SQB E;  3H1L E;  2FYU E;  3L74 E;  1BCC E;  1P84 E;  3CX5 E;  3L70 E;  1BGY E;  3L75 E;  1SQX E;  2A06 E;  3L71 E;  5KLV E;  1NTM E;  3H1K E;  1BE3 E;  1PP9 E;  1L0L E;  1L0N E;  4PD4 E;  3H1J E;  2IBZ E;  3BCC E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...