4D6TE

Cytochrome bc1 bound to the 4(1h)-pyridone gw844520
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
73
structure length
73
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antimalarial 4(1H)-Pyridones Bind to the Qi Site of Cytochrome Bc1.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME B-C1 COMPLEX SUBUNIT 1, MITOCHONDRIAL
total genus 22
structure length 73
sequence length 73
chains with identical sequence I, R
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2014-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
E PF09165 Ubiq-Cytc-red_N Ubiquinol-cytochrome c reductase 8 kDa, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 4d6tE00
3H1KE 1SQBE 3L72E 1SQVE 1EZVE 1SQXE 2BCCE 1BE3E 1SQQE 3H1LE 4PD4E 4U3FE 1BCCE 1PPJE 3H1HE 3L74E 1NTZE 3L73E 3L71E 1BGYE 1NTKE 3TGUE 3CXHE 2A06E 1NU1E 2FYUE 5KLVE 2IBZE 4D6TE 3BCCE 3CWBE 3L70E 1SQPE 1NTME 3H1JE 1KYOE 3L75E 1KB9E 1L0NE 1PP9E 3CX5E 1P84E 3H1IE 1L0LE
chains in the Genus database with same CATH superfamily
2KLVA 3MGNA 3VYIA 4K35A 2V7QJ 2D2CB 3I5CA 2KUBA 3L71D 1SQVE 1EZVE 2A45I 2ZVNB 3H1KG 3L72E 3RK2B 3RK3D 4C7NA 4C7NB 3ABVC 1J1EB 3H1LG 4IL6E 3GW6A 2GUSA 1GW4A 5CJ4A 2KSEA 1IK7A 1N7LA 4UB6H 1SP4A 1RF0A 2GA1A 3VP9A 1NTZE 1ZN5A 3L73G 4NPFX 1AJYA 1NTZG 3L73E 5AW8B 2P58A 5CHXA 2OGUA 3M0DC 1KYOI 3TK1A 1IZNB 1X79B 1L0ND 1LT1A 1N86A 2IYOA 4W7ZA 2KB7P 1VQ4P 3CWBG 1JCCA 1JB0J 1T3UA 5AVSB 1T8ZA 4EOTA 3RK2C 5APWA 1L0NE 3CXHI 1P84E 1T6AA 2I1JA 1PP9G 1SQBK 2R44A 3C8VA 1FC2C 4NPEA 4D6TJ 1T2KC 2UWJE 5CCGC 2OTKE 4N78D 2E76C 4TLFA 5AVRB 3WU2H 4H0LD 2ZXXA 2PFXA 3Q5SA 1AVOA 3MTUE 1K73Q 1LWUA 1LWUB 4PD4E 3L73J 3P7KA 2B89A 1S5LE 2M3EA 2LR2A 5KLVG 1M1KQ 2W6JH 5KKZC 1MFTA 1YIJP 1EQ7A 3RL0D 1S1CX 3MD0A 1M56D 2P2UA 4H0LB 5AW6B 3H1LD 1GMJA 1GU5A 1KN7A 2WSCJ 3PLNA 1L0NJ 2WSFJ 5KJ7C 4ASWA 1VQ6P 3TSIA 1KV4A 1YJNP 1QL1A 2NPSC 5AVUB 4UB6E 1VQ8P 3IR9A 2C9NY 3B5ND 1KYOH 1G2CB 1G2CA 2FYUG 2IBZD 3AE5C 4K3AA 1U7JA 1PGOA 3A0BH 1IFPA 4U3FJ 4IL6X 3VP8A 1H8AA 3TGUD 4HH2A 4EYYQ 2OTJP 1Q2NA 4PJ0E 1DEBA 3V5BA 1HF9A 1KB9E 3CCVP 4KT0J 1ZR4A 3AE1C 1BCCJ 3L72D 4R4MA 2Q3EA 4W7YA 3C9IA 5C39A 2Q9IA 3IFMA 3M9BA 1SQBE 1NYHA 1YJWP 1SQQG 1RH5B 3R4YA 1L0NK 4XA4A 1YTZI 3BCCD 3SFEC 2DW3A 1S5LX 3CXHH 1PV3A 3O8ZA 3BATA 1QEXA 2WPSA 3S4RA 4AQRD 3M06A 5BVZA 3EFGA 1YBKA 3SWFA 4DT0A 2FBWC 3OA7A 5E79H 1P84D 5L8RJ 1FJPA 1AA0A 4ZMDA 1XTGB 3EQ2A 4YPCA 2PAJA 1HVVA 1IFIA 2ZAEB 5B66E 2W6BA 3LIEA 1L4AC 4LGDE 5KKZB 2OYIA 1QLED 2OYIB 1KTMA 2LXBA 3BRTB 3OW2O 1K8AQ 2QA4P 1SQPG 4EI2A 2E5TA 5CBNA 4U3FD 3MIWA 3P8MC 1FDMA 3II6A 1J2JB 1Q90D 3V6IA 1ZMEC 3CWBD 1OXZA 2ITAA 2QJKC 1S9KD 1BCCD 1HGVA 3VN0A 1KYOD 1ZV8A 2YKOA 4EDFA 2E42A 1FOSF 4CPGA 2QRXA 3H1HE 2XNDH 1PZQA 1HUCA 1YQ3C 3U1CA 3L73D 2YKQA 1NU1J 1SQPJ 3Q3DA 2P67A 2WTYA 2BEQD 1KMIZ 2KIKA 3L70D 3GF3A 1NWQA 1T3JA 2A06G 2JEEA 1FDIA 1M7LA 1IFJA 3AE9C 3GMAA 4OGQC 2YMKA 5BU5A 5K5GB 1YI2P 3BVHA 1FZCC 3BCCE 3L74J 1OZHA 3CWBE 3AEFC 3A0BE 1R5LA 1FS0E 1RE4C 2E74C 2WZ7A 3B5NA 3B5NB 3M9QA 1VQPP 1AFOA 2Z5HA 3TNUA 3TNUB 4PV1D 3CD6P 1KFMA 1DD4A 4KJMA 1HWTC 4IFDK 1NTMJ 4W80A 4N78E 3AE8C 2H89C 3V4QA 1SVFA 3VOPA 1SQQD 1N73C 1VQ7P 4BWNA 2IFNA 1NU1D 1SQXK 3H6PA 4GKGA 3AEBC 1HH0A 2IBZI 1RE3C 1Y47A 2K3RA 4L75A 3FXEA 1BCCG 5APUA 1BGYG 5CCHA 3Q5RA 1SQVJ 3VTPC 1OIPA 2YIUC 3TGUG 2WITA 3L74D 4UB8E 3CX5I 3TF5A 1P84H 1OWAA 3CX5H 2K37A 3MZWB 1VF5D 4QMAA 5APQA 5GTHH 3H25A 1VQOP 4GIFA 1PPJD 3CCLP 1M1JC 1VL2A 1Z56A 2JJLA 1NTMG 4KHXA 4H44B 5AW9B 4JYCA 2N9YB 5KAFE 1MZ9A 1RQUA 2WWWA 3OJAB 1BE3J 1J1EC 2WQYC 2YO3A 1EC5A 3LW5H 2BASA 2Q6QA 3P32A 4TT3H 1ZR2A 1TU3F 2K1AA 1FBMA 3B4SA 1P84I 1YJ9P 3L71J 3M9HA 3CCUP 2ZXEB 1VPCA 1BE3D 1NKNA 3E1RA 1EXIA 2G3AA 5KJ7D 1NOHA 5GTHE 1X0TA 2E43A 1PL5A 1SQVK 3JC22 2J59M 4U7JA 5APVA 1JY2O 1WMKA 1JY3P 3L37A 2O1KA 2FXMA 3FGAD 1EXJA 2SPZA 1R5SA 1QVFO 1LNQA 1NGMB 2I8DA 1URQC 2QSIA 3HE4A 3HE4B 4JBZA 1BGYD 2CK3H 1R8EA 2Q3IA 3AE6C 3S9OA 3CCSP 1W2EA 3KZIE 3U1AA 1GD2E 2QG4A 1NTKJ 1JY2N 1GL2B 1GL2A 1K04A 1L0NG 3F89A 3V4WA 3G71P 3CCRP 1PP9E 5CCHC 2CPSA 3FWLA 4I1LA 1L0LD 2AXTH 2JWDA 3H1IG 4DZOA 1HJBA 3D6YA 2WMMA 1JUNA 2M3BA 1UIXA 3M0DA 2O1JA 3K5BA 4DJGA 3I56P 2HODB 2HODA 2FFDC 2PRRA 2O3JA 2XNXA 5AVTB 2JP3A 4YXDC 2K9JB 2K9JA 4H44C 2NRGA 2WSEH 3L36A 5GTIH 1CW5A 1SFCD 3D70A 3H1HG 3L35A 3W68A 3Q2YA 1PFIA 1AQ5A 1ZW0A 1ZXGA 3ZDMA 1JNMA 2XDJA 2E76B 1OW8A 1PIXA 2OQQA 3GHGB 1OVVA 1E79H 4RKUJ 2PGDA 3A0HH 1SFCB 1SFCA 2FYUE 4LC1A 4HKZH 4OGQD 3TYYA 3KHUA 2AXCA 1VQLP 3H1IJ 3HD7A 3HD7B 2O01H 3BCCG 5AW3B 1LT9C 2JKVA 3E7KA 4R4LA 5KLVK 2W27A 3L75G 2RN0A 4PD4I 1VF5B 2RH0A 1BDCA 1YITP 3N7NA 5CBOA 2QJPC 3A0HE 4OGQB 1Q86Q 1FZCA 1FZCB 1FZEA 1EZVD 1L2PA 2VRSA 3RK3E 2B87A 2B87B 3TDKA 1IO4A 1N7SB 1N7SA 2E74B 2KYVA 3CC7P 4U3FG 3B5NC 3GHGC 2K9YA 1J1DC 2XU6A 1NHLA 2KP8A 2KS1A 2KS1B 4HB1A 4U3FE 5B66H 1EDLA 1IJDB 2FYUD 1U57A 3L4FA 2L91A 2O01J 2E74D 5M1BA 2P7JA 3IF4A 5AVVB 1SQXJ 1USEA 1NJIQ 1SQBD 3KPEA 3RGUA 5B5EE 1M57D 1DH3A 2KI7B 3L71G 2QIWA 3TGUE 5KTBA 1HTLC 3G4SP 1KILC 3CXHE 2KNCA 1NU1E 2CPBA 2KNCB 4I7ZC 3WUVA 1LWUC 1EDIA 1X22A 2BCCJ 4D6TE 1PP9J 2WSFH 4D6TG 1E5WA 2WSCH 5CCGD 1FZBA 3E1IA 1LTGC 2JO1A 2M5AB 2M5AA 2WVRA 1SQPE 4Y99C 2E5YA 2V4HA 3T97B 3T97A 1J1DB 1NAFA 1FDOA 2POHA 3AECC 4L73A 5KLVJ 2FYZA 1FZGA 5KJ7A 1JCDA 1PP9D 3IAOA 3LIDA 1KILE 1M8OB 3L72G 1ZP0C 3SFDC 3CCJP 1Q82Q 3CWBJ 3PP5A 1EZVG 1N8RQ 4PD4D 1SQPK 5AW2B 3VMXA 2YXRB 2OTLP 2KK7A 3TGUJ 4DOJA 4ZKPA 1LTSC 1EZVI 4I7ZB 2IDBA 2Y0CA 3FWNA 3B71A 4IFFA 5AVZB 2HYNA 1L0LJ 1AV1A 2QVAA 2G8YA 4GOEA 3RBZA 1GW3A 1OVUA 2FYUJ 2R3CA 3QWOC 4C7RA 5B5EH 2WT7A 4OVNF 2WT7B 1S72P 1IFDA 1NVOA 4M3LA 4WWIA 4IOIH 2ZT9B 1NTZK 2QJKB 4WBAA 1X9VA 2MKVA 3AE3C 4GDOA 1W5CE 3RK3C 5KLVE 3H1HD 2E75C 4O9BA 2IFMA 4N3YB 4RO0A 1JTHB 1JTHA 1JMMA 1JEKA 4XFJA 5H2FE 4EIJA 1S2EA 2A45G 5AW0B 2Q7CA 3W67A 3WU2E 1A02F 1NTKK 4LLHA 2W8ZA 2A06D 5KLVD 1S9KE 3GLMA 1K05A 1L0LE 1KQFB 1YQ4C 1L0LG 3H1ID 4YXWH 1OMIA 2QEXP 2RMZA 1DX7A 2HG5D 4PV1B 5H2FH 3PHLA 3BCCJ 4GOFA 4JF7A 1SQXG 3L75J 3CC4P 2E76D 1SQVD 3HD7C 1VQKP 2ZVOB 3V2RA 2Q5UA 4WB4A 3CPWO 1JMBA 2BEZF 2FYUK 1LGHB 3SWYA 3L75D 3MUDC 3UIAA 3S1KA 3NTNA 1ZOYC 1JOCA 2C9LY 4I2LC 3AE2C 1G1JA 3FXDA 1U7MA 1KB9H 2KZJA 3NXSA 5DJUB 5TJHA 3SWKA 3OAKA 3KXDA 4OWFA 4WY4A 4WY4B 2WPVB 3RBXA 3V2NA 5CMZA 4WVZA 1Q81Q 4AUWA 1AQTA 1EDJA 2H43A 1KYOE 2H88C 3V2QA 2W6AA 1IFNA 1SFCC 2AEMA 3AEDC 2PP6A 4C46A 3AE7C 1KC8Q 2IYPA 4WY4D 3HE5B 3HE5A 4H44D 2NZ2A 4H13C 3CL3D 3RL0g 3GHGA 4H0LC 1YTZT 1RQVA 1KB9I 1S3JA 1VF5C 2A45H 1SQBG 1JY2P 1T2KD 3KZIH 2HPCA 2HPCB 2ZYAA 1QL2A 3CCMP 3B8EB 1LTTC 4PD4H 1LTAC 5APXA 1RF1B 1PPJG 1MFZA 3PH0A 4ASVA 3ITKA 5CCGA 2JDIH 4N6JA 3VMAA 1ZLLA 2QM8A 2Y0EA 3HUSC 1G1IA 4JYBA 5AW1B 1BGYJ 4BRYA 4BRYB 1NU1G 3JCUE 2N1TC 2ZYGA 1CZQA 2WSEJ 1JO5A 2YO2A 3H1IE 4L76A 2H8PD 3MUDA 1GL2D 1NTKD 5TISH 1KQSO 3G3ZA 2Z5IA 3NFQA 1BE3G 3P8CD 4H13D 1RY3A 1VQNP 4WY4C 5KAIE 3Q1MA 2OYHA 1Q7YQ 2OYIC 2OYHB 1FJKA 1MKMA 1MUUA 1USDA 2YNYA 2R5DA 1QGKB 2QJYC 2QM7A 3RL0C 2D2CC 2KSJA 4UB8H 2W83C 5EFWB 1MV8A 2YMYA 5CJ0A 1FU1A 4JPZB 3IN6A 4BXLA 1Y8AA 4DCKA 3H32A 3H32B 5GTIE 1RE3A 2KOGA 2XV5A 3M0AA 4OH8B 1VQMP 2Y0DA 5APSA 4PJ0H 1K9MQ 3D6ZA 2R32A 1OFCX 1GK4A 3H1JG 1SS1A 2GUVA 1FZAA 1LP1B 1LP1A 3AEEC 1SQQK 2RKLA 2Y9YA 1IC2A 2OYOA 3A7OA 2LXCB 2AEFA 3HD7D 3JSVC 3AEGC 4NPDA 1RF1A 2GM4A 1KZUB 2Y9ZA 5AVWB 2KZIA 3WMM0 5AVXB 2ZFCA 1D7MA 3KQGA 3NMDA 2OARA 3AE4C 3KYQA 2V7QH 1NTZJ 1OW7A 1LT9A 1LT9B 1N7SD 1JY3N 1OW6A 2HFED 3LW5J 1VQ9P 1KILA 1KILB 1BCCE 1PGPA 4XE5B 3D71A 4PV1C 4B86A 1HGZA 3H1LJ 4ZNCA 1FOSE 1L0LK 1RF1C 1A02J 1BGYE 1JY3O 2HR3A 3R2PA 3GG2A 4Z1MH 1NTKE 1N7SC 1RE4A 3H1KJ 1NTKG 2C0WA 3M91A 3USSA 2WSSH 2FYNC 1FZFA 2OYHC 3CI9A 5AVYB 1X8YA 2QJYB 2FXOA 1SLQA 2JR8A 1URQB 1URQA 2MJZA 5DJTB 1S4XA 2ZJSE 2BCCD 1PGQA 4HJGH 3CMEP 2FKWB 3CX5D 3H1JJ 2Z4EA 1BDDA 1SQVG 1KQLA 5KAFH 3H1KE 4GODA 2BCCG 5KLIC 3O6QA 3H1LE 2BCCE 1SQQE 3O6QB 3HRNA 1OVRA 2IPPA 1FE6A 3MP7B 1KQGB 3P8CE 1JM0A 1L4AA 1L4AB 2FY8A 3L70J 4Y99B 4H13B 1DD3A 2N1TB 2N1TA 1HJ0A 2ZT9C 3F5HA 3RK3B 3PRJA 2R5BA 4D6TD 1IK9A 3GF7A 2FXPA 2YKPA 2WPRA 5E79E 1XTCC 2JWAA 1L4AD 1UIIA 2Q1KA 3HTKA 3HTKB 2IX7C 2AXTE 3PJSK 4L74A 1LTIC 2XKMA 1FAVA 1KB9D 1N73A 1N73B 1OX3A 1SQBJ 2KXPB 2AEJA 1QVGO 2ZT9D 3L70E 5APTA 1LTJA 1LTJB 2IZ0A 3CLQA 3L70G 5KLIB 1BSHA 3HUSB 1SQQJ 3HUSA 2E75D 5AW4B 3RK2D 2P10A 3G6EP 1NH4A 2P1JA 2W90A 2YIUB 3AEAC 2M8RA 3EWKA 1EDKA 2HLOA 1LTBC 1PGJA 4Y28J 3WUTA 1GDTA 1YHQP 1SQXE 1WT6A 1BE3E 5AVQB 2QJPB 2E75B 3VMZA 1GZLA 1M1JA 1M1JB 2ZYDA 3H1JD 2M0BA 3CXHD 3L72J 1W2BO 1HBWA 1N2DC 1NU1K 1SQXD 2K88A 2KLUA 5AW7B 1CI6B 1CI6A 1ZRTD 4RESB 3QH9A 3WUUA 5AW5B 4AYCA 1NTZD 1LJ2A 3N4XA 1LTJC 2B88A 3KDPB 4RJTA 3BASA 4YTPC 3RL0B 2IBZG 2LKMA 2A06E 4I6MC 1ZRTE 1CSBA 2IBZE 3C1LA 1GK6A 1SQPD 4GT1A 1S5LH 3VMYA 2WPQA 1KORA 2NPSD 1AVYA 2QE7H 3V2PA 5KAIH 3CMAP 1H0TA 1H0TB 3U59A 3H1KD 3H1JE 3L75E 5TISE 1KD1Q 2J5UA 3A3YB 3CX5E 1H88A 2FFDB 2FFDA 4MN4C 3MHVA 1M90Q 3CC2P 3I55P 3H1HJ 2N9BA 2NPSA 1YYCA 2NPSB 1KILD 4IFMA 1VDFA 1RHZB 4JQ0D 2J58A 1Y9BA 3JCUH 2I1KA 1VQ5P 2FYNB 2L5GB 1BSNA 1WRGA 1NTMD 3FX0A 3G9RA 4HYTB 5CCHD 1DEEG 1GL2C 2B9BA 4ZKUA 4A7PA 5APYA 2C0XA 3L74G 1PPJE 2H7HA 3L74E 1DIPA 2XZRA 3EFFK 3A5TA 2YXQB 3PTZA 3BRVB 3L71E 1GTWA 2N1TD 1KFNA 5BU8B 1NAYA 1NTMK 1URQD 1RF0C 2IZ1A 1NKZB 3CCQP 2R3SA 2O01N 4IL6H 3SSUA 2D2CD 3Q5PA 1NO4A 1NTME 3A2AA 1QX8A 3CCEP 1IFMA 1GU4A 1H89A
chains in the Genus database with same CATH topology
3H1KE 1SQBE 3L72E 1SQVE 1EZVE 1SQXE 2BCCE 1BE3E 1SQQE 3H1LE 4PD4E 4U3FE 1BCCE 1PPJE 3H1HE 3L74E 1NTZE 3L73E 3L71E 1BGYE 1NTKE 3TGUE 3CXHE 2A06E 1NU1E 2FYUE 5KLVE 2IBZE 4D6TE 3BCCE 3CWBE 3L70E 1SQPE 1NTME 3H1JE 1KYOE 3L75E 1KB9E 1L0NE 1PP9E 3CX5E 1P84E 3H1IE 1L0LE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1K E;  1SQB E;  3L72 E;  1SQV E;  1EZV E;  1SQX E;  2BCC E;  1BE3 E;  1SQQ E;  3H1L E;  4PD4 E;  4U3F E;  1BCC E;  1PPJ E;  3H1H E;  3L74 E;  1NTZ E;  3L73 E;  3L71 E;  1BGY E;  1NTK E;  3TGU E;  3CXH E;  2A06 E;  1NU1 E;  2FYU E;  5KLV E;  2IBZ E;  4D6T E;  3BCC E;  3CWB E;  3L70 E;  1SQP E;  1NTM E;  3H1J E;  1KYO E;  3L75 E;  1KB9 E;  1L0N E;  1PP9 E;  3CX5 E;  1P84 E;  3H1I E;  1L0L E; 
#chains in the Genus database with same CATH topology
 2KLV A;  3MGN A;  3VYI A;  4K35 A;  2V7Q J;  2D2C B;  3I5C A;  2KUB A;  3L71 D;  1SQV E;  1EZV E;  2A45 I;  2ZVN B;  3H1K G;  3L72 E;  3RK2 B;  3RK3 D;  4C7N A;  4C7N B;  3ABV C;  1J1E B;  3H1L G;  4IL6 E;  3GW6 A;  2GUS A;  1GW4 A;  5CJ4 A;  2KSE A;  1IK7 A;  1N7L A;  4UB6 H;  1SP4 A;  1RF0 A;  2GA1 A;  3VP9 A;  1NTZ E;  1ZN5 A;  3L73 G;  4NPF X;  1AJY A;  1NTZ G;  3L73 E;  5AW8 B;  2P58 A;  5CHX A;  2OGU A;  3M0D C;  1KYO I;  3TK1 A;  1IZN B;  1X79 B;  1L0N D;  1LT1 A;  1N86 A;  2IYO A;  4W7Z A;  2KB7 P;  1VQ4 P;  3CWB G;  1JCC A;  1JB0 J;  1T3U A;  5AVS B;  1T8Z A;  4EOT A;  3RK2 C;  5APW A;  1L0N E;  3CXH I;  1P84 E;  1T6A A;  2I1J A;  1PP9 G;  1SQB K;  2R44 A;  3C8V A;  1FC2 C;  4NPE A;  4D6T J;  1T2K C;  2UWJ E;  5CCG C;  2OTK E;  4N78 D;  2E76 C;  4TLF A;  5AVR B;  3WU2 H;  4H0L D;  2ZXX A;  2PFX A;  3Q5S A;  1AVO A;  3MTU E;  1K73 Q;  1LWU A;  1LWU B;  4PD4 E;  3L73 J;  3P7K A;  2B89 A;  1S5L E;  2M3E A;  2LR2 A;  5KLV G;  1M1K Q;  2W6J H;  5KKZ C;  1MFT A;  1YIJ P;  1EQ7 A;  3RL0 D;  1S1C X;  3MD0 A;  1M56 D;  2P2U A;  4H0L B;  5AW6 B;  3H1L D;  1GMJ A;  1GU5 A;  1KN7 A;  2WSC J;  3PLN A;  1L0N J;  2WSF J;  5KJ7 C;  4ASW A;  1VQ6 P;  3TSI A;  1KV4 A;  1YJN P;  1QL1 A;  2NPS C;  5AVU B;  4UB6 E;  1VQ8 P;  3IR9 A;  2C9N Y;  3B5N D;  1KYO H;  1G2C B;  1G2C A;  2FYU G;  2IBZ D;  3AE5 C;  4K3A A;  1U7J A;  1PGO A;  3A0B H;  1IFP A;  4U3F J;  4IL6 X;  3VP8 A;  1H8A A;  3TGU D;  4HH2 A;  4EYY Q;  2OTJ P;  1Q2N A;  4PJ0 E;  1DEB A;  3V5B A;  1HF9 A;  1KB9 E;  3CCV P;  4KT0 J;  1ZR4 A;  3AE1 C;  1BCC J;  3L72 D;  4R4M A;  2Q3E A;  4W7Y A;  3C9I A;  5C39 A;  2Q9I A;  3IFM A;  3M9B A;  1SQB E;  1NYH A;  1YJW P;  1SQQ G;  1RH5 B;  3R4Y A;  1L0N K;  4XA4 A;  1YTZ I;  3BCC D;  3SFE C;  2DW3 A;  1S5L X;  3CXH H;  1PV3 A;  3O8Z A;  3BAT A;  1QEX A;  2WPS A;  3S4R A;  4AQR D;  3M06 A;  5BVZ A;  3EFG A;  1YBK A;  3SWF A;  4DT0 A;  2FBW C;  3OA7 A;  5E79 H;  1P84 D;  5L8R J;  1FJP A;  1AA0 A;  4ZMD A;  1XTG B;  3EQ2 A;  4YPC A;  2PAJ A;  1HVV A;  1IFI A;  2ZAE B;  5B66 E;  2W6B A;  3LIE A;  1L4A C;  4LGD E;  5KKZ B;  2OYI A;  1QLE D;  2OYI B;  1KTM A;  2LXB A;  3BRT B;  3OW2 O;  1K8A Q;  2QA4 P;  1SQP G;  4EI2 A;  2E5T A;  5CBN A;  4U3F D;  3MIW A;  3P8M C;  1FDM A;  3II6 A;  1J2J B;  1Q90 D;  3V6I A;  1ZME C;  3CWB D;  1OXZ A;  2ITA A;  2QJK C;  1S9K D;  1BCC D;  1HGV A;  3VN0 A;  1KYO D;  1ZV8 A;  2YKO A;  4EDF A;  2E42 A;  1FOS F;  4CPG A;  2QRX A;  3H1H E;  2XND H;  1PZQ A;  1HUC A;  1YQ3 C;  3U1C A;  3L73 D;  2YKQ A;  1NU1 J;  1SQP J;  3Q3D A;  2P67 A;  2WTY A;  2BEQ D;  1KMI Z;  2KIK A;  3L70 D;  3GF3 A;  1NWQ A;  1T3J A;  2A06 G;  2JEE A;  1FDI A;  1M7L A;  1IFJ A;  3AE9 C;  3GMA A;  4OGQ C;  2YMK A;  5BU5 A;  5K5G B;  1YI2 P;  3BVH A;  1FZC C;  3BCC E;  3L74 J;  1OZH A;  3CWB E;  3AEF C;  3A0B E;  1R5L A;  1FS0 E;  1RE4 C;  2E74 C;  2WZ7 A;  3B5N A;  3B5N B;  3M9Q A;  1VQP P;  1AFO A;  2Z5H A;  3TNU A;  3TNU B;  4PV1 D;  3CD6 P;  1KFM A;  1DD4 A;  4KJM A;  1HWT C;  4IFD K;  1NTM J;  4W80 A;  4N78 E;  3AE8 C;  2H89 C;  3V4Q A;  1SVF A;  3VOP A;  1SQQ D;  1N73 C;  1VQ7 P;  4BWN A;  2IFN A;  1NU1 D;  1SQX K;  3H6P A;  4GKG A;  3AEB C;  1HH0 A;  2IBZ I;  1RE3 C;  1Y47 A;  2K3R A;  4L75 A;  3FXE A;  1BCC G;  5APU A;  1BGY G;  5CCH A;  3Q5R A;  1SQV J;  3VTP C;  1OIP A;  2YIU C;  3TGU G;  2WIT A;  3L74 D;  4UB8 E;  3CX5 I;  3TF5 A;  1P84 H;  1OWA A;  3CX5 H;  2K37 A;  3MZW B;  1VF5 D;  4QMA A;  5APQ A;  5GTH H;  3H25 A;  1VQO P;  4GIF A;  1PPJ D;  3CCL P;  1M1J C;  1VL2 A;  1Z56 A;  2JJL A;  1NTM G;  4KHX A;  4H44 B;  5AW9 B;  4JYC A;  2N9Y B;  5KAF E;  1MZ9 A;  1RQU A;  2WWW A;  3OJA B;  1BE3 J;  1J1E C;  2WQY C;  2YO3 A;  1EC5 A;  3LW5 H;  2BAS A;  2Q6Q A;  3P32 A;  4TT3 H;  1ZR2 A;  1TU3 F;  2K1A A;  1FBM A;  3B4S A;  1P84 I;  1YJ9 P;  3L71 J;  3M9H A;  3CCU P;  2ZXE B;  1VPC A;  1BE3 D;  1NKN A;  3E1R A;  1EXI A;  2G3A A;  5KJ7 D;  1NOH A;  5GTH E;  1X0T A;  2E43 A;  1PL5 A;  1SQV K;  3JC2 2;  2J59 M;  4U7J A;  5APV A;  1JY2 O;  1WMK A;  1JY3 P;  3L37 A;  2O1K A;  2FXM A;  3FGA D;  1EXJ A;  2SPZ A;  1R5S A;  1QVF O;  1LNQ A;  1NGM B;  2I8D A;  1URQ C;  2QSI A;  3HE4 A;  3HE4 B;  4JBZ A;  1BGY D;  2CK3 H;  1R8E A;  2Q3I A;  3AE6 C;  3S9O A;  3CCS P;  1W2E A;  3KZI E;  3U1A A;  1GD2 E;  2QG4 A;  1NTK J;  1JY2 N;  1GL2 B;  1GL2 A;  1K04 A;  1L0N G;  3F89 A;  3V4W A;  3G71 P;  3CCR P;  1PP9 E;  5CCH C;  2CPS A;  3FWL A;  4I1L A;  1L0L D;  2AXT H;  2JWD A;  3H1I G;  4DZO A;  1HJB A;  3D6Y A;  2WMM A;  1JUN A;  2M3B A;  1UIX A;  3M0D A;  2O1J A;  3K5B A;  4DJG A;  3I56 P;  2HOD B;  2HOD A;  2FFD C;  2PRR A;  2O3J A;  2XNX A;  5AVT B;  2JP3 A;  4YXD C;  2K9J B;  2K9J A;  4H44 C;  2NRG A;  2WSE H;  3L36 A;  5GTI H;  1CW5 A;  1SFC D;  3D70 A;  3H1H G;  3L35 A;  3W68 A;  3Q2Y A;  1PFI A;  1AQ5 A;  1ZW0 A;  1ZXG A;  3ZDM A;  1JNM A;  2XDJ A;  2E76 B;  1OW8 A;  1PIX A;  2OQQ A;  3GHG B;  1OVV A;  1E79 H;  4RKU J;  2PGD A;  3A0H H;  1SFC B;  1SFC A;  2FYU E;  4LC1 A;  4HKZ H;  4OGQ D;  3TYY A;  3KHU A;  2AXC A;  1VQL P;  3H1I J;  3HD7 A;  3HD7 B;  2O01 H;  3BCC G;  5AW3 B;  1LT9 C;  2JKV A;  3E7K A;  4R4L A;  5KLV K;  2W27 A;  3L75 G;  2RN0 A;  4PD4 I;  1VF5 B;  2RH0 A;  1BDC A;  1YIT P;  3N7N A;  5CBO A;  2QJP C;  3A0H E;  4OGQ B;  1Q86 Q;  1FZC A;  1FZC B;  1FZE A;  1EZV D;  1L2P A;  2VRS A;  3RK3 E;  2B87 A;  2B87 B;  3TDK A;  1IO4 A;  1N7S B;  1N7S A;  2E74 B;  2KYV A;  3CC7 P;  4U3F G;  3B5N C;  3GHG C;  2K9Y A;  1J1D C;  2XU6 A;  1NHL A;  2KP8 A;  2KS1 A;  2KS1 B;  4HB1 A;  4U3F E;  5B66 H;  1EDL A;  1IJD B;  2FYU D;  1U57 A;  3L4F A;  2L91 A;  2O01 J;  2E74 D;  5M1B A;  2P7J A;  3IF4 A;  5AVV B;  1SQX J;  1USE A;  1NJI Q;  1SQB D;  3KPE A;  3RGU A;  5B5E E;  1M57 D;  1DH3 A;  2KI7 B;  3L71 G;  2QIW A;  3TGU E;  5KTB A;  1HTL C;  3G4S P;  1KIL C;  3CXH E;  2KNC A;  1NU1 E;  2CPB A;  2KNC B;  4I7Z C;  3WUV A;  1LWU C;  1EDI A;  1X22 A;  2BCC J;  4D6T E;  1PP9 J;  2WSF H;  4D6T G;  1E5W A;  2WSC H;  5CCG D;  1FZB A;  3E1I A;  1LTG C;  2JO1 A;  2M5A B;  2M5A A;  2WVR A;  1SQP E;  4Y99 C;  2E5Y A;  2V4H A;  3T97 B;  3T97 A;  1J1D B;  1NAF A;  1FDO A;  2POH A;  3AEC C;  4L73 A;  5KLV J;  2FYZ A;  1FZG A;  5KJ7 A;  1JCD A;  1PP9 D;  3IAO A;  3LID A;  1KIL E;  1M8O B;  3L72 G;  1ZP0 C;  3SFD C;  3CCJ P;  1Q82 Q;  3CWB J;  3PP5 A;  1EZV G;  1N8R Q;  4PD4 D;  1SQP K;  5AW2 B;  3VMX A;  2YXR B;  2OTL P;  2KK7 A;  3TGU J;  4DOJ A;  4ZKP A;  1LTS C;  1EZV I;  4I7Z B;  2IDB A;  2Y0C A;  3FWN A;  3B71 A;  4IFF A;  5AVZ B;  2HYN A;  1L0L J;  1AV1 A;  2QVA A;  2G8Y A;  4GOE A;  3RBZ A;  1GW3 A;  1OVU A;  2FYU J;  2R3C A;  3QWO C;  4C7R A;  5B5E H;  2WT7 A;  4OVN F;  2WT7 B;  1S72 P;  1IFD A;  1NVO A;  4M3L A;  4WWI A;  4IOI H;  2ZT9 B;  1NTZ K;  2QJK B;  4WBA A;  1X9V A;  2MKV A;  3AE3 C;  4GDO A;  1W5C E;  3RK3 C;  5KLV E;  3H1H D;  2E75 C;  4O9B A;  2IFM A;  4N3Y B;  4RO0 A;  1JTH B;  1JTH A;  1JMM A;  1JEK A;  4XFJ A;  5H2F E;  4EIJ A;  1S2E A;  2A45 G;  5AW0 B;  2Q7C A;  3W67 A;  3WU2 E;  1A02 F;  1NTK K;  4LLH A;  2W8Z A;  2A06 D;  5KLV D;  1S9K E;  3GLM A;  1K05 A;  1L0L E;  1KQF B;  1YQ4 C;  1L0L G;  3H1I D;  4YXW H;  1OMI A;  2QEX P;  2RMZ A;  1DX7 A;  2HG5 D;  4PV1 B;  5H2F H;  3PHL A;  3BCC J;  4GOF A;  4JF7 A;  1SQX G;  3L75 J;  3CC4 P;  2E76 D;  1SQV D;  3HD7 C;  1VQK P;  2ZVO B;  3V2R A;  2Q5U A;  4WB4 A;  3CPW O;  1JMB A;  2BEZ F;  2FYU K;  1LGH B;  3SWY A;  3L75 D;  3MUD C;  3UIA A;  3S1K A;  3NTN A;  1ZOY C;  1JOC A;  2C9L Y;  4I2L C;  3AE2 C;  1G1J A;  3FXD A;  1U7M A;  1KB9 H;  2KZJ A;  3NXS A;  5DJU B;  5TJH A;  3SWK A;  3OAK A;  3KXD A;  4OWF A;  4WY4 A;  4WY4 B;  2WPV B;  3RBX A;  3V2N A;  5CMZ A;  4WVZ A;  1Q81 Q;  4AUW A;  1AQT A;  1EDJ A;  2H43 A;  1KYO E;  2H88 C;  3V2Q A;  2W6A A;  1IFN A;  1SFC C;  2AEM A;  3AED C;  2PP6 A;  4C46 A;  3AE7 C;  1KC8 Q;  2IYP A;  4WY4 D;  3HE5 B;  3HE5 A;  4H44 D;  2NZ2 A;  4H13 C;  3CL3 D;  3RL0 g;  3GHG A;  4H0L C;  1YTZ T;  1RQV A;  1KB9 I;  1S3J A;  1VF5 C;  2A45 H;  1SQB G;  1JY2 P;  1T2K D;  3KZI H;  2HPC A;  2HPC B;  2ZYA A;  1QL2 A;  3CCM P;  3B8E B;  1LTT C;  4PD4 H;  1LTA C;  5APX A;  1RF1 B;  1PPJ G;  1MFZ A;  3PH0 A;  4ASV A;  3ITK A;  5CCG A;  2JDI H;  4N6J A;  3VMA A;  1ZLL A;  2QM8 A;  2Y0E A;  3HUS C;  1G1I A;  4JYB A;  5AW1 B;  1BGY J;  4BRY A;  4BRY B;  1NU1 G;  3JCU E;  2N1T C;  2ZYG A;  1CZQ A;  2WSE J;  1JO5 A;  2YO2 A;  3H1I E;  4L76 A;  2H8P D;  3MUD A;  1GL2 D;  1NTK D;  5TIS H;  1KQS O;  3G3Z A;  2Z5I A;  3NFQ A;  1BE3 G;  3P8C D;  4H13 D;  1RY3 A;  1VQN P;  4WY4 C;  5KAI E;  3Q1M A;  2OYH A;  1Q7Y Q;  2OYI C;  2OYH B;  1FJK A;  1MKM A;  1MUU A;  1USD A;  2YNY A;  2R5D A;  1QGK B;  2QJY C;  2QM7 A;  3RL0 C;  2D2C C;  2KSJ A;  4UB8 H;  2W83 C;  5EFW B;  1MV8 A;  2YMY A;  5CJ0 A;  1FU1 A;  4JPZ B;  3IN6 A;  4BXL A;  1Y8A A;  4DCK A;  3H32 A;  3H32 B;  5GTI E;  1RE3 A;  2KOG A;  2XV5 A;  3M0A A;  4OH8 B;  1VQM P;  2Y0D A;  5APS A;  4PJ0 H;  1K9M Q;  3D6Z A;  2R32 A;  1OFC X;  1GK4 A;  3H1J G;  1SS1 A;  2GUV A;  1FZA A;  1LP1 B;  1LP1 A;  3AEE C;  1SQQ K;  2RKL A;  2Y9Y A;  1IC2 A;  2OYO A;  3A7O A;  2LXC B;  2AEF A;  3HD7 D;  3JSV C;  3AEG C;  4NPD A;  1RF1 A;  2GM4 A;  1KZU B;  2Y9Z A;  5AVW B;  2KZI A;  3WMM 0;  5AVX B;  2ZFC A;  1D7M A;  3KQG A;  3NMD A;  2OAR A;  3AE4 C;  3KYQ A;  2V7Q H;  1NTZ J;  1OW7 A;  1LT9 A;  1LT9 B;  1N7S D;  1JY3 N;  1OW6 A;  2HFE D;  3LW5 J;  1VQ9 P;  1KIL A;  1KIL B;  1BCC E;  1PGP A;  4XE5 B;  3D71 A;  4PV1 C;  4B86 A;  1HGZ A;  3H1L J;  4ZNC A;  1FOS E;  1L0L K;  1RF1 C;  1A02 J;  1BGY E;  1JY3 O;  2HR3 A;  3R2P A;  3GG2 A;  4Z1M H;  1NTK E;  1N7S C;  1RE4 A;  3H1K J;  1NTK G;  2C0W A;  3M91 A;  3USS A;  2WSS H;  2FYN C;  1FZF A;  2OYH C;  3CI9 A;  5AVY B;  1X8Y A;  2QJY B;  2FXO A;  1SLQ A;  2JR8 A;  1URQ B;  1URQ A;  2MJZ A;  5DJT B;  1S4X A;  2ZJS E;  2BCC D;  1PGQ A;  4HJG H;  3CME P;  2FKW B;  3CX5 D;  3H1J J;  2Z4E A;  1BDD A;  1SQV G;  1KQL A;  5KAF H;  3H1K E;  4GOD A;  2BCC G;  5KLI C;  3O6Q A;  3H1L E;  2BCC E;  1SQQ E;  3O6Q B;  3HRN A;  1OVR A;  2IPP A;  1FE6 A;  3MP7 B;  1KQG B;  3P8C E;  1JM0 A;  1L4A A;  1L4A B;  2FY8 A;  3L70 J;  4Y99 B;  4H13 B;  1DD3 A;  2N1T B;  2N1T A;  1HJ0 A;  2ZT9 C;  3F5H A;  3RK3 B;  3PRJ A;  2R5B A;  4D6T D;  1IK9 A;  3GF7 A;  2FXP A;  2YKP A;  2WPR A;  5E79 E;  1XTC C;  2JWA A;  1L4A D;  1UII A;  2Q1K A;  3HTK A;  3HTK B;  2IX7 C;  2AXT E;  3PJS K;  4L74 A;  1LTI C;  2XKM A;  1FAV A;  1KB9 D;  1N73 A;  1N73 B;  1OX3 A;  1SQB J;  2KXP B;  2AEJ A;  1QVG O;  2ZT9 D;  3L70 E;  5APT A;  1LTJ A;  1LTJ B;  2IZ0 A;  3CLQ A;  3L70 G;  5KLI B;  1BSH A;  3HUS B;  1SQQ J;  3HUS A;  2E75 D;  5AW4 B;  3RK2 D;  2P10 A;  3G6E P;  1NH4 A;  2P1J A;  2W90 A;  2YIU B;  3AEA C;  2M8R A;  3EWK A;  1EDK A;  2HLO A;  1LTB C;  1PGJ A;  4Y28 J;  3WUT A;  1GDT A;  1YHQ P;  1SQX E;  1WT6 A;  1BE3 E;  5AVQ B;  2QJP B;  2E75 B;  3VMZ A;  1GZL A;  1M1J A;  1M1J B;  2ZYD A;  3H1J D;  2M0B A;  3CXH D;  3L72 J;  1W2B O;  1HBW A;  1N2D C;  1NU1 K;  1SQX D;  2K88 A;  2KLU A;  5AW7 B;  1CI6 B;  1CI6 A;  1ZRT D;  4RES B;  3QH9 A;  3WUU A;  5AW5 B;  4AYC A;  1NTZ D;  1LJ2 A;  3N4X A;  1LTJ C;  2B88 A;  3KDP B;  4RJT A;  3BAS A;  4YTP C;  3RL0 B;  2IBZ G;  2LKM A;  2A06 E;  4I6M C;  1ZRT E;  1CSB A;  2IBZ E;  3C1L A;  1GK6 A;  1SQP D;  4GT1 A;  1S5L H;  3VMY A;  2WPQ A;  1KOR A;  2NPS D;  1AVY A;  2QE7 H;  3V2P A;  5KAI H;  3CMA P;  1H0T A;  1H0T B;  3U59 A;  3H1K D;  3H1J E;  3L75 E;  5TIS E;  1KD1 Q;  2J5U A;  3A3Y B;  3CX5 E;  1H88 A;  2FFD B;  2FFD A;  4MN4 C;  3MHV A;  1M90 Q;  3CC2 P;  3I55 P;  3H1H J;  2N9B A;  2NPS A;  1YYC A;  2NPS B;  1KIL D;  4IFM A;  1VDF A;  1RHZ B;  4JQ0 D;  2J58 A;  1Y9B A;  3JCU H;  2I1K A;  1VQ5 P;  2FYN B;  2L5G B;  1BSN A;  1WRG A;  1NTM D;  3FX0 A;  3G9R A;  4HYT B;  5CCH D;  1DEE G;  1GL2 C;  2B9B A;  4ZKU A;  4A7P A;  5APY A;  2C0X A;  3L74 G;  1PPJ E;  2H7H A;  3L74 E;  1DIP A;  2XZR A;  3EFF K;  3A5T A;  2YXQ B;  3PTZ A;  3BRV B;  3L71 E;  1GTW A;  2N1T D;  1KFN A;  5BU8 B;  1NAY A;  1NTM K;  1URQ D;  1RF0 C;  2IZ1 A;  1NKZ B;  3CCQ P;  2R3S A;  2O01 N;  4IL6 H;  3SSU A;  2D2C D;  3Q5P A;  1NO4 A;  1NTM E;  3A2A A;  1QX8 A;  3CCE P;  1IFM A;  1GU4 A;  1H89 A; 
#chains in the Genus database with same CATH homology
 3H1K E;  1SQB E;  3L72 E;  1SQV E;  1EZV E;  1SQX E;  2BCC E;  1BE3 E;  1SQQ E;  3H1L E;  4PD4 E;  4U3F E;  1BCC E;  1PPJ E;  3H1H E;  3L74 E;  1NTZ E;  3L73 E;  3L71 E;  1BGY E;  1NTK E;  3TGU E;  3CXH E;  2A06 E;  1NU1 E;  2FYU E;  5KLV E;  2IBZ E;  4D6T E;  3BCC E;  3CWB E;  3L70 E;  1SQP E;  1NTM E;  3H1J E;  1KYO E;  3L75 E;  1KB9 E;  1L0N E;  1PP9 E;  3CX5 E;  1P84 E;  3H1I E;  1L0L E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...