4WBAA

Q/e mutant sa11 nsp4_ccd
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
42
structure length
42
Chain Sequence
IEKQMDRVVKEMRRQLEMIDKLTTRAIEAVELLKRIYDKLTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Plasticity of the Coiled-Coil Domain of Rotavirus NSP4.
pubmed doi rcsb
source organism Simian rotavirus a/sa11
molecule tags Viral protein
molecule keywords Non-structural glycoprotein NSP4
total genus 19
structure length 42
sequence length 42
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.430 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wbaA00
4HH2A 2O1JA 4WBAA 4WB4A 4C7RA 4LLHA 2WITA 2L5GB 3CI9A 4DOJA 3MIWA 1G1JA 2O1KA 1G1IA
chains in the Genus database with same CATH superfamily
3BRVB 2WPSA 3I5CA 1ZR2A 2OYHC 1JB0J 2FBWC 2POHA 4OWFA 1JMMA 1RE3A 4C7RA 4GKGA 1WRGA 1SQQK 5AVUB 4AUWA 4H0LC 2V7QJ 2YXRB 1BCCJ 2A06G 1G1IA 2E76B 2FYNB 1LGHB 2ZVNB 1VF5C 1KZUB 1SFCD 3L74J 3I56P 5KLVJ 1YI2P 3KXDA 1OW6A 3L35A 1BE3E 1FDIA 1Q2NA 4EOTA 2M3BA 3BRTB 1JY2O 2L5GB 3HD7C 3CWBG 5CJ0A 3VYIA 2MJZA 3CCMP 2YKOA 3TGUG 2H89C 3TDKA 2HLOA 2VRSA 3HTKA 1WT6A 1ZRTD 3EWKA 2W83C 1ZRTE 1X8YA 3V2QA 2ZT9D 2PGDA 2MKVA 4U3FE 3AE5C 3AEBC 2NPSB 1P84H 3L75D 1SQQD 3RK3C 2ZVOB 3JSVC 1NJIQ 4OGQC 1SQQE 4U7JA 3CCRP 1EXJA 1MFTA 2FY8A 1RE4C 4C46A 5CBOA 1BCCD 3KHUA 1M1JA 3CWBE 1SS1A 2J58A 1BCCE 3NTNA 3CCEP 2H43A 4JYCA 1NU1K 2WPQA 2R44A 3OJAB 2KB7P 4H44C 1NTMK 4GT1A 2JWDA 1M8OB 1OXZA 2M3EA 4UB8H 1SFCC 1S72P 3HUSA 3PJSK 5AW0B 3VP9A 5CCGD 1H8AA 1ZW0A 4I2LC 1Q82Q 2IBZD 2R3CA 2FFDB 3S9OA 2YO2A 1S5LH 1T3JA 2OYOA 5CCGA 1Q86Q 2WPRA 2QJPC 4N78E 3ZDMA 1OFCX 2OGUA 5GTHE 3V4QA 1LTTC 2N1TD 3B5ND 3GF7A 2FXOA 1IFNA 5AVWB 1KB9D 2N9BA 1EZVG 1SQBD 3L4FA 3KZIE 4LLHA 3MTUE 1KQGB 3A3YB 1HUCA 2BASA 4CPGA 4WY4D 3CWBJ 1PZQA 1QL2A 1RHZB 2E75B 3E1IA 3IR9A 3L74D 2M8RA 1SQQG 3L72D 1S4XA 3H1JG 2AEMA 1LWUC 5B5EH 1AVYA 5CCHA 1OIPA 5KJ7A 1L4AC 2FYUK 2Q3EA 2WSEJ 1LTIC 3H32A 3PH0A 1EZVE 4XFJA 3H6PA 1QLED 3E1RA 2E5YA 2W27A 1LJ2A 3IAOA 3Q1MA 3GLMA 1GD2E 4HKZH 4EI2A 1CI6A 1FZCC 3L75J 1U7MA 3PLNA 1EDJA 5KKZC 1FZBA 3D71A 2SPZA 3B71A 2RKLA 3RL0B 3WMM0 1E79H 2C0WA 3CXHD 2JEEA 4BWNA 3W68A 5KLIB 2YIUC 2HFED 1YHQP 1K73Q 5AW6B 2M0BA 2A45H 4DOJA 1N73C 4XA4A 1Q90D 1EXIA 3AE2C 1FC2C 3H1IJ 4ZKUA 1LNQA 5AW4B 3O6QA 1URQC 3GG2A 1HJ0A 2XNXA 1RE4A 2WVRA 1GL2B 1PPJD 1M1JC 3OW2O 1M57D 1KQLA 1N7LA 1PPJE 2NPSD 2RMZA 5CHXA 1KB9I 5CCHD 1N8RQ 1M1KQ 1UIIA 2WT7A 2I1KA 1NYHA 3E7KA 5CMZA 2HODA 4NPFX 1R5LA 3L75E 3P7KA 3EQ2A 3M9BA 2B89A 3P32A 3L71G 2G8YA 1OW7A 2KUBA 4YPCA 1SQPG 2E74C 3MP7B 2N9YB 2E76C 1J1EC 1N86A 1NH4A 1PL5A 2IZ1A 2N1TA 2YMKA 3A0HE 3B5NA 4NPDA 3CCJP 2ZJSE 1SVFA 3G3ZA 4IOIH 2W6BA 3CX5E 3HD7B 2FXPA 3Q2YA 3L70G 2KNCA 3RK3E 1GL2A 1K04A 2FYUD 4L74A 4DJGA 1MV8A 2GUSA 3P8MC 1HTLC 1L0NG 1NTME 3LW5H 3QWOC 4KT0J 4W7ZA 1Y9BA 1NU1E 4XE5B 5KAFE 1KYOE 1AVOA 1P84E 1LWUA 1SQVJ 2IDBA 2JO1A 1KYOD 1BGYG 1GW4A 4OGQB 4I7ZC 1LP1B 5CCHC 1R8EA 1RF1B 2Q1KA 1VQKP 3H1LE 5DJTB 4H0LD 3UIAA 1SLQA 2QM7A 2D2CC 1S1CX 1AA0A 3FXEA 3K5BA 4D6TJ 1ZMEC 3AE8C 4TT3H 2P10A 1BDCA 2QRXA 3A0HH 4H44B 2KIKA 3BASA 1YBKA 3HUSB 4O9BA 4WY4B 1JY2P 3KPEA 1SQXG 4IFDK 1NKZB 1JEKA 2FYZA 1VDFA 2KS1B 3JCUE 1ZN5A 1YTZT 3L73J 3AE7C 1KILC 3M9HA 3V2RA 3P8CD 4PJ0H 1IK7A 2G3AA 3CMAP 2C9LY 3OA7A 3D6YA 1LTJB 1VQOP 1LT9B 1BSNA 1OMIA 2O1JA 3H1HE 2XV5A 3LIEA 1YIJP 2P67A 1PGOA 1J1DC 1L0NE 1FS0E 1PIXA 2CPBA 1URQA 1EC5A 1AV1A 1L0ND 2JP3A 2KNCB 3CXHE 3BCCJ 3LIDA 1KN7A 3G9RA 4UB6E 3GF3A 1NTZE 1N7SC 5EFWB 2W6AA 1NTZD 1CSBA 1IFDA 2AXTE 2OQQA 1ZV8A 2AEFA 3M0DA 2E75D 2ZFCA 1R5SA 1PP9G 3CCSP 3U1CA 1VQ6P 3H1HG 5GTIE 1K9MQ 3CC4P 2WPVB 1LTAC 1S9KE 1IO4A 4K35A 1GU5A 1SQPE 2FYUJ 3CXHH 3MZWB 1L0LG 4BRYB 4HJGH 1OWAA 1SQPD 1JO5A 1VQ7P 2XU6A 1OX3A 1A02J 1SQXE 1HWTC 2N1TC 3ABVC 3B5NC 4WB4A 1FZCB 4NPEA 1HGZA 2K1AA 2KZIA 2OYIC 1KILE 3SWFA 3AE4C 2JJLA 2V7QH 2BCCD 1IJDB 5H2FH 4ASVA 1EQ7A 1S2EA 2W90A 1HBWA 1L2PA 2BEQD 4ZKPA 2ZYGA 4RKUJ 1L0LE 2KP8A 3N7NA 1H88A 4OVNF 2RH0A 2NPSA 4L75A 1X22A 5B66E 5AVSB 1N7SD 2IYOA 3CX5D 4GOFA 3C9IA 2H88C 5TJHA 2A06D 3FXDA 4JPZB 4EYYQ 2IBZE 2A06E 5KAIE 1SQPJ 2FYUE 4H13C 3CCUP 1VQ5P 1NTMD 3F89A 2K9JB 5BU5A 1KB9H 1NTKG 2P58A 2H8PD 4PD4H 4R4MA 4AYCA 1YTZI 2JKVA 1KB9E 2R3SA 4C7NB 3H1LD 1YITP 1RY3A 3O8ZA 4GDOA 5AVQB 3L73D 1J1EB 1KILA 4B86A 1FDMA 5AVXB 3RK3D 1YQ3C 5KLVD 2HG5D 3S1KA 1GMJA 1H89A 2YXQB 5KLVG 3WUTA 2YMYA 1HGVA 5APYA 3C1LA 1SQQJ 1LTSC 5DJUB 1SQPK 1VPCA 1FAVA 3L74G 1KQSO 2QJKB 1M7LA 1ZLLA 1MZ9A 1MKMA 3SWKA 4H13D 1NTKK 1BGYJ 2E42A 1SFCA 1NTZK 4IFMA 4OH8B 3WU2E 2YNYA 3W67A 1USEA 4WVZA 2O01H 2WWWA 4UB8E 1FU1A 2WSSH 3RK2B 2W8ZA 4Y99C 4HYTB 2WSFH 4GIFA 1JNMA 1DD4A 3RK3B 3HE4A 4WY4C 1QVGO 3MHVA 1NWQA 2CPSA 1AJYA 2UWJE 1BE3D 4YTPC 2GA1A 3T97B 5BVZA 1GTWA 4UB6H 1KILB 2IFMA 2WQYC 3H1KG 2E43A 1NTKJ 5KAIH 3Q3DA 1LTBC 1LTJA 1LT9C 2YKQA 3L71J 3AECC 4ASWA 4I6MC 1JCCA 3TYYA 5KJ7C 2Y9ZA 1T8ZA 1A02F 2XDJA 2CK3H 4EIJA 3G71P 2Z4EA 4H44D 2KOGA 2D2CD 1NAFA 3SSUA 2FFDC 1FOSF 3CPWO 3L36A 1M56D 1N7SB 1NO4A 3B4SA 2AXTH 3CWBD 2KXPB 2JWAA 3AE6C 1KORA 3H1KE 3M0AA 3RK2D 4LC1A 5BU8B 1FZCA 3ITKA 1VQNP 5AW1B 3A5TA 1H0TB 1FZAA 2KSJA 5KLVK 1NKNA 1PGJA 1BGYE 3MUDC 1HF9A 3HE5A 2HR3A 3CLQA 5AW5B 2B9BA 2KLUA 3CCQP 5TISE 1PP9E 3BCCD 1N73A 1L0NJ 2N1TB 3B5NB 2FYUG 1YJNP 1IFIA 1NU1D 2OYIB 2QJYB 3H1IE 3B8EB 1SQVE 1GL2D 3H1ID 3HE4B 3L37A 3L70J 4DCKA 1LP1A 1L4AB 1NU1J 3GW6A 2IYPA 1YJ9P 3L73E 2WSCJ 4PV1D 1RQUA 3GHGB 2NPSC 3VTPC 2IZ0A 2OYHB 1CW5A 1KMIZ 3KDPB 3L72E 4U3FG 2E76D 1GK6A 1FBMA 1QL1A 3L71E 2HYNA 3RL0C 3V5BA 5APQA 4D6TG 3FX0A 2Y0EA 4H0LB 3HE5B 4H13B 4KJMA 2YIUB 5AVZB 2FYNC 2R32A 4U3FD 1VF5B 1JMBA 2OTKE 3GMAA 5APTA 5GTHH 3C8VA 4WBAA 2M5AA 2IFNA 1PPJG 3L73G 3MD0A 3V2PA 1VQPP 2ZT9C 4PD4I 4MN4C 4WY4A 4ZMDA 5AVRB 2KYVA 4U3FJ 2I1JA 3H1IG 1YJWP 1GL2C 1VL2A 1NTKE 3CI9A 3M06A 5E79E 1N2DC 1LT9A 5AW9B 1NU1G 1PV3A 5GTIH 4L76A 5C39A 1HH0A 2R5DA 1W2BO 1RE3C 1IFMA 1PFIA 1VQMP 5H2FE 2QJKC 2LXCB 1MUUA 4N78D 1UIXA 3M9QA 1DEEG 4PD4E 1NHLA 5KLIC 1S9KD 1K05A 3VMZA 2BEZF 2ZYDA 2K37A 4JF7A 1SQBE 4N6JA 2WITA 1X9VA 3TSIA 1K8AQ 2JDIH 1NVOA 2R5BA 1BE3J 1EDIA 4Y28J 3AE9C 3HD7A 3KYQA 1FZEA 1KILD 5AW8B 1KD1Q 1HJBA 1AFOA 1GZLA 4BRYA 1QX8A 1JY3P 3HD7D 1VQ8P 2GM4A 4BXLA 4R4LA 4Y99B 1T6AA 1ZP0C 2QJPB 3PHLA 4A7PA 2C9NY 1L0LD 2KZJA 2B87B 3H1KD 2WSCH 3A0BE 1SQXK 3TNUA 3D6ZA 2QE7H 1AQ5A 3PTZA 3IN6A 4WWIA 1BE3G 3MIWA 5CBNA 1BGYD 1TU3F 2L91A 1U7JA 2V4HA 4OGQD 3VMAA 2E75C 2FKWB 3CX5I 1T2KC 3RL0D 1S5LX 3F5HA 3KZIH 3M0DC 1L0LK 1JTHA 3OAKA 4AQRD 1JY3N 1VQLP 1YYCA 2WMMA 3L70E 4HH2A 3HUSC 4PJ0E 3NXSA 2ITAA 3L70D 3RGUA 1YQ4C 4IFFA 5AW3B 1IK9A 2WZ7A 2LKMA 1OVRA 3AEDC 3V4WA 4IL6H 5CCGC 3VN0A 5B5EE 2E5TA 3II6A 2J5UA 1LT1A 1SQXJ 1WMKA 2Q7CA 4L73A 2O01J 1BCCG 1FDOA 5APWA 1GU4A 2PP6A 1JUNA 2A45G 1XTGB 4DZOA 1J1DB 2QSIA 2ZXEB 3L71D 4JQ0D 3L75G 4PV1B 5L8RJ 1EZVI 1KQFB 3WU2H 2KS1A 2DW3A 1E5WA 5KLVE 1KC8Q 1DIPA 1D7MA 1ZOYC 1OVVA 4I1LA 1JY2N 1KYOH 2Y9YA 2ZXXA 3IF4A 4IL6X 2QJYC 1SQBJ 1NOHA 3M91A 1T2KD 1NAYA 2OTJP 3TGUE 1AQTA 1S5LE 1HVVA 1L4AA 2JR8A 1URQB 3AEAC 3CXHI 3H1LG 4RJTA 1JOCA 5APUA 2NZ2A 1FZGA 2Q9IA 1M1JB 5AW7B 5M1BA 5K5GB 1SQVK 1USDA 2E74D 2QG4A 1G2CA 2OARA 3A7OA 1IFPA 1JY3O 1NTKD 3GHGC 1CZQA 3EFFK 2WSEH 2WT7B 3NMDA 1ZR4A 1NTMG 2HODB 2ZYAA 1RQVA 2Y0CA 5APXA 2BCCJ 3A0BH 4IL6E 5KTBA 3BVHA 3BCCG 3I55P 1MFZA 2Z5HA 2LXBA 3FWNA 2E74B 3CC7P 3MGNA 3T97A 1GDTA 2Z5IA 1VQ9P 3AEGC 1BSHA 3G6EP 3R2PA 4LGDE 3WUUA 3CCVP 1Q81Q 2ZT9B 1PGQA 4GODA 3KQGA 1JM0A 1IZNB 5AVYB 4RESB 2QEXP 2BCCG 1FJPA 1RF1A 3Q5RA 3H1JE 4JBZA 3V2NA 5B66H 3H1JD 3CMEP 3CL3D 1SP4A 1S3JA 2K9YA 1CI6B 2HPCA 5APVA 2C0XA 4I7ZB 3Q5SA 1OVUA 1JCDA 1OW8A 3FWLA 2P1JA 3HRNA 1T3UA 3AEFC 1EZVD 1SQBG 5E79H 3H32B 2W6JH 3P8CE 2D2CB 1U57A 4KHXA 5AVTB 1DEBA 3SWYA 3U1AA 1KV4A 1RF0C 3H1HD 3S4RA 3USSA 4DT0A 2XKMA 1NTZG 1KFNA 1PP9D 1XTCC 3BCCE 3FGAD 1P84I 4ZNCA 3TNUB 2IBZG 1PP9J 1SQVD 1EDKA 2J59M 2YO3A 2O1KA 3QH9A 4M3LA 2IPPA 3H1HJ 3TGUJ 3L72J 3VMYA 1RF1C 3IFMA 1DH3A 1NTMJ 2Q3IA 4W80A 3SFEC 1LTJC 2O01N 4W7YA 3AE1C 5KJ7D 1G1JA 2B87A 1JTHB 2K88A 2KSEA 2PAJA 2Q5UA 5APSA 1X79B 3TF5A 2OYHA 3A2AA 1SFCB 3O6QB 1GW3A 3WUVA 1Q7YQ 2Y0DA 2KK7A 2PFXA 1L4AD 1Y47A 3VP8A 4K3AA 2B88A 2FFDA 4HB1A 2YKPA 1SQXD 4YXDC 3L72G 3GHGA 3RK2C 2QVAA 2FXMA 4RO0A 1KFMA 2I8DA 2WSFJ 1FE6A 3EFGA 4QMAA 3RL0g 3SFDC 5KAFH 1BDDA 3JCUH 2BCCE 2LR2A 3BATA 1L0LJ 3TGUD 3CC2P 2OTLP 2NRGA 4TLFA 3Q5PA 1FZFA 4N3YB 1NGMB 3CD6P 3MUDA 5AVVB 3V6IA 2K3RA 1QEXA 2AEJA 3H1JJ 3PP5A 3PRJA 3RBXA 1QGKB 1IFJA 2IX7C 1SQBK 2WTYA 2RN0A 5AW2B 2M5AB 3AE3C 3VOPA 1FOSE 3D70A 1LWUB 3NFQA 4EDFA 1SQVG 4Z1MH 2KI7B 1M90Q 1X0TA 4PV1C 1URQD 1RH5B 1OZHA 4PD4D 1KYOI 1NTZJ 1FJKA 1N7SA 2KLVA 1DX7A 2K9JA 1QVFO 1IC2A 3H1LJ 1EDLA 1P84D 2QM8A 2GUVA 2Q6QA 2XNDH 3TK1A 3R4YA 2O3JA 5TISH 5KKZB 1Z56A 2P2UA 3U59A 1LTGC 3N4XA 1VF5D 2AXCA 4C7NA 2PRRA 3CX5H 3H25A 2P7JA 3H1KJ 3HTKB 4D6TE 4YXWH 1L0NK 2HPCB 1G2CB 1RF0A 1DD3A 2QIWA 3L74E 4D6TD 5CJ4A 1N73B 1H0TA 4JYBA 3LW5J 2OYIA 1J2JB 1Y8AA 2ZAEB 2QA4P 3AEEC 3VMXA 2A45I 1KTMA 1VQ4P 2IBZI 3JC22 1ZXGA 1PGPA 3CCLP 3RBZA 3G4SP 2H7HA 1W2EA 1GK4A 4GOEA 1W5CE 2XZRA
chains in the Genus database with same CATH topology
3BRVB 2WPSA 3I5CA 1ZR2A 2OYHC 2POHA 4C7RA 1JMMA 1RE3A 4GKGA 1WRGA 1SQQK 5AVUB 4AUWA 2HPCA 1G1IA 1LGHB 1KZUB 1SFCD 3L35A 4EOTA 2M3BA 3BRTB 1JY2O 2L5GB 3HD7C 5CJ0A 3VYIA 2H7HA 2MJZA 2YKOA 3HTKA 2HLOA 2VRSA 1WT6A 1X8YA 3V2QA 2NPSB 3RK3C 1RE4C 4C46A 1M1JA 2J58A 3NTNA 2H43A 4JYCA 1NU1K 2WPQA 3OJAB 2KB7P 1FZFA 1NTMK 4GT1A 1OXZA 1SFCC 3HUSA 5AW0B 3VP9A 5CCGD 1H8AA 4I2LC 2R3CA 2FFDB 2YO2A 1T3JA 5CCGA 2WPRA 4N78E 3V4QA 1LTTC 2N1TD 3B5ND 1IFNA 5AVWB 2N9BA 3L4FA 4LLHA 3MTUE 3A3YB 1HUCA 2BASA 4WY4D 3IR9A 1QL2A 3E1IA 2M8RA 1LWUC 5CCHA 5KJ7A 1L4AC 2FYUK 1LTIC 3H32A 3H6PA 2W27A 1GD2E 1CI6A 1FZCC 1FZBA 3RL0B 3WMM0 2C0WA 2JEEA 2HFED 5AW6B 2A45H 4DOJA 1N73C 4XA4A 4ZKUA 5AW4B 1URQC 2XNXA 1RE4A 1GL2B 1M1JC 1KQLA 1N7LA 2NPSD 5CHXA 5CCHD 2WT7A 2I1KA 5CMZA 2HODA 3P7KA 3EQ2A 3M9BA 3P32A 1J1EC 1N86A 1NH4A 2N1TA 3B5NA 3G3ZA 1SVFA 2W6BA 3HD7B 1GL2A 1MV8A 2GUSA 3P8MC 1HTLC 3LW5H 4W7ZA 4XE5B 2NPSC 1LWUA 5CCHC 1GW4A 1RF1B 1SLQA 2QM7A 3BASA 3HUSB 4O9BA 4WY4B 1JY2P 3KPEA 4IFDK 1NKZB 2FYZA 1VDFA 1ZN5A 1YTZT 2C9LY 1KILC 3M9HA 3V2RA 3P8CD 3OA7A 1LTJB 1LT9B 2O1JA 2XV5A 3LIEA 2P67A 1J1DC 2CPBA 4IFMA 1URQA 3LIDA 1N7SC 2W6AA 1CSBA 3M0DA 1IFDA 1ZV8A 2ZFCA 3U1CA 1IO4A 1LTAC 1S9KE 1GU5A 1OWAA 1JO5A 2XU6A 1A02J 1HWTC 2N1TC 3B5NC 4WB4A 1FZCB 1HGZA 2OYIC 3SWFA 2JJLA 1IJDB 1EQ7A 1HBWA 4ZKPA 2KP8A 3N7NA 1H88A 2NPSA 5AVSB 1N7SD 3C9IA 5BU5A 4AYCA 2H8PD 1YTZI 4C7NB 1RY3A 3O8ZA 5AVQB 1J1EB 1KILA 1FDMA 5AVXB 3RK3D 2HG5D 1H89A 2YMYA 1HGVA 5APYA 1LTSC 1SQPK 1VPCA 1FAVA 1M7LA 1ZLLA 1MZ9A 1NTKK 2E42A 1SFCA 1NTZK 4OH8B 2YNYA 2O01H 2WWWA 1FU1A 3RK2B 4Y99C 2WSFH 4GIFA 1JNMA 3RK3B 3HE4A 4WY4C 2CPSA 5BVZA 1GTWA 1KILB 2IFMA 2E43A 1LTBC 1LTJA 1LT9C 2YKQA 4I6MC 1JCCA 3TYYA 5KJ7C 1T8ZA 1A02F 2XDJA 4EIJA 2Z4EA 2KOGA 1NAFA 2FFDC 1FOSF 3L36A 1N7SB 1NO4A 1FZCA 3M0AA 3RK2D 4LC1A 5BU8B 5AW1B 3A5TA 1FZAA 2KSJA 5KLVK 1NKNA 3HE5A 3CLQA 5AW5B 1N73A 2N1TB 3B5NB 1IFIA 2OYIB 3B8EB 3HE4B 1GL2D 3L37A 1L4AB 3GHGB 3VTPC 2OYHB 1CW5A 3KDPB 1GK6A 1FBMA 1QL1A 3V5BA 2HYNA 3RL0C 5APQA 3HE5B 5AVZB 5AW9B 2R32A 5APTA 4WBAA 2IFNA 3MD0A 3V2PA 4WY4A 5AVRB 2KYVA 2I1JA 1GL2C 3CI9A 3M06A 1N2DC 1LT9A 1HH0A 2R5DA 1RE3C 1IFMA 1PFIA 1S9KD 1MUUA 4N78D 3M9QA 1NHLA 3VMZA 1HJBA 4JF7A 4N6JA 2WITA 1X9VA 3TSIA 2R5BA 3HD7A 3KYQA 1FZEA 1KILD 5AW8B 1AFOA 1GZLA 1JY3P 3HD7D 2GM4A 4Y99B 2C9NY 2WSCH 3TNUA 1SQXK 1AQ5A 3MIWA 2FKWB 1T2KC 3M0DC 1L0LK 1JTHA 3OAKA 4AQRD 1JY3N 1YYCA 4HH2A 1NWQA 3HUSC 1FOSE 3NXSA 4IFFA 5AW3B 1IK9A 2WZ7A 2LKMA 3V4WA 5CCGC 3VN0A 3II6A 2Q7CA 5APWA 1GU4A 2PP6A 1JUNA 2A45G 1XTGB 4DZOA 1J1DB 2ZXEB 1E5WA 4I1LA 1JY2N 1NOHA 3M91A 1T2KD 1HVVA 1L4AA 1URQB 1JOCA 5APUA 1FZGA 2Q9IA 1M1JB 5AW7B 1SQVK 3A7OA 4HYTB 1G2CA 2OARA 3GHGC 1JY3O 1CZQA 2WT7B 2WSEH 1ZR4A 3NMDA 2HODB 5APXA 5KTBA 3BVHA 1MFZA 2Z5HA 3MGNA 3T97A 1GDTA 2Z5IA 3R2PA 4LGDE 3KQGA 5AVYB 4RESB 1FJPA 3V2NA 3CL3D 1SP4A 1CI6B 5APVA 2C0XA 1JCDA 3HRNA 3RL0D 2P1JA 1RF1C 1T3UA 3H32B 3P8CE 4KHXA 5AVTB 3U1AA 1DEBA 3SWYA 1RF0C 2XKMA 1KFNA 1XTCC 3TNUB 2J59M 2YO3A 4M3LA 2O1KA 2IPPA 3VMYA 3IFMA 1DH3A 4W80A 2Q3IA 1LTJC 5KJ7D 4W7YA 3UIAA 4B86A 1G1JA 1JTHB 2PAJA 5APSA 2Q5UA 1X79B 2OYHA 3A2AA 1SFCB 1GW3A 3VP8A 1L4AD 2FFDA 2YKPA 3RK2C 3GHGA 2FXMA 1KFMA 3EFGA 3BATA 4N3YB 3MUDA 5AVVB 3PP5A 1IFJA 2IX7C 1SQBK 2WTYA 5AW2B 3VOPA 1LWUB 3NFQA 1URQD 1FJKA 1N7SA 2KLVA 1DX7A 1IC2A 2QM8A 3TK1A 2GUVA 1Z56A 2P2UA 3U59A 1LTGC 3N4XA 4C7NA 1RF1A 2P7JA 3HTKB 1L0NK 2HPCB 1G2CB 1RF0A 5CJ4A 1N73B 4JYBA 2OYIA 1J2JB 3VMXA 2A45I 1W2EA 1GK4A 2XZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HH2 A;  2O1J A;  4WBA A;  4WB4 A;  4C7R A;  4LLH A;  2WIT A;  2L5G B;  3CI9 A;  4DOJ A;  3MIW A;  1G1J A;  2O1K A;  1G1I A; 
#chains in the Genus database with same CATH topology
 3BRV B;  2WPS A;  3I5C A;  1ZR2 A;  2OYH C;  1JB0 J;  2FBW C;  2POH A;  4OWF A;  1JMM A;  1RE3 A;  4C7R A;  4GKG A;  1WRG A;  1SQQ K;  5AVU B;  4AUW A;  4H0L C;  2V7Q J;  2YXR B;  1BCC J;  2A06 G;  1G1I A;  2E76 B;  2FYN B;  1LGH B;  2ZVN B;  1VF5 C;  1KZU B;  1SFC D;  3L74 J;  3I56 P;  5KLV J;  1YI2 P;  3KXD A;  1OW6 A;  3L35 A;  1BE3 E;  1FDI A;  1Q2N A;  4EOT A;  2M3B A;  3BRT B;  1JY2 O;  2L5G B;  3HD7 C;  3CWB G;  5CJ0 A;  3VYI A;  2MJZ A;  3CCM P;  2YKO A;  3TGU G;  2H89 C;  3TDK A;  2HLO A;  2VRS A;  3HTK A;  1WT6 A;  1ZRT D;  3EWK A;  2W83 C;  1ZRT E;  1X8Y A;  3V2Q A;  2ZT9 D;  2PGD A;  2MKV A;  4U3F E;  3AE5 C;  3AEB C;  2NPS B;  1P84 H;  3L75 D;  1SQQ D;  3RK3 C;  2ZVO B;  3JSV C;  1NJI Q;  4OGQ C;  1SQQ E;  4U7J A;  3CCR P;  1EXJ A;  1MFT A;  2FY8 A;  1RE4 C;  4C46 A;  5CBO A;  1BCC D;  3KHU A;  1M1J A;  3CWB E;  1SS1 A;  2J58 A;  1BCC E;  3NTN A;  3CCE P;  2H43 A;  4JYC A;  1NU1 K;  2WPQ A;  2R44 A;  3OJA B;  2KB7 P;  4H44 C;  1NTM K;  4GT1 A;  2JWD A;  1M8O B;  1OXZ A;  2M3E A;  4UB8 H;  1SFC C;  1S72 P;  3HUS A;  3PJS K;  5AW0 B;  3VP9 A;  5CCG D;  1H8A A;  1ZW0 A;  4I2L C;  1Q82 Q;  2IBZ D;  2R3C A;  2FFD B;  3S9O A;  2YO2 A;  1S5L H;  1T3J A;  2OYO A;  5CCG A;  1Q86 Q;  2WPR A;  2QJP C;  4N78 E;  3ZDM A;  1OFC X;  2OGU A;  5GTH E;  3V4Q A;  1LTT C;  2N1T D;  3B5N D;  3GF7 A;  2FXO A;  1IFN A;  5AVW B;  1KB9 D;  2N9B A;  1EZV G;  1SQB D;  3L4F A;  3KZI E;  4LLH A;  3MTU E;  1KQG B;  3A3Y B;  1HUC A;  2BAS A;  4CPG A;  4WY4 D;  3CWB J;  1PZQ A;  1QL2 A;  1RHZ B;  2E75 B;  3E1I A;  3IR9 A;  3L74 D;  2M8R A;  1SQQ G;  3L72 D;  1S4X A;  3H1J G;  2AEM A;  1LWU C;  5B5E H;  1AVY A;  5CCH A;  1OIP A;  5KJ7 A;  1L4A C;  2FYU K;  2Q3E A;  2WSE J;  1LTI C;  3H32 A;  3PH0 A;  1EZV E;  4XFJ A;  3H6P A;  1QLE D;  3E1R A;  2E5Y A;  2W27 A;  1LJ2 A;  3IAO A;  3Q1M A;  3GLM A;  1GD2 E;  4HKZ H;  4EI2 A;  1CI6 A;  1FZC C;  3L75 J;  1U7M A;  3PLN A;  1EDJ A;  5KKZ C;  1FZB A;  3D71 A;  2SPZ A;  3B71 A;  2RKL A;  3RL0 B;  3WMM 0;  1E79 H;  2C0W A;  3CXH D;  2JEE A;  4BWN A;  3W68 A;  5KLI B;  2YIU C;  2HFE D;  1YHQ P;  1K73 Q;  5AW6 B;  2M0B A;  2A45 H;  4DOJ A;  1N73 C;  4XA4 A;  1Q90 D;  1EXI A;  3AE2 C;  1FC2 C;  3H1I J;  4ZKU A;  1LNQ A;  5AW4 B;  3O6Q A;  1URQ C;  3GG2 A;  1HJ0 A;  2XNX A;  1RE4 A;  2WVR A;  1GL2 B;  1PPJ D;  1M1J C;  3OW2 O;  1M57 D;  1KQL A;  1N7L A;  1PPJ E;  2NPS D;  2RMZ A;  5CHX A;  1KB9 I;  5CCH D;  1N8R Q;  1M1K Q;  1UII A;  2WT7 A;  2I1K A;  1NYH A;  3E7K A;  5CMZ A;  2HOD A;  4NPF X;  1R5L A;  3L75 E;  3P7K A;  3EQ2 A;  3M9B A;  2B89 A;  3P32 A;  3L71 G;  2G8Y A;  1OW7 A;  2KUB A;  4YPC A;  1SQP G;  2E74 C;  3MP7 B;  2N9Y B;  2E76 C;  1J1E C;  1N86 A;  1NH4 A;  1PL5 A;  2IZ1 A;  2N1T A;  2YMK A;  3A0H E;  3B5N A;  4NPD A;  3CCJ P;  2ZJS E;  1SVF A;  3G3Z A;  4IOI H;  2W6B A;  3CX5 E;  3HD7 B;  2FXP A;  3Q2Y A;  3L70 G;  2KNC A;  3RK3 E;  1GL2 A;  1K04 A;  2FYU D;  4L74 A;  4DJG A;  1MV8 A;  2GUS A;  3P8M C;  1HTL C;  1L0N G;  1NTM E;  3LW5 H;  3QWO C;  4KT0 J;  4W7Z A;  1Y9B A;  1NU1 E;  4XE5 B;  5KAF E;  1KYO E;  1AVO A;  1P84 E;  1LWU A;  1SQV J;  2IDB A;  2JO1 A;  1KYO D;  1BGY G;  1GW4 A;  4OGQ B;  4I7Z C;  1LP1 B;  5CCH C;  1R8E A;  1RF1 B;  2Q1K A;  1VQK P;  3H1L E;  5DJT B;  4H0L D;  3UIA A;  1SLQ A;  2QM7 A;  2D2C C;  1S1C X;  1AA0 A;  3FXE A;  3K5B A;  4D6T J;  1ZME C;  3AE8 C;  4TT3 H;  2P10 A;  1BDC A;  2QRX A;  3A0H H;  4H44 B;  2KIK A;  3BAS A;  1YBK A;  3HUS B;  4O9B A;  4WY4 B;  1JY2 P;  3KPE A;  1SQX G;  4IFD K;  1NKZ B;  1JEK A;  2FYZ A;  1VDF A;  2KS1 B;  3JCU E;  1ZN5 A;  1YTZ T;  3L73 J;  3AE7 C;  1KIL C;  3M9H A;  3V2R A;  3P8C D;  4PJ0 H;  1IK7 A;  2G3A A;  3CMA P;  2C9L Y;  3OA7 A;  3D6Y A;  1LTJ B;  1VQO P;  1LT9 B;  1BSN A;  1OMI A;  2O1J A;  3H1H E;  2XV5 A;  3LIE A;  1YIJ P;  2P67 A;  1PGO A;  1J1D C;  1L0N E;  1FS0 E;  1PIX A;  2CPB A;  1URQ A;  1EC5 A;  1AV1 A;  1L0N D;  2JP3 A;  2KNC B;  3CXH E;  3BCC J;  3LID A;  1KN7 A;  3G9R A;  4UB6 E;  3GF3 A;  1NTZ E;  1N7S C;  5EFW B;  2W6A A;  1NTZ D;  1CSB A;  1IFD A;  2AXT E;  2OQQ A;  1ZV8 A;  2AEF A;  3M0D A;  2E75 D;  2ZFC A;  1R5S A;  1PP9 G;  3CCS P;  3U1C A;  1VQ6 P;  3H1H G;  5GTI E;  1K9M Q;  3CC4 P;  2WPV B;  1LTA C;  1S9K E;  1IO4 A;  4K35 A;  1GU5 A;  1SQP E;  2FYU J;  3CXH H;  3MZW B;  1L0L G;  4BRY B;  4HJG H;  1OWA A;  1SQP D;  1JO5 A;  1VQ7 P;  2XU6 A;  1OX3 A;  1A02 J;  1SQX E;  1HWT C;  2N1T C;  3ABV C;  3B5N C;  4WB4 A;  1FZC B;  4NPE A;  1HGZ A;  2K1A A;  2KZI A;  2OYI C;  1KIL E;  3SWF A;  3AE4 C;  2JJL A;  2V7Q H;  2BCC D;  1IJD B;  5H2F H;  4ASV A;  1EQ7 A;  1S2E A;  2W90 A;  1HBW A;  1L2P A;  2BEQ D;  4ZKP A;  2ZYG A;  4RKU J;  1L0L E;  2KP8 A;  3N7N A;  1H88 A;  4OVN F;  2RH0 A;  2NPS A;  4L75 A;  1X22 A;  5B66 E;  5AVS B;  1N7S D;  2IYO A;  3CX5 D;  4GOF A;  3C9I A;  2H88 C;  5TJH A;  2A06 D;  3FXD A;  4JPZ B;  4EYY Q;  2IBZ E;  2A06 E;  5KAI E;  1SQP J;  2FYU E;  4H13 C;  3CCU P;  1VQ5 P;  1NTM D;  3F89 A;  2K9J B;  5BU5 A;  1KB9 H;  1NTK G;  2P58 A;  2H8P D;  4PD4 H;  4R4M A;  4AYC A;  1YTZ I;  2JKV A;  1KB9 E;  2R3S A;  4C7N B;  3H1L D;  1YIT P;  1RY3 A;  3O8Z A;  4GDO A;  5AVQ B;  3L73 D;  1J1E B;  1KIL A;  4B86 A;  1FDM A;  5AVX B;  3RK3 D;  1YQ3 C;  5KLV D;  2HG5 D;  3S1K A;  1GMJ A;  1H89 A;  2YXQ B;  5KLV G;  3WUT A;  2YMY A;  1HGV A;  5APY A;  3C1L A;  1SQQ J;  1LTS C;  5DJU B;  1SQP K;  1VPC A;  1FAV A;  3L74 G;  1KQS O;  2QJK B;  1M7L A;  1ZLL A;  1MZ9 A;  1MKM A;  3SWK A;  4H13 D;  1NTK K;  1BGY J;  2E42 A;  1SFC A;  1NTZ K;  4IFM A;  4OH8 B;  3WU2 E;  2YNY A;  3W67 A;  1USE A;  4WVZ A;  2O01 H;  2WWW A;  4UB8 E;  1FU1 A;  2WSS H;  3RK2 B;  2W8Z A;  4Y99 C;  4HYT B;  2WSF H;  4GIF A;  1JNM A;  1DD4 A;  3RK3 B;  3HE4 A;  4WY4 C;  1QVG O;  3MHV A;  1NWQ A;  2CPS A;  1AJY A;  2UWJ E;  1BE3 D;  4YTP C;  2GA1 A;  3T97 B;  5BVZ A;  1GTW A;  4UB6 H;  1KIL B;  2IFM A;  2WQY C;  3H1K G;  2E43 A;  1NTK J;  5KAI H;  3Q3D A;  1LTB C;  1LTJ A;  1LT9 C;  2YKQ A;  3L71 J;  3AEC C;  4ASW A;  4I6M C;  1JCC A;  3TYY A;  5KJ7 C;  2Y9Z A;  1T8Z A;  1A02 F;  2XDJ A;  2CK3 H;  4EIJ A;  3G71 P;  2Z4E A;  4H44 D;  2KOG A;  2D2C D;  1NAF A;  3SSU A;  2FFD C;  1FOS F;  3CPW O;  3L36 A;  1M56 D;  1N7S B;  1NO4 A;  3B4S A;  2AXT H;  3CWB D;  2KXP B;  2JWA A;  3AE6 C;  1KOR A;  3H1K E;  3M0A A;  3RK2 D;  4LC1 A;  5BU8 B;  1FZC A;  3ITK A;  1VQN P;  5AW1 B;  3A5T A;  1H0T B;  1FZA A;  2KSJ A;  5KLV K;  1NKN A;  1PGJ A;  1BGY E;  3MUD C;  1HF9 A;  3HE5 A;  2HR3 A;  3CLQ A;  5AW5 B;  2B9B A;  2KLU A;  3CCQ P;  5TIS E;  1PP9 E;  3BCC D;  1N73 A;  1L0N J;  2N1T B;  3B5N B;  2FYU G;  1YJN P;  1IFI A;  1NU1 D;  2OYI B;  2QJY B;  3H1I E;  3B8E B;  1SQV E;  1GL2 D;  3H1I D;  3HE4 B;  3L37 A;  3L70 J;  4DCK A;  1LP1 A;  1L4A B;  1NU1 J;  3GW6 A;  2IYP A;  1YJ9 P;  3L73 E;  2WSC J;  4PV1 D;  1RQU A;  3GHG B;  2NPS C;  3VTP C;  2IZ0 A;  2OYH B;  1CW5 A;  1KMI Z;  3KDP B;  3L72 E;  4U3F G;  2E76 D;  1GK6 A;  1FBM A;  1QL1 A;  3L71 E;  2HYN A;  3RL0 C;  3V5B A;  5APQ A;  4D6T G;  3FX0 A;  2Y0E A;  4H0L B;  3HE5 B;  4H13 B;  4KJM A;  2YIU B;  5AVZ B;  2FYN C;  2R32 A;  4U3F D;  1VF5 B;  1JMB A;  2OTK E;  3GMA A;  5APT A;  5GTH H;  3C8V A;  4WBA A;  2M5A A;  2IFN A;  1PPJ G;  3L73 G;  3MD0 A;  3V2P A;  1VQP P;  2ZT9 C;  4PD4 I;  4MN4 C;  4WY4 A;  4ZMD A;  5AVR B;  2KYV A;  4U3F J;  2I1J A;  3H1I G;  1YJW P;  1GL2 C;  1VL2 A;  1NTK E;  3CI9 A;  3M06 A;  5E79 E;  1N2D C;  1LT9 A;  5AW9 B;  1NU1 G;  1PV3 A;  5GTI H;  4L76 A;  5C39 A;  1HH0 A;  2R5D A;  1W2B O;  1RE3 C;  1IFM A;  1PFI A;  1VQM P;  5H2F E;  2QJK C;  2LXC B;  1MUU A;  4N78 D;  1UIX A;  3M9Q A;  1DEE G;  4PD4 E;  1NHL A;  5KLI C;  1S9K D;  1K05 A;  3VMZ A;  2BEZ F;  2ZYD A;  2K37 A;  4JF7 A;  1SQB E;  4N6J A;  2WIT A;  1X9V A;  3TSI A;  1K8A Q;  2JDI H;  1NVO A;  2R5B A;  1BE3 J;  1EDI A;  4Y28 J;  3AE9 C;  3HD7 A;  3KYQ A;  1FZE A;  1KIL D;  5AW8 B;  1KD1 Q;  1HJB A;  1AFO A;  1GZL A;  4BRY A;  1QX8 A;  1JY3 P;  3HD7 D;  1VQ8 P;  2GM4 A;  4BXL A;  4R4L A;  4Y99 B;  1T6A A;  1ZP0 C;  2QJP B;  3PHL A;  4A7P A;  2C9N Y;  1L0L D;  2KZJ A;  2B87 B;  3H1K D;  2WSC H;  3A0B E;  1SQX K;  3TNU A;  3D6Z A;  2QE7 H;  1AQ5 A;  3PTZ A;  3IN6 A;  4WWI A;  1BE3 G;  3MIW A;  5CBN A;  1BGY D;  1TU3 F;  2L91 A;  1U7J A;  2V4H A;  4OGQ D;  3VMA A;  2E75 C;  2FKW B;  3CX5 I;  1T2K C;  3RL0 D;  1S5L X;  3F5H A;  3KZI H;  3M0D C;  1L0L K;  1JTH A;  3OAK A;  4AQR D;  1JY3 N;  1VQL P;  1YYC A;  2WMM A;  3L70 E;  4HH2 A;  3HUS C;  4PJ0 E;  3NXS A;  2ITA A;  3L70 D;  3RGU A;  1YQ4 C;  4IFF A;  5AW3 B;  1IK9 A;  2WZ7 A;  2LKM A;  1OVR A;  3AED C;  3V4W A;  4IL6 H;  5CCG C;  3VN0 A;  5B5E E;  2E5T A;  3II6 A;  2J5U A;  1LT1 A;  1SQX J;  1WMK A;  2Q7C A;  4L73 A;  2O01 J;  1BCC G;  1FDO A;  5APW A;  1GU4 A;  2PP6 A;  1JUN A;  2A45 G;  1XTG B;  4DZO A;  1J1D B;  2QSI A;  2ZXE B;  3L71 D;  4JQ0 D;  3L75 G;  4PV1 B;  5L8R J;  1EZV I;  1KQF B;  3WU2 H;  2KS1 A;  2DW3 A;  1E5W A;  5KLV E;  1KC8 Q;  1DIP A;  1D7M A;  1ZOY C;  1OVV A;  4I1L A;  1JY2 N;  1KYO H;  2Y9Y A;  2ZXX A;  3IF4 A;  4IL6 X;  2QJY C;  1SQB J;  1NOH A;  3M91 A;  1T2K D;  1NAY A;  2OTJ P;  3TGU E;  1AQT A;  1S5L E;  1HVV A;  1L4A A;  2JR8 A;  1URQ B;  3AEA C;  3CXH I;  3H1L G;  4RJT A;  1JOC A;  5APU A;  2NZ2 A;  1FZG A;  2Q9I A;  1M1J B;  5AW7 B;  5M1B A;  5K5G B;  1SQV K;  1USD A;  2E74 D;  2QG4 A;  1G2C A;  2OAR A;  3A7O A;  1IFP A;  1JY3 O;  1NTK D;  3GHG C;  1CZQ A;  3EFF K;  2WSE H;  2WT7 B;  3NMD A;  1ZR4 A;  1NTM G;  2HOD B;  2ZYA A;  1RQV A;  2Y0C A;  5APX A;  2BCC J;  3A0B H;  4IL6 E;  5KTB A;  3BVH A;  3BCC G;  3I55 P;  1MFZ A;  2Z5H A;  2LXB A;  3FWN A;  2E74 B;  3CC7 P;  3MGN A;  3T97 A;  1GDT A;  2Z5I A;  1VQ9 P;  3AEG C;  1BSH A;  3G6E P;  3R2P A;  4LGD E;  3WUU A;  3CCV P;  1Q81 Q;  2ZT9 B;  1PGQ A;  4GOD A;  3KQG A;  1JM0 A;  1IZN B;  5AVY B;  4RES B;  2QEX P;  2BCC G;  1FJP A;  1RF1 A;  3Q5R A;  3H1J E;  4JBZ A;  3V2N A;  5B66 H;  3H1J D;  3CME P;  3CL3 D;  1SP4 A;  1S3J A;  2K9Y A;  1CI6 B;  2HPC A;  5APV A;  2C0X A;  4I7Z B;  3Q5S A;  1OVU A;  1JCD A;  1OW8 A;  3FWL A;  2P1J A;  3HRN A;  1T3U A;  3AEF C;  1EZV D;  1SQB G;  5E79 H;  3H32 B;  2W6J H;  3P8C E;  2D2C B;  1U57 A;  4KHX A;  5AVT B;  1DEB A;  3SWY A;  3U1A A;  1KV4 A;  1RF0 C;  3H1H D;  3S4R A;  3USS A;  4DT0 A;  2XKM A;  1NTZ G;  1KFN A;  1PP9 D;  1XTC C;  3BCC E;  3FGA D;  1P84 I;  4ZNC A;  3TNU B;  2IBZ G;  1PP9 J;  1SQV D;  1EDK A;  2J59 M;  2YO3 A;  2O1K A;  3QH9 A;  4M3L A;  2IPP A;  3H1H J;  3TGU J;  3L72 J;  3VMY A;  1RF1 C;  3IFM A;  1DH3 A;  1NTM J;  2Q3I A;  4W80 A;  3SFE C;  1LTJ C;  2O01 N;  4W7Y A;  3AE1 C;  5KJ7 D;  1G1J A;  2B87 A;  1JTH B;  2K88 A;  2KSE A;  2PAJ A;  2Q5U A;  5APS A;  1X79 B;  3TF5 A;  2OYH A;  3A2A A;  1SFC B;  3O6Q B;  1GW3 A;  3WUV A;  1Q7Y Q;  2Y0D A;  2KK7 A;  2PFX A;  1L4A D;  1Y47 A;  3VP8 A;  4K3A A;  2B88 A;  2FFD A;  4HB1 A;  2YKP A;  1SQX D;  4YXD C;  3L72 G;  3GHG A;  3RK2 C;  2QVA A;  2FXM A;  4RO0 A;  1KFM A;  2I8D A;  2WSF J;  1FE6 A;  3EFG A;  4QMA A;  3RL0 g;  3SFD C;  5KAF H;  1BDD A;  3JCU H;  2BCC E;  2LR2 A;  3BAT A;  1L0L J;  3TGU D;  3CC2 P;  2OTL P;  2NRG A;  4TLF A;  3Q5P A;  1FZF A;  4N3Y B;  1NGM B;  3CD6 P;  3MUD A;  5AVV B;  3V6I A;  2K3R A;  1QEX A;  2AEJ A;  3H1J J;  3PP5 A;  3PRJ A;  3RBX A;  1QGK B;  1IFJ A;  2IX7 C;  1SQB K;  2WTY A;  2RN0 A;  5AW2 B;  2M5A B;  3AE3 C;  3VOP A;  1FOS E;  3D70 A;  1LWU B;  3NFQ A;  4EDF A;  1SQV G;  4Z1M H;  2KI7 B;  1M90 Q;  1X0T A;  4PV1 C;  1URQ D;  1RH5 B;  1OZH A;  4PD4 D;  1KYO I;  1NTZ J;  1FJK A;  1N7S A;  2KLV A;  1DX7 A;  2K9J A;  1QVF O;  1IC2 A;  3H1L J;  1EDL A;  1P84 D;  2QM8 A;  2GUV A;  2Q6Q A;  2XND H;  3TK1 A;  3R4Y A;  2O3J A;  5TIS H;  5KKZ B;  1Z56 A;  2P2U A;  3U59 A;  1LTG C;  3N4X A;  1VF5 D;  2AXC A;  4C7N A;  2PRR A;  3CX5 H;  3H25 A;  2P7J A;  3H1K J;  3HTK B;  4D6T E;  4YXW H;  1L0N K;  2HPC B;  1G2C B;  1RF0 A;  1DD3 A;  2QIW A;  3L74 E;  4D6T D;  5CJ4 A;  1N73 B;  1H0T A;  4JYB A;  3LW5 J;  2OYI A;  1J2J B;  1Y8A A;  2ZAE B;  2QA4 P;  3AEE C;  3VMX A;  2A45 I;  1KTM A;  1VQ4 P;  2IBZ I;  3JC2 2;  1ZXG A;  1PGP A;  3CCL P;  3RBZ A;  3G4S P;  2H7H A;  1W2E A;  1GK4 A;  4GOE A;  1W5C E;  2XZR A; 
#chains in the Genus database with same CATH homology
 3BRV B;  2WPS A;  3I5C A;  1ZR2 A;  2OYH C;  2POH A;  4C7R A;  1JMM A;  1RE3 A;  4GKG A;  1WRG A;  1SQQ K;  5AVU B;  4AUW A;  2HPC A;  1G1I A;  1LGH B;  1KZU B;  1SFC D;  3L35 A;  4EOT A;  2M3B A;  3BRT B;  1JY2 O;  2L5G B;  3HD7 C;  5CJ0 A;  3VYI A;  2H7H A;  2MJZ A;  2YKO A;  3HTK A;  2HLO A;  2VRS A;  1WT6 A;  1X8Y A;  3V2Q A;  2NPS B;  3RK3 C;  1RE4 C;  4C46 A;  1M1J A;  2J58 A;  3NTN A;  2H43 A;  4JYC A;  1NU1 K;  2WPQ A;  3OJA B;  2KB7 P;  1FZF A;  1NTM K;  4GT1 A;  1OXZ A;  1SFC C;  3HUS A;  5AW0 B;  3VP9 A;  5CCG D;  1H8A A;  4I2L C;  2R3C A;  2FFD B;  2YO2 A;  1T3J A;  5CCG A;  2WPR A;  4N78 E;  3V4Q A;  1LTT C;  2N1T D;  3B5N D;  1IFN A;  5AVW B;  2N9B A;  3L4F A;  4LLH A;  3MTU E;  3A3Y B;  1HUC A;  2BAS A;  4WY4 D;  3IR9 A;  1QL2 A;  3E1I A;  2M8R A;  1LWU C;  5CCH A;  5KJ7 A;  1L4A C;  2FYU K;  1LTI C;  3H32 A;  3H6P A;  2W27 A;  1GD2 E;  1CI6 A;  1FZC C;  1FZB A;  3RL0 B;  3WMM 0;  2C0W A;  2JEE A;  2HFE D;  5AW6 B;  2A45 H;  4DOJ A;  1N73 C;  4XA4 A;  4ZKU A;  5AW4 B;  1URQ C;  2XNX A;  1RE4 A;  1GL2 B;  1M1J C;  1KQL A;  1N7L A;  2NPS D;  5CHX A;  5CCH D;  2WT7 A;  2I1K A;  5CMZ A;  2HOD A;  3P7K A;  3EQ2 A;  3M9B A;  3P32 A;  1J1E C;  1N86 A;  1NH4 A;  2N1T A;  3B5N A;  3G3Z A;  1SVF A;  2W6B A;  3HD7 B;  1GL2 A;  1MV8 A;  2GUS A;  3P8M C;  1HTL C;  3LW5 H;  4W7Z A;  4XE5 B;  2NPS C;  1LWU A;  5CCH C;  1GW4 A;  1RF1 B;  1SLQ A;  2QM7 A;  3BAS A;  3HUS B;  4O9B A;  4WY4 B;  1JY2 P;  3KPE A;  4IFD K;  1NKZ B;  2FYZ A;  1VDF A;  1ZN5 A;  1YTZ T;  2C9L Y;  1KIL C;  3M9H A;  3V2R A;  3P8C D;  3OA7 A;  1LTJ B;  1LT9 B;  2O1J A;  2XV5 A;  3LIE A;  2P67 A;  1J1D C;  2CPB A;  4IFM A;  1URQ A;  3LID A;  1N7S C;  2W6A A;  1CSB A;  3M0D A;  1IFD A;  1ZV8 A;  2ZFC A;  3U1C A;  1IO4 A;  1LTA C;  1S9K E;  1GU5 A;  1OWA A;  1JO5 A;  2XU6 A;  1A02 J;  1HWT C;  2N1T C;  3B5N C;  4WB4 A;  1FZC B;  1HGZ A;  2OYI C;  3SWF A;  2JJL A;  1IJD B;  1EQ7 A;  1HBW A;  4ZKP A;  2KP8 A;  3N7N A;  1H88 A;  2NPS A;  5AVS B;  1N7S D;  3C9I A;  5BU5 A;  4AYC A;  2H8P D;  1YTZ I;  4C7N B;  1RY3 A;  3O8Z A;  5AVQ B;  1J1E B;  1KIL A;  1FDM A;  5AVX B;  3RK3 D;  2HG5 D;  1H89 A;  2YMY A;  1HGV A;  5APY A;  1LTS C;  1SQP K;  1VPC A;  1FAV A;  1M7L A;  1ZLL A;  1MZ9 A;  1NTK K;  2E42 A;  1SFC A;  1NTZ K;  4OH8 B;  2YNY A;  2O01 H;  2WWW A;  1FU1 A;  3RK2 B;  4Y99 C;  2WSF H;  4GIF A;  1JNM A;  3RK3 B;  3HE4 A;  4WY4 C;  2CPS A;  5BVZ A;  1GTW A;  1KIL B;  2IFM A;  2E43 A;  1LTB C;  1LTJ A;  1LT9 C;  2YKQ A;  4I6M C;  1JCC A;  3TYY A;  5KJ7 C;  1T8Z A;  1A02 F;  2XDJ A;  4EIJ A;  2Z4E A;  2KOG A;  1NAF A;  2FFD C;  1FOS F;  3L36 A;  1N7S B;  1NO4 A;  1FZC A;  3M0A A;  3RK2 D;  4LC1 A;  5BU8 B;  5AW1 B;  3A5T A;  1FZA A;  2KSJ A;  5KLV K;  1NKN A;  3HE5 A;  3CLQ A;  5AW5 B;  1N73 A;  2N1T B;  3B5N B;  1IFI A;  2OYI B;  3B8E B;  3HE4 B;  1GL2 D;  3L37 A;  1L4A B;  3GHG B;  3VTP C;  2OYH B;  1CW5 A;  3KDP B;  1GK6 A;  1FBM A;  1QL1 A;  3V5B A;  2HYN A;  3RL0 C;  5APQ A;  3HE5 B;  5AVZ B;  5AW9 B;  2R32 A;  5APT A;  4WBA A;  2IFN A;  3MD0 A;  3V2P A;  4WY4 A;  5AVR B;  2KYV A;  2I1J A;  1GL2 C;  3CI9 A;  3M06 A;  1N2D C;  1LT9 A;  1HH0 A;  2R5D A;  1RE3 C;  1IFM A;  1PFI A;  1S9K D;  1MUU A;  4N78 D;  3M9Q A;  1NHL A;  3VMZ A;  1HJB A;  4JF7 A;  4N6J A;  2WIT A;  1X9V A;  3TSI A;  2R5B A;  3HD7 A;  3KYQ A;  1FZE A;  1KIL D;  5AW8 B;  1AFO A;  1GZL A;  1JY3 P;  3HD7 D;  2GM4 A;  4Y99 B;  2C9N Y;  2WSC H;  3TNU A;  1SQX K;  1AQ5 A;  3MIW A;  2FKW B;  1T2K C;  3M0D C;  1L0L K;  1JTH A;  3OAK A;  4AQR D;  1JY3 N;  1YYC A;  4HH2 A;  1NWQ A;  3HUS C;  1FOS E;  3NXS A;  4IFF A;  5AW3 B;  1IK9 A;  2WZ7 A;  2LKM A;  3V4W A;  5CCG C;  3VN0 A;  3II6 A;  2Q7C A;  5APW A;  1GU4 A;  2PP6 A;  1JUN A;  2A45 G;  1XTG B;  4DZO A;  1J1D B;  2ZXE B;  1E5W A;  4I1L A;  1JY2 N;  1NOH A;  3M91 A;  1T2K D;  1HVV A;  1L4A A;  1URQ B;  1JOC A;  5APU A;  1FZG A;  2Q9I A;  1M1J B;  5AW7 B;  1SQV K;  3A7O A;  4HYT B;  1G2C A;  2OAR A;  3GHG C;  1JY3 O;  1CZQ A;  2WT7 B;  2WSE H;  1ZR4 A;  3NMD A;  2HOD B;  5APX A;  5KTB A;  3BVH A;  1MFZ A;  2Z5H A;  3MGN A;  3T97 A;  1GDT A;  2Z5I A;  3R2P A;  4LGD E;  3KQG A;  5AVY B;  4RES B;  1FJP A;  3V2N A;  3CL3 D;  1SP4 A;  1CI6 B;  5APV A;  2C0X A;  1JCD A;  3HRN A;  3RL0 D;  2P1J A;  1RF1 C;  1T3U A;  3H32 B;  3P8C E;  4KHX A;  5AVT B;  3U1A A;  1DEB A;  3SWY A;  1RF0 C;  2XKM A;  1KFN A;  1XTC C;  3TNU B;  2J59 M;  2YO3 A;  4M3L A;  2O1K A;  2IPP A;  3VMY A;  3IFM A;  1DH3 A;  4W80 A;  2Q3I A;  1LTJ C;  5KJ7 D;  4W7Y A;  3UIA A;  4B86 A;  1G1J A;  1JTH B;  2PAJ A;  5APS A;  2Q5U A;  1X79 B;  2OYH A;  3A2A A;  1SFC B;  1GW3 A;  3VP8 A;  1L4A D;  2FFD A;  2YKP A;  3RK2 C;  3GHG A;  2FXM A;  1KFM A;  3EFG A;  3BAT A;  4N3Y B;  3MUD A;  5AVV B;  3PP5 A;  1IFJ A;  2IX7 C;  1SQB K;  2WTY A;  5AW2 B;  3VOP A;  1LWU B;  3NFQ A;  1URQ D;  1FJK A;  1N7S A;  2KLV A;  1DX7 A;  1IC2 A;  2QM8 A;  3TK1 A;  2GUV A;  1Z56 A;  2P2U A;  3U59 A;  1LTG C;  3N4X A;  4C7N A;  1RF1 A;  2P7J A;  3HTK B;  1L0N K;  2HPC B;  1G2C B;  1RF0 A;  5CJ4 A;  1N73 B;  4JYB A;  2OYI A;  1J2J B;  3VMX A;  2A45 I;  1W2E A;  1GK4 A;  2XZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...