4WBAA

Q/e mutant sa11 nsp4_ccd
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
42
structure length
42
Chain Sequence
IEKQMDRVVKEMRRQLEMIDKLTTRAIEAVELLKRIYDKLTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Non-structural glycoprotein NSP4
publication title Structural Plasticity of the Coiled-Coil Domain of Rotavirus NSP4.
pubmed doi rcsb
source organism Simian rotavirus a/sa11
total genus 19
structure length 42
sequence length 42
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.430 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wbaA00
2WITA 4HH2A 4DOJA 3CI9A 4WB4A 1G1JA 2O1JA 4C7RA 3MIWA 4LLHA 2O1KA 1G1IA 4WBAA 2L5GB
chains in the Genus database with same CATH superfamily
2WPSA 2E74D 3L35A 2FY8A 1SQPD 2CPSA 3G6EP 2KS1A 1S9KE 4IL6X 4L74A 3IN6A 4W80A 1RF1C 2FYUD 3MD0A 2L5GB 1PGPA 4DJGA 2E75C 1ZV8A 2OYIC 1NKNA 3H1KD 3I56P 1IK7A 4YTPC 1CI6B 1QVFO 4Y99C 3WUUA 2BEQD 1OVUA 1H88A 3VP8A 1BGYE 3H1IJ 2I1KA 3CX5E 1GL2C 3G9RA 2P58A 1JY2O 2PAJA 1MFTA 1SP4A 3N4XA 1KILC 1SQQG 5BU5A 1S5LX 3CWBD 3Q5RA 1ZLLA 1JB0J 1JY2N 1KILE 3H1JG 1L0LD 2QJPB 2HG5D 2FFDB 5KAFH 3HTKB 2IX7C 3H1HJ 3L71D 1OW8A 1KB9E 1LTJB 3E1RA 1FJKA 1L0NJ 4JBZA 2K1AA 3CLQA 3AE5C 1USDA 2H7HA 1K05A 1IFMA 3O6QA 1XTCC 2ZT9D 1VQ5P 2R5DA 1VQMP 4L73A 3PHLA 1FBMA 3CCVP 2YMKA 4TLFA 2L91A 3R2PA 1HF9A 1PGOA 1FOSF 3AEAC 1EDLA 3BCCG 2QJYC 1KC8Q 1LT9C 2YXQB 2IYOA 4C7NB 1ZMEC 2KSEA 3H1IE 1NU1G 2P1JA 3SWFA 3B5NC 1SQBJ 3AEFC 4PV1D 1NWQA 4HYTB 1RF0C 1YTZI 2A06G 1FZCA 1G1JA 2WZ7A 1QX8A 2IBZE 4IL6H 1ZR2A 2O3JA 2M5AA 1PL5A 2FYZA 2KP8A 3KXDA 5M1BA 3H1LJ 2D2CD 2KNCA 4KT0J 1M1JB 3CCMP 4IFFA 1L2PA 2LXCB 3M06A 5CHXA 1EXJA 1OFCX 3H1HE 2CK3H 2ITAA 2HODA 1HUCA 1H0TB 2GM4A 3BRTB 2E76B 1KYOD 1WT6A 3CCQP 1JO5A 3GG2A 1OZHA 1DD3A 3P8MC 1RE4A 5APWA 1OIPA 1G2CA 1EZVI 2LR2A 3D70A 1L4AA 5TISH 1SFCB 5AW6B 4YPCA 1Q86Q 2P2UA 1QL1A 1ZOYC 1H89A 1S5LH 3RL0B 1OWAA 3PLNA 1URQC 3GW6A 2NRGA 1UIXA 3PTZA 2K3RA 3TGUJ 3B71A 3V4QA 1SQBE 2I1JA 4K3AA 2KLUA 1VL2A 5AW1B 2N9YB 2YXRB 2I8DA 3P7KA 3Q3DA 3AEDC 3T97A 1CI6A 3H1LE 4RESB 1QEXA 2AEMA 3CC7P 4ASWA 2QG4A 1VF5B 1OW7A 2O01H 1SLQA 1X22A 2M3BA 2HPCB 4N6JA 4N78E 3A5TA 3RK2B 4HH2A 1Q2NA 2OARA 4DCKA 3JCUH 1SQVJ 1J1DC 3BVHA 1T3JA 3Q5PA 4JF7A 2KS1B 1ZN5A 1W2EA 4H44D 3QH9A 1USEA 1YJ9P 3FGAD 4XA4A 2YIUC 2Z5IA 1U7MA 4U3FD 1JCCA 3AE9C 1LTJA 2N1TC 3HE4B 2A45I 2OTKE 1K9MQ 2PFXA 4L76A 5DJUB 2A45H 1SQBK 1SS1A 2JO1A 4NPEA 2QM8A 2QE7H 2YO3A 1N7SC 1HVVA 5APXA 1GD2E 1NGMB 4BWNA 1CW5A 2WSCH 1QGKB 1VQPP 3G71P 1RF1B 5AVUB 4XE5B 4AUWA 3GLMA 1BE3G 2E75B 3W67A 2WSEH 5AVTB 5APUA 5KKZC 2OYIB 2FKWB 2E5TA 1A02J 4C7NA 3SWYA 3V2PA 3M0AA 3CX5H 1SQXD 1YQ3C 3AE7C 3L73J 4WY4A 1VQLP 2PP6A 1GL2B 4LGDE 4OWFA 2O01J 1YITP 3HE5A 2MJZA 2M0BA 1SQVE 3F89A 1E79H 1PIXA 3CPWO 1FU1A 1N8RQ 1BSNA 3GF3A 2ZVNB 1EZVD 3V2NA 1PGQA 1PPJD 2W6BA 2BCCD 4GOEA 5H2FE 3FX0A 2XKMA 3CCJP 5CCGC 4WVZA 2ZYDA 2PGDA 4W7YA 1FDMA 1SFCD 1EZVE 1AA0A 2OTLP 3L70J 1PPJE 1EQ7A 2OQQA 1AJYA 3L72J 5E79E 1FZEA 1LTGC 3AEGC 2E42A 1GU5A 1VDFA 1OW6A 1T2KD 4JYCA 4DOJA 3L4FA 4H0LC 5GTHE 3AE8C 3Q5SA 1OX3A 3M91A 1VQ6P 2WSCJ 2NPSC 1FZCB 2QRXA 2ZXEB 2POHA 4UB8E 3V5BA 2C9LY 2M5AB 3A0HH 4ZKPA 3L73E 3WU2E 2WSEJ 3WUVA 4N3YB 2WPVB 1AV1A 1BCCE 1NAFA 2FYUJ 2IYPA 2Q6QA 1JMMA 1NTMD 1BDCA 3B5NB 1SQVK 3HUSC 2W6JH 5KLVD 3H1KJ 2VRSA 1D7MA 4EOTA 1W5CE 2HODB 5CCHA 4QMAA 2WT7A 3HD7C 1NTME 1HGVA 2Q1KA 2JP3A 2Q5UA 1NTKD 3AECC 3ZDMA 1M8OB 3U1AA 2YNYA 1HWTC 3L70G 3KHUA 2JEEA 1G2CB 2GUSA 2KB7P 2W6AA 3OJAB 1JY2P 3IFMA 3CWBJ 1BSHA 1NTZD 3VMZA 3L72E 2J59M 1L0LJ 1N86A 2OTJP 2E74C 5CBOA 1KYOI 4MN4C 4IFDK 3GHGC 3L71J 1NTZE 2OYOA 1SQPE 4I7ZC 3HE4A 1OVVA 2RKLA 2Y0DA 1BGYG 2KXPB 4C7RA 2Q9IA 3T97B 1ZP0C 2FYUE 1VQKP 5CMZA 1ZR4A 2XU6A 1S2EA 1YQ4C 2JJLA 1RF1A 3FXEA 1R8EA 3H1KE 5AW4B 1NTMK 4R4MA 4U7JA 2OYIA 3SSUA 3HRNA 1ZRTD 3AE2C 1PFIA 1K8AQ 1IK9A 2KOGA 2O1JA 4JYBA 1SQQD 4ASVA 4H13B 3R4YA 1GL2A 1LTBC 1G1IA 2AXCA 3MUDC 1ZRTE 3AE3C 4OGQD 1KMIZ 1J1EB 3CWBE 1KILA 1L0LE 1IJDB 2C0WA 2JWDA 4WB4A 1NTZK 2LKMA 1SQPK 1IC2A 4AQRD 3TNUA 2WSFH 3L71E 1RHZB 3GMAA 1EXIA 3M9QA 1N2DC 5C39A 4ZKUA 3M0DC 2ZT9C 2FYUK 3H1IG 5BVZA 1Y8AA 3H6PA 3TYYA 3P8CD 5AVQB 1RQUA 3EWKA 2Y0CA 3A0HE 2OYHC 3BCCD 4ZMDA 4WY4B 2IBZG 1PP9D 1NO4A 2FXMA 1NU1D 1IFNA 3H25A 5GTIE 3AEEC 1DEBA 1EDKA 3HE5B 4PV1C 2A06D 5KKZB 3EFGA 5AVRB 3S9OA 4HB1A 4UB6E 3BCCE 1LT9A 1PP9E 4B86A 1NU1E 3H1HG 4I1LA 1HH0A 3B5NA 1WMKA 2HR3A 3M9HA 1RF0A 1L0NG 2D2CC 5APQA 1L0LK 3AE6C 1EDIA 1L4AD 2Z5HA 3Q2YA 1SVFA 5AW8B 2KK7A 3C9IA 1X0TA 3FWLA 2MKVA 1PGJA 5H2FH 1NAYA 2RN0A 4YXWH 2C9NY 1N73C 4EDFA 1EDJA 1OXZA 1KV4A 4RJTA 1GK6A 2M8RA 2WSFJ 1KYOE 3RK3B 4EI2A 1FJPA 5AVZB 2AEFA 1SQBG 5E79H 1M1KQ 1JY3P 4C46A 3D71A 5GTHH 2JDIH 2XNDH 3A3YB 2H88C 4U3FJ 1DD4A 1YIJP 3MGNA 1Q7YQ 3H1LG 2B87B 4UB8H 4WWIA 1URQA 3B4SA 2NPSB 1GTWA 1NU1K 3WU2H 3OA7A 2WT7B 2SPZA 3GF7A 3S4RA 1KORA 4M3LA 2IZ1A 4GODA 4A7PA 3AEBC 4H13D 1N7LA 1MFZA 3HUSB 5KJ7D 1VQ4P 1KD1Q 2QJPC 3KPEA 3SWKA 1HJ0A 1SQXJ 2FFDC 2IFNA 5KJ7C 1X8YA 3NFQA 3CXHD 1ZW0A 1GDTA 3BRVB 1J2JB 1K73Q 4H44C 1U57A 3TGUG 3MTUE 1YHQP 3E1IA 3QWOC 4GIFA 2R32A 3AE4C 1KQSO 2W83C 3L74D 3V6IA 2BCCJ 2E74B 1FE6A 4U3FE 3H32A 4WY4D 1NHLA 1A02F 3GHGB 2G3AA 1KFMA 1FDOA 3L74E 2N1TA 4I7ZB 5K5GB 2B89A 3CMEP 2OGUA 2W90A 1M7LA 1RE3C 5CJ0A 2ZXXA 1BE3D 4TT3H 2WQYC 1N7SA 4Y99B 4D6TD 4DT0A 2C0XA 3U1CA 1IFIA 2XV5A 1BCCJ 4RKUJ 1HJBA 1SQVG 5AVSB 1VQNP 1TU3F 1GZLA 2B9BA 1RE3A 2Q7CA 3PRJA 4D6TE 1SQXE 3C8VA 3KQGA 1KILB 2RMZA 2HYNA 4CPGA 2FXPA 5AVYB 1NTMJ 2R3SA 2E76D 3VMAA 3ABVC 1MUUA 3F5HA 3V2RA 3M9BA 1EZVG 5KLVJ 3TNUB 3CC4P 4GDOA 3NXSA 2ZAEB 4W7ZA 3L36A 2GUVA 5APSA 4DZOA 3RL0D 1VQ7P 3MZWB 3RK3D 1IFDA 1VPCA 4LLHA 1NTKJ 2BCCE 4IOIH 1Z56A 1SFCC 2FYNC 4Z1MH 1AQ5A 4JPZB 5CCGA 5AW0B 3KYQA 4NPDA 3RGUA 2WPRA 1JNMA 4RO0A 3A0BE 1NTZJ 3KZIE 3G3ZA 3L73G 1SQPJ 3CMAP 1T2KC 4GKGA 3L75D 1BCCG 1JTHB 3ITKA 3CCLP 2QJYB 5CCHD 1FZGA 1LT9B 1U7JA 1LWUC 2W8ZA 1Y47A 5B66H 1VF5D 2Y9ZA 5GTIH 1LNQA 2B87A 1QVGO 3L75E 2YKQA 1SQXK 5APTA 1CZQA 2NPSA 5APYA 1NTMG 1VF5C 2R3CA 4UB6H 4PD4D 3RK2D 3A7OA 5AW9B 1T8ZA 1WRGA 3D6ZA 1LWUA 4BXLA 4EIJA 5KLVE 1VQ8P 1W2BO 3HUSA 2HLOA 4AYCA 4PD4E 3UIAA 2D2CB 1LT1A 3L72G 5B5EE 1K04A 3W68A 2YO2A 1IZNB 2A45G 1P84I 3V2QA 1T3UA 1NTKE 3HD7A 4L75A 2HFED 1YJWP 2KIKA 3FWNA 1SQPG 3CC2P 4GT1A 1YI2P 1N73B 1E5WA 2O01N 3II6A 1KYOH 2KI7B 3S1KA 5BU8B 3OW2O 1RY3A 2K9YA 2FYUG 2YKPA 1URQB 1AFOA 1DIPA 2E75D 2V7QH 1GMJA 1YYCA 3H1KG 1BGYD 3CX5D 1AQTA 3GHGA 1HTLC 1S4XA 1GL2D 2NZ2A 3LIDA 1FAVA 3BATA 3SFEC 2BEZF 5KLVK 5KLIC 1NKZB 1KILD 3BCCJ 1PP9J 3O8ZA 3LIEA 3CWBG 1JCDA 1NU1J 1DEEG 3H1JD 1NTKK 4BRYB 1RH5B 1L0LG 1YTZT 3TK1A 3TSIA 3PH0A 1KB9D 4HKZH 1SQQE 5AVXB 1YJNP 4OGQC 2QJKC 2G8YA 3L71G 1J1DB 4GOFA 4EYYQ 1JOCA 3H1JE 1IFJA 2FBWC 1GK4A 1PZQA 3CXHI 3MUDA 3CD6P 3N7NA 2YIUB 3CXHH 3H32B 2AXTE 4H44B 3JC22 2N1TB 3VMXA 3JSVC 1CSBA 3IR9A 4WBAA 5AW5B 3H1ID 1R5LA 1N7SB 1FZCC 2V7QJ 1LTSC 3RBXA 1UIIA 1QL2A 5B66E 1JUNA 2QEXP 3B5ND 3M0DA 3Q1MA 5AW2B 2IBZD 3P8CE 1H8AA 1PP9G 3IF4A 3RL0g 4R4LA 1JTHA 2DW3A 4PJ0H 3TDKA 2P67A 1KFNA 3CCSP 4YXDC 1JEKA 1PV3A 2OYHA 2H89C 3WUTA 1Q82Q 1LTAC 3MHVA 1P84D 2JR8A 3H1HD 3LW5H 1SQQK 2A06E 1NJIQ 1BDDA 2WWWA 4OH8B 1L0ND 1FDIA 3CCEP 2XZRA 3CCUP 1RE4C 1XTGB 1NH4A 5KAIH 4KJMA 1P84E 1L4AC 2BASA 2AEJA 2WVRA 1S72P 3CI9A 3KDPB 1KQLA 1L0NE 1EC5A 2WITA 3IAOA 1S3JA 1URQD 5AVVB 1Q81Q 2YMYA 1HBWA 1SQBD 2FYNB 2O1KA 2ZVOB 1N73A 3BASA 2Z4EA 2QM7A 3A0BH 3KZIH 3PP5A 1R5SA 3EQ2A 4H0LB 2W27A 3CL3D 3L74J 1FOSE 3H1LD 1NYHA 2IPPA 3CCRP 1LTTC 3NTNA 1S1CX 3NMDA 1LWUB 2K9JB 4N78D 1Y9BA 1Q90D 3MP7B 1GW3A 2Y9YA 1KZUB 1M57D 2QA4P 5AVWB 5CBNA 3WMM0 1BE3J 2GA1A 3LW5J 4H13C 4I2LC 4JQ0D 3MIWA 1RQVA 3HD7B 4D6TJ 2N9BA 1L0NK 1LP1B 4PD4I 1J1EC 2M3EA 5KAFE 4PD4H 1X79B 2JKVA 4BRYA 1LTJC 5B5EH 1YBKA 1JY3O 2ZJSE 5AW7B 4KHXA 5TJHA 1M90Q 3CXHE 1X9VA 2FXOA 3C1LA 1KN7A 2FFDA 4U3FG 2N1TD 3HTKA 5KJ7A 3TGUD 2JWAA 1FS0E 1JY3N 2ZFCA 3B8EB 1NVOA 1DX7A 1QLED 3OAKA 3L74G 1N7SD 2K88A 3RBZA 1KTMA 3V4WA 1MZ9A 2ZYAA 3TGUE 2WPQA 2KSJA 1LGHB 5L8RJ 3A2AA 4WY4C 1MV8A 2LXBA 4PJ0E 3USSA 1OMIA 1FZFA 3VTPC 1NOHA 3SFDC 2XNXA 3VYIA 2QSIA 1MKMA 5APVA 2Q3EA 2H43A 4D6TG 1SQXG 4I6MC 2IDBA 1GW4A 4ZNCA 4NPFX 4IL6E 3L75J 3CX5I 1BE3E 3P32A 5AW3B 1SQVD 1M1JC 2K37A 5KLIB 3TF5A 5KTBA 2KZIA 3K5BA 3EFFK 5KAIE 2V4HA 5EFWB 2J58A 3E7KA 2R44A 2R5BA 1IO4A 1OVRA 1PPJG 2E76C 3VOPA 2KZJA 2BCCG 4O9BA 5CCGD 1M1JA 4K35A 3AE1C 2J5UA 3VN0A 4OGQB 1FZAA 2QJKB 3O6QB 1KB9I 1JM0A 5CJ4A 1KB9H 3RL0C 3I55P 3RK3C 1H0TA 5TISE 1VQ9P 4Y28J 2E5YA 2AXTH 4OVNF 1S5LE 2PRRA 3RK3E 1DH3A 2IFMA 2KLVA 4H0LD 1T6AA 2ZT9B 2NPSD 3L37A 3L73D 2H8PD 2XDJA 1SFCA 3L75G 3VMYA 1BCCD 2KYVA 2OYHB 1LJ2A 3U59A 5CCHC 2YKOA 4HJGH 3I5CA 2RH0A 4IFMA 1AVOA 2KNCB 3VP9A 3PJSK 1FZBA 4PV1B 1KQFB 1GU4A 1HGZA 5KLVG 2IBZI 3FXDA 1BGYJ 3HD7D 1M56D 2IZ0A 2K9JA 3RK2C 1JMBA 1LTIC 1FC2C 2Q3IA 1AVYA 2UWJE 1IFPA 2E43A 1NTKG 1VQOP 3D6YA 2ZYGA 2QVAA 3G4SP 2B88A 3L70D 3JCUE 2WSSH 3L72D 2HPCA 1P84H 1LP1A 1SQQJ 4LC1A 1S9KD 1KQGB 2CPBA 5DJTB 2P10A 2QIWA 2KUBA 1NTZG 1L4AB 1ZXGA 3H1JJ 2WTYA 2WMMA 3L70E 4XFJA 2Y0EA 2P7JA
chains in the Genus database with same CATH topology
2WPSA 3L35A 1LTSC 2CPSA 3V2NA 1QL2A 1JUNA 4M3LA 1S9KE 2W6BA 3B5ND 3M0DA 1N7LA 5AW2B 3P8CE 1H8AA 1MFZA 2XKMA 4W80A 5CCGC 3HUSB 1JTHA 5KJ7D 2P67A 1KFNA 1RF1C 3MD0A 2L5GB 4W7YA 1FDMA 1SFCD 3KPEA 2FFDC 2IFNA 5KJ7C 1X8YA 2OYHA 1EQ7A 1ZV8A 3NFQA 2OYIC 1NKNA 1LTAC 1GDTA 1FZEA 1LTGC 1SQQK 3LW5H 1CI6B 2E42A 4Y99C 3BRVB 2WWWA 1J2JB 1GU5A 1VDFA 4OH8B 1H88A 1T2KD 4JYCA 3VP8A 4DOJA 3L4FA 2I1KA 1GL2C 3MTUE 2XZRA 3M91A 1JY2O 3E1IA 2PAJA 4GIFA 1RE4C 2NPSC 1XTGB 1FZCB 1NH4A 2R32A 2ZXEB 1SP4A 2POHA 1L4AC 3V5BA 3N4XA 2BASA 2C9LY 1KILC 4ZKPA 5BU5A 3CI9A 3KDPB 1KQLA 1ZLLA 1JY2N 4N3YB 2WITA 1NAFA 3H32A 1JMMA 4WY4D 1NHLA 1A02F 3GHGB 3B5NB 1SQVK 1KFMA 2HG5D 2N1TA 3HUSC 2FFDB 3HTKB 1M7LA 1RE3C 1URQD 2IX7C 5AVVB 2VRSA 4EOTA 5CJ0A 2YMYA 2HODB 5CCHA 1HBWA 2WT7A 3HD7C 1N7SA 2O1KA 1N73A 4Y99B 3BASA 1LTJB 2Z4EA 2C0XA 1HGVA 3U1CA 1FJKA 1IFIA 2QM7A 2Q5UA 2XV5A 3CLQA 3PP5A 3EQ2A 1HJBA 3U1AA 2YNYA 1HWTC 5AVSB 2H7HA 1IFMA 2W27A 3CL3D 2JEEA 1G2CB 1GZLA 2GUSA 1XTCC 1FOSE 2KB7P 1RE3A 2W6AA 2Q7CA 3OJAB 2R5DA 1JY2P 2IPPA 3IFMA 1LTTC 3KQGA 3NTNA 1KILB 1FBMA 3NMDA 3VMZA 2HYNA 3R2PA 1LWUB 2J59M 5AVYB 1N86A 1FOSF 1MUUA 4N78D 3V2RA 1GW3A 3M9BA 1LT9C 4C7NB 3TNUB 1KZUB 2P1JA 5AVWB 3NXSA 4IFDK 3GHGC 3SWFA 3WMM0 4I2LC 3B5NC 4W7ZA 3L36A 3MIWA 4HYTB 1NWQA 3HE4A 1RF0C 1YTZI 3HD7B 2GUVA 5APSA 4DZOA 3RL0D 1FZCA 1G1JA 2N9BA 1L0NK 3RK3D 1IFDA 1VPCA 4LLHA 2WZ7A 1J1EC 1Z56A 1ZR2A 4C7RA 1SFCC 2Q9IA 1X79B 1AQ5A 2FYZA 1LTJC 2KP8A 5CMZA 1JY3O 5CCGA 5AW0B 2XU6A 3KYQA 4KHXA 5AW7B 1ZR4A 2WPRA 2JJLA 1JNMA 1M1JB 1RF1A 4IFFA 1X9VA 3G3ZA 5CHXA 3M06A 5AW4B 1T2KC 4GKGA 2FFDA 2N1TD 3HTKA 5KJ7A 1NTMK 1JTHB 2OYIA 1JY3N 2ZFCA 3B8EB 3HRNA 1DX7A 2HODA 1HUCA 5CCHD 3OAKA 1FZGA 1LT9B 1PFIA 1LWUC 2GM4A 1N7SD 1IK9A 2KOGA 2O1JA 4JYBA 3BRTB 1WT6A 1GL2A 1LTBC 3V4WA 2YKQA 1SQXK 5APTA 1MZ9A 1JO5A 1G1IA 2WPQA 1CZQA 2KSJA 3P8MC 1RE4A 2NPSA 1LGHB 5APYA 5APWA 1G2CA 3A2AA 4WY4C 1MV8A 2R3CA 1J1EB 1L4AA 1SFCB 3RK2D 5AW6B 3A7OA 2P2UA 1QL1A 1KILA 1H89A 5AW9B 1T8ZA 3RL0B 1OWAA 1URQC 1FZFA 1WRGA 3VTPC 1IJDB 1LWUA 1NOHA 2C0WA 2XNXA 4WB4A 3VYIA 4EIJA 5APVA 2H43A 1NTZK 4I6MC 2LKMA 1SQPK 1GW4A 1IC2A 4AQRD 3HUSA 3TNUA 2WSFH 2HLOA 4AYCA 3UIAA 3V4QA 3P32A 2I1JA 5AW3B 3M9QA 1N2DC 1M1JC 2YO2A 5AW1B 2A45G 4ZKUA 3M0DC 3V2QA 1T3UA 3HD7A 2HFED 2FYUK 5KTBA 3P7KA 5BVZA 3H6PA 3TYYA 2J58A 3P8CD 3T97A 5AVQB 1CI6A 4RESB 2R5BA 1IO4A 4GT1A 1N73B 2OYHC 3VOPA 1E5WA 3II6A 4WY4B 4O9BA 2O01H 5CCGD 1SLQA 1NO4A 2FXMA 1M1JA 5BU8B 2M3BA 1IFNA 1RY3A 2HPCB 2YKPA 1DEBA 1URQB 4N6JA 4N78E 3VN0A 1AFOA 1FZAA 3HE5B 3A5TA 3RK2B 4HH2A 5CJ4A 1YYCA 2OARA 3EFGA 5AVRB 3RL0C 1LT9A 3RK3C 1J1DC 3BVHA 1T3JA 4B86A 4I1LA 4JF7A 3GHGA 1HH0A 1W2EA 1ZN5A 3B5NA 1HTLC 1DH3A 2IFMA 2KLVA 3M9HA 1GL2D 1RF0A 3LIDA 5APQA 1L0LK 1FAVA 3BATA 4XA4A 2NPSD 3L37A 2H8PD 2Z5IA 2XDJA 1SFCA 1L4AD 2Z5HA 1JCCA 5KLVK 3VMYA 1SVFA 1NKZB 1LTJA 2N1TC 2KYVA 3HE4B 2A45I 1KILD 5AW8B 2OYHB 3O8ZA 3C9IA 2A45H 1SQBK 3LIEA 1JCDA 3U59A 5CCHC 2QM8A 2YKOA 2YO3A 3I5CA 1N7SC 2C9NY 1HVVA 5APXA 1NTKK 1N73C 1GD2E 4IFMA 1YTZT 3TK1A 1CW5A 3TSIA 2WSCH 3VP9A 1OXZA 1FZBA 1GU4A 1HGZA 1GK6A 2M8RA 1RF1B 5AVUB 5AVXB 4XE5B 4AUWA 3RK3B 3HD7D 1J1DB 1FJPA 5AVZB 2WSEH 5AVTB 1JOCA 5APUA 3RK2C 2OYIB 1LTIC 2FKWB 1JY3P 1IFJA 2Q3IA 1A02J 1GK4A 4C46A 4C7NA 3SWYA 2E43A 3V2PA 3M0AA 3MUDA 3A3YB 4WY4A 3N7NA 3H32B 3MGNA 2PP6A 1GL2B 2HPCA 4LGDE 2N1TB 4LC1A 1S9KD 1URQA 2CPBA 2NPSB 3HE5A 3VMXA 2MJZA 1GTWA 1NU1K 1CSBA 3IR9A 4WBAA 1L4AB 5AW5B 3OA7A 2WTYA 2WT7B 1N7SB 1FU1A 1FZCC 2P7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WIT A;  4HH2 A;  4DOJ A;  3CI9 A;  4WB4 A;  1G1J A;  2O1J A;  4C7R A;  3MIW A;  4LLH A;  2O1K A;  1G1I A;  4WBA A;  2L5G B; 
#chains in the Genus database with same CATH topology
 2WPS A;  2E74 D;  3L35 A;  2FY8 A;  1SQP D;  2CPS A;  3G6E P;  2KS1 A;  1S9K E;  4IL6 X;  4L74 A;  3IN6 A;  4W80 A;  1RF1 C;  2FYU D;  3MD0 A;  2L5G B;  1PGP A;  4DJG A;  2E75 C;  1ZV8 A;  2OYI C;  1NKN A;  3H1K D;  3I56 P;  1IK7 A;  4YTP C;  1CI6 B;  1QVF O;  4Y99 C;  3WUU A;  2BEQ D;  1OVU A;  1H88 A;  3VP8 A;  1BGY E;  3H1I J;  2I1K A;  3CX5 E;  1GL2 C;  3G9R A;  2P58 A;  1JY2 O;  2PAJ A;  1MFT A;  1SP4 A;  3N4X A;  1KIL C;  1SQQ G;  5BU5 A;  1S5L X;  3CWB D;  3Q5R A;  1ZLL A;  1JB0 J;  1JY2 N;  1KIL E;  3H1J G;  1L0L D;  2QJP B;  2HG5 D;  2FFD B;  5KAF H;  3HTK B;  2IX7 C;  3H1H J;  3L71 D;  1OW8 A;  1KB9 E;  1LTJ B;  3E1R A;  1FJK A;  1L0N J;  4JBZ A;  2K1A A;  3CLQ A;  3AE5 C;  1USD A;  2H7H A;  1K05 A;  1IFM A;  3O6Q A;  1XTC C;  2ZT9 D;  1VQ5 P;  2R5D A;  1VQM P;  4L73 A;  3PHL A;  1FBM A;  3CCV P;  2YMK A;  4TLF A;  2L91 A;  3R2P A;  1HF9 A;  1PGO A;  1FOS F;  3AEA C;  1EDL A;  3BCC G;  2QJY C;  1KC8 Q;  1LT9 C;  2YXQ B;  2IYO A;  4C7N B;  1ZME C;  2KSE A;  3H1I E;  1NU1 G;  2P1J A;  3SWF A;  3B5N C;  1SQB J;  3AEF C;  4PV1 D;  1NWQ A;  4HYT B;  1RF0 C;  1YTZ I;  2A06 G;  1FZC A;  1G1J A;  2WZ7 A;  1QX8 A;  2IBZ E;  4IL6 H;  1ZR2 A;  2O3J A;  2M5A A;  1PL5 A;  2FYZ A;  2KP8 A;  3KXD A;  5M1B A;  3H1L J;  2D2C D;  2KNC A;  4KT0 J;  1M1J B;  3CCM P;  4IFF A;  1L2P A;  2LXC B;  3M06 A;  5CHX A;  1EXJ A;  1OFC X;  3H1H E;  2CK3 H;  2ITA A;  2HOD A;  1HUC A;  1H0T B;  2GM4 A;  3BRT B;  2E76 B;  1KYO D;  1WT6 A;  3CCQ P;  1JO5 A;  3GG2 A;  1OZH A;  1DD3 A;  3P8M C;  1RE4 A;  5APW A;  1OIP A;  1G2C A;  1EZV I;  2LR2 A;  3D70 A;  1L4A A;  5TIS H;  1SFC B;  5AW6 B;  4YPC A;  1Q86 Q;  2P2U A;  1QL1 A;  1ZOY C;  1H89 A;  1S5L H;  3RL0 B;  1OWA A;  3PLN A;  1URQ C;  3GW6 A;  2NRG A;  1UIX A;  3PTZ A;  2K3R A;  3TGU J;  3B71 A;  3V4Q A;  1SQB E;  2I1J A;  4K3A A;  2KLU A;  1VL2 A;  5AW1 B;  2N9Y B;  2YXR B;  2I8D A;  3P7K A;  3Q3D A;  3AED C;  3T97 A;  1CI6 A;  3H1L E;  4RES B;  1QEX A;  2AEM A;  3CC7 P;  4ASW A;  2QG4 A;  1VF5 B;  1OW7 A;  2O01 H;  1SLQ A;  1X22 A;  2M3B A;  2HPC B;  4N6J A;  4N78 E;  3A5T A;  3RK2 B;  4HH2 A;  1Q2N A;  2OAR A;  4DCK A;  3JCU H;  1SQV J;  1J1D C;  3BVH A;  1T3J A;  3Q5P A;  4JF7 A;  2KS1 B;  1ZN5 A;  1W2E A;  4H44 D;  3QH9 A;  1USE A;  1YJ9 P;  3FGA D;  4XA4 A;  2YIU C;  2Z5I A;  1U7M A;  4U3F D;  1JCC A;  3AE9 C;  1LTJ A;  2N1T C;  3HE4 B;  2A45 I;  2OTK E;  1K9M Q;  2PFX A;  4L76 A;  5DJU B;  2A45 H;  1SQB K;  1SS1 A;  2JO1 A;  4NPE A;  2QM8 A;  2QE7 H;  2YO3 A;  1N7S C;  1HVV A;  5APX A;  1GD2 E;  1NGM B;  4BWN A;  1CW5 A;  2WSC H;  1QGK B;  1VQP P;  3G71 P;  1RF1 B;  5AVU B;  4XE5 B;  4AUW A;  3GLM A;  1BE3 G;  2E75 B;  3W67 A;  2WSE H;  5AVT B;  5APU A;  5KKZ C;  2OYI B;  2FKW B;  2E5T A;  1A02 J;  4C7N A;  3SWY A;  3V2P A;  3M0A A;  3CX5 H;  1SQX D;  1YQ3 C;  3AE7 C;  3L73 J;  4WY4 A;  1VQL P;  2PP6 A;  1GL2 B;  4LGD E;  4OWF A;  2O01 J;  1YIT P;  3HE5 A;  2MJZ A;  2M0B A;  1SQV E;  3F89 A;  1E79 H;  1PIX A;  3CPW O;  1FU1 A;  1N8R Q;  1BSN A;  3GF3 A;  2ZVN B;  1EZV D;  3V2N A;  1PGQ A;  1PPJ D;  2W6B A;  2BCC D;  4GOE A;  5H2F E;  3FX0 A;  2XKM A;  3CCJ P;  5CCG C;  4WVZ A;  2ZYD A;  2PGD A;  4W7Y A;  1FDM A;  1SFC D;  1EZV E;  1AA0 A;  2OTL P;  3L70 J;  1PPJ E;  1EQ7 A;  2OQQ A;  1AJY A;  3L72 J;  5E79 E;  1FZE A;  1LTG C;  3AEG C;  2E42 A;  1GU5 A;  1VDF A;  1OW6 A;  1T2K D;  4JYC A;  4DOJ A;  3L4F A;  4H0L C;  5GTH E;  3AE8 C;  3Q5S A;  1OX3 A;  3M91 A;  1VQ6 P;  2WSC J;  2NPS C;  1FZC B;  2QRX A;  2ZXE B;  2POH A;  4UB8 E;  3V5B A;  2C9L Y;  2M5A B;  3A0H H;  4ZKP A;  3L73 E;  3WU2 E;  2WSE J;  3WUV A;  4N3Y B;  2WPV B;  1AV1 A;  1BCC E;  1NAF A;  2FYU J;  2IYP A;  2Q6Q A;  1JMM A;  1NTM D;  1BDC A;  3B5N B;  1SQV K;  3HUS C;  2W6J H;  5KLV D;  3H1K J;  2VRS A;  1D7M A;  4EOT A;  1W5C E;  2HOD B;  5CCH A;  4QMA A;  2WT7 A;  3HD7 C;  1NTM E;  1HGV A;  2Q1K A;  2JP3 A;  2Q5U A;  1NTK D;  3AEC C;  3ZDM A;  1M8O B;  3U1A A;  2YNY A;  1HWT C;  3L70 G;  3KHU A;  2JEE A;  1G2C B;  2GUS A;  2KB7 P;  2W6A A;  3OJA B;  1JY2 P;  3IFM A;  3CWB J;  1BSH A;  1NTZ D;  3VMZ A;  3L72 E;  2J59 M;  1L0L J;  1N86 A;  2OTJ P;  2E74 C;  5CBO A;  1KYO I;  4MN4 C;  4IFD K;  3GHG C;  3L71 J;  1NTZ E;  2OYO A;  1SQP E;  4I7Z C;  3HE4 A;  1OVV A;  2RKL A;  2Y0D A;  1BGY G;  2KXP B;  4C7R A;  2Q9I A;  3T97 B;  1ZP0 C;  2FYU E;  1VQK P;  5CMZ A;  1ZR4 A;  2XU6 A;  1S2E A;  1YQ4 C;  2JJL A;  1RF1 A;  3FXE A;  1R8E A;  3H1K E;  5AW4 B;  1NTM K;  4R4M A;  4U7J A;  2OYI A;  3SSU A;  3HRN A;  1ZRT D;  3AE2 C;  1PFI A;  1K8A Q;  1IK9 A;  2KOG A;  2O1J A;  4JYB A;  1SQQ D;  4ASV A;  4H13 B;  3R4Y A;  1GL2 A;  1LTB C;  1G1I A;  2AXC A;  3MUD C;  1ZRT E;  3AE3 C;  4OGQ D;  1KMI Z;  1J1E B;  3CWB E;  1KIL A;  1L0L E;  1IJD B;  2C0W A;  2JWD A;  4WB4 A;  1NTZ K;  2LKM A;  1SQP K;  1IC2 A;  4AQR D;  3TNU A;  2WSF H;  3L71 E;  1RHZ B;  3GMA A;  1EXI A;  3M9Q A;  1N2D C;  5C39 A;  4ZKU A;  3M0D C;  2ZT9 C;  2FYU K;  3H1I G;  5BVZ A;  1Y8A A;  3H6P A;  3TYY A;  3P8C D;  5AVQ B;  1RQU A;  3EWK A;  2Y0C A;  3A0H E;  2OYH C;  3BCC D;  4ZMD A;  4WY4 B;  2IBZ G;  1PP9 D;  1NO4 A;  2FXM A;  1NU1 D;  1IFN A;  3H25 A;  5GTI E;  3AEE C;  1DEB A;  1EDK A;  3HE5 B;  4PV1 C;  2A06 D;  5KKZ B;  3EFG A;  5AVR B;  3S9O A;  4HB1 A;  4UB6 E;  3BCC E;  1LT9 A;  1PP9 E;  4B86 A;  1NU1 E;  3H1H G;  4I1L A;  1HH0 A;  3B5N A;  1WMK A;  2HR3 A;  3M9H A;  1RF0 A;  1L0N G;  2D2C C;  5APQ A;  1L0L K;  3AE6 C;  1EDI A;  1L4A D;  2Z5H A;  3Q2Y A;  1SVF A;  5AW8 B;  2KK7 A;  3C9I A;  1X0T A;  3FWL A;  2MKV A;  1PGJ A;  5H2F H;  1NAY A;  2RN0 A;  4YXW H;  2C9N Y;  1N73 C;  4EDF A;  1EDJ A;  1OXZ A;  1KV4 A;  4RJT A;  1GK6 A;  2M8R A;  2WSF J;  1KYO E;  3RK3 B;  4EI2 A;  1FJP A;  5AVZ B;  2AEF A;  1SQB G;  5E79 H;  1M1K Q;  1JY3 P;  4C46 A;  3D71 A;  5GTH H;  2JDI H;  2XND H;  3A3Y B;  2H88 C;  4U3F J;  1DD4 A;  1YIJ P;  3MGN A;  1Q7Y Q;  3H1L G;  2B87 B;  4UB8 H;  4WWI A;  1URQ A;  3B4S A;  2NPS B;  1GTW A;  1NU1 K;  3WU2 H;  3OA7 A;  2WT7 B;  2SPZ A;  3GF7 A;  3S4R A;  1KOR A;  4M3L A;  2IZ1 A;  4GOD A;  4A7P A;  3AEB C;  4H13 D;  1N7L A;  1MFZ A;  3HUS B;  5KJ7 D;  1VQ4 P;  1KD1 Q;  2QJP C;  3KPE A;  3SWK A;  1HJ0 A;  1SQX J;  2FFD C;  2IFN A;  5KJ7 C;  1X8Y A;  3NFQ A;  3CXH D;  1ZW0 A;  1GDT A;  3BRV B;  1J2J B;  1K73 Q;  4H44 C;  1U57 A;  3TGU G;  3MTU E;  1YHQ P;  3E1I A;  3QWO C;  4GIF A;  2R32 A;  3AE4 C;  1KQS O;  2W83 C;  3L74 D;  3V6I A;  2BCC J;  2E74 B;  1FE6 A;  4U3F E;  3H32 A;  4WY4 D;  1NHL A;  1A02 F;  3GHG B;  2G3A A;  1KFM A;  1FDO A;  3L74 E;  2N1T A;  4I7Z B;  5K5G B;  2B89 A;  3CME P;  2OGU A;  2W90 A;  1M7L A;  1RE3 C;  5CJ0 A;  2ZXX A;  1BE3 D;  4TT3 H;  2WQY C;  1N7S A;  4Y99 B;  4D6T D;  4DT0 A;  2C0X A;  3U1C A;  1IFI A;  2XV5 A;  1BCC J;  4RKU J;  1HJB A;  1SQV G;  5AVS B;  1VQN P;  1TU3 F;  1GZL A;  2B9B A;  1RE3 A;  2Q7C A;  3PRJ A;  4D6T E;  1SQX E;  3C8V A;  3KQG A;  1KIL B;  2RMZ A;  2HYN A;  4CPG A;  2FXP A;  5AVY B;  1NTM J;  2R3S A;  2E76 D;  3VMA A;  3ABV C;  1MUU A;  3F5H A;  3V2R A;  3M9B A;  1EZV G;  5KLV J;  3TNU B;  3CC4 P;  4GDO A;  3NXS A;  2ZAE B;  4W7Z A;  3L36 A;  2GUV A;  5APS A;  4DZO A;  3RL0 D;  1VQ7 P;  3MZW B;  3RK3 D;  1IFD A;  1VPC A;  4LLH A;  1NTK J;  2BCC E;  4IOI H;  1Z56 A;  1SFC C;  2FYN C;  4Z1M H;  1AQ5 A;  4JPZ B;  5CCG A;  5AW0 B;  3KYQ A;  4NPD A;  3RGU A;  2WPR A;  1JNM A;  4RO0 A;  3A0B E;  1NTZ J;  3KZI E;  3G3Z A;  3L73 G;  1SQP J;  3CMA P;  1T2K C;  4GKG A;  3L75 D;  1BCC G;  1JTH B;  3ITK A;  3CCL P;  2QJY B;  5CCH D;  1FZG A;  1LT9 B;  1U7J A;  1LWU C;  2W8Z A;  1Y47 A;  5B66 H;  1VF5 D;  2Y9Z A;  5GTI H;  1LNQ A;  2B87 A;  1QVG O;  3L75 E;  2YKQ A;  1SQX K;  5APT A;  1CZQ A;  2NPS A;  5APY A;  1NTM G;  1VF5 C;  2R3C A;  4UB6 H;  4PD4 D;  3RK2 D;  3A7O A;  5AW9 B;  1T8Z A;  1WRG A;  3D6Z A;  1LWU A;  4BXL A;  4EIJ A;  5KLV E;  1VQ8 P;  1W2B O;  3HUS A;  2HLO A;  4AYC A;  4PD4 E;  3UIA A;  2D2C B;  1LT1 A;  3L72 G;  5B5E E;  1K04 A;  3W68 A;  2YO2 A;  1IZN B;  2A45 G;  1P84 I;  3V2Q A;  1T3U A;  1NTK E;  3HD7 A;  4L75 A;  2HFE D;  1YJW P;  2KIK A;  3FWN A;  1SQP G;  3CC2 P;  4GT1 A;  1YI2 P;  1N73 B;  1E5W A;  2O01 N;  3II6 A;  1KYO H;  2KI7 B;  3S1K A;  5BU8 B;  3OW2 O;  1RY3 A;  2K9Y A;  2FYU G;  2YKP A;  1URQ B;  1AFO A;  1DIP A;  2E75 D;  2V7Q H;  1GMJ A;  1YYC A;  3H1K G;  1BGY D;  3CX5 D;  1AQT A;  3GHG A;  1HTL C;  1S4X A;  1GL2 D;  2NZ2 A;  3LID A;  1FAV A;  3BAT A;  3SFE C;  2BEZ F;  5KLV K;  5KLI C;  1NKZ B;  1KIL D;  3BCC J;  1PP9 J;  3O8Z A;  3LIE A;  3CWB G;  1JCD A;  1NU1 J;  1DEE G;  3H1J D;  1NTK K;  4BRY B;  1RH5 B;  1L0L G;  1YTZ T;  3TK1 A;  3TSI A;  3PH0 A;  1KB9 D;  4HKZ H;  1SQQ E;  5AVX B;  1YJN P;  4OGQ C;  2QJK C;  2G8Y A;  3L71 G;  1J1D B;  4GOF A;  4EYY Q;  1JOC A;  3H1J E;  1IFJ A;  2FBW C;  1GK4 A;  1PZQ A;  3CXH I;  3MUD A;  3CD6 P;  3N7N A;  2YIU B;  3CXH H;  3H32 B;  2AXT E;  4H44 B;  3JC2 2;  2N1T B;  3VMX A;  3JSV C;  1CSB A;  3IR9 A;  4WBA A;  5AW5 B;  3H1I D;  1R5L A;  1N7S B;  1FZC C;  2V7Q J;  1LTS C;  3RBX A;  1UII A;  1QL2 A;  5B66 E;  1JUN A;  2QEX P;  3B5N D;  3M0D A;  3Q1M A;  5AW2 B;  2IBZ D;  3P8C E;  1H8A A;  1PP9 G;  3IF4 A;  3RL0 g;  4R4L A;  1JTH A;  2DW3 A;  4PJ0 H;  3TDK A;  2P67 A;  1KFN A;  3CCS P;  4YXD C;  1JEK A;  1PV3 A;  2OYH A;  2H89 C;  3WUT A;  1Q82 Q;  1LTA C;  3MHV A;  1P84 D;  2JR8 A;  3H1H D;  3LW5 H;  1SQQ K;  2A06 E;  1NJI Q;  1BDD A;  2WWW A;  4OH8 B;  1L0N D;  1FDI A;  3CCE P;  2XZR A;  3CCU P;  1RE4 C;  1XTG B;  1NH4 A;  5KAI H;  4KJM A;  1P84 E;  1L4A C;  2BAS A;  2AEJ A;  2WVR A;  1S72 P;  3CI9 A;  3KDP B;  1KQL A;  1L0N E;  1EC5 A;  2WIT A;  3IAO A;  1S3J A;  1URQ D;  5AVV B;  1Q81 Q;  2YMY A;  1HBW A;  1SQB D;  2FYN B;  2O1K A;  2ZVO B;  1N73 A;  3BAS A;  2Z4E A;  2QM7 A;  3A0B H;  3KZI H;  3PP5 A;  1R5S A;  3EQ2 A;  4H0L B;  2W27 A;  3CL3 D;  3L74 J;  1FOS E;  3H1L D;  1NYH A;  2IPP A;  3CCR P;  1LTT C;  3NTN A;  1S1C X;  3NMD A;  1LWU B;  2K9J B;  4N78 D;  1Y9B A;  1Q90 D;  3MP7 B;  1GW3 A;  2Y9Y A;  1KZU B;  1M57 D;  2QA4 P;  5AVW B;  5CBN A;  3WMM 0;  1BE3 J;  2GA1 A;  3LW5 J;  4H13 C;  4I2L C;  4JQ0 D;  3MIW A;  1RQV A;  3HD7 B;  4D6T J;  2N9B A;  1L0N K;  1LP1 B;  4PD4 I;  1J1E C;  2M3E A;  5KAF E;  4PD4 H;  1X79 B;  2JKV A;  4BRY A;  1LTJ C;  5B5E H;  1YBK A;  1JY3 O;  2ZJS E;  5AW7 B;  4KHX A;  5TJH A;  1M90 Q;  3CXH E;  1X9V A;  2FXO A;  3C1L A;  1KN7 A;  2FFD A;  4U3F G;  2N1T D;  3HTK A;  5KJ7 A;  3TGU D;  2JWA A;  1FS0 E;  1JY3 N;  2ZFC A;  3B8E B;  1NVO A;  1DX7 A;  1QLE D;  3OAK A;  3L74 G;  1N7S D;  2K88 A;  3RBZ A;  1KTM A;  3V4W A;  1MZ9 A;  2ZYA A;  3TGU E;  2WPQ A;  2KSJ A;  1LGH B;  5L8R J;  3A2A A;  4WY4 C;  1MV8 A;  2LXB A;  4PJ0 E;  3USS A;  1OMI A;  1FZF A;  3VTP C;  1NOH A;  3SFD C;  2XNX A;  3VYI A;  2QSI A;  1MKM A;  5APV A;  2Q3E A;  2H43 A;  4D6T G;  1SQX G;  4I6M C;  2IDB A;  1GW4 A;  4ZNC A;  4NPF X;  4IL6 E;  3L75 J;  3CX5 I;  1BE3 E;  3P32 A;  5AW3 B;  1SQV D;  1M1J C;  2K37 A;  5KLI B;  3TF5 A;  5KTB A;  2KZI A;  3K5B A;  3EFF K;  5KAI E;  2V4H A;  5EFW B;  2J58 A;  3E7K A;  2R44 A;  2R5B A;  1IO4 A;  1OVR A;  1PPJ G;  2E76 C;  3VOP A;  2KZJ A;  2BCC G;  4O9B A;  5CCG D;  1M1J A;  4K35 A;  3AE1 C;  2J5U A;  3VN0 A;  4OGQ B;  1FZA A;  2QJK B;  3O6Q B;  1KB9 I;  1JM0 A;  5CJ4 A;  1KB9 H;  3RL0 C;  3I55 P;  3RK3 C;  1H0T A;  5TIS E;  1VQ9 P;  4Y28 J;  2E5Y A;  2AXT H;  4OVN F;  1S5L E;  2PRR A;  3RK3 E;  1DH3 A;  2IFM A;  2KLV A;  4H0L D;  1T6A A;  2ZT9 B;  2NPS D;  3L37 A;  3L73 D;  2H8P D;  2XDJ A;  1SFC A;  3L75 G;  3VMY A;  1BCC D;  2KYV A;  2OYH B;  1LJ2 A;  3U59 A;  5CCH C;  2YKO A;  4HJG H;  3I5C A;  2RH0 A;  4IFM A;  1AVO A;  2KNC B;  3VP9 A;  3PJS K;  1FZB A;  4PV1 B;  1KQF B;  1GU4 A;  1HGZ A;  5KLV G;  2IBZ I;  3FXD A;  1BGY J;  3HD7 D;  1M56 D;  2IZ0 A;  2K9J A;  3RK2 C;  1JMB A;  1LTI C;  1FC2 C;  2Q3I A;  1AVY A;  2UWJ E;  1IFP A;  2E43 A;  1NTK G;  1VQO P;  3D6Y A;  2ZYG A;  2QVA A;  3G4S P;  2B88 A;  3L70 D;  3JCU E;  2WSS H;  3L72 D;  2HPC A;  1P84 H;  1LP1 A;  1SQQ J;  4LC1 A;  1S9K D;  1KQG B;  2CPB A;  5DJT B;  2P10 A;  2QIW A;  2KUB A;  1NTZ G;  1L4A B;  1ZXG A;  3H1J J;  2WTY A;  2WMM A;  3L70 E;  4XFJ A;  2Y0E A;  2P7J A; 
#chains in the Genus database with same CATH homology
 2WPS A;  3L35 A;  1LTS C;  2CPS A;  3V2N A;  1QL2 A;  1JUN A;  4M3L A;  1S9K E;  2W6B A;  3B5N D;  3M0D A;  1N7L A;  5AW2 B;  3P8C E;  1H8A A;  1MFZ A;  2XKM A;  4W80 A;  5CCG C;  3HUS B;  1JTH A;  5KJ7 D;  2P67 A;  1KFN A;  1RF1 C;  3MD0 A;  2L5G B;  4W7Y A;  1FDM A;  1SFC D;  3KPE A;  2FFD C;  2IFN A;  5KJ7 C;  1X8Y A;  2OYH A;  1EQ7 A;  1ZV8 A;  3NFQ A;  2OYI C;  1NKN A;  1LTA C;  1GDT A;  1FZE A;  1LTG C;  1SQQ K;  3LW5 H;  1CI6 B;  2E42 A;  4Y99 C;  3BRV B;  2WWW A;  1J2J B;  1GU5 A;  1VDF A;  4OH8 B;  1H88 A;  1T2K D;  4JYC A;  3VP8 A;  4DOJ A;  3L4F A;  2I1K A;  1GL2 C;  3MTU E;  2XZR A;  3M91 A;  1JY2 O;  3E1I A;  2PAJ A;  4GIF A;  1RE4 C;  2NPS C;  1XTG B;  1FZC B;  1NH4 A;  2R32 A;  2ZXE B;  1SP4 A;  2POH A;  1L4A C;  3V5B A;  3N4X A;  2BAS A;  2C9L Y;  1KIL C;  4ZKP A;  5BU5 A;  3CI9 A;  3KDP B;  1KQL A;  1ZLL A;  1JY2 N;  4N3Y B;  2WIT A;  1NAF A;  3H32 A;  1JMM A;  4WY4 D;  1NHL A;  1A02 F;  3GHG B;  3B5N B;  1SQV K;  1KFM A;  2HG5 D;  2N1T A;  3HUS C;  2FFD B;  3HTK B;  1M7L A;  1RE3 C;  1URQ D;  2IX7 C;  5AVV B;  2VRS A;  4EOT A;  5CJ0 A;  2YMY A;  2HOD B;  5CCH A;  1HBW A;  2WT7 A;  3HD7 C;  1N7S A;  2O1K A;  1N73 A;  4Y99 B;  3BAS A;  1LTJ B;  2Z4E A;  2C0X A;  1HGV A;  3U1C A;  1FJK A;  1IFI A;  2QM7 A;  2Q5U A;  2XV5 A;  3CLQ A;  3PP5 A;  3EQ2 A;  1HJB A;  3U1A A;  2YNY A;  1HWT C;  5AVS B;  2H7H A;  1IFM A;  2W27 A;  3CL3 D;  2JEE A;  1G2C B;  1GZL A;  2GUS A;  1XTC C;  1FOS E;  2KB7 P;  1RE3 A;  2W6A A;  2Q7C A;  3OJA B;  2R5D A;  1JY2 P;  2IPP A;  3IFM A;  1LTT C;  3KQG A;  3NTN A;  1KIL B;  1FBM A;  3NMD A;  3VMZ A;  2HYN A;  3R2P A;  1LWU B;  2J59 M;  5AVY B;  1N86 A;  1FOS F;  1MUU A;  4N78 D;  3V2R A;  1GW3 A;  3M9B A;  1LT9 C;  4C7N B;  3TNU B;  1KZU B;  2P1J A;  5AVW B;  3NXS A;  4IFD K;  3GHG C;  3SWF A;  3WMM 0;  4I2L C;  3B5N C;  4W7Z A;  3L36 A;  3MIW A;  4HYT B;  1NWQ A;  3HE4 A;  1RF0 C;  1YTZ I;  3HD7 B;  2GUV A;  5APS A;  4DZO A;  3RL0 D;  1FZC A;  1G1J A;  2N9B A;  1L0N K;  3RK3 D;  1IFD A;  1VPC A;  4LLH A;  2WZ7 A;  1J1E C;  1Z56 A;  1ZR2 A;  4C7R A;  1SFC C;  2Q9I A;  1X79 B;  1AQ5 A;  2FYZ A;  1LTJ C;  2KP8 A;  5CMZ A;  1JY3 O;  5CCG A;  5AW0 B;  2XU6 A;  3KYQ A;  4KHX A;  5AW7 B;  1ZR4 A;  2WPR A;  2JJL A;  1JNM A;  1M1J B;  1RF1 A;  4IFF A;  1X9V A;  3G3Z A;  5CHX A;  3M06 A;  5AW4 B;  1T2K C;  4GKG A;  2FFD A;  2N1T D;  3HTK A;  5KJ7 A;  1NTM K;  1JTH B;  2OYI A;  1JY3 N;  2ZFC A;  3B8E B;  3HRN A;  1DX7 A;  2HOD A;  1HUC A;  5CCH D;  3OAK A;  1FZG A;  1LT9 B;  1PFI A;  1LWU C;  2GM4 A;  1N7S D;  1IK9 A;  2KOG A;  2O1J A;  4JYB A;  3BRT B;  1WT6 A;  1GL2 A;  1LTB C;  3V4W A;  2YKQ A;  1SQX K;  5APT A;  1MZ9 A;  1JO5 A;  1G1I A;  2WPQ A;  1CZQ A;  2KSJ A;  3P8M C;  1RE4 A;  2NPS A;  1LGH B;  5APY A;  5APW A;  1G2C A;  3A2A A;  4WY4 C;  1MV8 A;  2R3C A;  1J1E B;  1L4A A;  1SFC B;  3RK2 D;  5AW6 B;  3A7O A;  2P2U A;  1QL1 A;  1KIL A;  1H89 A;  5AW9 B;  1T8Z A;  3RL0 B;  1OWA A;  1URQ C;  1FZF A;  1WRG A;  3VTP C;  1IJD B;  1LWU A;  1NOH A;  2C0W A;  2XNX A;  4WB4 A;  3VYI A;  4EIJ A;  5APV A;  2H43 A;  1NTZ K;  4I6M C;  2LKM A;  1SQP K;  1GW4 A;  1IC2 A;  4AQR D;  3HUS A;  3TNU A;  2WSF H;  2HLO A;  4AYC A;  3UIA A;  3V4Q A;  3P32 A;  2I1J A;  5AW3 B;  3M9Q A;  1N2D C;  1M1J C;  2YO2 A;  5AW1 B;  2A45 G;  4ZKU A;  3M0D C;  3V2Q A;  1T3U A;  3HD7 A;  2HFE D;  2FYU K;  5KTB A;  3P7K A;  5BVZ A;  3H6P A;  3TYY A;  2J58 A;  3P8C D;  3T97 A;  5AVQ B;  1CI6 A;  4RES B;  2R5B A;  1IO4 A;  4GT1 A;  1N73 B;  2OYH C;  3VOP A;  1E5W A;  3II6 A;  4WY4 B;  4O9B A;  2O01 H;  5CCG D;  1SLQ A;  1NO4 A;  2FXM A;  1M1J A;  5BU8 B;  2M3B A;  1IFN A;  1RY3 A;  2HPC B;  2YKP A;  1DEB A;  1URQ B;  4N6J A;  4N78 E;  3VN0 A;  1AFO A;  1FZA A;  3HE5 B;  3A5T A;  3RK2 B;  4HH2 A;  5CJ4 A;  1YYC A;  2OAR A;  3EFG A;  5AVR B;  3RL0 C;  1LT9 A;  3RK3 C;  1J1D C;  3BVH A;  1T3J A;  4B86 A;  4I1L A;  4JF7 A;  3GHG A;  1HH0 A;  1W2E A;  1ZN5 A;  3B5N A;  1HTL C;  1DH3 A;  2IFM A;  2KLV A;  3M9H A;  1GL2 D;  1RF0 A;  3LID A;  5APQ A;  1L0L K;  1FAV A;  3BAT A;  4XA4 A;  2NPS D;  3L37 A;  2H8P D;  2Z5I A;  2XDJ A;  1SFC A;  1L4A D;  2Z5H A;  1JCC A;  5KLV K;  3VMY A;  1SVF A;  1NKZ B;  1LTJ A;  2N1T C;  2KYV A;  3HE4 B;  2A45 I;  1KIL D;  5AW8 B;  2OYH B;  3O8Z A;  3C9I A;  2A45 H;  1SQB K;  3LIE A;  1JCD A;  3U59 A;  5CCH C;  2QM8 A;  2YKO A;  2YO3 A;  3I5C A;  1N7S C;  2C9N Y;  1HVV A;  5APX A;  1NTK K;  1N73 C;  1GD2 E;  4IFM A;  1YTZ T;  3TK1 A;  1CW5 A;  3TSI A;  2WSC H;  3VP9 A;  1OXZ A;  1FZB A;  1GU4 A;  1HGZ A;  1GK6 A;  2M8R A;  1RF1 B;  5AVU B;  5AVX B;  4XE5 B;  4AUW A;  3RK3 B;  3HD7 D;  1J1D B;  1FJP A;  5AVZ B;  2WSE H;  5AVT B;  1JOC A;  5APU A;  3RK2 C;  2OYI B;  1LTI C;  2FKW B;  1JY3 P;  1IFJ A;  2Q3I A;  1A02 J;  1GK4 A;  4C46 A;  4C7N A;  3SWY A;  2E43 A;  3V2P A;  3M0A A;  3MUD A;  3A3Y B;  4WY4 A;  3N7N A;  3H32 B;  3MGN A;  2PP6 A;  1GL2 B;  2HPC A;  4LGD E;  2N1T B;  4LC1 A;  1S9K D;  1URQ A;  2CPB A;  2NPS B;  3HE5 A;  3VMX A;  2MJZ A;  1GTW A;  1NU1 K;  1CSB A;  3IR9 A;  4WBA A;  1L4A B;  5AW5 B;  3OA7 A;  2WTY A;  2WT7 B;  1N7S B;  1FU1 A;  1FZC C;  2P7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...