4WBAA

Q/e mutant sa11 nsp4_ccd
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
42
structure length
42
Chain Sequence
IEKQMDRVVKEMRRQLEMIDKLTTRAIEAVELLKRIYDKLTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Plasticity of the Coiled-Coil Domain of Rotavirus NSP4.
pubmed doi rcsb
source organism Simian rotavirus a/sa11
molecule tags Viral protein
molecule keywords Non-structural glycoprotein NSP4
total genus 19
structure length 42
sequence length 42
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2014-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.430 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4wbaA00
2O1KA 4DOJA 2WITA 1G1JA 2O1JA 4WB4A 3MIWA 4HH2A 4WBAA 4C7RA 3CI9A 1G1IA 2L5GB 4LLHA
chains in the Genus database with same CATH superfamily
2WSFJ 1BSNA 3TYYA 2K9JA 2O1JA 2D2CB 2Y0EA 3ITKA 3TF5A 1T3UA 4O9BA 2WT7A 4R4MA 3VTPC 4BRYB 1NAFA 2M8RA 4WY4C 2KOGA 4LLHA 2P2UA 2HFED 1DD3A 3RL0g 1L0NJ 1NTZG 5APWA 1KQFB 2WT7B 3CC4P 4RO0A 3A0BH 1HGVA 3AE5C 1NTKK 1VQ9P 3H1JD 1EDKA 1OIPA 2FY8A 2GUVA 2NPSB 4AQRD 5B66H 1BE3D 1JOCA 4L76A 3HUSA 3B71A 2QSIA 3SWYA 1SQPK 1QGKB 2QA4P 2NPSA 1OZHA 2DW3A 1L4AC 3KQGA 1J1DC 1HUCA 3AEGC 2JWAA 4DJGA 3KZIH 2JR8A 3IR9A 1W5CE 3L75J 2H8PD 3BASA 1RQVA 3HD7A 1M1JC 4IFMA 3VP8A 1NOHA 1BCCG 3B8EB 2E76D 2J5UA 3AEEC 1SQBD 2W27A 1S72P 1FZFA 3QH9A 2KSJA 1BCCJ 3C8VA 3M0AA 1PGPA 4XFJA 2C0WA 3L71J 2OTKE 2YKPA 3RK2C 1IFMA 1IFDA 1L0LG 2ZYAA 5TISE 1AJYA 1RF1A 2QVAA 1DX7A 2P1JA 2BCCD 2IFNA 1NU1D 2HYNA 2ZXXA 3BRTB 2E75D 3L70G 2BCCG 3L70D 1ZW0A 2C0XA 1IK9A 1OWAA 4PJ0E 4R4LA 2PRRA 3L35A 4UB8H 2N1TC 2NRGA 1M90Q 2J58A 2O1KA 5DJTB 3HRNA 2YO3A 3I55P 3JSVC 2QJYC 1S3JA 1M8OB 2E74B 1FOSF 1Y47A 1FZEA 2Q5UA 1A02F 1QVFO 1L2PA 3AE9C 1N73C 2YXQB 1SQXE 3RK2D 2R3SA 1HTLC 1NU1E 3H1IG 5M1BA 1JCCA 1K8AQ 2N1TA 5KTBA 1IFIA 3RK2B 4U3FG 4H13B 1JY3P 1DEBA 2L91A 3HE4B 3L72E 3PP5A 1T2KD 1KYOH 2B87B 2IX7C 2QJPC 3CXHH 2Q6QA 5APYA 3FXDA 2FFDA 1VQ6P 1KN7A 3CX5D 2N1TD 3CCVP 3WMM0 3P8CE 1KFMA 2B87A 3H1KD 1AVYA 2OGUA 5GTIH 4L73A 3U1AA 3CD6P 4B86A 1LTIC 1URQA 4PD4H 1EDLA 2WPVB 2YMYA 1G2CA 3BATA 4NPFX 1OVUA 1KQLA 1KZUB 1FOSE 5TJHA 2B9BA 5KLVE 3G71P 3B5NC 5H2FE 2HPCA 2KS1A 2P7JA 1L0NG 1NTZJ 1FZCA 1LTSC 2V7QJ 4W80A 2JEEA 1SQQK 5KJ7C 1GU4A 2OYHC 4OGQB 1DD4A 1LNQA 3TGUE 1JM0A 1N7SA 2QEXP 1RF0C 1R5LA 4L75A 5AW3B 3MGNA 5CCGD 3LIDA 5CCHD 1H89A 1PIXA 1FZCB 2E43A 3O6QB 3V2RA 2FYUD 1SQXG 4PD4I 5AW2B 1VF5B 1JNMA 5APTA 3E1RA 2WTYA 1L0LD 3BCCE 3IFMA 3MHVA 2V7QH 3BCCG 2QE7H 1S5LX 2ITAA 2KZJA 2W6JH 2H7HA 1BGYJ 2YIUC 1BCCE 3CWBG 3H1LG 3W68A 1CW5A 1EZVI 2ZFCA 4YPCA 1GMJA 2KP8A 2W90A 3CWBD 2NPSD 4IFFA 4BRYA 5KLVJ 3I56P 2IYOA 1JEKA 2ZVOB 4YXWH 2IDBA 3TSIA 3EWKA 1N86A 3ZDMA 3S9OA 1XTCC 4OWFA 3VMYA 5APSA 1FBMA 2VRSA 2WVRA 4WB4A 1NTMK 1FZGA 2H43A 2K3RA 2QM8A 3PLNA 2YO2A 1YJWP 2YNYA 4C7NA 2LXCB 2Y0CA 3H1JG 4D6TJ 2C9LY 4N6JA 4D6TG 3C1LA 1QLED 3H1ID 4OGQD 2A45I 4U3FE 1PP9D 3PHLA 2QM7A 2PAJA 3HD7B 1RHZB 4GDOA 4U7JA 1PGJA 2WSFH 3KHUA 2WITA 1M7LA 3CX5I 4EI2A 2XU6A 4EYYQ 1KYOD 1NU1K 2H88C 1YJNP 3L72J 3M9QA 2K88A 5EFWB 2UWJE 4RESB 1BGYG 1JY2O 1NKNA 5KAIH 4WWIA 5AW8B 5CJ4A 3CWBE 4K3AA 2FYUK 3M9HA 3MP7B 3A0HE 1JB0J 2W8ZA 3L73G 3PH0A 3SWFA 5KJ7A 1K9MQ 1FZCC 1KILE 1RF1B 1M56D 1AQ5A 4OGQC 3A7OA 3GG2A 2FYNC 1EZVG 1L0LE 2CK3H 2JDIH 2XNXA 3BCCD 5AVQB 1NO4A 1VQNP 3V2QA 1HF9A 2E74C 5AVYB 3RBZA 1CI6B 1IJDB 1J1DB 4UB6H 3RL0D 4C7RA 1PP9E 1P84E 1NTZE 2IYPA 3L36A 3M91A 1ZV8A 1S9KE 1NTKG 3GMAA 3A5TA 3AE2C 1SQPD 1RE4C 2LR2A 2R5BA 2ZVNB 2ZXEB 2YIUB 4HJGH 1IFNA 1BCCD 1SQQE 2J59M 3N7NA 1FZAA 4AYCA 1ZRTE 5CHXA 1GW4A 1NAYA 2E75B 2E42A 4YXDC 1KMIZ 3IAOA 4PV1D 1CSBA 4JYBA 3F5HA 1SLQA 1SFCB 4KJMA 1IFJA 4BWNA 2KNCA 2XZRA 5E79H 1BGYE 5APUA 3RL0C 2QG4A 3SWKA 1VQMP 1Q82Q 4I1LA 1JMBA 1SFCA 3Q3DA 1YIJP 1HJBA 3H1LE 3S4RA 1PP9J 3AE7C 1MV8A 1VL2A 3CXHI 2CPBA 1SQVJ 1Z56A 1DEEG 2IBZE 3IF4A 4OVNF 2OTLP 2IBZG 1U57A 1QL1A 4D6TD 3H32B 2AXTH 1SS1A 2AXCA 2IBZD 2RN0A 1FZBA 4RJTA 1PFIA 2V4HA 2M3EA 3VMAA 2FYZA 1N8RQ 3L73J 2NZ2A 4IFDK 4HH2A 4N78E 3HTKB 3KDPB 2WSCH 3V4WA 1VQLP 4CPGA 3CX5E 1BE3G 3AE6C 3AE1C 3A2AA 1L4AB 2BCCJ 2HG5D 2KLUA 3AE3C 3LW5J 2R3CA 3HTKA 3P7KA 4GOEA 3KYQA 4PD4D 1BGYD 1NTZD 3TGUG 3E1IA 1G1JA 2HODB 2W83C 4QMAA 4C7NB 2H89C 4H0LB 1IFPA 1SQXJ 1T3JA 1HGZA 4ZMDA 3H1KG 2M3BA 2P58A 1MKMA 1SQVE 2CPSA 5GTHE 1NJIQ 1YQ3C 1SQBJ 4I6MC 1SQVG 3RK3B 1NVOA 3K5BA 2D2CD 4XE5B 2IZ0A 1UIIA 2A45G 1GL2C 2QJKC 2QJYB 3RK3D 1NGMB 1P84I 1ZN5A 1M57D 3AE4C 3L73E 2E5TA 2W6AA 5KKZB 1ZR4A 1Q7YQ 1Q81Q 3L75E 4BXLA 1GTWA 2WSCJ 4EIJA 3TK1A 4JF7A 1JY2N 1VQKP 1X22A 4WVZA 1D7MA 4WY4D 2YXRB 1EQ7A 2OYOA 1HJ0A 1ZP0C 5DJUB 5CCHA 1N7SD 3L74G 2WQYC 2O01H 3MTUE 3R4YA 2C9NY 1OFCX 1J1EB 1R5SA 4MN4C 1FDMA 2I1JA 3GHGB 4W7ZA 1BE3E 1P84D 1L0NK 2IZ1A 1VDFA 3OJAB 1PPJD 5AW6B 1N73B 1USEA 1SQQG 1CZQA 3D71A 1HBWA 1CI6A 2G3AA 5CCHC 3RK3C 1SQBE 1GL2D 1H88A 3OAKA 1URQD 3CCJP 2MJZA 1MFTA 1ZMEC 4NPEA 3CXHE 3FWNA 3GLMA 3WU2H 2IBZI 3OA7A 4ASVA 1VPCA 4XA4A 1SQXK 1VQ4P 3H1IE 3JCUH 2Q1KA 2OYIB 5AVXB 5TISH 5KLVG 1J1EC 1NWQA 1H8AA 3L73D 1LWUA 2A06G 4H44C 1RF0A 3CI9A 1KILB 1FU1A 2R5DA 3L4FA 4IL6E 2FYUJ 2AEFA 4JYCA 1S5LH 1OW7A 3H6PA 4EDFA 3CCQP 1EXIA 1U7MA 3GF7A 5AVZB 5CBNA 1WRGA 1SQVD 3TNUA 2I1KA 1M1JA 1MZ9A 2XNDH 1KILA 3L70J 3PJSK 2WWWA 1G1IA 3AEAC 4M3LA 4YTPC 1MFZA 3V5BA 3BVHA 3A3YB 3L74E 4H13C 1PPJE 2E75C 3F89A 2Y0DA 2FFDB 1BSHA 1H0TA 3CCRP 1ZR2A 4PV1C 4ZKPA 1NTKE 1E79H 3FWLA 3AECC 3D6YA 2Q7CA 3EFGA 1G2CB 3RL0B 1VF5C 2WSEJ 3H1IJ 3H1JJ 1KB9H 3GW6A 1SQBG 1LTBC 2K37A 4H44D 4C46A 3M9BA 1EDJA 2HPCB 4JBZA 4PD4E 2GUSA 3SFDC 1KQSO 1SQPJ 3II6A 4WY4A 3V2NA 3D6ZA 2ZAEB 2O3JA 3TGUJ 2PFXA 1NU1G 2AXTE 3SFEC 1DIPA 2Z5IA 1RQUA 5AVWB 3CMEP 2G8YA 2HODA 2FBWC 2N9YB 5KLVD 3O6QA 3S1KA 2A06E 3CWBJ 2FYUG 2XV5A 5BVZA 2WPRA 2WSEH 3BCCJ 3NMDA 1LTTC 2O01N 4HKZH 3G6EP 3M06A 1K05A 3G3ZA 3H25A 4OH8B 1L0LJ 3Q2YA 1A02J 5AVUB 5CJ0A 1FJKA 2ZT9B 1GZLA 3H1LD 2A06D 3KZIE 5AW1B 4AUWA 2Q9IA 2KXPB 1GK6A 1NKZB 2JO1A 3AEDC 3MZWB 1ZRTD 2JP3A 4JQ0D 4JPZB 3L72D 1PP9G 5APVA 2YKOA 3V4QA 1K04A 3G9RA 3CCUP 4IL6H 4Z1MH 1W2EA 1QL2A 2R32A 1JO5A 1FAVA 2KYVA 4H0LD 1KQGB 2D2CC 1SQQJ 1SVFA 5KLIB 1GDTA 5GTIE 1AQTA 1YHQP 3AE8C 3EQ2A 3PRJA 2OARA 3OW2O 3L71D 3NXSA 4HYTB 2JJLA 3V6IA 3U59A 3VN0A 1KFNA 2OYHA 1JY2P 1FE6A 3NFQA 1N7SC 5KAFE 4Y28J 4GT1A 1JTHB 2BEZF 1OW6A 5B5EE 4DCKA 2P10A 3H1HE 3H1HG 2YMKA 2WZ7A 5APXA 5AW7B 3HE5B 1IO4A 2RH0A 2XKMA 3QWOC 1IK7A 3Q5RA 1LTAC 1T2KC 3AEBC 1LTJB 2IPPA 3KPEA 3MIWA 3GHGA 2HR3A 3B5NA 1LWUB 5B66E 5BU5A 3HE5A 2WPQA 1OXZA 2A45H 1NTME 1X79B 1M1KQ 2R44A 2SPZA 3WU2E 1R8EA 1NTZK 1KB9D 1KYOE 1QEXA 1M1JB 2FXMA 4HB1A 1VQOP 2BCCE 1SP4A 3Q5SA 3H1JE 3JCUE 1ZOYC 1YTZI 3CC2P 2AEMA 1LT9B 1OX3A 3CC7P 1FDIA 2ZYDA 1U7JA 1H0TB 1NU1J 2POHA 4TLFA 1KILD 4W7YA 1X8YA 3FGAD 1MUUA 3O8ZA 2Z4EA 1LGHB 4UB6E 3AEFC 5AVTB 3E7KA 1SQPG 3HE4A 4U3FD 3U1CA 3CCEP 4PJ0H 3MUDA 2WSSH 5CCGC 5AVRB 1NYHA 1SQVK 4GODA 4IOIH 4UB8E 5L8RJ 1W2BO 4H13D 2M0BA 2OQQA 4TT3H 3G4SP 3VP9A 1HH0A 3NTNA 3WUUA 3TDKA 1NTMJ 1URQB 3GHGC 1RE4A 2MKVA 3H1KJ 3L75G 3VMZA 2E76C 1PGOA 1SQQD 3GF3A 2E74D 2KI7B 3L75D 2RKLA 2AEJA 2KB7P 4I7ZB 4LC1A 1L0LK 4A7PA 4ZNCA 1S9KD 2KS1B 1GL2A 1USDA 1YBKA 1KILC 3P32A 4ZKUA 5AVVB 1AVOA 5B5EH 1YYCA 1BE3J 4WBAA 3CXHD 1N7SB 3W67A 5KLVK 3B4SA 2FXPA 2OYIC 1PL5A 2JKVA 2PGDA 4DZOA 4NPDA 3FX0A 3IN6A 3VYIA 3D70A 1ZLLA 1OVRA 1JCDA 2KK7A 2N9BA 1S1CX 2ZYGA 1YITP 3BRVB 1JMMA 1OVVA 2O01J 1L4AA 2YKQA 4I7ZC 2QJPB 3T97A 1EXJA 3H1KE 3A0BE 2FFDC 2E76B 1JY3O 1OMIA 5CBOA 3EFFK 2GM4A 1ZXGA 2K1AA 1J2JB 2LKMA 2ZT9D 3H1HJ 2WMMA 2K9JB 4L74A 1N2DC 1AV1A 1LT9C 1KB9E 2QRXA 1XTGB 3M0DC 2FYUE 5AW0B 1PZQA 1KYOI 1JY3N 1LT1A 1NTMD 1WMKA 1X9VA 1KORA 5AVSB 5BU8B 3P8CD 1KD1Q 2OYHB 3PTZA 4H0LC 4ASWA 1AFOA 4RKUJ 1KC8Q 1N7LA 1EZVE 1JTHA 1NHLA 1L4AD 1TU3F 1YQ4C 3C9IA 3VMXA 3CCSP 3FXEA 3L74J 3KXDA 3Q1MA 1E5WA 1LP1A 2BASA 2P67A 2K9YA 4KHXA 4IL6X 3WUVA 5AW9B 1BDDA 1PPJG 4U3FJ 4K35A 5AW5B 3V2PA 1KTMA 1T6AA 5CCGA 1Y9BA 3HUSB 1GW3A 1NTKJ 1VF5D 1LTJA 1FS0E 1LP1B 2E5YA 2KLVA 1L0NE 2Q3IA 2ZJSE 5GTHH 1IZNB 4DT0A 4H44B 1Q2NA 5KAIE 2ZT9C 4N78D 3CPWO 5E79E 1FDOA 1SQBK 2Q3EA 1OW8A 3VOPA 1QVGO 1RF1C 5K5GB 1K73Q 1S5LE 1T8ZA 2LXBA 3L37A 1SQPE 3USSA 4EOTA 1VQ5P 1PGQA 2XDJA 1N73A 1NH4A 4KT0J 1BDCA 1LTJC 5APQA 1WT6A 2GA1A 3CX5H 4GIFA 1SFCD 1LT9A 1FC2C 2B89A 2RMZA 3I5CA 1L0ND 3M0DA 3RGUA 1VQPP 4PV1B 3N4XA 3H1HD 1HWTC 2KSEA 3R2PA 3CCLP 3CCMP 1RE3C 1EDIA 3B5NB 3L72G 2HLOA 2FKWB 5AW4B 2Z5HA 5H2FH 3CL3D 5KLIC 1RY3A 4Y99C 3RK3E 1Q86Q 3TGUD 2OYIA 2W6BA 2N1TB 2KIKA 2KUBA 1RH5B 1EC5A 1S4XA 3JC22 4LGDE 2NPSC 3L71E 3LW5H 1YTZT 1YI2P 3L71G 5KAFH 3WUTA 1FJPA 1RE3A 1NTMG 2QIWA 1LTGC 1Y8AA 3L70E 3LIEA 3HD7C 1EZVD 1GK4A 5CMZA 3TNUB 4DOJA 2FXOA 3A0HH 3CMAP 1YJ9P 1KV4A 5KKZC 1SFCC 1HVVA 4D6TE 1URQC 1UIXA 1LWUC 1GL2B 1S2EA 2QJKB 3ABVC 3MD0A 4Y99B 3P8MC 3UIAA 2KZIA 1PV3A 1KB9I 1VQ7P 4GKGA 5C39A 1NTKD 1LJ2A 3Q5PA 2B88A 2FYNB 2I8DA 2KNCB 2OTJP 4I2LC 2Y9ZA 1P84H 2IFMA 2JWDA 2Y9YA 1VQ8P 3HUSC 4N3YB 3L74D 2WPSA 3B5ND 3H1LJ 4GOFA 1SQXD 2L5GB 5KJ7D 3MUDC 1DH3A 2M5AB 2PP6A 4WY4B 1QX8A 3RBXA 1AA0A 3H32A 3HD7D 1IC2A 3T97B 1GU5A 1JUNA 1GD2E 3SSUA 2BEQD 3CLQA 1X0TA 2M5AA 1Q90D
chains in the Genus database with same CATH topology
3TYYA 2O1JA 2WT7A 1T3UA 4O9BA 3VTPC 1NAFA 2M8RA 4WY4C 2KOGA 4LLHA 2P2UA 2HFED 2WT7B 5APWA 1HGVA 1NTKK 2NPSB 2GUVA 4AQRD 1JOCA 3HUSA 3SWYA 1SQPK 2NPSA 1L4AC 3KQGA 1J1DC 1HUCA 3IR9A 3VP8A 2H8PD 3BASA 3HD7A 4IFMA 1M1JC 1NOHA 3B8EB 2W27A 1FZFA 2KSJA 3M0AA 2C0WA 2YKPA 3RK2C 1IFMA 1IFDA 1RF1A 1DX7A 2P1JA 2IFNA 2HYNA 3BRTB 2C0XA 1IK9A 1OWAA 3L35A 2N1TC 2J58A 2O1KA 3HRNA 2YO3A 1FOSF 2Q5UA 1FZEA 1A02F 3RK2D 1HTLC 1JCCA 2N1TA 5KTBA 1IFIA 3RK2B 1JY3P 1DEBA 3HE4B 3PP5A 1T2KD 2IX7C 5APYA 2FFDA 2N1TD 3WMM0 3P8CE 1KFMA 3U1AA 4B86A 1LTIC 1URQA 2YMYA 1G2CA 3BATA 1KQLA 1KZUB 1FOSE 3B5NC 2HPCA 2P7JA 1FZCA 1LTSC 4W80A 2JEEA 1SQQK 5KJ7C 1GU4A 2OYHC 1N7SA 1RF0C 5CCHD 5AW3B 5CCGD 3MGNA 1H89A 3LIDA 1FZCB 2E43A 3V2RA 5AW2B 1JNMA 5APTA 2WTYA 3IFMA 2H7HA 1JUNA 1CW5A 1N73C 2ZFCA 2KP8A 2NPSD 4IFFA 3TSIA 1N86A 1XTCC 3VMYA 5APSA 1FBMA 2VRSA 4WB4A 2H43A 1NTMK 1FZGA 2QM8A 2YO2A 2YNYA 4C7NA 2C9LY 4N6JA 2A45I 2QM7A 2PAJA 3HD7B 2WSFH 2WITA 1M7LA 2XU6A 1NU1K 3M9QA 4RESB 1JY2O 1NKNA 5AW8B 5CJ4A 2FYUK 3M9HA 1FZCC 3SWFA 5KJ7A 1RF1B 1AQ5A 3A7OA 5AVQB 2XNXA 1NO4A 3V2QA 5AVYB 1CI6B 1IJDB 1J1DB 3RL0D 4C7RA 3L36A 3M91A 1ZV8A 1S9KE 3A5TA 2R5BA 1RE4C 2ZXEB 1IFNA 3N7NA 2J59M 1FZAA 4AYCA 5CHXA 1GW4A 2E42A 1CSBA 4JYBA 1SLQA 1SFCB 1IFJA 2XZRA 5APUA 3RL0C 4I1LA 1SFCA 1HJBA 1MV8A 2CPBA 1Z56A 1QL1A 3H32B 1FZBA 1PFIA 2FYZA 4IFDK 4HH2A 3HTKB 3KDPB 2WSCH 3V4WA 3A2AA 1L4AB 2HG5D 2R3CA 3P7KA 3HTKA 3KYQA 3E1IA 1G1JA 2HODB 4C7NB 1T3JA 1HGZA 2M3BA 2CPSA 4I6MC 3RK3B 4XE5B 2A45G 3RK3D 1GL2C 1ZN5A 2W6AA 1ZR4A 1GTWA 4EIJA 3TK1A 4JF7A 1JY2N 4WY4D 1EQ7A 5CCHA 1N7SD 2O01H 3MTUE 2C9NY 1J1EB 1FDMA 2I1JA 3GHGB 4W7ZA 3OJAB 1L0NK 1VDFA 5AW6B 1N73B 1HBWA 1CZQA 1CI6A 5CCHC 3RK3C 1GL2D 1H88A 3OAKA 1URQD 2MJZA 3OA7A 1VPCA 4XA4A 1SQXK 2OYIB 5AVXB 1J1EC 1NWQA 1H8AA 1LWUA 1RF0A 3CI9A 1KILB 1FU1A 2R5DA 3L4FA 4JYCA 3H6PA 5AVZB 1WRGA 3TNUA 2I1KA 1M1JA 1MZ9A 4M3LA 1KILA 2WWWA 1G1IA 3V5BA 1MFZA 3BVHA 3A3YB 2FFDB 1ZR2A 4ZKPA 2Q7CA 3EFGA 1G2CB 3RL0B 1LTBC 4C46A 3M9BA 2HPCB 2GUSA 3II6A 4WY4A 3V2NA 2Z5IA 5AVWB 2HODA 2XV5A 5BVZA 2WPRA 2WSEH 3NMDA 1LTTC 3M06A 3G3ZA 4OH8B 1A02J 5AVUB 5CJ0A 1FJKA 1GZLA 4AUWA 5AW1B 1GK6A 1NKZB 5APVA 3V4QA 2YKOA 1W2EA 1QL2A 2R32A 1JO5A 1FAVA 2KYVA 1GDTA 1SVFA 3EQ2A 2OARA 3NXSA 4HYTB 2JJLA 3U59A 3VN0A 1KFNA 2OYHA 1JY2P 3NFQA 1N7SC 4GT1A 1JTHB 2WZ7A 5APXA 5AW7B 3HE5B 1IO4A 2XKMA 1T2KC 1LTAC 1LTJB 2IPPA 3KPEA 3MIWA 3GHGA 3B5NA 1LWUB 5BU5A 3HE5A 2WPQA 1OXZA 2A45H 1X79B 1NTZK 2FXMA 1M1JB 1SP4A 1YTZI 1LT9B 2POHA 1KILD 4W7YA 1X8YA 3O8ZA 1MUUA 2Z4EA 1LGHB 5AVTB 3U1CA 3HE4A 3MUDA 5CCGC 5AVRB 1SQVK 3VP9A 1HH0A 3NTNA 1URQB 3GHGC 1RE4A 3VMZA 2KB7P 4LC1A 1L0LK 1S9KD 1GL2A 1KILC 3P32A 4ZKUA 5AVVB 1YYCA 4WBAA 5KLVK 1N7SB 2OYIC 4DZOA 3VYIA 1ZLLA 1JCDA 2N9BA 3BRVB 1JMMA 1L4AA 2YKQA 3T97A 2FFDC 1JY3O 2GM4A 2LKMA 1J2JB 1N2DC 5AW0B 1LT9C 3M0DC 1XTGB 1JY3N 1X9VA 2OYHB 5AVSB 1AFOA 5BU8B 3P8CD 1N7LA 3C9IA 1JTHA 1NHLA 1L4AD 3VMXA 1E5WA 2P67A 2BASA 4KHXA 5AW9B 3V2PA 5AW5B 5CCGA 3HUSB 1GW3A 4EOTA 1LTJA 2Q3IA 2KLVA 4N78D 1SQBK 3VOPA 1RF1C 1T8ZA 3L37A 1N73A 2XDJA 1NH4A 1LTJC 5APQA 1WT6A 4GIFA 1SFCD 1LT9A 3I5CA 3M0DA 1HWTC 3N4XA 3R2PA 1RE3C 3B5NB 5AW4B 2HLOA 2FKWB 2Q9IA 2Z5HA 3CL3D 2OYIA 1RY3A 4Y99C 2W6BA 2N1TB 4LGDE 2NPSC 3LW5H 1YTZT 1FJPA 1RE3A 3LIEA 4N78E 1LTGC 5CMZA 3TNUB 4DOJA 3HD7C 1GK4A 1SFCC 1HVVA 1URQC 1LWUC 1GL2B 3UIAA 3MD0A 4Y99B 3P8MC 4GKGA 4I2LC 2IFMA 3HUSC 4N3YB 2WPSA 3B5ND 1DH3A 2L5GB 5KJ7D 2PP6A 4WY4B 3H32A 3HD7D 1IC2A 1GU5A 1GD2E 3CLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O1K A;  4DOJ A;  2WIT A;  1G1J A;  2O1J A;  4WB4 A;  3MIW A;  4HH2 A;  4WBA A;  4C7R A;  3CI9 A;  1G1I A;  2L5G B;  4LLH A; 
#chains in the Genus database with same CATH topology
 2WSF J;  1BSN A;  3TYY A;  2K9J A;  2O1J A;  2D2C B;  2Y0E A;  3ITK A;  3TF5 A;  1T3U A;  4O9B A;  2WT7 A;  4R4M A;  3VTP C;  4BRY B;  1NAF A;  2M8R A;  4WY4 C;  2KOG A;  4LLH A;  2P2U A;  2HFE D;  1DD3 A;  3RL0 g;  1L0N J;  1NTZ G;  5APW A;  1KQF B;  2WT7 B;  3CC4 P;  4RO0 A;  3A0B H;  1HGV A;  3AE5 C;  1NTK K;  1VQ9 P;  3H1J D;  1EDK A;  1OIP A;  2FY8 A;  2GUV A;  2NPS B;  4AQR D;  5B66 H;  1BE3 D;  1JOC A;  4L76 A;  3HUS A;  3B71 A;  2QSI A;  3SWY A;  1SQP K;  1QGK B;  2QA4 P;  2NPS A;  1OZH A;  2DW3 A;  1L4A C;  3KQG A;  1J1D C;  1HUC A;  3AEG C;  2JWA A;  4DJG A;  3KZI H;  2JR8 A;  3IR9 A;  1W5C E;  3L75 J;  2H8P D;  3BAS A;  1RQV A;  3HD7 A;  1M1J C;  4IFM A;  3VP8 A;  1NOH A;  1BCC G;  3B8E B;  2E76 D;  2J5U A;  3AEE C;  1SQB D;  2W27 A;  1S72 P;  1FZF A;  3QH9 A;  2KSJ A;  1BCC J;  3C8V A;  3M0A A;  1PGP A;  4XFJ A;  2C0W A;  3L71 J;  2OTK E;  2YKP A;  3RK2 C;  1IFM A;  1IFD A;  1L0L G;  2ZYA A;  5TIS E;  1AJY A;  1RF1 A;  2QVA A;  1DX7 A;  2P1J A;  2BCC D;  2IFN A;  1NU1 D;  2HYN A;  2ZXX A;  3BRT B;  2E75 D;  3L70 G;  2BCC G;  3L70 D;  1ZW0 A;  2C0X A;  1IK9 A;  1OWA A;  4PJ0 E;  4R4L A;  2PRR A;  3L35 A;  4UB8 H;  2N1T C;  2NRG A;  1M90 Q;  2J58 A;  2O1K A;  5DJT B;  3HRN A;  2YO3 A;  3I55 P;  3JSV C;  2QJY C;  1S3J A;  1M8O B;  2E74 B;  1FOS F;  1Y47 A;  1FZE A;  2Q5U A;  1A02 F;  1QVF O;  1L2P A;  3AE9 C;  1N73 C;  2YXQ B;  1SQX E;  3RK2 D;  2R3S A;  1HTL C;  1NU1 E;  3H1I G;  5M1B A;  1JCC A;  1K8A Q;  2N1T A;  5KTB A;  1IFI A;  3RK2 B;  4U3F G;  4H13 B;  1JY3 P;  1DEB A;  2L91 A;  3HE4 B;  3L72 E;  3PP5 A;  1T2K D;  1KYO H;  2B87 B;  2IX7 C;  2QJP C;  3CXH H;  2Q6Q A;  5APY A;  3FXD A;  2FFD A;  1VQ6 P;  1KN7 A;  3CX5 D;  2N1T D;  3CCV P;  3WMM 0;  3P8C E;  1KFM A;  2B87 A;  3H1K D;  1AVY A;  2OGU A;  5GTI H;  4L73 A;  3U1A A;  3CD6 P;  4B86 A;  1LTI C;  1URQ A;  4PD4 H;  1EDL A;  2WPV B;  2YMY A;  1G2C A;  3BAT A;  4NPF X;  1OVU A;  1KQL A;  1KZU B;  1FOS E;  5TJH A;  2B9B A;  5KLV E;  3G71 P;  3B5N C;  5H2F E;  2HPC A;  2KS1 A;  2P7J A;  1L0N G;  1NTZ J;  1FZC A;  1LTS C;  2V7Q J;  4W80 A;  2JEE A;  1SQQ K;  5KJ7 C;  1GU4 A;  2OYH C;  4OGQ B;  1DD4 A;  1LNQ A;  3TGU E;  1JM0 A;  1N7S A;  2QEX P;  1RF0 C;  1R5L A;  4L75 A;  5AW3 B;  3MGN A;  5CCG D;  3LID A;  5CCH D;  1H89 A;  1PIX A;  1FZC B;  2E43 A;  3O6Q B;  3V2R A;  2FYU D;  1SQX G;  4PD4 I;  5AW2 B;  1VF5 B;  1JNM A;  5APT A;  3E1R A;  2WTY A;  1L0L D;  3BCC E;  3IFM A;  3MHV A;  2V7Q H;  3BCC G;  2QE7 H;  1S5L X;  2ITA A;  2KZJ A;  2W6J H;  2H7H A;  1BGY J;  2YIU C;  1BCC E;  3CWB G;  3H1L G;  3W68 A;  1CW5 A;  1EZV I;  2ZFC A;  4YPC A;  1GMJ A;  2KP8 A;  2W90 A;  3CWB D;  2NPS D;  4IFF A;  4BRY A;  5KLV J;  3I56 P;  2IYO A;  1JEK A;  2ZVO B;  4YXW H;  2IDB A;  3TSI A;  3EWK A;  1N86 A;  3ZDM A;  3S9O A;  1XTC C;  4OWF A;  3VMY A;  5APS A;  1FBM A;  2VRS A;  2WVR A;  4WB4 A;  1NTM K;  1FZG A;  2H43 A;  2K3R A;  2QM8 A;  3PLN A;  2YO2 A;  1YJW P;  2YNY A;  4C7N A;  2LXC B;  2Y0C A;  3H1J G;  4D6T J;  2C9L Y;  4N6J A;  4D6T G;  3C1L A;  1QLE D;  3H1I D;  4OGQ D;  2A45 I;  4U3F E;  1PP9 D;  3PHL A;  2QM7 A;  2PAJ A;  3HD7 B;  1RHZ B;  4GDO A;  4U7J A;  1PGJ A;  2WSF H;  3KHU A;  2WIT A;  1M7L A;  3CX5 I;  4EI2 A;  2XU6 A;  4EYY Q;  1KYO D;  1NU1 K;  2H88 C;  1YJN P;  3L72 J;  3M9Q A;  2K88 A;  5EFW B;  2UWJ E;  4RES B;  1BGY G;  1JY2 O;  1NKN A;  5KAI H;  4WWI A;  5AW8 B;  5CJ4 A;  3CWB E;  4K3A A;  2FYU K;  3M9H A;  3MP7 B;  3A0H E;  1JB0 J;  2W8Z A;  3L73 G;  3PH0 A;  3SWF A;  5KJ7 A;  1K9M Q;  1FZC C;  1KIL E;  1RF1 B;  1M56 D;  1AQ5 A;  4OGQ C;  3A7O A;  3GG2 A;  2FYN C;  1EZV G;  1L0L E;  2CK3 H;  2JDI H;  2XNX A;  3BCC D;  5AVQ B;  1NO4 A;  1VQN P;  3V2Q A;  1HF9 A;  2E74 C;  5AVY B;  3RBZ A;  1CI6 B;  1IJD B;  1J1D B;  4UB6 H;  3RL0 D;  4C7R A;  1PP9 E;  1P84 E;  1NTZ E;  2IYP A;  3L36 A;  3M91 A;  1ZV8 A;  1S9K E;  1NTK G;  3GMA A;  3A5T A;  3AE2 C;  1SQP D;  1RE4 C;  2LR2 A;  2R5B A;  2ZVN B;  2ZXE B;  2YIU B;  4HJG H;  1IFN A;  1BCC D;  1SQQ E;  2J59 M;  3N7N A;  1FZA A;  4AYC A;  1ZRT E;  5CHX A;  1GW4 A;  1NAY A;  2E75 B;  2E42 A;  4YXD C;  1KMI Z;  3IAO A;  4PV1 D;  1CSB A;  4JYB A;  3F5H A;  1SLQ A;  1SFC B;  4KJM A;  1IFJ A;  4BWN A;  2KNC A;  2XZR A;  5E79 H;  1BGY E;  5APU A;  3RL0 C;  2QG4 A;  3SWK A;  1VQM P;  1Q82 Q;  4I1L A;  1JMB A;  1SFC A;  3Q3D A;  1YIJ P;  1HJB A;  3H1L E;  3S4R A;  1PP9 J;  3AE7 C;  1MV8 A;  1VL2 A;  3CXH I;  2CPB A;  1SQV J;  1Z56 A;  1DEE G;  2IBZ E;  3IF4 A;  4OVN F;  2OTL P;  2IBZ G;  1U57 A;  1QL1 A;  4D6T D;  3H32 B;  2AXT H;  1SS1 A;  2AXC A;  2IBZ D;  2RN0 A;  1FZB A;  4RJT A;  1PFI A;  2V4H A;  2M3E A;  3VMA A;  2FYZ A;  1N8R Q;  3L73 J;  2NZ2 A;  4IFD K;  4HH2 A;  4N78 E;  3HTK B;  3KDP B;  2WSC H;  3V4W A;  1VQL P;  4CPG A;  3CX5 E;  1BE3 G;  3AE6 C;  3AE1 C;  3A2A A;  1L4A B;  2BCC J;  2HG5 D;  2KLU A;  3AE3 C;  3LW5 J;  2R3C A;  3HTK A;  3P7K A;  4GOE A;  3KYQ A;  4PD4 D;  1BGY D;  1NTZ D;  3TGU G;  3E1I A;  1G1J A;  2HOD B;  2W83 C;  4QMA A;  4C7N B;  2H89 C;  4H0L B;  1IFP A;  1SQX J;  1T3J A;  1HGZ A;  4ZMD A;  3H1K G;  2M3B A;  2P58 A;  1MKM A;  1SQV E;  2CPS A;  5GTH E;  1NJI Q;  1YQ3 C;  1SQB J;  4I6M C;  1SQV G;  3RK3 B;  1NVO A;  3K5B A;  2D2C D;  4XE5 B;  2IZ0 A;  1UII A;  2A45 G;  1GL2 C;  2QJK C;  2QJY B;  3RK3 D;  1NGM B;  1P84 I;  1ZN5 A;  1M57 D;  3AE4 C;  3L73 E;  2E5T A;  2W6A A;  5KKZ B;  1ZR4 A;  1Q7Y Q;  1Q81 Q;  3L75 E;  4BXL A;  1GTW A;  2WSC J;  4EIJ A;  3TK1 A;  4JF7 A;  1JY2 N;  1VQK P;  1X22 A;  4WVZ A;  1D7M A;  4WY4 D;  2YXR B;  1EQ7 A;  2OYO A;  1HJ0 A;  1ZP0 C;  5DJU B;  5CCH A;  1N7S D;  3L74 G;  2WQY C;  2O01 H;  3MTU E;  3R4Y A;  2C9N Y;  1OFC X;  1J1E B;  1R5S A;  4MN4 C;  1FDM A;  2I1J A;  3GHG B;  4W7Z A;  1BE3 E;  1P84 D;  1L0N K;  2IZ1 A;  1VDF A;  3OJA B;  1PPJ D;  5AW6 B;  1N73 B;  1USE A;  1SQQ G;  1CZQ A;  3D71 A;  1HBW A;  1CI6 A;  2G3A A;  5CCH C;  3RK3 C;  1SQB E;  1GL2 D;  1H88 A;  3OAK A;  1URQ D;  3CCJ P;  2MJZ A;  1MFT A;  1ZME C;  4NPE A;  3CXH E;  3FWN A;  3GLM A;  3WU2 H;  2IBZ I;  3OA7 A;  4ASV A;  1VPC A;  4XA4 A;  1SQX K;  1VQ4 P;  3H1I E;  3JCU H;  2Q1K A;  2OYI B;  5AVX B;  5TIS H;  5KLV G;  1J1E C;  1NWQ A;  1H8A A;  3L73 D;  1LWU A;  2A06 G;  4H44 C;  1RF0 A;  3CI9 A;  1KIL B;  1FU1 A;  2R5D A;  3L4F A;  4IL6 E;  2FYU J;  2AEF A;  4JYC A;  1S5L H;  1OW7 A;  3H6P A;  4EDF A;  3CCQ P;  1EXI A;  1U7M A;  3GF7 A;  5AVZ B;  5CBN A;  1WRG A;  1SQV D;  3TNU A;  2I1K A;  1M1J A;  1MZ9 A;  2XND H;  1KIL A;  3L70 J;  3PJS K;  2WWW A;  1G1I A;  3AEA C;  4M3L A;  4YTP C;  1MFZ A;  3V5B A;  3BVH A;  3A3Y B;  3L74 E;  4H13 C;  1PPJ E;  2E75 C;  3F89 A;  2Y0D A;  2FFD B;  1BSH A;  1H0T A;  3CCR P;  1ZR2 A;  4PV1 C;  4ZKP A;  1NTK E;  1E79 H;  3FWL A;  3AEC C;  3D6Y A;  2Q7C A;  3EFG A;  1G2C B;  3RL0 B;  1VF5 C;  2WSE J;  3H1I J;  3H1J J;  1KB9 H;  3GW6 A;  1SQB G;  1LTB C;  2K37 A;  4H44 D;  4C46 A;  3M9B A;  1EDJ A;  2HPC B;  4JBZ A;  4PD4 E;  2GUS A;  3SFD C;  1KQS O;  1SQP J;  3II6 A;  4WY4 A;  3V2N A;  3D6Z A;  2ZAE B;  2O3J A;  3TGU J;  2PFX A;  1NU1 G;  2AXT E;  3SFE C;  1DIP A;  2Z5I A;  1RQU A;  5AVW B;  3CME P;  2G8Y A;  2HOD A;  2FBW C;  2N9Y B;  5KLV D;  3O6Q A;  3S1K A;  2A06 E;  3CWB J;  2FYU G;  2XV5 A;  5BVZ A;  2WPR A;  2WSE H;  3BCC J;  3NMD A;  1LTT C;  2O01 N;  4HKZ H;  3G6E P;  3M06 A;  1K05 A;  3G3Z A;  3H25 A;  4OH8 B;  1L0L J;  3Q2Y A;  1A02 J;  5AVU B;  5CJ0 A;  1FJK A;  2ZT9 B;  1GZL A;  3H1L D;  2A06 D;  3KZI E;  5AW1 B;  4AUW A;  2Q9I A;  2KXP B;  1GK6 A;  1NKZ B;  2JO1 A;  3AED C;  3MZW B;  1ZRT D;  2JP3 A;  4JQ0 D;  4JPZ B;  3L72 D;  1PP9 G;  5APV A;  2YKO A;  3V4Q A;  1K04 A;  3G9R A;  3CCU P;  4IL6 H;  4Z1M H;  1W2E A;  1QL2 A;  2R32 A;  1JO5 A;  1FAV A;  2KYV A;  4H0L D;  1KQG B;  2D2C C;  1SQQ J;  1SVF A;  5KLI B;  1GDT A;  5GTI E;  1AQT A;  1YHQ P;  3AE8 C;  3EQ2 A;  3PRJ A;  2OAR A;  3OW2 O;  3L71 D;  3NXS A;  4HYT B;  2JJL A;  3V6I A;  3U59 A;  3VN0 A;  1KFN A;  2OYH A;  1JY2 P;  1FE6 A;  3NFQ A;  1N7S C;  5KAF E;  4Y28 J;  4GT1 A;  1JTH B;  2BEZ F;  1OW6 A;  5B5E E;  4DCK A;  2P10 A;  3H1H E;  3H1H G;  2YMK A;  2WZ7 A;  5APX A;  5AW7 B;  3HE5 B;  1IO4 A;  2RH0 A;  2XKM A;  3QWO C;  1IK7 A;  3Q5R A;  1LTA C;  1T2K C;  3AEB C;  1LTJ B;  2IPP A;  3KPE A;  3MIW A;  3GHG A;  2HR3 A;  3B5N A;  1LWU B;  5B66 E;  5BU5 A;  3HE5 A;  2WPQ A;  1OXZ A;  2A45 H;  1NTM E;  1X79 B;  1M1K Q;  2R44 A;  2SPZ A;  3WU2 E;  1R8E A;  1NTZ K;  1KB9 D;  1KYO E;  1QEX A;  1M1J B;  2FXM A;  4HB1 A;  1VQO P;  2BCC E;  1SP4 A;  3Q5S A;  3H1J E;  3JCU E;  1ZOY C;  1YTZ I;  3CC2 P;  2AEM A;  1LT9 B;  1OX3 A;  3CC7 P;  1FDI A;  2ZYD A;  1U7J A;  1H0T B;  1NU1 J;  2POH A;  4TLF A;  1KIL D;  4W7Y A;  1X8Y A;  3FGA D;  1MUU A;  3O8Z A;  2Z4E A;  1LGH B;  4UB6 E;  3AEF C;  5AVT B;  3E7K A;  1SQP G;  3HE4 A;  4U3F D;  3U1C A;  3CCE P;  4PJ0 H;  3MUD A;  2WSS H;  5CCG C;  5AVR B;  1NYH A;  1SQV K;  4GOD A;  4IOI H;  4UB8 E;  5L8R J;  1W2B O;  4H13 D;  2M0B A;  2OQQ A;  4TT3 H;  3G4S P;  3VP9 A;  1HH0 A;  3NTN A;  3WUU A;  3TDK A;  1NTM J;  1URQ B;  3GHG C;  1RE4 A;  2MKV A;  3H1K J;  3L75 G;  3VMZ A;  2E76 C;  1PGO A;  1SQQ D;  3GF3 A;  2E74 D;  2KI7 B;  3L75 D;  2RKL A;  2AEJ A;  2KB7 P;  4I7Z B;  4LC1 A;  1L0L K;  4A7P A;  4ZNC A;  1S9K D;  2KS1 B;  1GL2 A;  1USD A;  1YBK A;  1KIL C;  3P32 A;  4ZKU A;  5AVV B;  1AVO A;  5B5E H;  1YYC A;  1BE3 J;  4WBA A;  3CXH D;  1N7S B;  3W67 A;  5KLV K;  3B4S A;  2FXP A;  2OYI C;  1PL5 A;  2JKV A;  2PGD A;  4DZO A;  4NPD A;  3FX0 A;  3IN6 A;  3VYI A;  3D70 A;  1ZLL A;  1OVR A;  1JCD A;  2KK7 A;  2N9B A;  1S1C X;  2ZYG A;  1YIT P;  3BRV B;  1JMM A;  1OVV A;  2O01 J;  1L4A A;  2YKQ A;  4I7Z C;  2QJP B;  3T97 A;  1EXJ A;  3H1K E;  3A0B E;  2FFD C;  2E76 B;  1JY3 O;  1OMI A;  5CBO A;  3EFF K;  2GM4 A;  1ZXG A;  2K1A A;  1J2J B;  2LKM A;  2ZT9 D;  3H1H J;  2WMM A;  2K9J B;  4L74 A;  1N2D C;  1AV1 A;  1LT9 C;  1KB9 E;  2QRX A;  1XTG B;  3M0D C;  2FYU E;  5AW0 B;  1PZQ A;  1KYO I;  1JY3 N;  1LT1 A;  1NTM D;  1WMK A;  1X9V A;  1KOR A;  5AVS B;  5BU8 B;  3P8C D;  1KD1 Q;  2OYH B;  3PTZ A;  4H0L C;  4ASW A;  1AFO A;  4RKU J;  1KC8 Q;  1N7L A;  1EZV E;  1JTH A;  1NHL A;  1L4A D;  1TU3 F;  1YQ4 C;  3C9I A;  3VMX A;  3CCS P;  3FXE A;  3L74 J;  3KXD A;  3Q1M A;  1E5W A;  1LP1 A;  2BAS A;  2P67 A;  2K9Y A;  4KHX A;  4IL6 X;  3WUV A;  5AW9 B;  1BDD A;  1PPJ G;  4U3F J;  4K35 A;  5AW5 B;  3V2P A;  1KTM A;  1T6A A;  5CCG A;  1Y9B A;  3HUS B;  1GW3 A;  1NTK J;  1VF5 D;  1LTJ A;  1FS0 E;  1LP1 B;  2E5Y A;  2KLV A;  1L0N E;  2Q3I A;  2ZJS E;  5GTH H;  1IZN B;  4DT0 A;  4H44 B;  1Q2N A;  5KAI E;  2ZT9 C;  4N78 D;  3CPW O;  5E79 E;  1FDO A;  1SQB K;  2Q3E A;  1OW8 A;  3VOP A;  1QVG O;  1RF1 C;  5K5G B;  1K73 Q;  1S5L E;  1T8Z A;  2LXB A;  3L37 A;  1SQP E;  3USS A;  4EOT A;  1VQ5 P;  1PGQ A;  2XDJ A;  1N73 A;  1NH4 A;  4KT0 J;  1BDC A;  1LTJ C;  5APQ A;  1WT6 A;  2GA1 A;  3CX5 H;  4GIF A;  1SFC D;  1LT9 A;  1FC2 C;  2B89 A;  2RMZ A;  3I5C A;  1L0N D;  3M0D A;  3RGU A;  1VQP P;  4PV1 B;  3N4X A;  3H1H D;  1HWT C;  2KSE A;  3R2P A;  3CCL P;  3CCM P;  1RE3 C;  1EDI A;  3B5N B;  3L72 G;  2HLO A;  2FKW B;  5AW4 B;  2Z5H A;  5H2F H;  3CL3 D;  5KLI C;  1RY3 A;  4Y99 C;  3RK3 E;  1Q86 Q;  3TGU D;  2OYI A;  2W6B A;  2N1T B;  2KIK A;  2KUB A;  1RH5 B;  1EC5 A;  1S4X A;  3JC2 2;  4LGD E;  2NPS C;  3L71 E;  3LW5 H;  1YTZ T;  1YI2 P;  3L71 G;  5KAF H;  3WUT A;  1FJP A;  1RE3 A;  1NTM G;  2QIW A;  1LTG C;  1Y8A A;  3L70 E;  3LIE A;  3HD7 C;  1EZV D;  1GK4 A;  5CMZ A;  3TNU B;  4DOJ A;  2FXO A;  3A0H H;  3CMA P;  1YJ9 P;  1KV4 A;  5KKZ C;  1SFC C;  1HVV A;  4D6T E;  1URQ C;  1UIX A;  1LWU C;  1GL2 B;  1S2E A;  2QJK B;  3ABV C;  3MD0 A;  4Y99 B;  3P8M C;  3UIA A;  2KZI A;  1PV3 A;  1KB9 I;  1VQ7 P;  4GKG A;  5C39 A;  1NTK D;  1LJ2 A;  3Q5P A;  2B88 A;  2FYN B;  2I8D A;  2KNC B;  2OTJ P;  4I2L C;  2Y9Z A;  1P84 H;  2IFM A;  2JWD A;  2Y9Y A;  1VQ8 P;  3HUS C;  4N3Y B;  3L74 D;  2WPS A;  3B5N D;  3H1L J;  4GOF A;  1SQX D;  2L5G B;  5KJ7 D;  3MUD C;  1DH3 A;  2M5A B;  2PP6 A;  4WY4 B;  1QX8 A;  3RBX A;  1AA0 A;  3H32 A;  3HD7 D;  1IC2 A;  3T97 B;  1GU5 A;  1JUN A;  1GD2 E;  3SSU A;  2BEQ D;  3CLQ A;  1X0T A;  2M5A A;  1Q90 D; 
#chains in the Genus database with same CATH homology
 3TYY A;  2O1J A;  2WT7 A;  1T3U A;  4O9B A;  3VTP C;  1NAF A;  2M8R A;  4WY4 C;  2KOG A;  4LLH A;  2P2U A;  2HFE D;  2WT7 B;  5APW A;  1HGV A;  1NTK K;  2NPS B;  2GUV A;  4AQR D;  1JOC A;  3HUS A;  3SWY A;  1SQP K;  2NPS A;  1L4A C;  3KQG A;  1J1D C;  1HUC A;  3IR9 A;  3VP8 A;  2H8P D;  3BAS A;  3HD7 A;  4IFM A;  1M1J C;  1NOH A;  3B8E B;  2W27 A;  1FZF A;  2KSJ A;  3M0A A;  2C0W A;  2YKP A;  3RK2 C;  1IFM A;  1IFD A;  1RF1 A;  1DX7 A;  2P1J A;  2IFN A;  2HYN A;  3BRT B;  2C0X A;  1IK9 A;  1OWA A;  3L35 A;  2N1T C;  2J58 A;  2O1K A;  3HRN A;  2YO3 A;  1FOS F;  2Q5U A;  1FZE A;  1A02 F;  3RK2 D;  1HTL C;  1JCC A;  2N1T A;  5KTB A;  1IFI A;  3RK2 B;  1JY3 P;  1DEB A;  3HE4 B;  3PP5 A;  1T2K D;  2IX7 C;  5APY A;  2FFD A;  2N1T D;  3WMM 0;  3P8C E;  1KFM A;  3U1A A;  4B86 A;  1LTI C;  1URQ A;  2YMY A;  1G2C A;  3BAT A;  1KQL A;  1KZU B;  1FOS E;  3B5N C;  2HPC A;  2P7J A;  1FZC A;  1LTS C;  4W80 A;  2JEE A;  1SQQ K;  5KJ7 C;  1GU4 A;  2OYH C;  1N7S A;  1RF0 C;  5CCH D;  5AW3 B;  5CCG D;  3MGN A;  1H89 A;  3LID A;  1FZC B;  2E43 A;  3V2R A;  5AW2 B;  1JNM A;  5APT A;  2WTY A;  3IFM A;  2H7H A;  1JUN A;  1CW5 A;  1N73 C;  2ZFC A;  2KP8 A;  2NPS D;  4IFF A;  3TSI A;  1N86 A;  1XTC C;  3VMY A;  5APS A;  1FBM A;  2VRS A;  4WB4 A;  2H43 A;  1NTM K;  1FZG A;  2QM8 A;  2YO2 A;  2YNY A;  4C7N A;  2C9L Y;  4N6J A;  2A45 I;  2QM7 A;  2PAJ A;  3HD7 B;  2WSF H;  2WIT A;  1M7L A;  2XU6 A;  1NU1 K;  3M9Q A;  4RES B;  1JY2 O;  1NKN A;  5AW8 B;  5CJ4 A;  2FYU K;  3M9H A;  1FZC C;  3SWF A;  5KJ7 A;  1RF1 B;  1AQ5 A;  3A7O A;  5AVQ B;  2XNX A;  1NO4 A;  3V2Q A;  5AVY B;  1CI6 B;  1IJD B;  1J1D B;  3RL0 D;  4C7R A;  3L36 A;  3M91 A;  1ZV8 A;  1S9K E;  3A5T A;  2R5B A;  1RE4 C;  2ZXE B;  1IFN A;  3N7N A;  2J59 M;  1FZA A;  4AYC A;  5CHX A;  1GW4 A;  2E42 A;  1CSB A;  4JYB A;  1SLQ A;  1SFC B;  1IFJ A;  2XZR A;  5APU A;  3RL0 C;  4I1L A;  1SFC A;  1HJB A;  1MV8 A;  2CPB A;  1Z56 A;  1QL1 A;  3H32 B;  1FZB A;  1PFI A;  2FYZ A;  4IFD K;  4HH2 A;  3HTK B;  3KDP B;  2WSC H;  3V4W A;  3A2A A;  1L4A B;  2HG5 D;  2R3C A;  3P7K A;  3HTK A;  3KYQ A;  3E1I A;  1G1J A;  2HOD B;  4C7N B;  1T3J A;  1HGZ A;  2M3B A;  2CPS A;  4I6M C;  3RK3 B;  4XE5 B;  2A45 G;  3RK3 D;  1GL2 C;  1ZN5 A;  2W6A A;  1ZR4 A;  1GTW A;  4EIJ A;  3TK1 A;  4JF7 A;  1JY2 N;  4WY4 D;  1EQ7 A;  5CCH A;  1N7S D;  2O01 H;  3MTU E;  2C9N Y;  1J1E B;  1FDM A;  2I1J A;  3GHG B;  4W7Z A;  3OJA B;  1L0N K;  1VDF A;  5AW6 B;  1N73 B;  1HBW A;  1CZQ A;  1CI6 A;  5CCH C;  3RK3 C;  1GL2 D;  1H88 A;  3OAK A;  1URQ D;  2MJZ A;  3OA7 A;  1VPC A;  4XA4 A;  1SQX K;  2OYI B;  5AVX B;  1J1E C;  1NWQ A;  1H8A A;  1LWU A;  1RF0 A;  3CI9 A;  1KIL B;  1FU1 A;  2R5D A;  3L4F A;  4JYC A;  3H6P A;  5AVZ B;  1WRG A;  3TNU A;  2I1K A;  1M1J A;  1MZ9 A;  4M3L A;  1KIL A;  2WWW A;  1G1I A;  3V5B A;  1MFZ A;  3BVH A;  3A3Y B;  2FFD B;  1ZR2 A;  4ZKP A;  2Q7C A;  3EFG A;  1G2C B;  3RL0 B;  1LTB C;  4C46 A;  3M9B A;  2HPC B;  2GUS A;  3II6 A;  4WY4 A;  3V2N A;  2Z5I A;  5AVW B;  2HOD A;  2XV5 A;  5BVZ A;  2WPR A;  2WSE H;  3NMD A;  1LTT C;  3M06 A;  3G3Z A;  4OH8 B;  1A02 J;  5AVU B;  5CJ0 A;  1FJK A;  1GZL A;  4AUW A;  5AW1 B;  1GK6 A;  1NKZ B;  5APV A;  3V4Q A;  2YKO A;  1W2E A;  1QL2 A;  2R32 A;  1JO5 A;  1FAV A;  2KYV A;  1GDT A;  1SVF A;  3EQ2 A;  2OAR A;  3NXS A;  4HYT B;  2JJL A;  3U59 A;  3VN0 A;  1KFN A;  2OYH A;  1JY2 P;  3NFQ A;  1N7S C;  4GT1 A;  1JTH B;  2WZ7 A;  5APX A;  5AW7 B;  3HE5 B;  1IO4 A;  2XKM A;  1T2K C;  1LTA C;  1LTJ B;  2IPP A;  3KPE A;  3MIW A;  3GHG A;  3B5N A;  1LWU B;  5BU5 A;  3HE5 A;  2WPQ A;  1OXZ A;  2A45 H;  1X79 B;  1NTZ K;  2FXM A;  1M1J B;  1SP4 A;  1YTZ I;  1LT9 B;  2POH A;  1KIL D;  4W7Y A;  1X8Y A;  3O8Z A;  1MUU A;  2Z4E A;  1LGH B;  5AVT B;  3U1C A;  3HE4 A;  3MUD A;  5CCG C;  5AVR B;  1SQV K;  3VP9 A;  1HH0 A;  3NTN A;  1URQ B;  3GHG C;  1RE4 A;  3VMZ A;  2KB7 P;  4LC1 A;  1L0L K;  1S9K D;  1GL2 A;  1KIL C;  3P32 A;  4ZKU A;  5AVV B;  1YYC A;  4WBA A;  5KLV K;  1N7S B;  2OYI C;  4DZO A;  3VYI A;  1ZLL A;  1JCD A;  2N9B A;  3BRV B;  1JMM A;  1L4A A;  2YKQ A;  3T97 A;  2FFD C;  1JY3 O;  2GM4 A;  2LKM A;  1J2J B;  1N2D C;  5AW0 B;  1LT9 C;  3M0D C;  1XTG B;  1JY3 N;  1X9V A;  2OYH B;  5AVS B;  1AFO A;  5BU8 B;  3P8C D;  1N7L A;  3C9I A;  1JTH A;  1NHL A;  1L4A D;  3VMX A;  1E5W A;  2P67 A;  2BAS A;  4KHX A;  5AW9 B;  3V2P A;  5AW5 B;  5CCG A;  3HUS B;  1GW3 A;  4EOT A;  1LTJ A;  2Q3I A;  2KLV A;  4N78 D;  1SQB K;  3VOP A;  1RF1 C;  1T8Z A;  3L37 A;  1N73 A;  2XDJ A;  1NH4 A;  1LTJ C;  5APQ A;  1WT6 A;  4GIF A;  1SFC D;  1LT9 A;  3I5C A;  3M0D A;  1HWT C;  3N4X A;  3R2P A;  1RE3 C;  3B5N B;  5AW4 B;  2HLO A;  2FKW B;  2Q9I A;  2Z5H A;  3CL3 D;  2OYI A;  1RY3 A;  4Y99 C;  2W6B A;  2N1T B;  4LGD E;  2NPS C;  3LW5 H;  1YTZ T;  1FJP A;  1RE3 A;  3LIE A;  4N78 E;  1LTG C;  5CMZ A;  3TNU B;  4DOJ A;  3HD7 C;  1GK4 A;  1SFC C;  1HVV A;  1URQ C;  1LWU C;  1GL2 B;  3UIA A;  3MD0 A;  4Y99 B;  3P8M C;  4GKG A;  4I2L C;  2IFM A;  3HUS C;  4N3Y B;  2WPS A;  3B5N D;  1DH3 A;  2L5G B;  5KJ7 D;  2PP6 A;  4WY4 B;  3H32 A;  3HD7 D;  1IC2 A;  1GU5 A;  1GD2 E;  3CLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...