1PP9G

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
RQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
total genus 18
structure length 73
sequence length 73
chains with identical sequence T
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1pp9G00
4D6TG 2A06G 1KB9H 3L71G 1SQBG 3CWBG 5KLVG 3L70G 1SQXG 3TGUG 1PP9G 1KYOH 3L72G 1SQQG 1EZVG 1BGYG 1SQVG 3L73G 4PD4H 1BCCG 1PPJG 3L75G 1NU1G 3H1HG 4U3FG 3H1JG 3H1LG 1SQPG 1L0NG 3BCCG 1NTZG 3L74G 3H1KG 1BE3G 3CXHH 1P84H 2IBZG 1NTMG 1NTKG 2FYUG 1L0LG 3H1IG 2BCCG 3CX5H
chains in the Genus database with same CATH superfamily
4RESB 1HGZA 2O01N 1URQD 5AVXB 4EDFA 1YIJP 1IO4A 4DJGA 1Y47A 1NWQA 5KKZB 1H88A 1AVYA 1LNQA 2PGDA 4Y99C 1JCDA 1FZBA 4H44C 3CXHH 2FYUE 1VQ7P 1GL2A 3L75J 3BVHA 4D6TD 3AEAC 3HD7C 1S72P 1OW8A 3RK3E 4LGDE 3M0AA 3TYYA 1D7MA 2W27A 3GG2A 4H13D 2A45H 2K9JA 3PJSK 3WUTA 1BGYJ 1JY3O 3RK3B 4K3AA 5AW6B 3H6PA 3L70E 2BEQD 1LGHB 4R4MA 2JWAA 2K1AA 1KILC 4JBZA 3Q5RA 1OFCX 1BE3E 2QJYB 2OYIB 5GTIH 1PP9J 3JC22 4NPDA 2BCCE 3VOPA 2L5GB 1KB9H 1OVRA 1EXJA 3A2AA 2JR8A 1SQBK 4ZKPA 3L75G 5CCHD 2OYIA 3WMM0 1KD1Q 4I7ZB 1NYHA 1N8RQ 2H88C 3CC2P 3RL0D 4KT0J 3M9QA 1HTLC 1MZ9A 2WPRA 1JB0J 2IFMA 2FYUJ 2O1JA 2WITA 1BGYG 2Y9ZA 1NKZB 3B5NB 1IFDA 4HB1A 5AVWB 1BSNA 2OTLP 1NGMB 4W7ZA 1P84E 3PH0A 3F89A 1PFIA 3WU2E 1PP9G 3CCMP 3H25A 3B5NA 4W7YA 3L70J 2WSCH 1IZNB 5CCGD 3GMAA 1VQ5P 1ZXGA 1S1CX 1FZCB 1RQUA 1BE3J 2ZFCA 1UIXA 2BCCJ 3CL3D 2Y9YA 1SQVE 3L73E 4LC1A 1OWAA 1LWUB 2FYNC 2FYUG 2XU6A 2Q3IA 3GF3A 1YITP 1L0LD 2A06E 1FJKA 2OARA 2K37A 3CCQP 4H13C 2FFDB 4GKGA 2ZXXA 3VP9A 3V2RA 2KUBA 1ZOYC 1PPJD 4MN4C 4PV1D 4QMAA 1L0NE 1LWUA 3E7KA 3LW5J 3OJAB 1YTZT 3FWNA 3TF5A 2MKVA 2M8RA 2L91A 2FFDA 2CPSA 3GLMA 4YPCA 3MHVA 1E79H 2XDJA 2FKWB 1TU3F 3KZIE 2Q3EA 2GUVA 1X0TA 1NH4A 1BE3G 2OGUA 4I2LC 5APUA 3Q2YA 1AVOA 3KXDA 2BCCG 4N3YB 3AEEC 3M9BA 2LXCB 1G1JA 3IF4A 1NTMK 1SLQA 3CX5D 1RF0A 2YXQB 2P67A 1HF9A 3AE9C 2QSIA 4BRYB 1YJ9P 1RE4A 1SQPD 3L74D 4XA4A 4GDOA 3P8CD 1SQVJ 3L73J 1RE3C 2Q7CA 2D2CD 3PP5A 1YQ4C 5GTIE 5KJ7A 1T6AA 1KC8Q 4A7PA 4EIJA 5AW8B 1FU1A 1S5LE 1KFMA 2KLVA 4BRYA 3KQGA 5CBOA 2AEJA 5AVQB 3H1HD 3H1JE 3H1LD 3BCCE 2B88A 2IBZE 1SQQK 4KHXA 1FZAA 1M1JB 1L0NJ 2OYHC 3CWBE 2JJLA 1K9MQ 4IL6X 3L72D 3G71P 2R3CA 3LIEA 4XFJA 2YKQA 1FBMA 2KXPB 3GF7A 3P7KA 3RK2C 2IX7C 1L4AB 5AVSB 4WY4D 2QA4P 2ZT9B 2KP8A 5APTA 2HYNA 1SQVG 3L73G 1IJDB 2K3RA 1NTZE 3IFMA 2N1TD 2AEFA 1VQKP 3MZWB 3HUSC 2A06G 4AUWA 4TLFA 1AA0A 1M8OB 2QJYC 1EZVD 2QM7A 1BCCD 1FZGA 1L0NG 4ASVA 4W80A 3AE2C 3L71D 1G2CB 3H1JJ 3BCCJ 1FOSE 2H89C 3PTZA 4YTPC 1W5CE 2QRXA 5AW1B 1SFCB 2ZYGA 3M9HA 4GODA 4Z1MH 2ZYDA 4BWNA 2PP6A 1LTBC 2XKMA 3S9OA 1G2CA 1M57D 2IZ0A 1JTHB 2QE7H 1NOHA 3AEDC 1SQBD 2B9BA 2AEMA 3N7NA 1NTKJ 5AVYB 2NPSC 2FYZA 3FWLA 5KLIC 4EOTA 2CPBA 3CX5I 1H0TB 1SFCA 2OYOA 1QEXA 2B89A 5B66H 1NU1J 3EWKA 3E1RA 1LTGC 1HVVA 1NTZJ 2YIUB 4H44D 5APSA 2E75D 1YJWP 1KQLA 1Q81Q 1KZUB 4NPEA 1KB9D 2E76D 3HD7D 2WSCJ 2OTJP 1BDDA 2KNCA 2RKLA 2P58A 2PRRA 1FZCC 2IBZG 2WMMA 3CMAP 4PD4D 4D6TE 1LJ2A 1MKMA 3H1KJ 1J1DC 3S4RA 3CCUP 4HH2A 1T3UA 2WPQA 2C0WA 1EXIA 2NRGA 3AEBC 4U3FD 2KZIA 4IL6H 4EI2A 1URQA 3MD0A 2WVRA 1NTKG 1S5LX 2SPZA 1JM0A 1OXZA 2E74D 1KILD 5CJ4A 1RF1A 3BATA 4C7RA 1JO5A 3JSVC 2POHA 3CC4P 1R5SA 1Q82Q 5AW5B 1GU4A 4JPZB 1NU1G 3OW2O 4GOFA 1VPCA 1NTZG 1RHZB 1P84H 3CCEP 5AVRB 2J59M 4H0LB 2QJKC 3M0DC 3WU2H 1J1EB 2B87A 2QM8A 4ZMDA 2YO2A 4DOJA 3R2PA 2Q1KA 1EZVI 1KV4A 3C1LA 3H1KG 1QVGO 1VF5B 5CBNA 5AW9B 1OIPA 2HG5D 3CXHI 1LT9C 4D6TJ 4ZKUA 1KYOH 3BRVB 1ZV8A 3RL0B 1N73C 1VQ8P 2HR3A 3H1IG 1NTMD 3GHGC 2QVAA 3FGAD 1GL2B 2A45I 5CCHA 2ZXEB 1LTAC 1SP4A 1Y9BA 4OGQD 1EDIA 3A7OA 5KAFE 1J2JB 1JOCA 3U1CA 2E75C 1SS1A 2K9JB 1YBKA 2IYOA 2E43A 3KZIH 1AJYA 2E76C 2YXRB 3KPEA 1FDIA 2AXCA 2N9YB 2R5BA 3I56P 1X9VA 1JY2O 1SQQD 1KB9I 1L4AC 1FAVA 1L0LE 2O01H 5AW0B 2IFNA 4HJGH 4D6TG 4PD4I 2ITAA 2J5UA 3E1IA 1LTSC 5B66E 3EFFK 1PPJE 3M06A 2E74C 3B8EB 5CCGA 2KK7A 3CPWO 3V2QA 1A02F 3MUDC 4Y28J 1OW7A 3TNUB 2PFXA 1S5LH 2Q5UA 1NJIQ 2XZRA 3NMDA 5APYA 4RKUJ 1H89A 2N9BA 2CK3H 1LT1A 1IFIA 1SQXK 4YXWH 3FXEA 1ZW0A 2OQQA 2E5YA 3TNUA 3QH9A 5AW7B 3SFEC 1GK6A 1QL1A 2C9NY 4IL6E 2KZJA 1GW3A 5APQA 1Y8AA 3II6A 1SQPE 3VMZA 3L74E 2C9LY 2VRSA 1IFPA 3AEFC 3CCVP 1FJPA 1L0LJ 1XTCC 4GOEA 3VMXA 3CD6P 4WBAA 3H1LE 5KLVK 1KORA 2YIUC 4XE5B 4JF7A 4OGQC 1U57A 2YKOA 4N78D 2BEZF 1X8YA 5E79E 4RJTA 3RK2D 1LP1B 3FXDA 3U59A 3N4XA 1MV8A 1KYOE 1JY3N 2GUSA 2GA1A 1KN7A 4DZOA 3PLNA 2G3AA 3G4SP 1LP1A 2QIWA 4EYYQ 1N7SB 1YYCA 5DJTB 1L0LG 1USEA 1SQPJ 1U7MA 2P7JA 1QLED 3L74J 3V2NA 3L70D 1KMIZ 1S9KD 3TDKA 2H43A 1BCCE 2LXBA 2N1TB 1PPJG 1JEKA 2R44A 1N7SA 4I1LA 1GMJA 3CC7P 1K8AQ 2JP3A 4WY4A 1U7JA 3VP8A 3L71E 3H1LJ 3HE5B 3C9IA 1W2BO 5K5GB 1FC2C 5BU5A 2N1TA 3TGUD 1QGKB 2WSFJ 2Y0CA 1YI2P 2NZ2A 2AXTH 3W68A 1R5LA 2NPSD 3B5ND 3L72J 3HE5A 3A0HE 1CI6A 2XNXA 3IN6A 2IYPA 4AYCA 5C39A 2RH0A 1M7LA 1SQPG 3Q1MA 3L74G 2DW3A 1GL2C 1XTGB 2JO1A 4C7NB 4GIFA 2KI7B 5KKZC 1LTJB 4IFMA 1LT9A 1ZR2A 1MFTA 3H1HG 5TJHA 3H1LG 2ZVNB 3CI9A 1NHLA 5BU8B 4C7NA 1NTKE 4Y99B 1BCCJ 1LTJA 1AQTA 3WUUA 1FZEA 2W6AA 2LKMA 3AE4C 3I55P 3HD7B 3A0BH 3L72G 3L71J 1Z56A 2WT7A 1NU1E 1T3JA 4HYTB 1NVOA 1WRGA 1K05A 3RK3C 1ZP0C 2O01J 3A3YB 1KILE 3WUVA 3VMAA 2Y0EA 1OW6A 3HD7A 3NFQA 3D70A 4WWIA 2OYIC 1E5WA 3PRJA 3FX0A 1KILB 3H1KE 2O3JA 5APVA 4LLHA 3IR9A 1EDJA 3NTNA 2W8ZA 5KAFH 3CXHD 4DCKA 1YQ3C 1EZVG 4I7ZC 1RY3A 1BCCG 1KILA 2O1KA 5KJ7D 1GDTA 2LR2A 2G8YA 3H1IE 2W90A 3L71G 1M90Q 1GZLA 1HGVA 1ZRTE 4I6MC 4L74A 1MFZA 3ITKA 1SQXD 1LTTC 3B5NC 1VQNP 1IK9A 3EFGA 1JY3P 2ZYAA 2YO3A 1NTME 2WWWA 2KNCB 3GW6A 2KS1B 1DH3A 1SQBG 3S1KA 5AVUB 2FYUK 2KSJA 1L2PA 1IC2A 3H1JD 1PGPA 3BCCD 2KS1A 5TISH 1URQB 2AXTE 1M56D 3EQ2A 3LIDA 3RBZA 1RF1B 3CWBD 5BVZA 5KLVD 1L4AD 3RGUA 1P84I 4JQ0D 1SQQE 3HE4B 2ZT9D 3L4FA 1LWUC 1RH5B 5DJUB 1JMMA 1PGOA 2FFDC 3CX5H 4N6JA 3AECC 2KOGA 1DD4A 1NO4A 2B87B 3HE4A 3H1IJ 4H13B 2ZAEB 4WB4A 1PGJA 3CCSP 4U3FG 3Q3DA 4R4LA 1DEBA 5B5EE 3U1AA 1KYOI 4PJ0E 2KB7P 3OAKA 1T2KC 2Z5IA 2WTYA 2P2UA 1VQ9P 1QX8A 1NTMJ 1ZLLA 1RF0C 3JCUH 2WSFH 1RE4C 2W6JH 2FBWC 2R5DA 1GW4A 3A0BE 3RL0g 2QJPB 3QWOC 3CCJP 5E79H 4OWFA 1N86A 5KJ7C 3AE3C 5KAIH 2WSEJ 3G6EP 3KHUA 4GT1A 1SQQJ 1VQ6P 3CMEP 2HPCB 2YKPA 3OA7A 5L8RJ 5AVVB 3D6ZA 1FOSF 2E5TA 1PGQA 1WT6A 5EFWB 3TK1A 2YNYA 3H32A 1NKNA 1M1JC 1NTMG 1SQVK 4RO0A 2HPCA 5AVTB 2FXMA 1RE3A 4N78E 2JWDA 1USDA 1PIXA 4TT3H 2I8DA 2OYHB 3AE7C 2I1JA 1NAYA 3CLQA 3D71A 1VL2A 1VQOP 3AEGC 2IBZI 4BXLA 2ZT9C 2E42A 1L0NK 2HODB 2WSSH 1N7LA 3RK2B 3T97B 2OYHA 5AVZB 2RMZA 1EC5A 1SQQG 1X79B 3SFDC 4K35A 4IFDK 1H8AA 1JCCA 4KJMA 2IDBA 3A0HH 2R3SA 4B86A 2HODA 3T97A 4H0LD 1K73Q 3HUSB 1S9KE 5TISE 2KSEA 4PV1B 4UB8H 2QEXP 1LTIC 1QL2A 1HWTC 1GTWA 1FS0E 3L75D 1GK4A 1RQVA 2V7QJ 3P32A 1VF5D 3HUSA 3V2PA 1IFJA 3TGUE 1IK7A 4IFFA 3MGNA 3CX5E 1KQSO 1SFCC 2QG4A 4PD4H 1BGYD 3P8CE 1OMIA 1FE6A 2M5AB 4UB6E 2P1JA 1GL2D 2YMYA 3AE5C 5CHXA 3B4SA 1PP9D 3P8MC 1VQLP 3H1HE 2NPSB 1Q2NA 1AV1A 5KLIB 4JYBA 2D2CB 1Q86Q 3JCUE 1FDOA 1PV3A 2M5AA 2V4HA 3SWKA 1NTKK 3F5HA 2NPSA 3L72E 1JY2N 5KAIE 4M3LA 1URQC 3USSA 1YJNP 1NAFA 5CJ0A 2YMKA 1RF1C 2FYUD 1NU1K 1EDLA 2ZJSE 2H8PD 1NTZK 3RK3D 2K88A 4L75A 3RBXA 3MTUE 1J1DB 3Q5SA 1KTMA 3TGUJ 1VQPP 5H2FE 5APWA 3HTKB 1OX3A 2WZ7A 3G9RA 1FZCA 2FXOA 1ZN5A 4WY4B 1G1IA 2KYVA 2OTKE 3L35A 1Q7YQ 5AW4B 3O6QB 1EZVE 4ZNCA 4C46A 3PHLA 1Q90D 4H0LC 4ASWA 3HTKA 1J1EC 1BE3D 1N2DC 2BCCD 3B71A 3H1HJ 3SWFA 3O6QA 3CXHE 2QJKB 1PL5A 2RN0A 3L70G 2BASA 2P10A 2FXPA 1OVVA 1EDKA 3Q5PA 2WSEH 1CI6B 1CSBA 5CMZA 2QJPC 2C0XA 1VF5C 3ABVC 2IZ1A 1X22A 3MP7B 3KYQA 1HH0A 3M0DA 5CCHC 3G3ZA 1SQBE 1SQXE 3TGUG 3RL0C 1GU5A 2WPVB 1LT9B 1DD3A 3K5BA 4UB8E 1N73B 1DX7A 1MUUA 1VQ4P 3GHGB 1P84D 1KB9E 1UIIA 5B5EH 3TSIA 3W67A 1ZR4A 2R32A 4PJ0H 2J58A 1R8EA 5GTHH 2WT7B 1N73A 5APXA 4PD4E 1JUNA 4H44B 3GHGA 2E75B 3AE8C 1CW5A 5KLVE 2ZVOB 3IAOA 2E76B 5CCGC 1HJBA 1SQVD 3L73D 4U3FE 4YXDC 1EQ7A 1KYOD 1M1JA 1N7SD 4O9BA 2A06D 2H7HA 1W2EA 4AQRD 4CPGA 2XV5A 1SQBJ 1T2KD 1SQXJ 2E74B 1L0ND 4WVZA 2V7QH 2Z5HA 1L4AA 3NXSA 1YHQP 1DIPA 2GM4A 4IOIH 1IFMA 2HLOA 4PV1C 5AW3B 2Q9IA 2W6BA 2UWJE 4NPFX 1GD2E 1QVFO 3BASA 3R4YA 3CCLP 1HUCA 3KDPB 3M91A 4L76A 1S3JA 2KLUA 3MUDA 2I1KA 1PZQA 1AFOA 1HBWA 1JY2P 2W83C 2M3EA 3L36A 2PAJA 3CCRP 3I5CA 4OH8B 3CWBJ 5KLVJ 4U7JA 1KFNA 1VQMP 1KQFB 2A45G 2WPSA 1CZQA 1S4XA 4DT0A 3V4QA 4U3FJ 5AW2B 1SQXG 3V6IA 1K04A 1OZHA 2D2CC 2Y0DA 5KTBA 2K9YA 2JEEA 3ZDMA 1M1KQ 3V4WA 1JTHA 2JDIH 2IBZD 1L0LK 4OGQB 1H0TA 1VDFA 3BRTB 1FZFA 3H1JG 3BCCG 3O8ZA 1NTKD 1KQGB 3AE6C 2FYNB 3SWYA 3CWBG 5KLVG 2WQYC 3VYIA 1S2EA 1WMKA 1N7SC 2HFED 1NU1D 1JNMA 3AE1C 4WY4C 1NTZD 3LW5H 4UB6H 3C8VA 5GTHE 5M1BA 4OVNF 1T8ZA 2N1TC 3MIWA 3UIAA 1BSHA 2MJZA 3L75E 1IFNA 1ZMEC 2M3BA 3V5BA 2M0BA 3H1KD 3SSUA 1SFCD 1OVUA 4L73A 1SQPK 3VTPC 2IPPA 1FDMA 2Z4EA 1AQ5A 3A5TA 3HRNA 1SVFA 4JYCA 1BGYE 3L37A 1JMBA 2FY8A 3H1ID 3VMYA 3VN0A 1A02J 2Q6QA 3H32B 1YTZI 1BDCA 1ZRTD 4HKZH 1DEEG 1HJ0A 3D6YA 2KIKA 2XNDH 1PP9E 2JKVA 5H2FH 1LTJC
chains in the Genus database with same CATH topology
4D6TG 2A06G 1KB9H 3L71G 1SQBG 3CWBG 5KLVG 3L70G 1SQXG 3TGUG 1PP9G 1KYOH 3L72G 1SQQG 1EZVG 1BGYG 1SQVG 3L73G 4PD4H 1BCCG 1PPJG 3L75G 1NU1G 3H1HG 4U3FG 3H1JG 3H1LG 1SQPG 1L0NG 3BCCG 1NTZG 3L74G 3H1KG 1BE3G 3CXHH 1P84H 2IBZG 1NTMG 1NTKG 2FYUG 1L0LG 3H1IG 2BCCG 3CX5H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D6T G;  2A06 G;  1KB9 H;  3L71 G;  1SQB G;  3CWB G;  5KLV G;  3L70 G;  1SQX G;  3TGU G;  1PP9 G;  1KYO H;  3L72 G;  1SQQ G;  1EZV G;  1BGY G;  1SQV G;  3L73 G;  4PD4 H;  1BCC G;  1PPJ G;  3L75 G;  1NU1 G;  3H1H G;  4U3F G;  3H1J G;  3H1L G;  1SQP G;  1L0N G;  3BCC G;  1NTZ G;  3L74 G;  3H1K G;  1BE3 G;  3CXH H;  1P84 H;  2IBZ G;  1NTM G;  1NTK G;  2FYU G;  1L0L G;  3H1I G;  2BCC G;  3CX5 H; 
#chains in the Genus database with same CATH topology
 4RES B;  1HGZ A;  2O01 N;  1URQ D;  5AVX B;  4EDF A;  1YIJ P;  1IO4 A;  4DJG A;  1Y47 A;  1NWQ A;  5KKZ B;  1H88 A;  1AVY A;  1LNQ A;  2PGD A;  4Y99 C;  1JCD A;  1FZB A;  4H44 C;  3CXH H;  2FYU E;  1VQ7 P;  1GL2 A;  3L75 J;  3BVH A;  4D6T D;  3AEA C;  3HD7 C;  1S72 P;  1OW8 A;  3RK3 E;  4LGD E;  3M0A A;  3TYY A;  1D7M A;  2W27 A;  3GG2 A;  4H13 D;  2A45 H;  2K9J A;  3PJS K;  3WUT A;  1BGY J;  1JY3 O;  3RK3 B;  4K3A A;  5AW6 B;  3H6P A;  3L70 E;  2BEQ D;  1LGH B;  4R4M A;  2JWA A;  2K1A A;  1KIL C;  4JBZ A;  3Q5R A;  1OFC X;  1BE3 E;  2QJY B;  2OYI B;  5GTI H;  1PP9 J;  3JC2 2;  4NPD A;  2BCC E;  3VOP A;  2L5G B;  1KB9 H;  1OVR A;  1EXJ A;  3A2A A;  2JR8 A;  1SQB K;  4ZKP A;  3L75 G;  5CCH D;  2OYI A;  3WMM 0;  1KD1 Q;  4I7Z B;  1NYH A;  1N8R Q;  2H88 C;  3CC2 P;  3RL0 D;  4KT0 J;  3M9Q A;  1HTL C;  1MZ9 A;  2WPR A;  1JB0 J;  2IFM A;  2FYU J;  2O1J A;  2WIT A;  1BGY G;  2Y9Z A;  1NKZ B;  3B5N B;  1IFD A;  4HB1 A;  5AVW B;  1BSN A;  2OTL P;  1NGM B;  4W7Z A;  1P84 E;  3PH0 A;  3F89 A;  1PFI A;  3WU2 E;  1PP9 G;  3CCM P;  3H25 A;  3B5N A;  4W7Y A;  3L70 J;  2WSC H;  1IZN B;  5CCG D;  3GMA A;  1VQ5 P;  1ZXG A;  1S1C X;  1FZC B;  1RQU A;  1BE3 J;  2ZFC A;  1UIX A;  2BCC J;  3CL3 D;  2Y9Y A;  1SQV E;  3L73 E;  4LC1 A;  1OWA A;  1LWU B;  2FYN C;  2FYU G;  2XU6 A;  2Q3I A;  3GF3 A;  1YIT P;  1L0L D;  2A06 E;  1FJK A;  2OAR A;  2K37 A;  3CCQ P;  4H13 C;  2FFD B;  4GKG A;  2ZXX A;  3VP9 A;  3V2R A;  2KUB A;  1ZOY C;  1PPJ D;  4MN4 C;  4PV1 D;  4QMA A;  1L0N E;  1LWU A;  3E7K A;  3LW5 J;  3OJA B;  1YTZ T;  3FWN A;  3TF5 A;  2MKV A;  2M8R A;  2L91 A;  2FFD A;  2CPS A;  3GLM A;  4YPC A;  3MHV A;  1E79 H;  2XDJ A;  2FKW B;  1TU3 F;  3KZI E;  2Q3E A;  2GUV A;  1X0T A;  1NH4 A;  1BE3 G;  2OGU A;  4I2L C;  5APU A;  3Q2Y A;  1AVO A;  3KXD A;  2BCC G;  4N3Y B;  3AEE C;  3M9B A;  2LXC B;  1G1J A;  3IF4 A;  1NTM K;  1SLQ A;  3CX5 D;  1RF0 A;  2YXQ B;  2P67 A;  1HF9 A;  3AE9 C;  2QSI A;  4BRY B;  1YJ9 P;  1RE4 A;  1SQP D;  3L74 D;  4XA4 A;  4GDO A;  3P8C D;  1SQV J;  3L73 J;  1RE3 C;  2Q7C A;  2D2C D;  3PP5 A;  1YQ4 C;  5GTI E;  5KJ7 A;  1T6A A;  1KC8 Q;  4A7P A;  4EIJ A;  5AW8 B;  1FU1 A;  1S5L E;  1KFM A;  2KLV A;  4BRY A;  3KQG A;  5CBO A;  2AEJ A;  5AVQ B;  3H1H D;  3H1J E;  3H1L D;  3BCC E;  2B88 A;  2IBZ E;  1SQQ K;  4KHX A;  1FZA A;  1M1J B;  1L0N J;  2OYH C;  3CWB E;  2JJL A;  1K9M Q;  4IL6 X;  3L72 D;  3G71 P;  2R3C A;  3LIE A;  4XFJ A;  2YKQ A;  1FBM A;  2KXP B;  3GF7 A;  3P7K A;  3RK2 C;  2IX7 C;  1L4A B;  5AVS B;  4WY4 D;  2QA4 P;  2ZT9 B;  2KP8 A;  5APT A;  2HYN A;  1SQV G;  3L73 G;  1IJD B;  2K3R A;  1NTZ E;  3IFM A;  2N1T D;  2AEF A;  1VQK P;  3MZW B;  3HUS C;  2A06 G;  4AUW A;  4TLF A;  1AA0 A;  1M8O B;  2QJY C;  1EZV D;  2QM7 A;  1BCC D;  1FZG A;  1L0N G;  4ASV A;  4W80 A;  3AE2 C;  3L71 D;  1G2C B;  3H1J J;  3BCC J;  1FOS E;  2H89 C;  3PTZ A;  4YTP C;  1W5C E;  2QRX A;  5AW1 B;  1SFC B;  2ZYG A;  3M9H A;  4GOD A;  4Z1M H;  2ZYD A;  4BWN A;  2PP6 A;  1LTB C;  2XKM A;  3S9O A;  1G2C A;  1M57 D;  2IZ0 A;  1JTH B;  2QE7 H;  1NOH A;  3AED C;  1SQB D;  2B9B A;  2AEM A;  3N7N A;  1NTK J;  5AVY B;  2NPS C;  2FYZ A;  3FWL A;  5KLI C;  4EOT A;  2CPB A;  3CX5 I;  1H0T B;  1SFC A;  2OYO A;  1QEX A;  2B89 A;  5B66 H;  1NU1 J;  3EWK A;  3E1R A;  1LTG C;  1HVV A;  1NTZ J;  2YIU B;  4H44 D;  5APS A;  2E75 D;  1YJW P;  1KQL A;  1Q81 Q;  1KZU B;  4NPE A;  1KB9 D;  2E76 D;  3HD7 D;  2WSC J;  2OTJ P;  1BDD A;  2KNC A;  2RKL A;  2P58 A;  2PRR A;  1FZC C;  2IBZ G;  2WMM A;  3CMA P;  4PD4 D;  4D6T E;  1LJ2 A;  1MKM A;  3H1K J;  1J1D C;  3S4R A;  3CCU P;  4HH2 A;  1T3U A;  2WPQ A;  2C0W A;  1EXI A;  2NRG A;  3AEB C;  4U3F D;  2KZI A;  4IL6 H;  4EI2 A;  1URQ A;  3MD0 A;  2WVR A;  1NTK G;  1S5L X;  2SPZ A;  1JM0 A;  1OXZ A;  2E74 D;  1KIL D;  5CJ4 A;  1RF1 A;  3BAT A;  4C7R A;  1JO5 A;  3JSV C;  2POH A;  3CC4 P;  1R5S A;  1Q82 Q;  5AW5 B;  1GU4 A;  4JPZ B;  1NU1 G;  3OW2 O;  4GOF A;  1VPC A;  1NTZ G;  1RHZ B;  1P84 H;  3CCE P;  5AVR B;  2J59 M;  4H0L B;  2QJK C;  3M0D C;  3WU2 H;  1J1E B;  2B87 A;  2QM8 A;  4ZMD A;  2YO2 A;  4DOJ A;  3R2P A;  2Q1K A;  1EZV I;  1KV4 A;  3C1L A;  3H1K G;  1QVG O;  1VF5 B;  5CBN A;  5AW9 B;  1OIP A;  2HG5 D;  3CXH I;  1LT9 C;  4D6T J;  4ZKU A;  1KYO H;  3BRV B;  1ZV8 A;  3RL0 B;  1N73 C;  1VQ8 P;  2HR3 A;  3H1I G;  1NTM D;  3GHG C;  2QVA A;  3FGA D;  1GL2 B;  2A45 I;  5CCH A;  2ZXE B;  1LTA C;  1SP4 A;  1Y9B A;  4OGQ D;  1EDI A;  3A7O A;  5KAF E;  1J2J B;  1JOC A;  3U1C A;  2E75 C;  1SS1 A;  2K9J B;  1YBK A;  2IYO A;  2E43 A;  3KZI H;  1AJY A;  2E76 C;  2YXR B;  3KPE A;  1FDI A;  2AXC A;  2N9Y B;  2R5B A;  3I56 P;  1X9V A;  1JY2 O;  1SQQ D;  1KB9 I;  1L4A C;  1FAV A;  1L0L E;  2O01 H;  5AW0 B;  2IFN A;  4HJG H;  4D6T G;  4PD4 I;  2ITA A;  2J5U A;  3E1I A;  1LTS C;  5B66 E;  3EFF K;  1PPJ E;  3M06 A;  2E74 C;  3B8E B;  5CCG A;  2KK7 A;  3CPW O;  3V2Q A;  1A02 F;  3MUD C;  4Y28 J;  1OW7 A;  3TNU B;  2PFX A;  1S5L H;  2Q5U A;  1NJI Q;  2XZR A;  3NMD A;  5APY A;  4RKU J;  1H89 A;  2N9B A;  2CK3 H;  1LT1 A;  1IFI A;  1SQX K;  4YXW H;  3FXE A;  1ZW0 A;  2OQQ A;  2E5Y A;  3TNU A;  3QH9 A;  5AW7 B;  3SFE C;  1GK6 A;  1QL1 A;  2C9N Y;  4IL6 E;  2KZJ A;  1GW3 A;  5APQ A;  1Y8A A;  3II6 A;  1SQP E;  3VMZ A;  3L74 E;  2C9L Y;  2VRS A;  1IFP A;  3AEF C;  3CCV P;  1FJP A;  1L0L J;  1XTC C;  4GOE A;  3VMX A;  3CD6 P;  4WBA A;  3H1L E;  5KLV K;  1KOR A;  2YIU C;  4XE5 B;  4JF7 A;  4OGQ C;  1U57 A;  2YKO A;  4N78 D;  2BEZ F;  1X8Y A;  5E79 E;  4RJT A;  3RK2 D;  1LP1 B;  3FXD A;  3U59 A;  3N4X A;  1MV8 A;  1KYO E;  1JY3 N;  2GUS A;  2GA1 A;  1KN7 A;  4DZO A;  3PLN A;  2G3A A;  3G4S P;  1LP1 A;  2QIW A;  4EYY Q;  1N7S B;  1YYC A;  5DJT B;  1L0L G;  1USE A;  1SQP J;  1U7M A;  2P7J A;  1QLE D;  3L74 J;  3V2N A;  3L70 D;  1KMI Z;  1S9K D;  3TDK A;  2H43 A;  1BCC E;  2LXB A;  2N1T B;  1PPJ G;  1JEK A;  2R44 A;  1N7S A;  4I1L A;  1GMJ A;  3CC7 P;  1K8A Q;  2JP3 A;  4WY4 A;  1U7J A;  3VP8 A;  3L71 E;  3H1L J;  3HE5 B;  3C9I A;  1W2B O;  5K5G B;  1FC2 C;  5BU5 A;  2N1T A;  3TGU D;  1QGK B;  2WSF J;  2Y0C A;  1YI2 P;  2NZ2 A;  2AXT H;  3W68 A;  1R5L A;  2NPS D;  3B5N D;  3L72 J;  3HE5 A;  3A0H E;  1CI6 A;  2XNX A;  3IN6 A;  2IYP A;  4AYC A;  5C39 A;  2RH0 A;  1M7L A;  1SQP G;  3Q1M A;  3L74 G;  2DW3 A;  1GL2 C;  1XTG B;  2JO1 A;  4C7N B;  4GIF A;  2KI7 B;  5KKZ C;  1LTJ B;  4IFM A;  1LT9 A;  1ZR2 A;  1MFT A;  3H1H G;  5TJH A;  3H1L G;  2ZVN B;  3CI9 A;  1NHL A;  5BU8 B;  4C7N A;  1NTK E;  4Y99 B;  1BCC J;  1LTJ A;  1AQT A;  3WUU A;  1FZE A;  2W6A A;  2LKM A;  3AE4 C;  3I55 P;  3HD7 B;  3A0B H;  3L72 G;  3L71 J;  1Z56 A;  2WT7 A;  1NU1 E;  1T3J A;  4HYT B;  1NVO A;  1WRG A;  1K05 A;  3RK3 C;  1ZP0 C;  2O01 J;  3A3Y B;  1KIL E;  3WUV A;  3VMA A;  2Y0E A;  1OW6 A;  3HD7 A;  3NFQ A;  3D70 A;  4WWI A;  2OYI C;  1E5W A;  3PRJ A;  3FX0 A;  1KIL B;  3H1K E;  2O3J A;  5APV A;  4LLH A;  3IR9 A;  1EDJ A;  3NTN A;  2W8Z A;  5KAF H;  3CXH D;  4DCK A;  1YQ3 C;  1EZV G;  4I7Z C;  1RY3 A;  1BCC G;  1KIL A;  2O1K A;  5KJ7 D;  1GDT A;  2LR2 A;  2G8Y A;  3H1I E;  2W90 A;  3L71 G;  1M90 Q;  1GZL A;  1HGV A;  1ZRT E;  4I6M C;  4L74 A;  1MFZ A;  3ITK A;  1SQX D;  1LTT C;  3B5N C;  1VQN P;  1IK9 A;  3EFG A;  1JY3 P;  2ZYA A;  2YO3 A;  1NTM E;  2WWW A;  2KNC B;  3GW6 A;  2KS1 B;  1DH3 A;  1SQB G;  3S1K A;  5AVU B;  2FYU K;  2KSJ A;  1L2P A;  1IC2 A;  3H1J D;  1PGP A;  3BCC D;  2KS1 A;  5TIS H;  1URQ B;  2AXT E;  1M56 D;  3EQ2 A;  3LID A;  3RBZ A;  1RF1 B;  3CWB D;  5BVZ A;  5KLV D;  1L4A D;  3RGU A;  1P84 I;  4JQ0 D;  1SQQ E;  3HE4 B;  2ZT9 D;  3L4F A;  1LWU C;  1RH5 B;  5DJU B;  1JMM A;  1PGO A;  2FFD C;  3CX5 H;  4N6J A;  3AEC C;  2KOG A;  1DD4 A;  1NO4 A;  2B87 B;  3HE4 A;  3H1I J;  4H13 B;  2ZAE B;  4WB4 A;  1PGJ A;  3CCS P;  4U3F G;  3Q3D A;  4R4L A;  1DEB A;  5B5E E;  3U1A A;  1KYO I;  4PJ0 E;  2KB7 P;  3OAK A;  1T2K C;  2Z5I A;  2WTY A;  2P2U A;  1VQ9 P;  1QX8 A;  1NTM J;  1ZLL A;  1RF0 C;  3JCU H;  2WSF H;  1RE4 C;  2W6J H;  2FBW C;  2R5D A;  1GW4 A;  3A0B E;  3RL0 g;  2QJP B;  3QWO C;  3CCJ P;  5E79 H;  4OWF A;  1N86 A;  5KJ7 C;  3AE3 C;  5KAI H;  2WSE J;  3G6E P;  3KHU A;  4GT1 A;  1SQQ J;  1VQ6 P;  3CME P;  2HPC B;  2YKP A;  3OA7 A;  5L8R J;  5AVV B;  3D6Z A;  1FOS F;  2E5T A;  1PGQ A;  1WT6 A;  5EFW B;  3TK1 A;  2YNY A;  3H32 A;  1NKN A;  1M1J C;  1NTM G;  1SQV K;  4RO0 A;  2HPC A;  5AVT B;  2FXM A;  1RE3 A;  4N78 E;  2JWD A;  1USD A;  1PIX A;  4TT3 H;  2I8D A;  2OYH B;  3AE7 C;  2I1J A;  1NAY A;  3CLQ A;  3D71 A;  1VL2 A;  1VQO P;  3AEG C;  2IBZ I;  4BXL A;  2ZT9 C;  2E42 A;  1L0N K;  2HOD B;  2WSS H;  1N7L A;  3RK2 B;  3T97 B;  2OYH A;  5AVZ B;  2RMZ A;  1EC5 A;  1SQQ G;  1X79 B;  3SFD C;  4K35 A;  4IFD K;  1H8A A;  1JCC A;  4KJM A;  2IDB A;  3A0H H;  2R3S A;  4B86 A;  2HOD A;  3T97 A;  4H0L D;  1K73 Q;  3HUS B;  1S9K E;  5TIS E;  2KSE A;  4PV1 B;  4UB8 H;  2QEX P;  1LTI C;  1QL2 A;  1HWT C;  1GTW A;  1FS0 E;  3L75 D;  1GK4 A;  1RQV A;  2V7Q J;  3P32 A;  1VF5 D;  3HUS A;  3V2P A;  1IFJ A;  3TGU E;  1IK7 A;  4IFF A;  3MGN A;  3CX5 E;  1KQS O;  1SFC C;  2QG4 A;  4PD4 H;  1BGY D;  3P8C E;  1OMI A;  1FE6 A;  2M5A B;  4UB6 E;  2P1J A;  1GL2 D;  2YMY A;  3AE5 C;  5CHX A;  3B4S A;  1PP9 D;  3P8M C;  1VQL P;  3H1H E;  2NPS B;  1Q2N A;  1AV1 A;  5KLI B;  4JYB A;  2D2C B;  1Q86 Q;  3JCU E;  1FDO A;  1PV3 A;  2M5A A;  2V4H A;  3SWK A;  1NTK K;  3F5H A;  2NPS A;  3L72 E;  1JY2 N;  5KAI E;  4M3L A;  1URQ C;  3USS A;  1YJN P;  1NAF A;  5CJ0 A;  2YMK A;  1RF1 C;  2FYU D;  1NU1 K;  1EDL A;  2ZJS E;  2H8P D;  1NTZ K;  3RK3 D;  2K88 A;  4L75 A;  3RBX A;  3MTU E;  1J1D B;  3Q5S A;  1KTM A;  3TGU J;  1VQP P;  5H2F E;  5APW A;  3HTK B;  1OX3 A;  2WZ7 A;  3G9R A;  1FZC A;  2FXO A;  1ZN5 A;  4WY4 B;  1G1I A;  2KYV A;  2OTK E;  3L35 A;  1Q7Y Q;  5AW4 B;  3O6Q B;  1EZV E;  4ZNC A;  4C46 A;  3PHL A;  1Q90 D;  4H0L C;  4ASW A;  3HTK A;  1J1E C;  1BE3 D;  1N2D C;  2BCC D;  3B71 A;  3H1H J;  3SWF A;  3O6Q A;  3CXH E;  2QJK B;  1PL5 A;  2RN0 A;  3L70 G;  2BAS A;  2P10 A;  2FXP A;  1OVV A;  1EDK A;  3Q5P A;  2WSE H;  1CI6 B;  1CSB A;  5CMZ A;  2QJP C;  2C0X A;  1VF5 C;  3ABV C;  2IZ1 A;  1X22 A;  3MP7 B;  3KYQ A;  1HH0 A;  3M0D A;  5CCH C;  3G3Z A;  1SQB E;  1SQX E;  3TGU G;  3RL0 C;  1GU5 A;  2WPV B;  1LT9 B;  1DD3 A;  3K5B A;  4UB8 E;  1N73 B;  1DX7 A;  1MUU A;  1VQ4 P;  3GHG B;  1P84 D;  1KB9 E;  1UII A;  5B5E H;  3TSI A;  3W67 A;  1ZR4 A;  2R32 A;  4PJ0 H;  2J58 A;  1R8E A;  5GTH H;  2WT7 B;  1N73 A;  5APX A;  4PD4 E;  1JUN A;  4H44 B;  3GHG A;  2E75 B;  3AE8 C;  1CW5 A;  5KLV E;  2ZVO B;  3IAO A;  2E76 B;  5CCG C;  1HJB A;  1SQV D;  3L73 D;  4U3F E;  4YXD C;  1EQ7 A;  1KYO D;  1M1J A;  1N7S D;  4O9B A;  2A06 D;  2H7H A;  1W2E A;  4AQR D;  4CPG A;  2XV5 A;  1SQB J;  1T2K D;  1SQX J;  2E74 B;  1L0N D;  4WVZ A;  2V7Q H;  2Z5H A;  1L4A A;  3NXS A;  1YHQ P;  1DIP A;  2GM4 A;  4IOI H;  1IFM A;  2HLO A;  4PV1 C;  5AW3 B;  2Q9I A;  2W6B A;  2UWJ E;  4NPF X;  1GD2 E;  1QVF O;  3BAS A;  3R4Y A;  3CCL P;  1HUC A;  3KDP B;  3M91 A;  4L76 A;  1S3J A;  2KLU A;  3MUD A;  2I1K A;  1PZQ A;  1AFO A;  1HBW A;  1JY2 P;  2W83 C;  2M3E A;  3L36 A;  2PAJ A;  3CCR P;  3I5C A;  4OH8 B;  3CWB J;  5KLV J;  4U7J A;  1KFN A;  1VQM P;  1KQF B;  2A45 G;  2WPS A;  1CZQ A;  1S4X A;  4DT0 A;  3V4Q A;  4U3F J;  5AW2 B;  1SQX G;  3V6I A;  1K04 A;  1OZH A;  2D2C C;  2Y0D A;  5KTB A;  2K9Y A;  2JEE A;  3ZDM A;  1M1K Q;  3V4W A;  1JTH A;  2JDI H;  2IBZ D;  1L0L K;  4OGQ B;  1H0T A;  1VDF A;  3BRT B;  1FZF A;  3H1J G;  3BCC G;  3O8Z A;  1NTK D;  1KQG B;  3AE6 C;  2FYN B;  3SWY A;  3CWB G;  5KLV G;  2WQY C;  3VYI A;  1S2E A;  1WMK A;  1N7S C;  2HFE D;  1NU1 D;  1JNM A;  3AE1 C;  4WY4 C;  1NTZ D;  3LW5 H;  4UB6 H;  3C8V A;  5GTH E;  5M1B A;  4OVN F;  1T8Z A;  2N1T C;  3MIW A;  3UIA A;  1BSH A;  2MJZ A;  3L75 E;  1IFN A;  1ZME C;  2M3B A;  3V5B A;  2M0B A;  3H1K D;  3SSU A;  1SFC D;  1OVU A;  4L73 A;  1SQP K;  3VTP C;  2IPP A;  1FDM A;  2Z4E A;  1AQ5 A;  3A5T A;  3HRN A;  1SVF A;  4JYC A;  1BGY E;  3L37 A;  1JMB A;  2FY8 A;  3H1I D;  3VMY A;  3VN0 A;  1A02 J;  2Q6Q A;  3H32 B;  1YTZ I;  1BDC A;  1ZRT D;  4HKZ H;  1DEE G;  1HJ0 A;  3D6Y A;  2KIK A;  2XND H;  1PP9 E;  2JKV A;  5H2F H;  1LTJ C; 
#chains in the Genus database with same CATH homology
 4D6T G;  2A06 G;  1KB9 H;  3L71 G;  1SQB G;  3CWB G;  5KLV G;  3L70 G;  1SQX G;  3TGU G;  1PP9 G;  1KYO H;  3L72 G;  1SQQ G;  1EZV G;  1BGY G;  1SQV G;  3L73 G;  4PD4 H;  1BCC G;  1PPJ G;  3L75 G;  1NU1 G;  3H1H G;  4U3F G;  3H1J G;  3H1L G;  1SQP G;  1L0N G;  3BCC G;  1NTZ G;  3L74 G;  3H1K G;  1BE3 G;  3CXH H;  1P84 H;  2IBZ G;  1NTM G;  1NTK G;  2FYU G;  1L0L G;  3H1I G;  2BCC G;  3CX5 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...