1PP9G

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
RQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
total genus 18
structure length 73
sequence length 73
chains with identical sequence T
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1pp9G00
1SQXG 3H1KG 3L73G 3H1LG 1KB9H 3L75G 4U3FG 1L0NG 3BCCG 3H1IG 3L74G 1EZVG 3H1HG 2A06G 1BGYG 3TGUG 1BE3G 1BCCG 3L72G 4D6TG 1PP9G 1SQVG 1NTKG 5KLVG 1NTMG 3H1JG 1SQPG 3CX5H 1NU1G 3L70G 1SQQG 2FYUG 1KYOH 2IBZG 1P84H 3L71G 3CXHH 4PD4H 1NTZG 1L0LG 3CWBG 1PPJG 2BCCG 1SQBG
chains in the Genus database with same CATH superfamily
1SQXG 1FZBA 2WTYA 5TISE 2FFDA 1YQ3C 2KB7P 4I7ZB 4BXLA 2NRGA 3E1IA 3HE4B 3IR9A 1W5CE 1EDKA 2KNCB 2V4HA 1KQGB 3L75E 4I1LA 2K1AA 2ZYGA 4C7RA 3A0HH 4LGDE 1UIIA 3L71D 1NGMB 1IFDA 3PTZA 5APUA 1LTJA 3L73E 1Y8AA 2FYUD 3A2AA 1IJDB 2E75D 2ZXXA 2HLOA 4MN4C 3MUDC 1VQLP 2KK7A 1SQVJ 2QJPB 3RGUA 2WMMA 3H1LD 1DD3A 1LTAC 3NFQA 1P84E 2XV5A 1KORA 4ASVA 2WITA 1N7SC 4WBAA 1RF0C 5KLVJ 1FE6A 1KILE 1QVGO 2OTKE 1SQPJ 3SWFA 1EZVI 4EI2A 3H25A 1OX3A 3AE2C 4GDOA 1P84H 1OXZA 2J5UA 1XTCC 3KDPB 1HJBA 1IFPA 3HUSC 1Q90D 1Q81Q 3H1HG 1JY2N 3MD0A 2CK3H 4GT1A 1NTKG 1PPJG 3AEAC 3B8EB 5EFWB 2WSSH 4YPCA 2PAJA 2KSEA 1MKMA 3L35A 1NTMD 3W67A 3IAOA 4PD4E 2QJKB 3TGUE 2Y9ZA 3GLMA 1LWUC 2D2CC 3G3ZA 3CL3D 1L2PA 2NZ2A 1QEXA 1M1KQ 1L0LD 1NAFA 1ZR4A 1J1EC 1EDIA 4GODA 1LTJC 4RJTA 2QVAA 2OYIB 4A7PA 4YXDC 3MUDA 1VQOP 2QE7H 2IZ1A 2O1KA 2KIKA 3CCUP 1KN7A 1LT9A 2K9JB 4D6TJ 1L0NK 4YXWH 3KHUA 1QGKB 3CC2P 2KUBA 2OQQA 2PRRA 1RF0A 1Q2NA 1SQBJ 1RE4C 1NTZK 1E5WA 2N9YB 1SQQG 1WT6A 2O01H 3HD7A 3P8CE 4I2LC 3T97A 5KKZB 1W2BO 1R5LA 2JDIH 1ZRTE 1PZQA 2WVRA 2YIUC 4H0LB 3TNUA 5APWA 3EWKA 3M91A 5AVQB 1NU1D 4LLHA 1KFNA 2HODA 3GG2A 1LT9C 1SQVD 2GA1A 1KQLA 1VL2A 1LGHB 2IFNA 4I7ZC 5CBOA 5CCHC 1JMBA 3U1CA 3F5HA 1MFTA 3CX5E 4U3FG 2C9LY 1EC5A 1EZVG 2CPSA 2FY8A 2M0BA 3CCQP 2AXCA 3CCSP 2FKWB 3S9OA 1LP1A 3WU2E 1KYOD 2NPSB 1S72P 1LTIC 3MZWB 1VF5B 2QSIA 2QJPC 4GIFA 5CJ4A 2M3EA 2B88A 3H1JE 3M06A 4PV1D 3PJSK 2RH0A 2XU6A 2R5DA 1N73B 2D2CD 2Q7CA 1ZOYC 5AVRB 1ZR2A 1JB0J 1USEA 2E74C 2NPSD 1NHLA 1Y9BA 1BE3E 2BCCD 2Q5UA 2O3JA 3HRNA 1MUUA 3QH9A 3V4QA 3USSA 1KC8Q 5CBNA 1X9VA 1S4XA 1FDOA 1BGYD 1JTHB 3U1AA 1QL2A 1HF9A 1H89A 1KQFB 1SFCC 3P8CD 3D6YA 3ABVC 2JWDA 3L75G 4KJMA 2E42A 3RL0B 3GMAA 2PGDA 1H0TB 4IFDK 3N4XA 1JY3O 4PJ0H 3MHVA 1N7SB 2WT7B 2ZFCA 1WRGA 3CX5D 3V4WA 1N2DC 3AE5C 3K5BA 4WWIA 4DT0A 3HTKA 5GTHE 1VQKP 1KV4A 5KLVE 3R4YA 1ZW0A 3RK3B 2R3CA 1HGVA 4H13C 2PFXA 2M5AB 3WMM0 5KAFH 1FZCC 1RHZB 4HH2A 2A45I 2KSJA 5AW5B 5KLVG 1SP4A 3A3YB 2FFDC 2ZXEB 1UIXA 2KS1B 1BCCJ 3HD7C 2KZJA 3SFEC 2W6AA 4H44D 3QWOC 3SSUA 2UWJE 3F89A 5KAIE 1NTZJ 2QJKC 1T2KD 1N8RQ 3CXHH 2YIUB 2A06E 1BGYJ 1EZVD 4IOIH 2ITAA 1OFCX 5KAFE 1BCCE 1JCDA 1GK6A 1D7MA 1J2JB 5AVXB 1L4AB 1SFCA 2JJLA 2FYUK 1FOSE 3AE8C 3AE1C 3CPWO 4WY4B 1J1DB 3CWBD 4B86A 2WT7A 3L74G 3OA7A 2N1TD 4O9BA 4ZKPA 2P10A 2OTLP 2FYZA 2P58A 2JWAA 4RESB 4OGQC 4DJGA 1HBWA 1KMIZ 2AEMA 2AXTH 1RE3A 1YJ9P 2YKPA 3RBXA 2E75B 1IFMA 2RKLA 2R44A 1NU1G 2GUSA 1M57D 2QJYC 5CMZA 5APYA 5AVTB 3L72J 1KYOH 4JF7A 1K9MQ 3IFMA 4UB6E 3A0BE 3AE7C 1PL5A 1OW8A 1LTBC 2DW3A 3I5CA 2FYNB 4BRYA 4U3FD 1L0LK 1TU3F 3H1ID 4Y99B 1NTZE 1ZXGA 3V5BA 3C1LA 2IBZE 1T3JA 3H1LG 3TSIA 3KZIE 1L0NE 1ZP0C 2H88C 2YO3A 3L73D 2RMZA 4U3FJ 1T2KC 3A0HE 1W2EA 5KLVD 5DJTB 3H1JJ 1A02F 1S3JA 2B87B 2E76C 1K04A 1NU1J 1MZ9A 3PP5A 1YTZI 3BASA 1FZCA 2V7QJ 1GW4A 3L4FA 4IFFA 2K3RA 1KQSO 1FDMA 2ZYDA 1PGQA 4OGQD 5KLIB 1SQXK 2KXPB 1JMMA 1RE3C 3GHGB 1KFMA 1KZUB 2A45G 2O1JA 1SQBD 4RO0A 1OVRA 3B71A 3M0AA 5M1BA 3RK2B 3VTPC 2Q9IA 2KOGA 1FBMA 5APVA 1YJNP 1IO4A 2J58A 4K35A 4PV1B 1LTGC 2E43A 3TYYA 3CC7P 1JY2P 1VQ5P 1CI6A 3ITKA 4JYBA 3EFFK 4QMAA 5APTA 3AECC 3CLQA 1M1JB 2ZVOB 4DOJA 4Y99C 3H6PA 1NKNA 3PHLA 4Z1MH 3RK3C 1X0TA 4WB4A 3A5TA 1DEEG 3H1JD 3L74J 2E5TA 2Y0DA 4H13D 2P7JA 4EYYQ 3A0BH 1YI2P 4TT3H 3L73J 2HPCB 1J1DC 3A7OA 3AE4C 1HGZA 4L73A 4C7NB 1GW3A 4LC1A 5BU5A 1AVYA 4ZNCA 1YHQP 3MP7B 5AVWB 3LW5J 1GL2C 3HD7D 3MIWA 3D6ZA 3AE3C 2WSCJ 1RQUA 2QM7A 4N78E 3H32B 3VMZA 3Q5PA 2K9JA 3O8ZA 1VF5D 2G8YA 3VP8A 4IFMA 1EXJA 2L91A 2C0XA 3HD7B 3M0DA 2WPQA 3VYIA 4D6TD 4RKUJ 4I6MC 1DIPA 1SQBK 1N86A 3II6A 1NTZG 5AW8B 2QEXP 2FYUJ 1YQ4C 2KP8A 3TF5A 2W27A 2WSEH 3L74D 4XA4A 3RK3E 2NPSA 3VMAA 2O01N 4ZKUA 1LJ2A 3CWBJ 3G71P 5APQA 3AEBC 1JO5A 1AVOA 1LTSC 1AQ5A 5B66H 2K9YA 1U7JA 5KTBA 4OWFA 1T6AA 2WSCH 3H1HE 3O6QB 4OH8B 3LW5H 4CPGA 2BCCJ 1G1IA 5AVVB 4OVNF 3RK2D 1SQQJ 3PRJA 4NPFX 1VQ9P 5CCGD 2E74D 2NPSC 4KHXA 3HUSB 4UB8H 1FZFA 2K37A 2OYHC 3I56P 1G2CB 1OVUA 4N3YB 1JY3P 2OARA 3BCCJ 2YNYA 2W83C 2WSFH 1OZHA 3W68A 4EDFA 1N73C 2IBZD 3IN6A 3S1KA 1GZLA 4PJ0E 2H43A 1NTZD 2GM4A 1OWAA 1N7LA 2QG4A 1VQNP 3H1IE 1GU5A 2W6JH 1SQXJ 1GTWA 2XDJA 4YTPC 1VF5C 1IK9A 2IYOA 1PV3A 1S2EA 2BCCG 1VQPP 1YIJP 1SQVK 2WSFJ 3CC4P 1JCCA 2LXCB 2Q3IA 1NU1K 2W6BA 2Y0EA 2YKOA 3AE9C 2IZ0A 5KLIC 3P8MC 1H0TA 3BCCG 1Q7YQ 3CCMP 1J1EB 1RQVA 1ZLLA 1ZV8A 2IDBA 1GL2A 3H1KJ 2Q6QA 3L72D 3M9HA 3TGUG 5B5EE 2M8RA 3OW2O 2Q3EA 1IFNA 1S5LX 3D71A 1L0LJ 2RN0A 1IFIA 1HUCA 2C9NY 3FXEA 1M56D 5AVZB 1NYHA 3KPEA 5E79E 5AW0B 1S5LE 2MKVA 5L8RJ 3L70G 1N73A 3H1KD 3HE4A 3TK1A 4BWNA 1FZEA 5AW9B 5C39A 2N1TB 3Q5RA 3G9RA 1L0NJ 1DX7A 2KI7B 4IL6H 5TJHA 3JCUH 2P1JA 3L74E 3OAKA 3KQGA 2FXPA 2Y0CA 4U7JA 3RK3D 3TGUJ 4DCKA 3H32A 1BDDA 2E75C 3H1HJ 1SQPD 4WY4A 1A02J 1LWUB 3B5NA 1YITP 1IC2A 1YJWP 1IZNB 4GKGA 3TNUB 2A06G 1BGYG 3CD6P 3CWBE 1X79B 1JEKA 3L70J 4HKZH 1Z56A 2GUVA 4N78D 1URQB 2HODB 1Y47A 2FBWC 4D6TG 2LKMA 2OYOA 2A45H 2P2UA 2IPPA 1Q86Q 1FZGA 1GDTA 5AW1B 2E74B 2WPRA 4WY4C 1EZVE 3LIDA 3H1IJ 3S4RA 1MFZA 5AW6B 1NWQA 4AUWA 1BSHA 1KTMA 2D2CB 2I1KA 1M90Q 2QRXA 1VPCA 2L5GB 2WPVB 3B5ND 2B89A 2FXMA 3KXDA 3BCCE 3R2PA 4JBZA 1NOHA 3G4SP 2JO1A 2K88A 1S9KD 1XTGB 3VMXA 3D70A 1GK4A 4PD4I 3ZDMA 3FXDA 4TLFA 3WUVA 1CW5A 1FJPA 2YKQA 1JNMA 4C46A 2OYIC 1PGPA 2BCCE 2I8DA 2N9BA 5H2FH 2ZJSE 1AJYA 1SQQE 2FFDB 3M0DC 4GOFA 1X8YA 5KAIH 2WZ7A 3H1IG 2B87A 4KT0J 1PGJA 3U59A 3RBZA 3VN0A 5BU8B 1H8AA 1KD1Q 1JTHA 1BSNA 1CSBA 1LNQA 2R3SA 4H0LC 1VQMP 4HJGH 3N7NA 3EFGA 2LXBA 2YMYA 5AVUB 3G6EP 2KZIA 2ZT9D 1LTJB 2OYIA 1QL1A 2WWWA 1PP9G 5AW2B 1EDJA 3AE6C 4L75A 3HE5A 1HJ0A 3L70E 3H1JG 3BVHA 1NTKD 1PPJD 1SQVE 1SQXD 3CXHD 2YXRB 3RK2C 3H1LJ 5AVYB 2KYVA 3KZIH 3JSVC 1GL2B 1BE3D 4ZMDA 1FOSF 2J59M 2IYPA 1NTKE 1PPJE 3SWKA 3TDKA 2ZYAA 1ZRTD 1HVVA 1M1JA 3BCCD 2AXTE 1S9KE 3IF4A 2OYHA 4UB8E 1JY2O 3M9QA 1IK7A 2PP6A 3FX0A 1T3UA 1R5SA 5KJ7C 1KB9H 1KYOE 1FU1A 2KLUA 1PP9J 2SPZA 3BRTB 2JP3A 4GOEA 4H44C 3AEDC 3L71J 2KNCA 2JEEA 3L36A 3T97B 2E5YA 1GU4A 1NJIQ 1DD4A 3CX5I 2ZVNB 3V2PA 1RF1A 3GF3A 1SQQD 2BEQD 2N1TC 2IBZI 1YYCA 5GTIH 1AFOA 1L0ND 3Q1MA 3M9BA 2OGUA 2W8ZA 4L76A 3P32A 1K05A 5CHXA 5CJ0A 1LT1A 3AEGC 3V2RA 1NTME 1LT9B 1URQD 1ZN5A 1X22A 1SLQA 2XNDH 5H2FE 2HFED 2R32A 3L71G 2ZT9C 1NTKK 2HG5D 4WVZA 1H88A 4JQ0D 1BCCD 3Q3DA 3B4SA 2IFMA 2XNXA 1M1JC 1NTMJ 2OYHB 1SQBG 2A06D 1NVOA 2AEFA 1PIXA 1WMKA 2O01J 2Q1KA 3CCRP 1JUNA 5B5EH 2AEJA 1QVFO 3Q2YA 4HYTB 2HR3A 2YMKA 5AW7B 1VQ4P 1PP9D 1P84D 5K5GB 1KYOI 2ZAEB 4K3AA 5AW4B 1M8OB 2KLVA 3KYQA 3LIEA 1RF1B 1NH4A 3MGNA 1G1JA 2HYNA 3L71E 1PP9E 2BASA 3OJAB 2H7HA 1AA0A 3L72E 4XE5B 1KB9I 1NO4A 1NTMG 4H44B 4UB6H 1GMJA 1PGOA 4IL6E 3B5NC 1SFCB 4R4LA 1NTKJ 2HPCA 2QA4P 1QX8A 3SWYA 5E79H 1Q82Q 3AEEC 3AEFC 1JM0A 4JYCA 1YTZT 3V2NA 1P84I 4WY4D 2IBZG 1OMIA 2QIWA 3H1LE 3JCUE 2Z5HA 1L4AD 1OIPA 3FGAD 3CCJP 3HE5B 1VQ6P 2XKMA 2FYUE 1EQ7A 1KILB 2FXOA 1SQXE 3CXHE 1N7SA 3VOPA 1ZMEC 2QJYB 1MV8A 3O6QA 1S5LH 3CMEP 5BVZA 1CI6B 1YBKA 1FJKA 1JOCA 2Z4EA 1RF1C 1FAVA 2YO2A 4W80A 3WUTA 2P67A 3L75J 3I55P 1M7LA 3EQ2A 3WUUA 1CZQA 1OW6A 1BE3J 1GL2D 3WU2H 4AQRD 1SQVG 1HTLC 4W7ZA 1FC2C 4IL6X 1SQPG 2JKVA 5GTHH 4C7NA 1BGYE 1G2CA 3CX5H 4JPZB 4PV1C 2WPSA 4Y28J 1LP1B 2KS1A 2YXQB 4M3LA 1KB9E 1N7SD 2ZT9B 4NPEA 1FS0E 1L0LG 2XZRA 3RL0D 2MJZA 3CXHI 5KJ7D 3Q5SA 3CCLP 3GW6A 1FDIA 3CMAP 1HWTC 3C8VA 3L70D 3H1KG 3L73G 2W90A 1K8AQ 3CCEP 1VQ8P 1SQQK 3CCVP 1KILA 1SVFA 2E76D 3VP9A 3V6IA 3PH0A 1L0NG 2JR8A 3H1HD 2V7QH 1PFIA 2FYNC 1RY3A 2H8PD 2VRSA 3GF7A 5B66E 4XFJA 3E1RA 3NMDA 1OVVA 1S1CX 1L4AC 3MTUE 4BRYB 5APSA 1GD2E 2M5AA 3UIAA 2C0WA 2Y9YA 5KJ7A 1EXIA 3JC22 1KILC 1E79H 2R5BA 1NU1E 5CCHA 1AV1A 5DJUB 1K73Q 3GHGC 3SFDC 4AYCA 2WSEJ 4PD4D 3NXSA 4EIJA 3V2QA 2FYUG 3HTKB 4OGQB 4D6TE 4ASWA 2I1JA 3C9IA 5CCGC 3E7KA 5AVSB 3RL0g 2N1TA 3HUSA 2E76B 4L74A 1U57A 3CWBG 5GTIE 1AQTA 4H13B 4HB1A 1NTMK 3BATA 1HH0A 1URQC 1NKZB 1NAYA 2LR2A 3FWLA 3P7KA 3H1KE 1EDLA 2G3AA 1SQPK 2B9BA 4H0LD 1DEBA 1JY3N 1R8EA 5CCHD 3RL0C 4EOTA 5KLVK 1L0LE 1LWUA 3B5NB 5CCGA 3CI9A 4N6JA 1U7MA 2Z5IA 1BE3G 1USDA 1BCCG 1BDCA 3L72G 1VQ7P 1IFJA 3TGUD 1L4AA 4NPDA 2M3BA 3BRVB 3FWNA 3VMYA 1SQPE 1URQA 2OTJP 4R4MA 1FZCB 1RH5B 2BEZF 4W7YA 2WQYC 2QM8A 1DH3A 3L75D 2CPBA 1SFCD 2IX7C 2POHA 3GHGA 2H89C 1OW7A 5AW3B 1KB9D 1RE4A 3L37A 4DZOA 5APXA 5KKZC 1FZAA 3PLNA 5TISH 1QLED 4PD4H 1T8ZA 4U3FE 1SQBE 1VDFA 3NTNA 1KILD 1SS1A 1LTTC
chains in the Genus database with same CATH topology
1SQXG 3H1KG 3L73G 3H1LG 1KB9H 3L75G 4U3FG 1L0NG 3BCCG 3H1IG 3L74G 1EZVG 3H1HG 2A06G 1BGYG 3TGUG 1BE3G 1BCCG 3L72G 4D6TG 1PP9G 1SQVG 1NTKG 5KLVG 1NTMG 3H1JG 1SQPG 3CX5H 1NU1G 3L70G 1SQQG 2FYUG 1KYOH 2IBZG 1P84H 3L71G 3CXHH 4PD4H 1NTZG 1L0LG 3CWBG 1PPJG 2BCCG 1SQBG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQX G;  3H1K G;  3L73 G;  3H1L G;  1KB9 H;  3L75 G;  4U3F G;  1L0N G;  3BCC G;  3H1I G;  3L74 G;  1EZV G;  3H1H G;  2A06 G;  1BGY G;  3TGU G;  1BE3 G;  1BCC G;  3L72 G;  4D6T G;  1PP9 G;  1SQV G;  1NTK G;  5KLV G;  1NTM G;  3H1J G;  1SQP G;  3CX5 H;  1NU1 G;  3L70 G;  1SQQ G;  2FYU G;  1KYO H;  2IBZ G;  1P84 H;  3L71 G;  3CXH H;  4PD4 H;  1NTZ G;  1L0L G;  3CWB G;  1PPJ G;  2BCC G;  1SQB G; 
#chains in the Genus database with same CATH topology
 1SQX G;  1FZB A;  2WTY A;  5TIS E;  2FFD A;  1YQ3 C;  2KB7 P;  4I7Z B;  4BXL A;  2NRG A;  3E1I A;  3HE4 B;  3IR9 A;  1W5C E;  1EDK A;  2KNC B;  2V4H A;  1KQG B;  3L75 E;  4I1L A;  2K1A A;  2ZYG A;  4C7R A;  3A0H H;  4LGD E;  1UII A;  3L71 D;  1NGM B;  1IFD A;  3PTZ A;  5APU A;  1LTJ A;  3L73 E;  1Y8A A;  2FYU D;  3A2A A;  1IJD B;  2E75 D;  2ZXX A;  2HLO A;  4MN4 C;  3MUD C;  1VQL P;  2KK7 A;  1SQV J;  2QJP B;  3RGU A;  2WMM A;  3H1L D;  1DD3 A;  1LTA C;  3NFQ A;  1P84 E;  2XV5 A;  1KOR A;  4ASV A;  2WIT A;  1N7S C;  4WBA A;  1RF0 C;  5KLV J;  1FE6 A;  1KIL E;  1QVG O;  2OTK E;  1SQP J;  3SWF A;  1EZV I;  4EI2 A;  3H25 A;  1OX3 A;  3AE2 C;  4GDO A;  1P84 H;  1OXZ A;  2J5U A;  1XTC C;  3KDP B;  1HJB A;  1IFP A;  3HUS C;  1Q90 D;  1Q81 Q;  3H1H G;  1JY2 N;  3MD0 A;  2CK3 H;  4GT1 A;  1NTK G;  1PPJ G;  3AEA C;  3B8E B;  5EFW B;  2WSS H;  4YPC A;  2PAJ A;  2KSE A;  1MKM A;  3L35 A;  1NTM D;  3W67 A;  3IAO A;  4PD4 E;  2QJK B;  3TGU E;  2Y9Z A;  3GLM A;  1LWU C;  2D2C C;  3G3Z A;  3CL3 D;  1L2P A;  2NZ2 A;  1QEX A;  1M1K Q;  1L0L D;  1NAF A;  1ZR4 A;  1J1E C;  1EDI A;  4GOD A;  1LTJ C;  4RJT A;  2QVA A;  2OYI B;  4A7P A;  4YXD C;  3MUD A;  1VQO P;  2QE7 H;  2IZ1 A;  2O1K A;  2KIK A;  3CCU P;  1KN7 A;  1LT9 A;  2K9J B;  4D6T J;  1L0N K;  4YXW H;  3KHU A;  1QGK B;  3CC2 P;  2KUB A;  2OQQ A;  2PRR A;  1RF0 A;  1Q2N A;  1SQB J;  1RE4 C;  1NTZ K;  1E5W A;  2N9Y B;  1SQQ G;  1WT6 A;  2O01 H;  3HD7 A;  3P8C E;  4I2L C;  3T97 A;  5KKZ B;  1W2B O;  1R5L A;  2JDI H;  1ZRT E;  1PZQ A;  2WVR A;  2YIU C;  4H0L B;  3TNU A;  5APW A;  3EWK A;  3M91 A;  5AVQ B;  1NU1 D;  4LLH A;  1KFN A;  2HOD A;  3GG2 A;  1LT9 C;  1SQV D;  2GA1 A;  1KQL A;  1VL2 A;  1LGH B;  2IFN A;  4I7Z C;  5CBO A;  5CCH C;  1JMB A;  3U1C A;  3F5H A;  1MFT A;  3CX5 E;  4U3F G;  2C9L Y;  1EC5 A;  1EZV G;  2CPS A;  2FY8 A;  2M0B A;  3CCQ P;  2AXC A;  3CCS P;  2FKW B;  3S9O A;  1LP1 A;  3WU2 E;  1KYO D;  2NPS B;  1S72 P;  1LTI C;  3MZW B;  1VF5 B;  2QSI A;  2QJP C;  4GIF A;  5CJ4 A;  2M3E A;  2B88 A;  3H1J E;  3M06 A;  4PV1 D;  3PJS K;  2RH0 A;  2XU6 A;  2R5D A;  1N73 B;  2D2C D;  2Q7C A;  1ZOY C;  5AVR B;  1ZR2 A;  1JB0 J;  1USE A;  2E74 C;  2NPS D;  1NHL A;  1Y9B A;  1BE3 E;  2BCC D;  2Q5U A;  2O3J A;  3HRN A;  1MUU A;  3QH9 A;  3V4Q A;  3USS A;  1KC8 Q;  5CBN A;  1X9V A;  1S4X A;  1FDO A;  1BGY D;  1JTH B;  3U1A A;  1QL2 A;  1HF9 A;  1H89 A;  1KQF B;  1SFC C;  3P8C D;  3D6Y A;  3ABV C;  2JWD A;  3L75 G;  4KJM A;  2E42 A;  3RL0 B;  3GMA A;  2PGD A;  1H0T B;  4IFD K;  3N4X A;  1JY3 O;  4PJ0 H;  3MHV A;  1N7S B;  2WT7 B;  2ZFC A;  1WRG A;  3CX5 D;  3V4W A;  1N2D C;  3AE5 C;  3K5B A;  4WWI A;  4DT0 A;  3HTK A;  5GTH E;  1VQK P;  1KV4 A;  5KLV E;  3R4Y A;  1ZW0 A;  3RK3 B;  2R3C A;  1HGV A;  4H13 C;  2PFX A;  2M5A B;  3WMM 0;  5KAF H;  1FZC C;  1RHZ B;  4HH2 A;  2A45 I;  2KSJ A;  5AW5 B;  5KLV G;  1SP4 A;  3A3Y B;  2FFD C;  2ZXE B;  1UIX A;  2KS1 B;  1BCC J;  3HD7 C;  2KZJ A;  3SFE C;  2W6A A;  4H44 D;  3QWO C;  3SSU A;  2UWJ E;  3F89 A;  5KAI E;  1NTZ J;  2QJK C;  1T2K D;  1N8R Q;  3CXH H;  2YIU B;  2A06 E;  1BGY J;  1EZV D;  4IOI H;  2ITA A;  1OFC X;  5KAF E;  1BCC E;  1JCD A;  1GK6 A;  1D7M A;  1J2J B;  5AVX B;  1L4A B;  1SFC A;  2JJL A;  2FYU K;  1FOS E;  3AE8 C;  3AE1 C;  3CPW O;  4WY4 B;  1J1D B;  3CWB D;  4B86 A;  2WT7 A;  3L74 G;  3OA7 A;  2N1T D;  4O9B A;  4ZKP A;  2P10 A;  2OTL P;  2FYZ A;  2P58 A;  2JWA A;  4RES B;  4OGQ C;  4DJG A;  1HBW A;  1KMI Z;  2AEM A;  2AXT H;  1RE3 A;  1YJ9 P;  2YKP A;  3RBX A;  2E75 B;  1IFM A;  2RKL A;  2R44 A;  1NU1 G;  2GUS A;  1M57 D;  2QJY C;  5CMZ A;  5APY A;  5AVT B;  3L72 J;  1KYO H;  4JF7 A;  1K9M Q;  3IFM A;  4UB6 E;  3A0B E;  3AE7 C;  1PL5 A;  1OW8 A;  1LTB C;  2DW3 A;  3I5C A;  2FYN B;  4BRY A;  4U3F D;  1L0L K;  1TU3 F;  3H1I D;  4Y99 B;  1NTZ E;  1ZXG A;  3V5B A;  3C1L A;  2IBZ E;  1T3J A;  3H1L G;  3TSI A;  3KZI E;  1L0N E;  1ZP0 C;  2H88 C;  2YO3 A;  3L73 D;  2RMZ A;  4U3F J;  1T2K C;  3A0H E;  1W2E A;  5KLV D;  5DJT B;  3H1J J;  1A02 F;  1S3J A;  2B87 B;  2E76 C;  1K04 A;  1NU1 J;  1MZ9 A;  3PP5 A;  1YTZ I;  3BAS A;  1FZC A;  2V7Q J;  1GW4 A;  3L4F A;  4IFF A;  2K3R A;  1KQS O;  1FDM A;  2ZYD A;  1PGQ A;  4OGQ D;  5KLI B;  1SQX K;  2KXP B;  1JMM A;  1RE3 C;  3GHG B;  1KFM A;  1KZU B;  2A45 G;  2O1J A;  1SQB D;  4RO0 A;  1OVR A;  3B71 A;  3M0A A;  5M1B A;  3RK2 B;  3VTP C;  2Q9I A;  2KOG A;  1FBM A;  5APV A;  1YJN P;  1IO4 A;  2J58 A;  4K35 A;  4PV1 B;  1LTG C;  2E43 A;  3TYY A;  3CC7 P;  1JY2 P;  1VQ5 P;  1CI6 A;  3ITK A;  4JYB A;  3EFF K;  4QMA A;  5APT A;  3AEC C;  3CLQ A;  1M1J B;  2ZVO B;  4DOJ A;  4Y99 C;  3H6P A;  1NKN A;  3PHL A;  4Z1M H;  3RK3 C;  1X0T A;  4WB4 A;  3A5T A;  1DEE G;  3H1J D;  3L74 J;  2E5T A;  2Y0D A;  4H13 D;  2P7J A;  4EYY Q;  3A0B H;  1YI2 P;  4TT3 H;  3L73 J;  2HPC B;  1J1D C;  3A7O A;  3AE4 C;  1HGZ A;  4L73 A;  4C7N B;  1GW3 A;  4LC1 A;  5BU5 A;  1AVY A;  4ZNC A;  1YHQ P;  3MP7 B;  5AVW B;  3LW5 J;  1GL2 C;  3HD7 D;  3MIW A;  3D6Z A;  3AE3 C;  2WSC J;  1RQU A;  2QM7 A;  4N78 E;  3H32 B;  3VMZ A;  3Q5P A;  2K9J A;  3O8Z A;  1VF5 D;  2G8Y A;  3VP8 A;  4IFM A;  1EXJ A;  2L91 A;  2C0X A;  3HD7 B;  3M0D A;  2WPQ A;  3VYI A;  4D6T D;  4RKU J;  4I6M C;  1DIP A;  1SQB K;  1N86 A;  3II6 A;  1NTZ G;  5AW8 B;  2QEX P;  2FYU J;  1YQ4 C;  2KP8 A;  3TF5 A;  2W27 A;  2WSE H;  3L74 D;  4XA4 A;  3RK3 E;  2NPS A;  3VMA A;  2O01 N;  4ZKU A;  1LJ2 A;  3CWB J;  3G71 P;  5APQ A;  3AEB C;  1JO5 A;  1AVO A;  1LTS C;  1AQ5 A;  5B66 H;  2K9Y A;  1U7J A;  5KTB A;  4OWF A;  1T6A A;  2WSC H;  3H1H E;  3O6Q B;  4OH8 B;  3LW5 H;  4CPG A;  2BCC J;  1G1I A;  5AVV B;  4OVN F;  3RK2 D;  1SQQ J;  3PRJ A;  4NPF X;  1VQ9 P;  5CCG D;  2E74 D;  2NPS C;  4KHX A;  3HUS B;  4UB8 H;  1FZF A;  2K37 A;  2OYH C;  3I56 P;  1G2C B;  1OVU A;  4N3Y B;  1JY3 P;  2OAR A;  3BCC J;  2YNY A;  2W83 C;  2WSF H;  1OZH A;  3W68 A;  4EDF A;  1N73 C;  2IBZ D;  3IN6 A;  3S1K A;  1GZL A;  4PJ0 E;  2H43 A;  1NTZ D;  2GM4 A;  1OWA A;  1N7L A;  2QG4 A;  1VQN P;  3H1I E;  1GU5 A;  2W6J H;  1SQX J;  1GTW A;  2XDJ A;  4YTP C;  1VF5 C;  1IK9 A;  2IYO A;  1PV3 A;  1S2E A;  2BCC G;  1VQP P;  1YIJ P;  1SQV K;  2WSF J;  3CC4 P;  1JCC A;  2LXC B;  2Q3I A;  1NU1 K;  2W6B A;  2Y0E A;  2YKO A;  3AE9 C;  2IZ0 A;  5KLI C;  3P8M C;  1H0T A;  3BCC G;  1Q7Y Q;  3CCM P;  1J1E B;  1RQV A;  1ZLL A;  1ZV8 A;  2IDB A;  1GL2 A;  3H1K J;  2Q6Q A;  3L72 D;  3M9H A;  3TGU G;  5B5E E;  2M8R A;  3OW2 O;  2Q3E A;  1IFN A;  1S5L X;  3D71 A;  1L0L J;  2RN0 A;  1IFI A;  1HUC A;  2C9N Y;  3FXE A;  1M56 D;  5AVZ B;  1NYH A;  3KPE A;  5E79 E;  5AW0 B;  1S5L E;  2MKV A;  5L8R J;  3L70 G;  1N73 A;  3H1K D;  3HE4 A;  3TK1 A;  4BWN A;  1FZE A;  5AW9 B;  5C39 A;  2N1T B;  3Q5R A;  3G9R A;  1L0N J;  1DX7 A;  2KI7 B;  4IL6 H;  5TJH A;  3JCU H;  2P1J A;  3L74 E;  3OAK A;  3KQG A;  2FXP A;  2Y0C A;  4U7J A;  3RK3 D;  3TGU J;  4DCK A;  3H32 A;  1BDD A;  2E75 C;  3H1H J;  1SQP D;  4WY4 A;  1A02 J;  1LWU B;  3B5N A;  1YIT P;  1IC2 A;  1YJW P;  1IZN B;  4GKG A;  3TNU B;  2A06 G;  1BGY G;  3CD6 P;  3CWB E;  1X79 B;  1JEK A;  3L70 J;  4HKZ H;  1Z56 A;  2GUV A;  4N78 D;  1URQ B;  2HOD B;  1Y47 A;  2FBW C;  4D6T G;  2LKM A;  2OYO A;  2A45 H;  2P2U A;  2IPP A;  1Q86 Q;  1FZG A;  1GDT A;  5AW1 B;  2E74 B;  2WPR A;  4WY4 C;  1EZV E;  3LID A;  3H1I J;  3S4R A;  1MFZ A;  5AW6 B;  1NWQ A;  4AUW A;  1BSH A;  1KTM A;  2D2C B;  2I1K A;  1M90 Q;  2QRX A;  1VPC A;  2L5G B;  2WPV B;  3B5N D;  2B89 A;  2FXM A;  3KXD A;  3BCC E;  3R2P A;  4JBZ A;  1NOH A;  3G4S P;  2JO1 A;  2K88 A;  1S9K D;  1XTG B;  3VMX A;  3D70 A;  1GK4 A;  4PD4 I;  3ZDM A;  3FXD A;  4TLF A;  3WUV A;  1CW5 A;  1FJP A;  2YKQ A;  1JNM A;  4C46 A;  2OYI C;  1PGP A;  2BCC E;  2I8D A;  2N9B A;  5H2F H;  2ZJS E;  1AJY A;  1SQQ E;  2FFD B;  3M0D C;  4GOF A;  1X8Y A;  5KAI H;  2WZ7 A;  3H1I G;  2B87 A;  4KT0 J;  1PGJ A;  3U59 A;  3RBZ A;  3VN0 A;  5BU8 B;  1H8A A;  1KD1 Q;  1JTH A;  1BSN A;  1CSB A;  1LNQ A;  2R3S A;  4H0L C;  1VQM P;  4HJG H;  3N7N A;  3EFG A;  2LXB A;  2YMY A;  5AVU B;  3G6E P;  2KZI A;  2ZT9 D;  1LTJ B;  2OYI A;  1QL1 A;  2WWW A;  1PP9 G;  5AW2 B;  1EDJ A;  3AE6 C;  4L75 A;  3HE5 A;  1HJ0 A;  3L70 E;  3H1J G;  3BVH A;  1NTK D;  1PPJ D;  1SQV E;  1SQX D;  3CXH D;  2YXR B;  3RK2 C;  3H1L J;  5AVY B;  2KYV A;  3KZI H;  3JSV C;  1GL2 B;  1BE3 D;  4ZMD A;  1FOS F;  2J59 M;  2IYP A;  1NTK E;  1PPJ E;  3SWK A;  3TDK A;  2ZYA A;  1ZRT D;  1HVV A;  1M1J A;  3BCC D;  2AXT E;  1S9K E;  3IF4 A;  2OYH A;  4UB8 E;  1JY2 O;  3M9Q A;  1IK7 A;  2PP6 A;  3FX0 A;  1T3U A;  1R5S A;  5KJ7 C;  1KB9 H;  1KYO E;  1FU1 A;  2KLU A;  1PP9 J;  2SPZ A;  3BRT B;  2JP3 A;  4GOE A;  4H44 C;  3AED C;  3L71 J;  2KNC A;  2JEE A;  3L36 A;  3T97 B;  2E5Y A;  1GU4 A;  1NJI Q;  1DD4 A;  3CX5 I;  2ZVN B;  3V2P A;  1RF1 A;  3GF3 A;  1SQQ D;  2BEQ D;  2N1T C;  2IBZ I;  1YYC A;  5GTI H;  1AFO A;  1L0N D;  3Q1M A;  3M9B A;  2OGU A;  2W8Z A;  4L76 A;  3P32 A;  1K05 A;  5CHX A;  5CJ0 A;  1LT1 A;  3AEG C;  3V2R A;  1NTM E;  1LT9 B;  1URQ D;  1ZN5 A;  1X22 A;  1SLQ A;  2XND H;  5H2F E;  2HFE D;  2R32 A;  3L71 G;  2ZT9 C;  1NTK K;  2HG5 D;  4WVZ A;  1H88 A;  4JQ0 D;  1BCC D;  3Q3D A;  3B4S A;  2IFM A;  2XNX A;  1M1J C;  1NTM J;  2OYH B;  1SQB G;  2A06 D;  1NVO A;  2AEF A;  1PIX A;  1WMK A;  2O01 J;  2Q1K A;  3CCR P;  1JUN A;  5B5E H;  2AEJ A;  1QVF O;  3Q2Y A;  4HYT B;  2HR3 A;  2YMK A;  5AW7 B;  1VQ4 P;  1PP9 D;  1P84 D;  5K5G B;  1KYO I;  2ZAE B;  4K3A A;  5AW4 B;  1M8O B;  2KLV A;  3KYQ A;  3LIE A;  1RF1 B;  1NH4 A;  3MGN A;  1G1J A;  2HYN A;  3L71 E;  1PP9 E;  2BAS A;  3OJA B;  2H7H A;  1AA0 A;  3L72 E;  4XE5 B;  1KB9 I;  1NO4 A;  1NTM G;  4H44 B;  4UB6 H;  1GMJ A;  1PGO A;  4IL6 E;  3B5N C;  1SFC B;  4R4L A;  1NTK J;  2HPC A;  2QA4 P;  1QX8 A;  3SWY A;  5E79 H;  1Q82 Q;  3AEE C;  3AEF C;  1JM0 A;  4JYC A;  1YTZ T;  3V2N A;  1P84 I;  4WY4 D;  2IBZ G;  1OMI A;  2QIW A;  3H1L E;  3JCU E;  2Z5H A;  1L4A D;  1OIP A;  3FGA D;  3CCJ P;  3HE5 B;  1VQ6 P;  2XKM A;  2FYU E;  1EQ7 A;  1KIL B;  2FXO A;  1SQX E;  3CXH E;  1N7S A;  3VOP A;  1ZME C;  2QJY B;  1MV8 A;  3O6Q A;  1S5L H;  3CME P;  5BVZ A;  1CI6 B;  1YBK A;  1FJK A;  1JOC A;  2Z4E A;  1RF1 C;  1FAV A;  2YO2 A;  4W80 A;  3WUT A;  2P67 A;  3L75 J;  3I55 P;  1M7L A;  3EQ2 A;  3WUU A;  1CZQ A;  1OW6 A;  1BE3 J;  1GL2 D;  3WU2 H;  4AQR D;  1SQV G;  1HTL C;  4W7Z A;  1FC2 C;  4IL6 X;  1SQP G;  2JKV A;  5GTH H;  4C7N A;  1BGY E;  1G2C A;  3CX5 H;  4JPZ B;  4PV1 C;  2WPS A;  4Y28 J;  1LP1 B;  2KS1 A;  2YXQ B;  4M3L A;  1KB9 E;  1N7S D;  2ZT9 B;  4NPE A;  1FS0 E;  1L0L G;  2XZR A;  3RL0 D;  2MJZ A;  3CXH I;  5KJ7 D;  3Q5S A;  3CCL P;  3GW6 A;  1FDI A;  3CMA P;  1HWT C;  3C8V A;  3L70 D;  3H1K G;  3L73 G;  2W90 A;  1K8A Q;  3CCE P;  1VQ8 P;  1SQQ K;  3CCV P;  1KIL A;  1SVF A;  2E76 D;  3VP9 A;  3V6I A;  3PH0 A;  1L0N G;  2JR8 A;  3H1H D;  2V7Q H;  1PFI A;  2FYN C;  1RY3 A;  2H8P D;  2VRS A;  3GF7 A;  5B66 E;  4XFJ A;  3E1R A;  3NMD A;  1OVV A;  1S1C X;  1L4A C;  3MTU E;  4BRY B;  5APS A;  1GD2 E;  2M5A A;  3UIA A;  2C0W A;  2Y9Y A;  5KJ7 A;  1EXI A;  3JC2 2;  1KIL C;  1E79 H;  2R5B A;  1NU1 E;  5CCH A;  1AV1 A;  5DJU B;  1K73 Q;  3GHG C;  3SFD C;  4AYC A;  2WSE J;  4PD4 D;  3NXS A;  4EIJ A;  3V2Q A;  2FYU G;  3HTK B;  4OGQ B;  4D6T E;  4ASW A;  2I1J A;  3C9I A;  5CCG C;  3E7K A;  5AVS B;  3RL0 g;  2N1T A;  3HUS A;  2E76 B;  4L74 A;  1U57 A;  3CWB G;  5GTI E;  1AQT A;  4H13 B;  4HB1 A;  1NTM K;  3BAT A;  1HH0 A;  1URQ C;  1NKZ B;  1NAY A;  2LR2 A;  3FWL A;  3P7K A;  3H1K E;  1EDL A;  2G3A A;  1SQP K;  2B9B A;  4H0L D;  1DEB A;  1JY3 N;  1R8E A;  5CCH D;  3RL0 C;  4EOT A;  5KLV K;  1L0L E;  1LWU A;  3B5N B;  5CCG A;  3CI9 A;  4N6J A;  1U7M A;  2Z5I A;  1BE3 G;  1USD A;  1BCC G;  1BDC A;  3L72 G;  1VQ7 P;  1IFJ A;  3TGU D;  1L4A A;  4NPD A;  2M3B A;  3BRV B;  3FWN A;  3VMY A;  1SQP E;  1URQ A;  2OTJ P;  4R4M A;  1FZC B;  1RH5 B;  2BEZ F;  4W7Y A;  2WQY C;  2QM8 A;  1DH3 A;  3L75 D;  2CPB A;  1SFC D;  2IX7 C;  2POH A;  3GHG A;  2H89 C;  1OW7 A;  5AW3 B;  1KB9 D;  1RE4 A;  3L37 A;  4DZO A;  5APX A;  5KKZ C;  1FZA A;  3PLN A;  5TIS H;  1QLE D;  4PD4 H;  1T8Z A;  4U3F E;  1SQB E;  1VDF A;  3NTN A;  1KIL D;  1SS1 A;  1LTT C; 
#chains in the Genus database with same CATH homology
 1SQX G;  3H1K G;  3L73 G;  3H1L G;  1KB9 H;  3L75 G;  4U3F G;  1L0N G;  3BCC G;  3H1I G;  3L74 G;  1EZV G;  3H1H G;  2A06 G;  1BGY G;  3TGU G;  1BE3 G;  1BCC G;  3L72 G;  4D6T G;  1PP9 G;  1SQV G;  1NTK G;  5KLV G;  1NTM G;  3H1J G;  1SQP G;  3CX5 H;  1NU1 G;  3L70 G;  1SQQ G;  2FYU G;  1KYO H;  2IBZ G;  1P84 H;  3L71 G;  3CXH H;  4PD4 H;  1NTZ G;  1L0L G;  3CWB G;  1PPJ G;  2BCC G;  1SQB G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...