1PP9G

Bovine cytochrome bc1 complex with stigmatellin bound
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
73
structure length
73
Chain Sequence
RQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 18
structure length 73
sequence length 73
chains with identical sequence T
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1pp9G00
3L74G 3CXHH 3L70G 3L72G 3CX5H 1SQQG 1KYOH 1NU1G 1L0NG 5KLVG 3TGUG 3L75G 1PPJG 3H1IG 1BCCG 2BCCG 1SQPG 4PD4H 3L71G 1NTKG 3H1JG 1NTZG 1SQVG 2FYUG 1BGYG 1L0LG 1PP9G 1KB9H 3BCCG 1BE3G 1SQBG 2A06G 1EZVG 3H1KG 1SQXG 3H1LG 3H1HG 3CWBG 1NTMG 1P84H 4D6TG 3L73G 4U3FG 2IBZG
chains in the Genus database with same CATH superfamily
5APXA 4C7NA 3E7KA 3PTZA 5B5EH 3H1IG 1GL2B 1LTSC 4N78D 5APSA 3AE4C 2XZRA 2K1AA 3TK1A 4C46A 1SQPD 5GTHH 1CI6B 4OWFA 2R32A 1NU1G 3FWLA 5KLVG 2XKMA 1HJ0A 1DH3A 2Y9YA 1URQD 1SFCC 2FYNC 4H0LD 1VQ6P 1BGYG 1K9MQ 3CC4P 2V7QH 2GUVA 5TISH 3L71E 2Q6QA 3HTKB 1AFOA 2QSIA 3H1KD 3VMYA 1IK7A 1KYOI 1L0LJ 2R5DA 1KYOD 5H2FH 4RJTA 2W6AA 2WMMA 1YJWP 2E43A 1TU3F 1D7MA 2B88A 2QJPC 5AW5B 3AEBC 2ZAEB 1NTKG 1S2EA 3A7OA 1JMBA 2QJPB 1RF1A 1J1EB 1L0NK 2C9LY 2N1TD 1OWAA 1DX7A 3H1IJ 1H88A 2FXPA 1YQ4C 5DJUB 1HGZA 1VQ5P 2AXTE 3JC22 3RL0D 2QEXP 4U3FD 2R44A 1L0NE 3H1KG 2KSEA 4EI2A 1N2DC 4KHXA 4Y99C 1NU1J 5KLVJ 1N7SD 1FZFA 3VMAA 2QIWA 1NTME 2ZYAA 4UB8H 2KS1B 4Y99B 1BGYJ 2L91A 3EWKA 4H13C 2YIUC 4NPEA 3AEEC 4XA4A 3CL3D 2W8ZA 2B89A 3LW5J 1EDKA 3NFQA 4H13B 2FYUD 2YIUB 5CCGD 3VYIA 3Q2YA 2HPCB 2R3CA 1K05A 2KYVA 4HH2A 2E5YA 3EFGA 3PLNA 2LR2A 5APVA 2GM4A 4N6JA 2KSJA 1GU4A 1VF5D 4ASVA 3WMM0 1NTZK 3M9QA 1JCDA 1NTKJ 2ZFCA 1NYHA 3JSVC 2KIKA 3QH9A 1QX8A 1NKZB 1SQQG 5APQA 1LP1A 2PAJA 1QEXA 1EZVD 2H7HA 3B5ND 3KPEA 5AW6B 1IC2A 2C0WA 3L74D 1BDCA 2YXRB 5B66E 2OGUA 1H0TA 1FAVA 3AEAC 2B87A 3H1HD 3D70A 2NZ2A 3CXHD 3L70D 1VQ4P 2Q3IA 1OVRA 1UIIA 1KILA 3RBZA 1RE3A 1GK4A 1M7LA 3CCMP 3M0DA 3VP9A 1LT9A 1IFDA 3LW5H 1FE6A 3MZWB 1NH4A 4OGQC 4PD4H 4HB1A 2HG5D 1S9KE 3VOPA 1PP9G 1KB9H 1YHQP 5BU5A 4OGQB 1KQSO 1LTJC 3Q5SA 1SLQA 3L75G 4HYTB 5C39A 5E79H 3W67A 2ZJSE 1Y8AA 3L72D 1EQ7A 2IPPA 4UB6E 5APUA 4DCKA 3L73G 1SQQJ 3L70G 1ZRTD 5KAFE 2PP6A 3VMZA 1FOSF 4PJ0E 1YJNP 1OX3A 1M56D 1LP1B 1PPJD 3I56P 3G4SP 3GW6A 4A7PA 1JTHB 2ZT9D 3CX5H 2FXOA 2AEJA 1T3UA 2YO2A 2WPRA 1EXIA 1URQA 4LLHA 2P67A 3RK3D 1SQXK 1YI2P 3TGUE 3WU2H 2D2CC 4GOEA 3GF3A 2WWWA 2E5TA 3H1JD 4M3LA 2IZ0A 1RE3C 1JY2O 1M90Q 2D2CB 3M0AA 1SQXE 3RBXA 2A45H 2WTYA 2Q3EA 2QJYC 2QM7A 1PP9J 3BRTB 2A06G 1RQVA 2QJYB 1G2CB 4IL6E 3WUUA 5KAIH 4C7RA 3L75J 2CK3H 2OTLP 1GW3A 2WITA 1PPJG 2Z5IA 3AE9C 4RO0A 3T97A 3AEGC 2QG4A 2HODA 2UWJE 4H44C 3L73J 1HBWA 1LTTC 3L70J 4GDOA 2N1TA 2Z5HA 2E76B 2XV5A 4NPFX 1BE3E 1NKNA 3L71G 3H1JG 3N7NA 1LNQA 5CMZA 3G6EP 1MFZA 2H89C 2OARA 3CPWO 4I6MC 2P1JA 5AVXB 1W2BO 1FJPA 1GW4A 1KTMA 5CCHD 1L0LD 3P8CD 1T6AA 4XE5B 1KV4A 5AW3B 3USSA 1T2KD 3O6QB 2IFMA 1AV1A 1WRGA 2HYNA 3V2PA 5AW8B 3CC2P 1U57A 1GU5A 2WSCH 4L73A 1PZQA 3A0BH 2J58A 1OZHA 3H1LD 1SQBK 1NWQA 3L74E 5AVZB 2E75C 2CPBA 1IFPA 3FX0A 2KK7A 1OVUA 1A02J 2ZXEB 3H1ID 2E75B 1GZLA 2IFNA 1SQVE 2G3AA 3A0HH 1L0NG 1T3JA 2WT7A 1FDMA 3PJSK 4I7ZC 2FXMA 2XNXA 3CXHE 1KC8Q 4XFJA 3O8ZA 2DW3A 1QVFO 1NU1D 3KZIH 5KLVD 4IOIH 3CMEP 1KFNA 1NTZD 4WY4C 3T97B 1S1CX 3HUSC 1FS0E 3L71J 1BDDA 3G71P 4MN4C 1W2EA 4WY4B 1FU1A 3B5NA 2K9YA 1DIPA 4L74A 3L4FA 3H1LG 4R4LA 4PD4D 1BCCE 1QVGO 1KB9I 1KB9D 3BCCE 4JBZA 4GKGA 2E42A 1LJ2A 1H89A 3EFFK 4H44D 2O3JA 3L72E 1JY3O 4EOTA 2IZ1A 1JB0J 1N7LA 4RESB 2K9JA 1NTKD 4BRYA 3B8EB 4K35A 3A2AA 3TNUB 4CPGA 2ZVNB 5AW9B 1VQ7P 1VQOP 1NTZG 1L4AD 3V4QA 1K8AQ 1KQFB 2KOGA 1VQ9P 3D6ZA 2Y0DA 2Q7CA 2NRGA 3U59A 5GTIE 1L0NJ 2M5AA 4IFDK 2LXCB 3CX5I 3M9BA 3CX5D 1VF5B 2PRRA 1S5LE 2O1JA 1JMMA 1RF0A 3H32A 5KJ7D 4U7JA 1BSHA 5CJ4A 3MUDA 1SVFA 3GHGA 3A3YB 3M91A 5AVUB 1J1EC 1HJBA 1S3JA 3H1LJ 1VPCA 2A45I 2JKVA 2GA1A 1NHLA 5K5GB 3HD7C 2W27A 2QE7H 1HF9A 1P84E 1AVYA 5L8RJ 2P2UA 3KYQA 1N73A 2NPSD 3HD7B 1NTMK 1QLED 4C7NB 4UB8E 4WB4A 2OTKE 2P7JA 2WSFJ 3HE5A 3IN6A 2Q1KA 1NTZJ 3L37A 3CWBE 4OVNF 3JCUE 1M1JA 2WVRA 1PL5A 1RQUA 2FFDA 3V2RA 1SQQD 1GL2D 4W7ZA 4YPCA 1GK6A 3KQGA 3TYYA 2I1KA 5AVRB 2AXTH 1L0LE 1NOHA 2A45G 1GDTA 4JQ0D 4R4MA 2IBZE 3SWYA 2OYIA 1USEA 3P32A 2M5AB 1VQPP 1LGHB 2M0BA 1Y47A 3Q3DA 1YIJP 1YQ3C 2JO1A 1SFCD 3AE8C 1KQGB 3R2PA 3SWFA 3AECC 3H32B 3TF5A 3LIDA 3TSIA 2O1KA 1SQXG 1RF1C 1KILE 3B71A 3V4WA 1JM0A 3BVHA 3B4SA 4PV1C 1RE4A 5CCHA 2YMYA 1PP9D 1XTCC 1RF1B 2HR3A 4PV1B 1NJIQ 2VRSA 2XU6A 2WSEJ 1NU1E 3L75D 5APYA 1BGYE 2JWDA 1ZR2A 1RY3A 2WSFH 1FC2C 3VTPC 2HLOA 1FZCA 2V4HA 4W80A 2I1JA 3HE5B 3L73D 2HFED 3GLMA 2OYHA 1BE3G 2QJKB 3ITKA 4PD4E 4D6TG 1LWUA 3PRJA 1SQPK 1SQBD 1LTBC 4N78E 5B66H 1JOCA 1G1JA 2OYOA 5AVVB 3AEDC 2BCCD 1SQPE 2OYIB 1U7JA 1A02F 4B86A 4ZKUA 1AVOA 3P8MC 2W6BA 1ZR4A 4H13D 2Y9ZA 2MKVA 1SQXJ 4IFMA 2Q5UA 4IL6X 2KXPB 5KTBA 2KZJA 2PGDA 5CBOA 1FBMA 3MD0A 3H1KE 2A06D 4DJGA 1KYOE 3IAOA 3CCEP 4DZOA 3KHUA 1SQBG 3S1KA 1EC5A 3RGUA 3CCRP 2WSEH 5AW2B 4ZKPA 3CCQP 2BCCG 1H0TB 4HJGH 1L4AA 4UB6H 1IFJA 1BE3J 1JCCA 5M1BA 2B87B 3GMAA 4YTPC 5KAFH 4D6TJ 2WSCJ 3FWNA 1R5LA 2O01J 4PJ0H 3BASA 3L71D 1KILC 1YTZT 3I5CA 4L76A 3M0DC 1LT9C 3WUVA 1BCCG 3RK2C 1KILB 2L5GB 4U3FE 2LKMA 1LT9B 4ZMDA 3RK2B 3CC7P 2YKQA 4AUWA 5KJ7A 2KNCA 2E74C 1ZLLA 1PGPA 3GF7A 3V6IA 5APTA 2LXBA 2FYUK 4WVZA 2E74B 3D6YA 1MZ9A 2QRXA 2QA4P 2E76C 4Z1MH 1IO4A 3ABVC 3MHVA 1NO4A 3C1LA 2FYUE 4OGQD 1U7MA 2FBWC 1WMKA 3CCLP 5AW4B 1SQVJ 1IFMA 1IFNA 3FXDA 1SQBJ 2NPSA 1GD2E 1L0ND 3KDPB 1J2JB 2KP8A 1DEEG 1N7SA 2BCCJ 2IYOA 3R4YA 1K04A 1NTMD 1AQTA 3A0BE 1X0TA 1URQC 2YNYA 1PIXA 2JDIH 1EDIA 1GL2A 4H0LC 3SWKA 5AW1B 1OVVA 1URQB 3VN0A 3E1IA 4H0LB 1X22A 2B9BA 2O01H 1BCCJ 2RKLA 5CCGA 1EZVE 1SQVK 1VQNP 4IFFA 1KN7A 1AJYA 2R5BA 4BWNA 1KQLA 2WPSA 3KXDA 1Q82Q 1PFIA 2JEEA 1PGJA 1LTIC 3PHLA 1SFCA 3G3ZA 3H1HE 3L73E 4LGDE 2J5UA 3UIAA 3L70E 1OW6A 2D2CD 3PH0A 3U1CA 3CWBG 1NTMG 3CD6P 4JF7A 1FZEA 5APWA 4OH8B 2N1TC 3CCUP 1RHZB 2HODB 1AA0A 1X79B 1OFCX 4EYYQ 5AVWB 1FDOA 2N1TB 4ZNCA 1S5LX 5B5EE 3E1RA 3RL0C 4EIJA 3BRVB 4I2LC 3CXHH 3C8VA 3RL0B 1OW7A 2ZYGA 2OTJP 1N7SC 5GTHE 2E76D 1KFMA 1N7SB 2MJZA 4W7YA 2JJLA 3AE7C 1Q86Q 2KLUA 1ZRTE 2A06E 5TISE 1M57D 3HE4A 3OAKA 5CCGC 3H25A 1N8RQ 1OXZA 1IZNB 1S9KD 2KS1A 1PPJE 2YKOA 3V2QA 1HGVA 3CMAP 3IR9A 3SFDC 5H2FE 5BU8B 3Q5RA 1OIPA 1VF5C 1EDLA 2WPQA 3L35A 3RK3E 1Q2NA 1Q81Q 1NVOA 4LC1A 1FOSE 2J59M 3VMXA 2HPCA 3BATA 1NTMJ 3CWBJ 1SFCB 3SFEC 2FYNB 2WT7B 2Z4EA 4GIFA 2P58A 3H1JE 2ITAA 4WWIA 2E75D 1CSBA 1KZUB 2M8RA 2R3SA 5GTIH 3B5NC 3HRNA 3B5NB 4TLFA 4AQRD 5TJHA 5KKZC 3H6PA 4EDFA 3QWOC 1FZBA 5DJTB 1SQPG 1S5LH 5KKZB 1LTGC 3FXEA 3TGUD 2WQYC 4WY4D 2AEMA 1JY2P 3CLQA 1NAFA 2QM8A 1JO5A 1YJ9P 3I55P 3CCSP 1ZOYC 3OW2O 1OMIA 1GMJA 1SQXD 1L0LK 2BASA 1YYCA 3U1AA 2K9JB 2N9BA 2YMKA 4BRYB 1BSNA 1SS1A 1P84H 1Z56A 3HE4B 2M3EA 2XDJA 2PFXA 4YXDC 3P8CE 4RKUJ 4ASWA 5EFWB 3M06A 1ZW0A 2WSSH 2C9NY 3S4RA 1X9VA 2RN0A 1UIXA 3JCUH 1RF0C 3NXSA 3TGUG 1BE3D 3H1LE 2GUSA 3MUDC 3GHGC 4D6TD 3Q1MA 2RH0A 2M3BA 5CJ0A 1PGOA 3GHGB 3H1IE 1LTJA 1FDIA 1NU1K 1USDA 2ZVOB 1AQ5A 4U3FG 5KLVK 1VQKP 1ZMEC 1Q90D 2FYZA 1SQPJ 3AE6C 2ZT9C 2O01N 3NTNA 3WUTA 1LTAC 2ZT9B 2P10A 3IF4A 3RK3C 5KLVE 1N73C 4DOJA 5CHXA 1NTZE 1KD1Q 1YTZI 3A5TA 1R8EA 1EZVI 1MUUA 1JNMA 3RK3B 1N73B 1ZV8A 4YXWH 1H8AA 2QJKC 1JTHA 3LIEA 2KB7P 2FKWB 2FYUG 3H1KJ 1HVVA 4L75A 1E79H 1M1JC 1FJKA 2FFDC 1FZGA 3HD7D 3AE5C 1KB9E 1QGKB 1SQVD 1MV8A 4DT0A 1M1JB 4BXLA 3D71A 4TT3H 2FFDB 1NTKK 1JY2N 2CPSA 3CXHI 1HUCA 1S4XA 3EQ2A 2KUBA 3Q5PA 3P7KA 4N3YB 1VL2A 2OYIC 2H8PD 5E79E 2KZIA 1NTKE 4Y28J 3TGUJ 1NGMB 1RH5B 1EXJA 4JPZB 1G2CA 4O9BA 1YITP 2JR8A 4GOFA 2YKPA 1KORA 1JUNA 2ZXXA 1EZVG 3II6A 4U3FJ 3NMDA 1BCCD 1MFTA 3L74G 1VQLP 2IYPA 3BCCD 2ZYDA 1RE4C 5CCHC 1VQ8P 1LTJB 1JY3P 1IJDB 3CX5E 1SQVG 1EDJA 1T2KC 2W6JH 3H1HG 1HWTC 3AEFC 1IK9A 3WU2E 1SP4A 2FYUJ 5AVQB 1FZCC 3MIWA 4KJMA 2I8DA 3N4XA 3OJAB 5KLIC 1CZQA 1KMIZ 2OYHC 1FZCB 4PV1D 3O6QA 2Y0EA 2K3RA 2FY8A 5BVZA 1KYOH 5KLIB 1LWUC 2OYHB 4KT0J 5KAIE 4JYCA 3ZDMA 3BCCG 1ZP0C 3L36A 1LWUB 2W83C 2N9YB 1E5WA 3C9IA 3V2NA 2K37A 1SQQK 3F89A 3L72G 4NPDA 3TDKA 1ZXGA 2KI7B 1GTWA 2BEZF 3MGNA 1HTLC 3IFMA 2W90A 1SQQE 2JP3A 3L74J 1DD4A 3PP5A 1Q7YQ 2H43A 1YBKA 1P84I 1R5SA 1P84D 1M8OB 1T8ZA 2Y0CA 3W68A 3AE1C 4IL6H 1FZAA 3H1HJ 2K88A 4WY4A 5AW0B 3HUSA 2IX7C 4H44B 1LT1A 1VDFA 5CBNA 3CWBD 4D6TE 1X8YA 1XTGB 2POHA 1L4AC 1JY3N 2JWAA 4AYCA 3M9HA 3CCVP 4HKZH 1N86A 1L4AB 1PP9E 2AXCA 2SPZA 2IBZI 1CI6A 3A0HE 3BCCJ 3TNUA 1VQMP 2IBZD 2IDBA 2YXQB 2WZ7A 3L75E 2QVAA 5AVTB 1OW8A 3L72J 1M1KQ 3G9RA 3KZIE 5KJ7C 2G8YA 3F5HA 1MKMA 5AW7B 2C0XA 4WBAA 1QL2A 4GODA 2V7QJ 1HH0A 3V5BA 3MP7B 3FGAD 3HTKA 3AE2C 3GG2A 2KNCB 2WPVB 2OQQA 2BEQD 3K5BA 4K3AA 1KILD 3SSUA 1Y9BA 3OA7A 1S72P 4QMAA 1K73Q 1SQBE 1WT6A 3RK2D 1IFIA 4I1LA 3S9OA 1QL1A 1L0LG 3MTUE 4I7ZB 2NPSC 2BCCE 4GT1A 3VP8A 2E74D 3CCJP 1W5CE 1DD3A 2IBZG 1L2PA 1BGYD 2NPSB 5AVYB 1J1DC 3H1JJ 2RMZA 1DEBA 3AE3C 2YO3A 1JEKA 2KLVA 2Q9IA 3HUSB 3CI9A 4PD4I 1J1DB 4JYBA 5AVSB 3RL0g 1NAYA 1ZN5A 2XNDH 1CW5A 2AEFA 2H88C 1G1IA 1GL2C 1PGQA 3HD7A 1PV3A
chains in the Genus database with same CATH topology
3L74G 3CXHH 3L70G 3L72G 3CX5H 1SQQG 1KYOH 1NU1G 1L0NG 5KLVG 3TGUG 3L75G 1PPJG 3H1IG 1BCCG 2BCCG 1SQPG 4PD4H 3L71G 1NTKG 3H1JG 1NTZG 1SQVG 2FYUG 1BGYG 1L0LG 1PP9G 1KB9H 3BCCG 1BE3G 1SQBG 2A06G 1EZVG 3H1KG 1SQXG 3H1LG 3H1HG 3CWBG 1NTMG 1P84H 4D6TG 3L73G 4U3FG 2IBZG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L74 G;  3CXH H;  3L70 G;  3L72 G;  3CX5 H;  1SQQ G;  1KYO H;  1NU1 G;  1L0N G;  5KLV G;  3TGU G;  3L75 G;  1PPJ G;  3H1I G;  1BCC G;  2BCC G;  1SQP G;  4PD4 H;  3L71 G;  1NTK G;  3H1J G;  1NTZ G;  1SQV G;  2FYU G;  1BGY G;  1L0L G;  1PP9 G;  1KB9 H;  3BCC G;  1BE3 G;  1SQB G;  2A06 G;  1EZV G;  3H1K G;  1SQX G;  3H1L G;  3H1H G;  3CWB G;  1NTM G;  1P84 H;  4D6T G;  3L73 G;  4U3F G;  2IBZ G; 
#chains in the Genus database with same CATH topology
 5APX A;  4C7N A;  3E7K A;  3PTZ A;  5B5E H;  3H1I G;  1GL2 B;  1LTS C;  4N78 D;  5APS A;  3AE4 C;  2XZR A;  2K1A A;  3TK1 A;  4C46 A;  1SQP D;  5GTH H;  1CI6 B;  4OWF A;  2R32 A;  1NU1 G;  3FWL A;  5KLV G;  2XKM A;  1HJ0 A;  1DH3 A;  2Y9Y A;  1URQ D;  1SFC C;  2FYN C;  4H0L D;  1VQ6 P;  1BGY G;  1K9M Q;  3CC4 P;  2V7Q H;  2GUV A;  5TIS H;  3L71 E;  2Q6Q A;  3HTK B;  1AFO A;  2QSI A;  3H1K D;  3VMY A;  1IK7 A;  1KYO I;  1L0L J;  2R5D A;  1KYO D;  5H2F H;  4RJT A;  2W6A A;  2WMM A;  1YJW P;  2E43 A;  1TU3 F;  1D7M A;  2B88 A;  2QJP C;  5AW5 B;  3AEB C;  2ZAE B;  1NTK G;  1S2E A;  3A7O A;  1JMB A;  2QJP B;  1RF1 A;  1J1E B;  1L0N K;  2C9L Y;  2N1T D;  1OWA A;  1DX7 A;  3H1I J;  1H88 A;  2FXP A;  1YQ4 C;  5DJU B;  1HGZ A;  1VQ5 P;  2AXT E;  3JC2 2;  3RL0 D;  2QEX P;  4U3F D;  2R44 A;  1L0N E;  3H1K G;  2KSE A;  4EI2 A;  1N2D C;  4KHX A;  4Y99 C;  1NU1 J;  5KLV J;  1N7S D;  1FZF A;  3VMA A;  2QIW A;  1NTM E;  2ZYA A;  4UB8 H;  2KS1 B;  4Y99 B;  1BGY J;  2L91 A;  3EWK A;  4H13 C;  2YIU C;  4NPE A;  3AEE C;  4XA4 A;  3CL3 D;  2W8Z A;  2B89 A;  3LW5 J;  1EDK A;  3NFQ A;  4H13 B;  2FYU D;  2YIU B;  5CCG D;  3VYI A;  3Q2Y A;  2HPC B;  2R3C A;  1K05 A;  2KYV A;  4HH2 A;  2E5Y A;  3EFG A;  3PLN A;  2LR2 A;  5APV A;  2GM4 A;  4N6J A;  2KSJ A;  1GU4 A;  1VF5 D;  4ASV A;  3WMM 0;  1NTZ K;  3M9Q A;  1JCD A;  1NTK J;  2ZFC A;  1NYH A;  3JSV C;  2KIK A;  3QH9 A;  1QX8 A;  1NKZ B;  1SQQ G;  5APQ A;  1LP1 A;  2PAJ A;  1QEX A;  1EZV D;  2H7H A;  3B5N D;  3KPE A;  5AW6 B;  1IC2 A;  2C0W A;  3L74 D;  1BDC A;  2YXR B;  5B66 E;  2OGU A;  1H0T A;  1FAV A;  3AEA C;  2B87 A;  3H1H D;  3D70 A;  2NZ2 A;  3CXH D;  3L70 D;  1VQ4 P;  2Q3I A;  1OVR A;  1UII A;  1KIL A;  3RBZ A;  1RE3 A;  1GK4 A;  1M7L A;  3CCM P;  3M0D A;  3VP9 A;  1LT9 A;  1IFD A;  3LW5 H;  1FE6 A;  3MZW B;  1NH4 A;  4OGQ C;  4PD4 H;  4HB1 A;  2HG5 D;  1S9K E;  3VOP A;  1PP9 G;  1KB9 H;  1YHQ P;  5BU5 A;  4OGQ B;  1KQS O;  1LTJ C;  3Q5S A;  1SLQ A;  3L75 G;  4HYT B;  5C39 A;  5E79 H;  3W67 A;  2ZJS E;  1Y8A A;  3L72 D;  1EQ7 A;  2IPP A;  4UB6 E;  5APU A;  4DCK A;  3L73 G;  1SQQ J;  3L70 G;  1ZRT D;  5KAF E;  2PP6 A;  3VMZ A;  1FOS F;  4PJ0 E;  1YJN P;  1OX3 A;  1M56 D;  1LP1 B;  1PPJ D;  3I56 P;  3G4S P;  3GW6 A;  4A7P A;  1JTH B;  2ZT9 D;  3CX5 H;  2FXO A;  2AEJ A;  1T3U A;  2YO2 A;  2WPR A;  1EXI A;  1URQ A;  4LLH A;  2P67 A;  3RK3 D;  1SQX K;  1YI2 P;  3TGU E;  3WU2 H;  2D2C C;  4GOE A;  3GF3 A;  2WWW A;  2E5T A;  3H1J D;  4M3L A;  2IZ0 A;  1RE3 C;  1JY2 O;  1M90 Q;  2D2C B;  3M0A A;  1SQX E;  3RBX A;  2A45 H;  2WTY A;  2Q3E A;  2QJY C;  2QM7 A;  1PP9 J;  3BRT B;  2A06 G;  1RQV A;  2QJY B;  1G2C B;  4IL6 E;  3WUU A;  5KAI H;  4C7R A;  3L75 J;  2CK3 H;  2OTL P;  1GW3 A;  2WIT A;  1PPJ G;  2Z5I A;  3AE9 C;  4RO0 A;  3T97 A;  3AEG C;  2QG4 A;  2HOD A;  2UWJ E;  4H44 C;  3L73 J;  1HBW A;  1LTT C;  3L70 J;  4GDO A;  2N1T A;  2Z5H A;  2E76 B;  2XV5 A;  4NPF X;  1BE3 E;  1NKN A;  3L71 G;  3H1J G;  3N7N A;  1LNQ A;  5CMZ A;  3G6E P;  1MFZ A;  2H89 C;  2OAR A;  3CPW O;  4I6M C;  2P1J A;  5AVX B;  1W2B O;  1FJP A;  1GW4 A;  1KTM A;  5CCH D;  1L0L D;  3P8C D;  1T6A A;  4XE5 B;  1KV4 A;  5AW3 B;  3USS A;  1T2K D;  3O6Q B;  2IFM A;  1AV1 A;  1WRG A;  2HYN A;  3V2P A;  5AW8 B;  3CC2 P;  1U57 A;  1GU5 A;  2WSC H;  4L73 A;  1PZQ A;  3A0B H;  2J58 A;  1OZH A;  3H1L D;  1SQB K;  1NWQ A;  3L74 E;  5AVZ B;  2E75 C;  2CPB A;  1IFP A;  3FX0 A;  2KK7 A;  1OVU A;  1A02 J;  2ZXE B;  3H1I D;  2E75 B;  1GZL A;  2IFN A;  1SQV E;  2G3A A;  3A0H H;  1L0N G;  1T3J A;  2WT7 A;  1FDM A;  3PJS K;  4I7Z C;  2FXM A;  2XNX A;  3CXH E;  1KC8 Q;  4XFJ A;  3O8Z A;  2DW3 A;  1QVF O;  1NU1 D;  3KZI H;  5KLV D;  4IOI H;  3CME P;  1KFN A;  1NTZ D;  4WY4 C;  3T97 B;  1S1C X;  3HUS C;  1FS0 E;  3L71 J;  1BDD A;  3G71 P;  4MN4 C;  1W2E A;  4WY4 B;  1FU1 A;  3B5N A;  2K9Y A;  1DIP A;  4L74 A;  3L4F A;  3H1L G;  4R4L A;  4PD4 D;  1BCC E;  1QVG O;  1KB9 I;  1KB9 D;  3BCC E;  4JBZ A;  4GKG A;  2E42 A;  1LJ2 A;  1H89 A;  3EFF K;  4H44 D;  2O3J A;  3L72 E;  1JY3 O;  4EOT A;  2IZ1 A;  1JB0 J;  1N7L A;  4RES B;  2K9J A;  1NTK D;  4BRY A;  3B8E B;  4K35 A;  3A2A A;  3TNU B;  4CPG A;  2ZVN B;  5AW9 B;  1VQ7 P;  1VQO P;  1NTZ G;  1L4A D;  3V4Q A;  1K8A Q;  1KQF B;  2KOG A;  1VQ9 P;  3D6Z A;  2Y0D A;  2Q7C A;  2NRG A;  3U59 A;  5GTI E;  1L0N J;  2M5A A;  4IFD K;  2LXC B;  3CX5 I;  3M9B A;  3CX5 D;  1VF5 B;  2PRR A;  1S5L E;  2O1J A;  1JMM A;  1RF0 A;  3H32 A;  5KJ7 D;  4U7J A;  1BSH A;  5CJ4 A;  3MUD A;  1SVF A;  3GHG A;  3A3Y B;  3M91 A;  5AVU B;  1J1E C;  1HJB A;  1S3J A;  3H1L J;  1VPC A;  2A45 I;  2JKV A;  2GA1 A;  1NHL A;  5K5G B;  3HD7 C;  2W27 A;  2QE7 H;  1HF9 A;  1P84 E;  1AVY A;  5L8R J;  2P2U A;  3KYQ A;  1N73 A;  2NPS D;  3HD7 B;  1NTM K;  1QLE D;  4C7N B;  4UB8 E;  4WB4 A;  2OTK E;  2P7J A;  2WSF J;  3HE5 A;  3IN6 A;  2Q1K A;  1NTZ J;  3L37 A;  3CWB E;  4OVN F;  3JCU E;  1M1J A;  2WVR A;  1PL5 A;  1RQU A;  2FFD A;  3V2R A;  1SQQ D;  1GL2 D;  4W7Z A;  4YPC A;  1GK6 A;  3KQG A;  3TYY A;  2I1K A;  5AVR B;  2AXT H;  1L0L E;  1NOH A;  2A45 G;  1GDT A;  4JQ0 D;  4R4M A;  2IBZ E;  3SWY A;  2OYI A;  1USE A;  3P32 A;  2M5A B;  1VQP P;  1LGH B;  2M0B A;  1Y47 A;  3Q3D A;  1YIJ P;  1YQ3 C;  2JO1 A;  1SFC D;  3AE8 C;  1KQG B;  3R2P A;  3SWF A;  3AEC C;  3H32 B;  3TF5 A;  3LID A;  3TSI A;  2O1K A;  1SQX G;  1RF1 C;  1KIL E;  3B71 A;  3V4W A;  1JM0 A;  3BVH A;  3B4S A;  4PV1 C;  1RE4 A;  5CCH A;  2YMY A;  1PP9 D;  1XTC C;  1RF1 B;  2HR3 A;  4PV1 B;  1NJI Q;  2VRS A;  2XU6 A;  2WSE J;  1NU1 E;  3L75 D;  5APY A;  1BGY E;  2JWD A;  1ZR2 A;  1RY3 A;  2WSF H;  1FC2 C;  3VTP C;  2HLO A;  1FZC A;  2V4H A;  4W80 A;  2I1J A;  3HE5 B;  3L73 D;  2HFE D;  3GLM A;  2OYH A;  1BE3 G;  2QJK B;  3ITK A;  4PD4 E;  4D6T G;  1LWU A;  3PRJ A;  1SQP K;  1SQB D;  1LTB C;  4N78 E;  5B66 H;  1JOC A;  1G1J A;  2OYO A;  5AVV B;  3AED C;  2BCC D;  1SQP E;  2OYI B;  1U7J A;  1A02 F;  4B86 A;  4ZKU A;  1AVO A;  3P8M C;  2W6B A;  1ZR4 A;  4H13 D;  2Y9Z A;  2MKV A;  1SQX J;  4IFM A;  2Q5U A;  4IL6 X;  2KXP B;  5KTB A;  2KZJ A;  2PGD A;  5CBO A;  1FBM A;  3MD0 A;  3H1K E;  2A06 D;  4DJG A;  1KYO E;  3IAO A;  3CCE P;  4DZO A;  3KHU A;  1SQB G;  3S1K A;  1EC5 A;  3RGU A;  3CCR P;  2WSE H;  5AW2 B;  4ZKP A;  3CCQ P;  2BCC G;  1H0T B;  4HJG H;  1L4A A;  4UB6 H;  1IFJ A;  1BE3 J;  1JCC A;  5M1B A;  2B87 B;  3GMA A;  4YTP C;  5KAF H;  4D6T J;  2WSC J;  3FWN A;  1R5L A;  2O01 J;  4PJ0 H;  3BAS A;  3L71 D;  1KIL C;  1YTZ T;  3I5C A;  4L76 A;  3M0D C;  1LT9 C;  3WUV A;  1BCC G;  3RK2 C;  1KIL B;  2L5G B;  4U3F E;  2LKM A;  1LT9 B;  4ZMD A;  3RK2 B;  3CC7 P;  2YKQ A;  4AUW A;  5KJ7 A;  2KNC A;  2E74 C;  1ZLL A;  1PGP A;  3GF7 A;  3V6I A;  5APT A;  2LXB A;  2FYU K;  4WVZ A;  2E74 B;  3D6Y A;  1MZ9 A;  2QRX A;  2QA4 P;  2E76 C;  4Z1M H;  1IO4 A;  3ABV C;  3MHV A;  1NO4 A;  3C1L A;  2FYU E;  4OGQ D;  1U7M A;  2FBW C;  1WMK A;  3CCL P;  5AW4 B;  1SQV J;  1IFM A;  1IFN A;  3FXD A;  1SQB J;  2NPS A;  1GD2 E;  1L0N D;  3KDP B;  1J2J B;  2KP8 A;  1DEE G;  1N7S A;  2BCC J;  2IYO A;  3R4Y A;  1K04 A;  1NTM D;  1AQT A;  3A0B E;  1X0T A;  1URQ C;  2YNY A;  1PIX A;  2JDI H;  1EDI A;  1GL2 A;  4H0L C;  3SWK A;  5AW1 B;  1OVV A;  1URQ B;  3VN0 A;  3E1I A;  4H0L B;  1X22 A;  2B9B A;  2O01 H;  1BCC J;  2RKL A;  5CCG A;  1EZV E;  1SQV K;  1VQN P;  4IFF A;  1KN7 A;  1AJY A;  2R5B A;  4BWN A;  1KQL A;  2WPS A;  3KXD A;  1Q82 Q;  1PFI A;  2JEE A;  1PGJ A;  1LTI C;  3PHL A;  1SFC A;  3G3Z A;  3H1H E;  3L73 E;  4LGD E;  2J5U A;  3UIA A;  3L70 E;  1OW6 A;  2D2C D;  3PH0 A;  3U1C A;  3CWB G;  1NTM G;  3CD6 P;  4JF7 A;  1FZE A;  5APW A;  4OH8 B;  2N1T C;  3CCU P;  1RHZ B;  2HOD B;  1AA0 A;  1X79 B;  1OFC X;  4EYY Q;  5AVW B;  1FDO A;  2N1T B;  4ZNC A;  1S5L X;  5B5E E;  3E1R A;  3RL0 C;  4EIJ A;  3BRV B;  4I2L C;  3CXH H;  3C8V A;  3RL0 B;  1OW7 A;  2ZYG A;  2OTJ P;  1N7S C;  5GTH E;  2E76 D;  1KFM A;  1N7S B;  2MJZ A;  4W7Y A;  2JJL A;  3AE7 C;  1Q86 Q;  2KLU A;  1ZRT E;  2A06 E;  5TIS E;  1M57 D;  3HE4 A;  3OAK A;  5CCG C;  3H25 A;  1N8R Q;  1OXZ A;  1IZN B;  1S9K D;  2KS1 A;  1PPJ E;  2YKO A;  3V2Q A;  1HGV A;  3CMA P;  3IR9 A;  3SFD C;  5H2F E;  5BU8 B;  3Q5R A;  1OIP A;  1VF5 C;  1EDL A;  2WPQ A;  3L35 A;  3RK3 E;  1Q2N A;  1Q81 Q;  1NVO A;  4LC1 A;  1FOS E;  2J59 M;  3VMX A;  2HPC A;  3BAT A;  1NTM J;  3CWB J;  1SFC B;  3SFE C;  2FYN B;  2WT7 B;  2Z4E A;  4GIF A;  2P58 A;  3H1J E;  2ITA A;  4WWI A;  2E75 D;  1CSB A;  1KZU B;  2M8R A;  2R3S A;  5GTI H;  3B5N C;  3HRN A;  3B5N B;  4TLF A;  4AQR D;  5TJH A;  5KKZ C;  3H6P A;  4EDF A;  3QWO C;  1FZB A;  5DJT B;  1SQP G;  1S5L H;  5KKZ B;  1LTG C;  3FXE A;  3TGU D;  2WQY C;  4WY4 D;  2AEM A;  1JY2 P;  3CLQ A;  1NAF A;  2QM8 A;  1JO5 A;  1YJ9 P;  3I55 P;  3CCS P;  1ZOY C;  3OW2 O;  1OMI A;  1GMJ A;  1SQX D;  1L0L K;  2BAS A;  1YYC A;  3U1A A;  2K9J B;  2N9B A;  2YMK A;  4BRY B;  1BSN A;  1SS1 A;  1P84 H;  1Z56 A;  3HE4 B;  2M3E A;  2XDJ A;  2PFX A;  4YXD C;  3P8C E;  4RKU J;  4ASW A;  5EFW B;  3M06 A;  1ZW0 A;  2WSS H;  2C9N Y;  3S4R A;  1X9V A;  2RN0 A;  1UIX A;  3JCU H;  1RF0 C;  3NXS A;  3TGU G;  1BE3 D;  3H1L E;  2GUS A;  3MUD C;  3GHG C;  4D6T D;  3Q1M A;  2RH0 A;  2M3B A;  5CJ0 A;  1PGO A;  3GHG B;  3H1I E;  1LTJ A;  1FDI A;  1NU1 K;  1USD A;  2ZVO B;  1AQ5 A;  4U3F G;  5KLV K;  1VQK P;  1ZME C;  1Q90 D;  2FYZ A;  1SQP J;  3AE6 C;  2ZT9 C;  2O01 N;  3NTN A;  3WUT A;  1LTA C;  2ZT9 B;  2P10 A;  3IF4 A;  3RK3 C;  5KLV E;  1N73 C;  4DOJ A;  5CHX A;  1NTZ E;  1KD1 Q;  1YTZ I;  3A5T A;  1R8E A;  1EZV I;  1MUU A;  1JNM A;  3RK3 B;  1N73 B;  1ZV8 A;  4YXW H;  1H8A A;  2QJK C;  1JTH A;  3LIE A;  2KB7 P;  2FKW B;  2FYU G;  3H1K J;  1HVV A;  4L75 A;  1E79 H;  1M1J C;  1FJK A;  2FFD C;  1FZG A;  3HD7 D;  3AE5 C;  1KB9 E;  1QGK B;  1SQV D;  1MV8 A;  4DT0 A;  1M1J B;  4BXL A;  3D71 A;  4TT3 H;  2FFD B;  1NTK K;  1JY2 N;  2CPS A;  3CXH I;  1HUC A;  1S4X A;  3EQ2 A;  2KUB A;  3Q5P A;  3P7K A;  4N3Y B;  1VL2 A;  2OYI C;  2H8P D;  5E79 E;  2KZI A;  1NTK E;  4Y28 J;  3TGU J;  1NGM B;  1RH5 B;  1EXJ A;  4JPZ B;  1G2C A;  4O9B A;  1YIT P;  2JR8 A;  4GOF A;  2YKP A;  1KOR A;  1JUN A;  2ZXX A;  1EZV G;  3II6 A;  4U3F J;  3NMD A;  1BCC D;  1MFT A;  3L74 G;  1VQL P;  2IYP A;  3BCC D;  2ZYD A;  1RE4 C;  5CCH C;  1VQ8 P;  1LTJ B;  1JY3 P;  1IJD B;  3CX5 E;  1SQV G;  1EDJ A;  1T2K C;  2W6J H;  3H1H G;  1HWT C;  3AEF C;  1IK9 A;  3WU2 E;  1SP4 A;  2FYU J;  5AVQ B;  1FZC C;  3MIW A;  4KJM A;  2I8D A;  3N4X A;  3OJA B;  5KLI C;  1CZQ A;  1KMI Z;  2OYH C;  1FZC B;  4PV1 D;  3O6Q A;  2Y0E A;  2K3R A;  2FY8 A;  5BVZ A;  1KYO H;  5KLI B;  1LWU C;  2OYH B;  4KT0 J;  5KAI E;  4JYC A;  3ZDM A;  3BCC G;  1ZP0 C;  3L36 A;  1LWU B;  2W83 C;  2N9Y B;  1E5W A;  3C9I A;  3V2N A;  2K37 A;  1SQQ K;  3F89 A;  3L72 G;  4NPD A;  3TDK A;  1ZXG A;  2KI7 B;  1GTW A;  2BEZ F;  3MGN A;  1HTL C;  3IFM A;  2W90 A;  1SQQ E;  2JP3 A;  3L74 J;  1DD4 A;  3PP5 A;  1Q7Y Q;  2H43 A;  1YBK A;  1P84 I;  1R5S A;  1P84 D;  1M8O B;  1T8Z A;  2Y0C A;  3W68 A;  3AE1 C;  4IL6 H;  1FZA A;  3H1H J;  2K88 A;  4WY4 A;  5AW0 B;  3HUS A;  2IX7 C;  4H44 B;  1LT1 A;  1VDF A;  5CBN A;  3CWB D;  4D6T E;  1X8Y A;  1XTG B;  2POH A;  1L4A C;  1JY3 N;  2JWA A;  4AYC A;  3M9H A;  3CCV P;  4HKZ H;  1N86 A;  1L4A B;  1PP9 E;  2AXC A;  2SPZ A;  2IBZ I;  1CI6 A;  3A0H E;  3BCC J;  3TNU A;  1VQM P;  2IBZ D;  2IDB A;  2YXQ B;  2WZ7 A;  3L75 E;  2QVA A;  5AVT B;  1OW8 A;  3L72 J;  1M1K Q;  3G9R A;  3KZI E;  5KJ7 C;  2G8Y A;  3F5H A;  1MKM A;  5AW7 B;  2C0X A;  4WBA A;  1QL2 A;  4GOD A;  2V7Q J;  1HH0 A;  3V5B A;  3MP7 B;  3FGA D;  3HTK A;  3AE2 C;  3GG2 A;  2KNC B;  2WPV B;  2OQQ A;  2BEQ D;  3K5B A;  4K3A A;  1KIL D;  3SSU A;  1Y9B A;  3OA7 A;  1S72 P;  4QMA A;  1K73 Q;  1SQB E;  1WT6 A;  3RK2 D;  1IFI A;  4I1L A;  3S9O A;  1QL1 A;  1L0L G;  3MTU E;  4I7Z B;  2NPS C;  2BCC E;  4GT1 A;  3VP8 A;  2E74 D;  3CCJ P;  1W5C E;  1DD3 A;  2IBZ G;  1L2P A;  1BGY D;  2NPS B;  5AVY B;  1J1D C;  3H1J J;  2RMZ A;  1DEB A;  3AE3 C;  2YO3 A;  1JEK A;  2KLV A;  2Q9I A;  3HUS B;  3CI9 A;  4PD4 I;  1J1D B;  4JYB A;  5AVS B;  3RL0 g;  1NAY A;  1ZN5 A;  2XND H;  1CW5 A;  2AEF A;  2H88 C;  1G1I A;  1GL2 C;  1PGQ A;  3HD7 A;  1PV3 A; 
#chains in the Genus database with same CATH homology
 3L74 G;  3CXH H;  3L70 G;  3L72 G;  3CX5 H;  1SQQ G;  1KYO H;  1NU1 G;  1L0N G;  5KLV G;  3TGU G;  3L75 G;  1PPJ G;  3H1I G;  1BCC G;  2BCC G;  1SQP G;  4PD4 H;  3L71 G;  1NTK G;  3H1J G;  1NTZ G;  1SQV G;  2FYU G;  1BGY G;  1L0L G;  1PP9 G;  1KB9 H;  3BCC G;  1BE3 G;  1SQB G;  2A06 G;  1EZV G;  3H1K G;  1SQX G;  3H1L G;  3H1H G;  3CWB G;  1NTM G;  1P84 H;  4D6T G;  3L73 G;  4U3F G;  2IBZ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...