1BGYG

Cytochrome bc1 complex from bovine
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYENDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 22
structure length 81
sequence length 81
chains with identical sequence S
ec nomenclature
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1bgyG00
1BGYG 4D6TG 1BE3G 3H1HG 3CWBG 1SQXG 2A06G 1P84H 3L73G 1BCCG 3CXHH 1L0LG 1EZVG 3H1IG 1PPJG 1SQPG 3L70G 1L0NG 1NU1G 1KYOH 3L74G 2BCCG 1NTKG 1SQVG 3H1LG 2IBZG 3CX5H 3L71G 1SQBG 3BCCG 1KB9H 1NTZG 1NTMG 2FYUG 3TGUG 4U3FG 5KLVG 3H1JG 3H1KG 1SQQG 3L75G 1PP9G 4PD4H 3L72G
chains in the Genus database with same CATH superfamily
1GK4A 2A06G 3FWLA 4IL6X 4I1LA 2HODA 5CCGC 3Q2YA 2KZJA 1RE4A 5KTBA 2FBWC 4HYTB 1OX3A 1VQKP 3HUSC 3TGUD 2M5AA 5KLVD 3KZIE 1DX7A 2Y0EA 1M1JA 3PP5A 4IFMA 4CPGA 5KJ7A 3GG2A 2AEFA 3G6EP 1ZR4A 1HWTC 3V2NA 3AEBC 1SQVD 3KPEA 1W2EA 2K9JB 4H0LD 2FXOA 4WVZA 1SQQG 1RE3C 1PP9D 4JBZA 1E5WA 1KZUB 2ZT9B 2JP3A 1M57D 5KLVK 3CXHI 3H32B 2BASA 4IOIH 1KD1Q 4K3AA 1HJ0A 1J1EC 1SLQA 1YJNP 4UB8H 1SQVK 1PPJD 2IZ1A 2JEEA 2PP6A 4L74A 2W6JH 1VF5B 2R3CA 2E75B 1FJKA 1A02F 2N1TD 2B89A 3V4QA 4H0LB 3IF4A 2P7JA 3B5NC 3CCEP 2QRXA 3VMZA 2Y9YA 1HVVA 2Q6QA 3TGUE 5KLVE 3D6ZA 1OXZA 1R5SA 1NTZG 2HYNA 2H88C 1NYHA 1OVRA 3WUUA 2IYOA 2YO2A 1OW6A 3VP9A 2NRGA 1H89A 1RF0C 3GLMA 4GIFA 2YIUB 2NZ2A 3JSVC 3E7KA 2OYIB 2QJKC 3CC4P 3H1LD 1PP9E 5CCHC 3CX5D 2KP8A 2YO3A 3S1KA 1MKMA 3H1HD 1JY3N 5AVTB 2GUVA 5APVA 2N1TB 1FZCC 5L8RJ 1KQFB 2PRRA 3M9HA 1JOCA 1T3UA 2QM7A 1PPJE 1GL2B 2WVRA 3MD0A 2QJPC 2AXTH 2CPSA 1J1EB 3D70A 3FXEA 2N9BA 5B66E 1VQPP 1JEKA 4H44C 1M8OB 3A0BH 1G2CA 5APYA 3H1JE 5GTHE 1R5LA 1NAFA 3CCLP 5AVVB 1HH0A 3OA7A 2E74B 4RJTA 1FZEA 1KILA 1LJ2A 2ZYAA 2NPSD 5AW2B 2JJLA 1AFOA 5M1BA 1LWUC 1NTME 4YXWH 3AE3C 2HPCA 5KLVJ 4Y28J 3CCQP 1RQVA 2FXMA 4IFFA 1SFCB 5B5EE 3O6QA 3M0DA 4TLFA 1NHLA 3AE9C 1JMMA 1IFDA 1AA0A 2POHA 1NAYA 2IZ0A 1HGVA 3CX5E 2XU6A 2BCCD 4WBAA 2Q9IA 1NTKD 3HE5A 1Q86Q 1JCCA 1SQBD 3H1HE 1AJYA 1RQUA 4DZOA 1JY2P 3L75D 4DOJA 4BXLA 1NU1K 2WZ7A 3IR9A 2XZRA 1FZAA 4H13C 1VQNP 4U3FJ 1RE4C 2JKVA 1NWQA 2IDBA 5AW6B 3L73J 4UB6E 4XE5B 1ZR2A 2P58A 1VQMP 1CSBA 2O01J 2FYZA 1M1JC 2V4HA 5KJ7C 1BDDA 1NTKK 2XV5A 4PV1C 3G9RA 1SQBK 4XFJA 3H1JJ 3SFDC 5KLIC 3CI9A 3TGUG 5KLVG 1SS1A 2Q3EA 5CMZA 1K73Q 3TYYA 1FOSE 3KDPB 1NTMJ 1NGMB 5CJ0A 2Y9ZA 3TDKA 2HG5D 1JUNA 3MP7B 1H0TA 1OWAA 2KZIA 3I5CA 2M3BA 3RK3D 2XKMA 1L0NJ 1PP9G 2BCCE 1LT9B 3RK2C 1G1JA 2E42A 3TF5A 4L76A 2WPVB 4NPFX 1SVFA 1WRGA 1KV4A 2ITAA 3AE2C 3RBZA 3H1HJ 5AW5B 2Q5UA 1N7SB 2WQYC 4OGQC 5H2FE 1PPJG 1MV8A 3IAOA 1DD3A 2B87A 3G71P 3LIDA 3H1JG 2CK3H 3WU2E 4AUWA 2SPZA 1IK9A 3P8CD 2KS1A 1DEEG 3EQ2A 3NMDA 3F5HA 1VDFA 5GTIH 2FFDB 1LNQA 1NTMG 3GHGA 1PGJA 2R32A 1JY2O 2MKVA 2D2CC 2AXCA 3CMEP 5APXA 2ZAEB 1BGYJ 2IBZI 3USSA 1R8EA 1HUCA 1JNMA 4TT3H 1URQD 4PD4H 2BCCJ 4WY4B 3H1HG 4R4MA 1L0LD 3L74D 1GW3A 2G3AA 1PIXA 3AECC 2FKWB 3L72E 1Q82Q 1S1CX 3I56P 1T3JA 1KILC 2RKLA 4KT0J 5AW0B 3AE5C 2NPSA 4RESB 5AW1B 1M7LA 2XDJA 1ZW0A 3KXDA 2RMZA 3EFFK 5AW8B 5TJHA 2UWJE 3NTNA 3M0DC 3RL0B 1L4AB 5E79H 1CW5A 3P8CE 1J2JB 3PTZA 5KAFH 4KHXA 1YQ4C 1LTGC 4C7NA 2WSFJ 2P2UA 4UB8E 1YITP 4GOFA 2R5DA 3CWBJ 1SQXJ 4BRYB 1N73A 1YJWP 3VOPA 1N86A 2QG4A 1FS0E 3AE6C 1P84H 3EFGA 2ZFCA 1U7JA 3L70D 4O9BA 1LTJC 2KXPB 2BCCG 2C0WA 1AQTA 1BSHA 2FYNC 1GZLA 3S4RA 4U7JA 1L0LE 3LW5J 3SFEC 2KNCB 1M56D 3L74E 1QEXA 1EXIA 3KQGA 5AVYB 3L72J 2YMKA 3HE4A 1DH3A 1K9MQ 1K04A 3R2PA 1ZN5A 3AEDC 1BE3D 3K5BA 2RH0A 4PJ0H 1VF5D 1IFJA 4XA4A 2JWDA 1MZ9A 2E75D 5CHXA 3HD7D 2WSCJ 1QVFO 1RF1A 1IFMA 3V2PA 4EYYQ 2P67A 3D6YA 2LKMA 3BASA 3H6PA 3T97A 4N6JA 5BU8B 1S5LH 1KQLA 4YPCA 1MFZA 4U3FD 5APQA 3L70E 3G4SP 3EWKA 1J1DC 4MN4C 4D6TD 1LTIC 3L73D 3L71E 2W83C 2E76C 3TSIA 1KC8Q 4PD4I 1YJ9P 2K37A 1IO4A 3AE1C 4Y99C 4IFDK 1XTGB 1LTJB 1RHZB 1Y47A 2FY8A 1L0LJ 3H1JD 3HD7B 3L74J 3L72G 2J5UA 4OH8B 1UIIA 4JPZB 3M06A 1M90Q 1KYOH 4KJMA 1EZVI 1FJPA 1YQ3C 1GL2D 2OTJP 1BE3E 3CCUP 3GHGC 1NTMD 1BCCJ 1LP1A 4GODA 4JQ0D 1X9VA 2IBZE 4B86A 2WT7A 2ZVOB 3HUSB 1YHQP 3ZDMA 4ASWA 1KTMA 1L0ND 2E74D 3C1LA 1LT1A 1HTLC 1OFCX 2QJYC 1FOSF 2C9NY 3AE7C 1H88A 1URQA 4EDFA 1X8YA 3PRJA 1YIJP 1T2KC 1KQSO 3B5ND 1SFCD 2Y0DA 4U3FE 1NTMK 1P84I 1IFIA 3HTKA 4D6TE 2M8RA 3L73E 3Q5SA 2R44A 1VQ5P 3L70J 3V5BA 1FC2C 3V2RA 1L0NK 2NPSC 3L71J 1L0LG 3L74G 2KK7A 2H89C 1QVGO 2H7HA 5CJ4A 3GF3A 5CCHD 3OAKA 4GOEA 1U7MA 2VRSA 2OYHC 3M91A 3SWYA 2OTKE 4QMAA 1VQOP 3SWKA 3BCCE 2QIWA 3CXHD 4A7PA 3MTUE 5K5GB 3B4SA 3A0HH 3B5NB 2A45H 1N73C 1USEA 1BE3J 2FYUD 3CPWO 5CBNA 3SSUA 1L0NE 1BGYD 5AW9B 3ITKA 5BU5A 3BATA 2K9JA 3Q1MA 1FBMA 3OJAB 4H44D 3MUDA 1N8RQ 1EXJA 3BVHA 1NO4A 2QJKB 1CZQA 1QL1A 3VTPC 3CCJP 1ZP0C 3H32A 2GA1A 3L70G 2YNYA 2ZXXA 1NKNA 3L71G 4N3YB 1FZCB 4D6TJ 3CCVP 2KUBA 2W6BA 1JY2N 5GTIE 3H25A 2YXQB 2HR3A 4GDOA 4I7ZC 2C0XA 4OVNF 1Q90D 2QJPB 3W67A 1N7SD 1CI6B 2KSEA 1KFNA 1JTHB 2W6AA 1KYOI 1WMKA 4H44B 3RK3C 1RF1C 2M3EA 2V7QJ 3CXHE 2H43A 2ZVNB 1BE3G 1SQXD 3BRTB 3CWBD 1LTSC 2OYHB 1P84D 3BCCJ 2N9YB 4H13D 2FYUE 1FDIA 2R5BA 3W68A 2IBZG 5B66H 2YKOA 1FE6A 1Q2NA 1LWUB 4IL6H 1BGYE 2AEJA 5GTHH 2OYIA 1ZLLA 1PGOA 5KJ7D 1TU3F 3MZWB 1IFNA 2XNXA 1N2DC 2KYVA 1VPCA 1KB9H 1QX8A 2W90A 3Q5PA 1SQXK 4U3FG 1EZVE 2K88A 2YKQA 2N1TA 1RE3A 5B5EH 1XTCC 4DJGA 3L72D 4D6TG 3L73G 1PL5A 1IFPA 1EDIA 2KI7B 2B9BA 1YBKA 1GL2A 3CX5H 4EI2A 3VP8A 4H13B 4WY4D 2HODB 1FAVA 2KLUA 1FZBA 3AEGC 2M5AB 1JMBA 1PZQA 3V2QA 2Z4EA 4W7YA 2LR2A 5AVUB 2QE7H 5KKZC 1A02J 1M1JB 3V4WA 4R4LA 4W7ZA 1BSNA 4PV1B 3BCCG 3CWBE 1SQXE 5AVZB 4C46A 1P84E 5C39A 3FXDA 2A45I 1S4XA 4EIJA 5KLIB 1KN7A 2HFED 3RBXA 1SFCA 1L0NG 4ZMDA 4M3LA 2FYUJ 4C7RA 3RL0D 1L4AD 4HB1A 1S3JA 4W80A 3QH9A 2JO1A 2IYPA 1GD2E 1IZNB 1JCDA 3L37A 1JM0A 1EDJA 3CD6P 1OW8A 1NJIQ 3PJSK 1ZXGA 1EDLA 3H1KE 3RK2B 3GW6A 1KORA 2H8PD 3A7OA 4JYCA 2D2CD 5AVWB 2QEXP 1YI2P 1BCCD 1NH4A 1FU1A 1Y8AA 1L2PA 4OGQB 4LLHA 4OWFA 2KLVA 3BRVB 3NFQA 5AVXB 2G8YA 3CLQA 4HH2A 1ZRTD 1W5CE 1L0LK 2P10A 2WMMA 2XNDH 3L36A 3L4FA 1NKZB 3S9OA 3MUDC 4ZKPA 4ZKUA 3HRNA 2HLOA 2QM8A 2MJZA 2FYUG 3KHUA 3M9BA 2ZT9C 1BGYG 3CMAP 3H1ID 3WU2H 2D2CB 2PGDA 1SQQJ 3L71D 1QL2A 4RO0A 1LT9A 5TISH 1OVUA 1KB9I 3AEAC 3UIAA 3MIWA 2QA4P 4YTPC 1IK7A 1KYOE 3N4XA 3A5TA 1K8AQ 1VF5C 1ZOYC 1EZVG 3FX0A 1USDA 1EQ7A 3H1KJ 1N7SA 1EC5A 4H0LC 3C8VA 1BCCE 1G2CB 5AVQB 4GKGA 1KQGB 3NXSA 3CX5I 2E5YA 2K3RA 3LW5H 5AW4B 3CC7P 2WSEH 1KILB 5BVZA 1HF9A 5AW3B 5AVRB 2KSJA 3P8MC 4LGDE 1ZRTE 2IBZD 2YIUC 3U59A 2WITA 2HPCB 4ASVA 2OYIC 1VQLP 3O6QB 1VQ7P 3AEFC 3CWBG 1SQXG 2FFDA 2QSIA 5DJUB 1NTZJ 3E1RA 2O3JA 1KILE 2Y0CA 5CCGD 1IC2A 3WUTA 2IPPA 1S9KE 2RN0A 1GTWA 2AXTE 2N1TC 3H1IE 3HE5B 3VMAA 1VQ9P 1FDMA 2WSCH 1GDTA 2W27A 3A0BE 2OTLP 2WPSA 1SQPD 2J59M 1GL2C 3O8ZA 3AE4C 4WY4A 1S72P 4LC1A 3Q3DA 3H1KG 3U1AA 2FYNB 3CCSP 1QGKB 3A0HE 2E74C 2OQQA 2I8DA 1N7LA 3A2AA 1OVVA 2KOGA 3BCCD 2IX7C 1GW4A 2AEMA 1AV1A 3F89A 1GK6A 3E1IA 1SQPK 1YYCA 3B71A 2E76D 2L5GB 1SFCC 5KAIH 3JCUH 3AE8C 1L4AA 1ZMEC 3JC22 3P7KA 1KB9D 3M9QA 3OW2O 1JB0J 1JY3P 2I1JA 1SQVE 1H0TB 3KZIH 2C9LY 1KMIZ 1ZV8A 2O1JA 4BRYA 4DT0A 2Z5HA 3A3YB 1RH5B 2WTYA 4GT1A 1FZFA 4N78D 1SQPE 2YMYA 3H1IJ 3VMXA 2WPQA 4Z1MH 4DCKA 3TNUA 3L35A 2Z5IA 2YKPA 3IN6A 4JYBA 1DEBA 1J1DB 4L73A 1WT6A 3WUVA 2KNCA 1MUUA 2E76B 4HKZH 5DJTB 1S2EA 2ZXEB 5APWA 4Y99B 3Q5RA 4WWIA 2B87B 2P1JA 1T2KD 1BCCG 4IL6E 3LIEA 2K1AA 1HJBA 2E5TA 3II6A 2LXBA 2KS1B 5APUA 3VYIA 1X0TA 1PFIA 2Q3IA 3KYQA 3GHGB 4PD4D 1KB9E 1NU1D 3TGUJ 1Q7YQ 1VQ8P 3RL0g 2JDIH 1LT9C 3WMM0 1AQ5A 4HJGH 1VQ6P 3H1LE 1SQVJ 4K35A 2QJYB 1EZVD 3H1IG 4N78E 3U1CA 3RGUA 2FYUK 3P32A 1N7SC 1PP9J 1H8AA 1AVYA 3VN0A 3V6IA 1OW7A 1SQPJ 2JWAA 1X22A 1Z56A 5CBOA 2KB7P 2A06D 2BEZF 2Q7CA 3CCMP 1FZGA 2JR8A 1LTJA 1NVOA 2NPSB 3HD7A 2A45G 1JY3O 2FXPA 1EDKA 3PHLA 3QWOC 1S5LX 2FFDC 2W8ZA 4L75A 2O01H 1HGZA 1MFTA 5CCGA 3ABVC 2GM4A 4PD4E 3HUSA 2B88A 1SQQD 4C7NB 1NU1E 3PH0A 1OIPA 2QVAA 2V7QH 1N73B 1M1KQ 4YXDC 4PV1D 2O01N 1SQVG 1K05A 2WWWA 2BEQD 4WY4C 4BWNA 2OYOA 2WSSH 3TK1A 2DW3A 2YXRB 3H1KD 1X79B 1NTKE 3R4YA 2ZJSE 3H1LJ 4AQRD 1VQ4P 1SQBE 1T8ZA 4RKUJ 3GMAA 1SQPG 2ZYDA 2OARA 1PV3A 3L75E 5E79E 1SQQK 3I55P 2A06E 3CL3D 5KAFE 2Q1KA 5AW7B 3HE4B 3RK2D 2R3SA 3RL0C 3CCRP 1L4AC 1LGHB 3FGAD 3MGNA 1DIPA 1SP4A 1Y9BA 1HBWA 1NTZD 2PFXA 2KIKA 1LTBC 4I7ZB 3CC2P 4I2LC 1URQC 1W2BO 4UB6H 4OGQD 5APSA 1LTTC 3RK3B 1RF1B 3B5NA 2GUSA 5TISE 1G1IA 4NPEA 1SQQE 1U57A 1LTAC 4EOTA 2I1KA 3T97B 3MHVA 1NOHA 1KFMA 1NU1J 1DD4A 2L91A 5AVSB 1RF0A 3CXHH 4WB4A 1NTZK 1VL2A 3RK3E 3H1LG 4ZNCA 1KYOD 5CCHA 3IFMA 2OGUA 4PJ0E 5EFWB 1BDCA 4JF7A 1GU5A 1NTKJ 3G3ZA 1SQBJ 2IFMA 1PGQA 1FZCA 1GU4A 4I6MC 2WPRA 3L75J 5APTA 3FWNA 3AEEC 1PGPA 2M0BA 3SWFA 1Q81Q 1CI6A 1S5LE 1RY3A 1NTZE 1YTZI 1JTHA 1D7MA 1LP1B 5H2FH 2WT7B 2O1KA 1FDOA 1QLED 5KKZB 2E43A 2CPBA 2OYHA 1KILD 1JO5A 1GMJA 1AVOA 1S9KD 2IFNA 1E79H 1LWUA 3VMYA 1IJDB 1URQB 1NU1G 3D71A 4AYCA 3N7NA 3B8EB 4NPDA 2WSFH 1T6AA 1UIXA 2K9YA 3HTKB 2J58A 3PLNA 3M0AA 2PAJA 3C9IA 1NTKG 3TNUB 2ZYGA 2E75C 1OZHA 1SQBG 3HD7C 1YTZT 2LXCB 2WSEJ 3L75G 3GF7A 5KAIE 1OMIA 2ZT9D 3JCUE
chains in the Genus database with same CATH topology
1BGYG 4D6TG 1BE3G 3H1HG 3CWBG 1SQXG 2A06G 1P84H 3L73G 1BCCG 3CXHH 1L0LG 1EZVG 3H1IG 1PPJG 1SQPG 3L70G 1L0NG 1NU1G 1KYOH 3L74G 2BCCG 1NTKG 1SQVG 3H1LG 2IBZG 3CX5H 3L71G 1SQBG 3BCCG 1KB9H 1NTZG 1NTMG 2FYUG 3TGUG 4U3FG 5KLVG 3H1JG 3H1KG 1SQQG 3L75G 1PP9G 4PD4H 3L72G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGY G;  4D6T G;  1BE3 G;  3H1H G;  3CWB G;  1SQX G;  2A06 G;  1P84 H;  3L73 G;  1BCC G;  3CXH H;  1L0L G;  1EZV G;  3H1I G;  1PPJ G;  1SQP G;  3L70 G;  1L0N G;  1NU1 G;  1KYO H;  3L74 G;  2BCC G;  1NTK G;  1SQV G;  3H1L G;  2IBZ G;  3CX5 H;  3L71 G;  1SQB G;  3BCC G;  1KB9 H;  1NTZ G;  1NTM G;  2FYU G;  3TGU G;  4U3F G;  5KLV G;  3H1J G;  3H1K G;  1SQQ G;  3L75 G;  1PP9 G;  4PD4 H;  3L72 G; 
#chains in the Genus database with same CATH topology
 1GK4 A;  2A06 G;  3FWL A;  4IL6 X;  4I1L A;  2HOD A;  5CCG C;  3Q2Y A;  2KZJ A;  1RE4 A;  5KTB A;  2FBW C;  4HYT B;  1OX3 A;  1VQK P;  3HUS C;  3TGU D;  2M5A A;  5KLV D;  3KZI E;  1DX7 A;  2Y0E A;  1M1J A;  3PP5 A;  4IFM A;  4CPG A;  5KJ7 A;  3GG2 A;  2AEF A;  3G6E P;  1ZR4 A;  1HWT C;  3V2N A;  3AEB C;  1SQV D;  3KPE A;  1W2E A;  2K9J B;  4H0L D;  2FXO A;  4WVZ A;  1SQQ G;  1RE3 C;  1PP9 D;  4JBZ A;  1E5W A;  1KZU B;  2ZT9 B;  2JP3 A;  1M57 D;  5KLV K;  3CXH I;  3H32 B;  2BAS A;  4IOI H;  1KD1 Q;  4K3A A;  1HJ0 A;  1J1E C;  1SLQ A;  1YJN P;  4UB8 H;  1SQV K;  1PPJ D;  2IZ1 A;  2JEE A;  2PP6 A;  4L74 A;  2W6J H;  1VF5 B;  2R3C A;  2E75 B;  1FJK A;  1A02 F;  2N1T D;  2B89 A;  3V4Q A;  4H0L B;  3IF4 A;  2P7J A;  3B5N C;  3CCE P;  2QRX A;  3VMZ A;  2Y9Y A;  1HVV A;  2Q6Q A;  3TGU E;  5KLV E;  3D6Z A;  1OXZ A;  1R5S A;  1NTZ G;  2HYN A;  2H88 C;  1NYH A;  1OVR A;  3WUU A;  2IYO A;  2YO2 A;  1OW6 A;  3VP9 A;  2NRG A;  1H89 A;  1RF0 C;  3GLM A;  4GIF A;  2YIU B;  2NZ2 A;  3JSV C;  3E7K A;  2OYI B;  2QJK C;  3CC4 P;  3H1L D;  1PP9 E;  5CCH C;  3CX5 D;  2KP8 A;  2YO3 A;  3S1K A;  1MKM A;  3H1H D;  1JY3 N;  5AVT B;  2GUV A;  5APV A;  2N1T B;  1FZC C;  5L8R J;  1KQF B;  2PRR A;  3M9H A;  1JOC A;  1T3U A;  2QM7 A;  1PPJ E;  1GL2 B;  2WVR A;  3MD0 A;  2QJP C;  2AXT H;  2CPS A;  1J1E B;  3D70 A;  3FXE A;  2N9B A;  5B66 E;  1VQP P;  1JEK A;  4H44 C;  1M8O B;  3A0B H;  1G2C A;  5APY A;  3H1J E;  5GTH E;  1R5L A;  1NAF A;  3CCL P;  5AVV B;  1HH0 A;  3OA7 A;  2E74 B;  4RJT A;  1FZE A;  1KIL A;  1LJ2 A;  2ZYA A;  2NPS D;  5AW2 B;  2JJL A;  1AFO A;  5M1B A;  1LWU C;  1NTM E;  4YXW H;  3AE3 C;  2HPC A;  5KLV J;  4Y28 J;  3CCQ P;  1RQV A;  2FXM A;  4IFF A;  1SFC B;  5B5E E;  3O6Q A;  3M0D A;  4TLF A;  1NHL A;  3AE9 C;  1JMM A;  1IFD A;  1AA0 A;  2POH A;  1NAY A;  2IZ0 A;  1HGV A;  3CX5 E;  2XU6 A;  2BCC D;  4WBA A;  2Q9I A;  1NTK D;  3HE5 A;  1Q86 Q;  1JCC A;  1SQB D;  3H1H E;  1AJY A;  1RQU A;  4DZO A;  1JY2 P;  3L75 D;  4DOJ A;  4BXL A;  1NU1 K;  2WZ7 A;  3IR9 A;  2XZR A;  1FZA A;  4H13 C;  1VQN P;  4U3F J;  1RE4 C;  2JKV A;  1NWQ A;  2IDB A;  5AW6 B;  3L73 J;  4UB6 E;  4XE5 B;  1ZR2 A;  2P58 A;  1VQM P;  1CSB A;  2O01 J;  2FYZ A;  1M1J C;  2V4H A;  5KJ7 C;  1BDD A;  1NTK K;  2XV5 A;  4PV1 C;  3G9R A;  1SQB K;  4XFJ A;  3H1J J;  3SFD C;  5KLI C;  3CI9 A;  3TGU G;  5KLV G;  1SS1 A;  2Q3E A;  5CMZ A;  1K73 Q;  3TYY A;  1FOS E;  3KDP B;  1NTM J;  1NGM B;  5CJ0 A;  2Y9Z A;  3TDK A;  2HG5 D;  1JUN A;  3MP7 B;  1H0T A;  1OWA A;  2KZI A;  3I5C A;  2M3B A;  3RK3 D;  2XKM A;  1L0N J;  1PP9 G;  2BCC E;  1LT9 B;  3RK2 C;  1G1J A;  2E42 A;  3TF5 A;  4L76 A;  2WPV B;  4NPF X;  1SVF A;  1WRG A;  1KV4 A;  2ITA A;  3AE2 C;  3RBZ A;  3H1H J;  5AW5 B;  2Q5U A;  1N7S B;  2WQY C;  4OGQ C;  5H2F E;  1PPJ G;  1MV8 A;  3IAO A;  1DD3 A;  2B87 A;  3G71 P;  3LID A;  3H1J G;  2CK3 H;  3WU2 E;  4AUW A;  2SPZ A;  1IK9 A;  3P8C D;  2KS1 A;  1DEE G;  3EQ2 A;  3NMD A;  3F5H A;  1VDF A;  5GTI H;  2FFD B;  1LNQ A;  1NTM G;  3GHG A;  1PGJ A;  2R32 A;  1JY2 O;  2MKV A;  2D2C C;  2AXC A;  3CME P;  5APX A;  2ZAE B;  1BGY J;  2IBZ I;  3USS A;  1R8E A;  1HUC A;  1JNM A;  4TT3 H;  1URQ D;  4PD4 H;  2BCC J;  4WY4 B;  3H1H G;  4R4M A;  1L0L D;  3L74 D;  1GW3 A;  2G3A A;  1PIX A;  3AEC C;  2FKW B;  3L72 E;  1Q82 Q;  1S1C X;  3I56 P;  1T3J A;  1KIL C;  2RKL A;  4KT0 J;  5AW0 B;  3AE5 C;  2NPS A;  4RES B;  5AW1 B;  1M7L A;  2XDJ A;  1ZW0 A;  3KXD A;  2RMZ A;  3EFF K;  5AW8 B;  5TJH A;  2UWJ E;  3NTN A;  3M0D C;  3RL0 B;  1L4A B;  5E79 H;  1CW5 A;  3P8C E;  1J2J B;  3PTZ A;  5KAF H;  4KHX A;  1YQ4 C;  1LTG C;  4C7N A;  2WSF J;  2P2U A;  4UB8 E;  1YIT P;  4GOF A;  2R5D A;  3CWB J;  1SQX J;  4BRY B;  1N73 A;  1YJW P;  3VOP A;  1N86 A;  2QG4 A;  1FS0 E;  3AE6 C;  1P84 H;  3EFG A;  2ZFC A;  1U7J A;  3L70 D;  4O9B A;  1LTJ C;  2KXP B;  2BCC G;  2C0W A;  1AQT A;  1BSH A;  2FYN C;  1GZL A;  3S4R A;  4U7J A;  1L0L E;  3LW5 J;  3SFE C;  2KNC B;  1M56 D;  3L74 E;  1QEX A;  1EXI A;  3KQG A;  5AVY B;  3L72 J;  2YMK A;  3HE4 A;  1DH3 A;  1K9M Q;  1K04 A;  3R2P A;  1ZN5 A;  3AED C;  1BE3 D;  3K5B A;  2RH0 A;  4PJ0 H;  1VF5 D;  1IFJ A;  4XA4 A;  2JWD A;  1MZ9 A;  2E75 D;  5CHX A;  3HD7 D;  2WSC J;  1QVF O;  1RF1 A;  1IFM A;  3V2P A;  4EYY Q;  2P67 A;  3D6Y A;  2LKM A;  3BAS A;  3H6P A;  3T97 A;  4N6J A;  5BU8 B;  1S5L H;  1KQL A;  4YPC A;  1MFZ A;  4U3F D;  5APQ A;  3L70 E;  3G4S P;  3EWK A;  1J1D C;  4MN4 C;  4D6T D;  1LTI C;  3L73 D;  3L71 E;  2W83 C;  2E76 C;  3TSI A;  1KC8 Q;  4PD4 I;  1YJ9 P;  2K37 A;  1IO4 A;  3AE1 C;  4Y99 C;  4IFD K;  1XTG B;  1LTJ B;  1RHZ B;  1Y47 A;  2FY8 A;  1L0L J;  3H1J D;  3HD7 B;  3L74 J;  3L72 G;  2J5U A;  4OH8 B;  1UII A;  4JPZ B;  3M06 A;  1M90 Q;  1KYO H;  4KJM A;  1EZV I;  1FJP A;  1YQ3 C;  1GL2 D;  2OTJ P;  1BE3 E;  3CCU P;  3GHG C;  1NTM D;  1BCC J;  1LP1 A;  4GOD A;  4JQ0 D;  1X9V A;  2IBZ E;  4B86 A;  2WT7 A;  2ZVO B;  3HUS B;  1YHQ P;  3ZDM A;  4ASW A;  1KTM A;  1L0N D;  2E74 D;  3C1L A;  1LT1 A;  1HTL C;  1OFC X;  2QJY C;  1FOS F;  2C9N Y;  3AE7 C;  1H88 A;  1URQ A;  4EDF A;  1X8Y A;  3PRJ A;  1YIJ P;  1T2K C;  1KQS O;  3B5N D;  1SFC D;  2Y0D A;  4U3F E;  1NTM K;  1P84 I;  1IFI A;  3HTK A;  4D6T E;  2M8R A;  3L73 E;  3Q5S A;  2R44 A;  1VQ5 P;  3L70 J;  3V5B A;  1FC2 C;  3V2R A;  1L0N K;  2NPS C;  3L71 J;  1L0L G;  3L74 G;  2KK7 A;  2H89 C;  1QVG O;  2H7H A;  5CJ4 A;  3GF3 A;  5CCH D;  3OAK A;  4GOE A;  1U7M A;  2VRS A;  2OYH C;  3M91 A;  3SWY A;  2OTK E;  4QMA A;  1VQO P;  3SWK A;  3BCC E;  2QIW A;  3CXH D;  4A7P A;  3MTU E;  5K5G B;  3B4S A;  3A0H H;  3B5N B;  2A45 H;  1N73 C;  1USE A;  1BE3 J;  2FYU D;  3CPW O;  5CBN A;  3SSU A;  1L0N E;  1BGY D;  5AW9 B;  3ITK A;  5BU5 A;  3BAT A;  2K9J A;  3Q1M A;  1FBM A;  3OJA B;  4H44 D;  3MUD A;  1N8R Q;  1EXJ A;  3BVH A;  1NO4 A;  2QJK B;  1CZQ A;  1QL1 A;  3VTP C;  3CCJ P;  1ZP0 C;  3H32 A;  2GA1 A;  3L70 G;  2YNY A;  2ZXX A;  1NKN A;  3L71 G;  4N3Y B;  1FZC B;  4D6T J;  3CCV P;  2KUB A;  2W6B A;  1JY2 N;  5GTI E;  3H25 A;  2YXQ B;  2HR3 A;  4GDO A;  4I7Z C;  2C0X A;  4OVN F;  1Q90 D;  2QJP B;  3W67 A;  1N7S D;  1CI6 B;  2KSE A;  1KFN A;  1JTH B;  2W6A A;  1KYO I;  1WMK A;  4H44 B;  3RK3 C;  1RF1 C;  2M3E A;  2V7Q J;  3CXH E;  2H43 A;  2ZVN B;  1BE3 G;  1SQX D;  3BRT B;  3CWB D;  1LTS C;  2OYH B;  1P84 D;  3BCC J;  2N9Y B;  4H13 D;  2FYU E;  1FDI A;  2R5B A;  3W68 A;  2IBZ G;  5B66 H;  2YKO A;  1FE6 A;  1Q2N A;  1LWU B;  4IL6 H;  1BGY E;  2AEJ A;  5GTH H;  2OYI A;  1ZLL A;  1PGO A;  5KJ7 D;  1TU3 F;  3MZW B;  1IFN A;  2XNX A;  1N2D C;  2KYV A;  1VPC A;  1KB9 H;  1QX8 A;  2W90 A;  3Q5P A;  1SQX K;  4U3F G;  1EZV E;  2K88 A;  2YKQ A;  2N1T A;  1RE3 A;  5B5E H;  1XTC C;  4DJG A;  3L72 D;  4D6T G;  3L73 G;  1PL5 A;  1IFP A;  1EDI A;  2KI7 B;  2B9B A;  1YBK A;  1GL2 A;  3CX5 H;  4EI2 A;  3VP8 A;  4H13 B;  4WY4 D;  2HOD B;  1FAV A;  2KLU A;  1FZB A;  3AEG C;  2M5A B;  1JMB A;  1PZQ A;  3V2Q A;  2Z4E A;  4W7Y A;  2LR2 A;  5AVU B;  2QE7 H;  5KKZ C;  1A02 J;  1M1J B;  3V4W A;  4R4L A;  4W7Z A;  1BSN A;  4PV1 B;  3BCC G;  3CWB E;  1SQX E;  5AVZ B;  4C46 A;  1P84 E;  5C39 A;  3FXD A;  2A45 I;  1S4X A;  4EIJ A;  5KLI B;  1KN7 A;  2HFE D;  3RBX A;  1SFC A;  1L0N G;  4ZMD A;  4M3L A;  2FYU J;  4C7R A;  3RL0 D;  1L4A D;  4HB1 A;  1S3J A;  4W80 A;  3QH9 A;  2JO1 A;  2IYP A;  1GD2 E;  1IZN B;  1JCD A;  3L37 A;  1JM0 A;  1EDJ A;  3CD6 P;  1OW8 A;  1NJI Q;  3PJS K;  1ZXG A;  1EDL A;  3H1K E;  3RK2 B;  3GW6 A;  1KOR A;  2H8P D;  3A7O A;  4JYC A;  2D2C D;  5AVW B;  2QEX P;  1YI2 P;  1BCC D;  1NH4 A;  1FU1 A;  1Y8A A;  1L2P A;  4OGQ B;  4LLH A;  4OWF A;  2KLV A;  3BRV B;  3NFQ A;  5AVX B;  2G8Y A;  3CLQ A;  4HH2 A;  1ZRT D;  1W5C E;  1L0L K;  2P10 A;  2WMM A;  2XND H;  3L36 A;  3L4F A;  1NKZ B;  3S9O A;  3MUD C;  4ZKP A;  4ZKU A;  3HRN A;  2HLO A;  2QM8 A;  2MJZ A;  2FYU G;  3KHU A;  3M9B A;  2ZT9 C;  1BGY G;  3CMA P;  3H1I D;  3WU2 H;  2D2C B;  2PGD A;  1SQQ J;  3L71 D;  1QL2 A;  4RO0 A;  1LT9 A;  5TIS H;  1OVU A;  1KB9 I;  3AEA C;  3UIA A;  3MIW A;  2QA4 P;  4YTP C;  1IK7 A;  1KYO E;  3N4X A;  3A5T A;  1K8A Q;  1VF5 C;  1ZOY C;  1EZV G;  3FX0 A;  1USD A;  1EQ7 A;  3H1K J;  1N7S A;  1EC5 A;  4H0L C;  3C8V A;  1BCC E;  1G2C B;  5AVQ B;  4GKG A;  1KQG B;  3NXS A;  3CX5 I;  2E5Y A;  2K3R A;  3LW5 H;  5AW4 B;  3CC7 P;  2WSE H;  1KIL B;  5BVZ A;  1HF9 A;  5AW3 B;  5AVR B;  2KSJ A;  3P8M C;  4LGD E;  1ZRT E;  2IBZ D;  2YIU C;  3U59 A;  2WIT A;  2HPC B;  4ASV A;  2OYI C;  1VQL P;  3O6Q B;  1VQ7 P;  3AEF C;  3CWB G;  1SQX G;  2FFD A;  2QSI A;  5DJU B;  1NTZ J;  3E1R A;  2O3J A;  1KIL E;  2Y0C A;  5CCG D;  1IC2 A;  3WUT A;  2IPP A;  1S9K E;  2RN0 A;  1GTW A;  2AXT E;  2N1T C;  3H1I E;  3HE5 B;  3VMA A;  1VQ9 P;  1FDM A;  2WSC H;  1GDT A;  2W27 A;  3A0B E;  2OTL P;  2WPS A;  1SQP D;  2J59 M;  1GL2 C;  3O8Z A;  3AE4 C;  4WY4 A;  1S72 P;  4LC1 A;  3Q3D A;  3H1K G;  3U1A A;  2FYN B;  3CCS P;  1QGK B;  3A0H E;  2E74 C;  2OQQ A;  2I8D A;  1N7L A;  3A2A A;  1OVV A;  2KOG A;  3BCC D;  2IX7 C;  1GW4 A;  2AEM A;  1AV1 A;  3F89 A;  1GK6 A;  3E1I A;  1SQP K;  1YYC A;  3B71 A;  2E76 D;  2L5G B;  1SFC C;  5KAI H;  3JCU H;  3AE8 C;  1L4A A;  1ZME C;  3JC2 2;  3P7K A;  1KB9 D;  3M9Q A;  3OW2 O;  1JB0 J;  1JY3 P;  2I1J A;  1SQV E;  1H0T B;  3KZI H;  2C9L Y;  1KMI Z;  1ZV8 A;  2O1J A;  4BRY A;  4DT0 A;  2Z5H A;  3A3Y B;  1RH5 B;  2WTY A;  4GT1 A;  1FZF A;  4N78 D;  1SQP E;  2YMY A;  3H1I J;  3VMX A;  2WPQ A;  4Z1M H;  4DCK A;  3TNU A;  3L35 A;  2Z5I A;  2YKP A;  3IN6 A;  4JYB A;  1DEB A;  1J1D B;  4L73 A;  1WT6 A;  3WUV A;  2KNC A;  1MUU A;  2E76 B;  4HKZ H;  5DJT B;  1S2E A;  2ZXE B;  5APW A;  4Y99 B;  3Q5R A;  4WWI A;  2B87 B;  2P1J A;  1T2K D;  1BCC G;  4IL6 E;  3LIE A;  2K1A A;  1HJB A;  2E5T A;  3II6 A;  2LXB A;  2KS1 B;  5APU A;  3VYI A;  1X0T A;  1PFI A;  2Q3I A;  3KYQ A;  3GHG B;  4PD4 D;  1KB9 E;  1NU1 D;  3TGU J;  1Q7Y Q;  1VQ8 P;  3RL0 g;  2JDI H;  1LT9 C;  3WMM 0;  1AQ5 A;  4HJG H;  1VQ6 P;  3H1L E;  1SQV J;  4K35 A;  2QJY B;  1EZV D;  3H1I G;  4N78 E;  3U1C A;  3RGU A;  2FYU K;  3P32 A;  1N7S C;  1PP9 J;  1H8A A;  1AVY A;  3VN0 A;  3V6I A;  1OW7 A;  1SQP J;  2JWA A;  1X22 A;  1Z56 A;  5CBO A;  2KB7 P;  2A06 D;  2BEZ F;  2Q7C A;  3CCM P;  1FZG A;  2JR8 A;  1LTJ A;  1NVO A;  2NPS B;  3HD7 A;  2A45 G;  1JY3 O;  2FXP A;  1EDK A;  3PHL A;  3QWO C;  1S5L X;  2FFD C;  2W8Z A;  4L75 A;  2O01 H;  1HGZ A;  1MFT A;  5CCG A;  3ABV C;  2GM4 A;  4PD4 E;  3HUS A;  2B88 A;  1SQQ D;  4C7N B;  1NU1 E;  3PH0 A;  1OIP A;  2QVA A;  2V7Q H;  1N73 B;  1M1K Q;  4YXD C;  4PV1 D;  2O01 N;  1SQV G;  1K05 A;  2WWW A;  2BEQ D;  4WY4 C;  4BWN A;  2OYO A;  2WSS H;  3TK1 A;  2DW3 A;  2YXR B;  3H1K D;  1X79 B;  1NTK E;  3R4Y A;  2ZJS E;  3H1L J;  4AQR D;  1VQ4 P;  1SQB E;  1T8Z A;  4RKU J;  3GMA A;  1SQP G;  2ZYD A;  2OAR A;  1PV3 A;  3L75 E;  5E79 E;  1SQQ K;  3I55 P;  2A06 E;  3CL3 D;  5KAF E;  2Q1K A;  5AW7 B;  3HE4 B;  3RK2 D;  2R3S A;  3RL0 C;  3CCR P;  1L4A C;  1LGH B;  3FGA D;  3MGN A;  1DIP A;  1SP4 A;  1Y9B A;  1HBW A;  1NTZ D;  2PFX A;  2KIK A;  1LTB C;  4I7Z B;  3CC2 P;  4I2L C;  1URQ C;  1W2B O;  4UB6 H;  4OGQ D;  5APS A;  1LTT C;  3RK3 B;  1RF1 B;  3B5N A;  2GUS A;  5TIS E;  1G1I A;  4NPE A;  1SQQ E;  1U57 A;  1LTA C;  4EOT A;  2I1K A;  3T97 B;  3MHV A;  1NOH A;  1KFM A;  1NU1 J;  1DD4 A;  2L91 A;  5AVS B;  1RF0 A;  3CXH H;  4WB4 A;  1NTZ K;  1VL2 A;  3RK3 E;  3H1L G;  4ZNC A;  1KYO D;  5CCH A;  3IFM A;  2OGU A;  4PJ0 E;  5EFW B;  1BDC A;  4JF7 A;  1GU5 A;  1NTK J;  3G3Z A;  1SQB J;  2IFM A;  1PGQ A;  1FZC A;  1GU4 A;  4I6M C;  2WPR A;  3L75 J;  5APT A;  3FWN A;  3AEE C;  1PGP A;  2M0B A;  3SWF A;  1Q81 Q;  1CI6 A;  1S5L E;  1RY3 A;  1NTZ E;  1YTZ I;  1JTH A;  1D7M A;  1LP1 B;  5H2F H;  2WT7 B;  2O1K A;  1FDO A;  1QLE D;  5KKZ B;  2E43 A;  2CPB A;  2OYH A;  1KIL D;  1JO5 A;  1GMJ A;  1AVO A;  1S9K D;  2IFN A;  1E79 H;  1LWU A;  3VMY A;  1IJD B;  1URQ B;  1NU1 G;  3D71 A;  4AYC A;  3N7N A;  3B8E B;  4NPD A;  2WSF H;  1T6A A;  1UIX A;  2K9Y A;  3HTK B;  2J58 A;  3PLN A;  3M0A A;  2PAJ A;  3C9I A;  1NTK G;  3TNU B;  2ZYG A;  2E75 C;  1OZH A;  1SQB G;  3HD7 C;  1YTZ T;  2LXC B;  2WSE J;  3L75 G;  3GF7 A;  5KAI E;  1OMI A;  2ZT9 D;  3JCU E; 
#chains in the Genus database with same CATH homology
 1BGY G;  4D6T G;  1BE3 G;  3H1H G;  3CWB G;  1SQX G;  2A06 G;  1P84 H;  3L73 G;  1BCC G;  3CXH H;  1L0L G;  1EZV G;  3H1I G;  1PPJ G;  1SQP G;  3L70 G;  1L0N G;  1NU1 G;  1KYO H;  3L74 G;  2BCC G;  1NTK G;  1SQV G;  3H1L G;  2IBZ G;  3CX5 H;  3L71 G;  1SQB G;  3BCC G;  1KB9 H;  1NTZ G;  1NTM G;  2FYU G;  3TGU G;  4U3F G;  5KLV G;  3H1J G;  3H1K G;  1SQQ G;  3L75 G;  1PP9 G;  4PD4 H;  3L72 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...