1BGYG

Cytochrome bc1 complex from bovine
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYENDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
total genus 22
structure length 81
sequence length 81
chains with identical sequence S
ec nomenclature
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1bgyG00
1EZVG 1SQQG 1NTKG 1BE3G 1NTZG 1SQPG 1SQXG 2FYUG 3L71G 1P84H 3BCCG 3CX5H 3H1IG 1BGYG 1KYOH 3L72G 1KB9H 3CXHH 3H1HG 3L70G 2IBZG 5KLVG 1NTMG 3H1KG 3TGUG 1L0NG 1PPJG 3CWBG 4D6TG 3L73G 1PP9G 4PD4H 3H1LG 2A06G 3L75G 2BCCG 3H1JG 3L74G 1SQVG 1L0LG 4U3FG 1SQBG 1BCCG 1NU1G
chains in the Genus database with same CATH superfamily
1OZHA 2V4HA 1HTLC 3GF7A 3L70D 1OW7A 2KZIA 1GL2C 3OA7A 4Y99C 3PLNA 3M0DC 4D6TD 1Y8AA 3H1LD 3BASA 3RK2B 4I1LA 5AVSB 1K04A 1KILE 5AVRB 1S72P 2YXQB 1QL2A 5AVYB 5DJUB 1NO4A 3KZIE 1AVYA 2QEXP 3CX5I 1FZCC 3Q5RA 3B5ND 1JY2O 1LT1A 1RHZB 4C7NB 3B71A 3RBXA 3P7KA 4PD4H 3Q1MA 2YO2A 4AUWA 2QJKB 4H13C 5KKZC 1QVFO 4I6MC 1VQNP 2N1TC 3TGUD 1SQQE 1GL2B 1PP9J 5AW4B 3CXHD 3H25A 3V2RA 2KNCB 1SQPD 1SQQG 2WSFJ 2QRXA 4C46A 1KILC 3AE8C 1EXJA 4RESB 4L74A 3AEGC 2E76C 3SWFA 5H2FH 2O01N 4JBZA 1FZCB 3MUDC 1URQD 1SQBD 1JB0J 3GHGC 4GOFA 4DOJA 2C9NY 1VDFA 3L73E 1ZRTE 5KKZB 5CHXA 1IFIA 2QJYC 3L73G 3CCSP 1VPCA 1NKNA 4UB8E 1G1JA 3RGUA 1BDDA 3HTKA 4WY4A 2YXRB 1DEBA 1NAYA 5KLVD 1Q81Q 4IFDK 3CCLP 1SQVE 1P84D 2WTYA 2E76B 1N7LA 2ZYGA 3H1JJ 3I56P 4R4LA 1OVRA 2O3JA 1USEA 2ITAA 2WWWA 4EI2A 3CX5H 3AE7C 5CCHC 2RH0A 1ZXGA 3GHGB 3TSIA 2XZRA 1PIXA 2O1KA 3AEDC 1KYOI 1USDA 1ZV8A 2BCCD 3MD0A 4ASWA 1NYHA 1EDIA 1LP1A 2AXCA 1NU1J 2WPSA 2POHA 3FWLA 2FYUD 1PV3A 1LTIC 2P10A 2M3BA 4H44C 1AQTA 1YQ3C 4OGQC 5TISH 2KIKA 3LW5J 2OTKE 1IFNA 5CBOA 1NTME 1OIPA 2JO1A 3M0DA 2KNCA 3Q3DA 3GLMA 3AE3C 1NTMG 3L37A 3BCCE 2A06G 2J59M 3P8MC 2QJPC 5AW7B 1FZCA 3HUSC 2E43A 1SQVK 3BCCG 4WB4A 2IBZD 2Z5HA 2I8DA 1N7SC 3JC22 4NPEA 4H44B 4OGQB 2N1TA 2V7QH 1L0LJ 2YKPA 2M0BA 3A0BE 5AW8B 2E42A 4TLFA 4U7JA 4LGDE 1R5LA 1BE3E 1VQLP 1KILA 2ZXXA 1VQ4P 3SFEC 4AQRD 1NJIQ 1LT9A 5GTIE 2NPSD 2ZVNB 1BE3G 3CWBE 2PRRA 3NTNA 2QJPB 1IFJA 2RKLA 3HD7D 1E79H 1KYOH 5AVQB 2Q3EA 2HLOA 3PJSK 3V2PA 1JY3O 1X9VA 2K9JA 4Y28J 3CWBG 3L71E 1YTZI 1BGYE 2P58A 1N7SB 2PFXA 3E1IA 1S5LX 4D6TE 3L71G 1BGYG 4YTPC 1OVUA 1OWAA 1VQMP 4IFFA 1FJPA 4D6TG 2Y0EA 2LXCB 2W6BA 4PD4E 1A02F 1EC5A 3BRVB 3L75E 2OYHB 1HF9A 4K35A 3JCUH 1KD1Q 2KSEA 3H1KJ 2GM4A 2WSCH 5CCHA 3PH0A 1PFIA 1VQ6P 2C0WA 1X79B 3L75G 2WT7B 1J1DC 3V6IA 2OTJP 3SSUA 1RF1B 1RQVA 5H2FE 1LWUC 1FDMA 3V2QA 3R2PA 2HYNA 2R5BA 3ZDMA 1YJWP 1X0TA 2IFMA 2K9YA 2KLVA 1PZQA 3B5NC 2KK7A 3G9RA 3USSA 1U7JA 1EZVE 1IZNB 1T8ZA 3C8VA 3AEBC 4HKZH 1GMJA 1PGQA 1FC2C 4L75A 4U3FD 3M9BA 1SQBG 1EZVG 5CBNA 3PTZA 1J1DB 1YHQP 1HWTC 1ZR4A 1ZW0A 5CJ4A 2Y9YA 3MHVA 3HUSA 3EFGA 1HUCA 2I1JA 1LWUB 1SQVJ 5AW1B 1EDKA 2SPZA 1GW4A 1NTKD 2WZ7A 3CX5E 1YIJP 5AVWB 1N7SA 1FDOA 3L35A 1YI2P 2M5AB 3CMEP 1SQXE 3B5NB 1KB9I 4ASVA 3AE2C 3KYQA 2R5DA 1DEEG 1NGMB 3NMDA 1SQXG 3SWKA 3RBZA 3V5BA 2WSEJ 4IOIH 3P32A 3AE1C 5TISE 2P67A 1NTZE 1GU4A 4JYCA 4W80A 3WUTA 3B4SA 4IL6H 1L4AA 2D2CC 5KAFH 1UIXA 3AEAC 1NTZG 3K5BA 4N78E 1FZFA 2FYZA 1EDLA 2IZ1A 5C39A 4GT1A 3H6PA 3H1IE 2RMZA 3CXHI 5CCGC 3E1RA 4YXWH 3CC2P 3IF4A 3A0HH 3H1IG 4L73A 1RF0A 1RE3C 2Y0CA 3FX0A 2WQYC 2P1JA 2OTLP 3N7NA 1QLED 1WMKA 3WMM0 3H1HE 2ZT9D 1SVFA 1JMMA 5AVTB 1M57D 2GUSA 2QE7H 1X22A 1K8AQ 1QX8A 1LNQA 1SQXK 2E5YA 1S9KD 3H1HG 3L74E 4HB1A 5APYA 5L8RJ 2MJZA 2CPSA 1KB9D 1N2DC 2QM8A 4QMAA 1SS1A 3L74G 1KTMA 3IR9A 2H89C 1L0NE 2Z4EA 1BE3J 2PAJA 1LWUA 3AE6C 4GODA 1FE6A 2A45I 1KYOE 1NTZK 4RJTA 1H0TB 1KB9H 4IFMA 2W90A 3S9OA 4N6JA 1L0NG 3AE5C 1GD2E 1P84I 1PP9D 1EXIA 3R4YA 1Q2NA 3BRTB 3B5NA 2HODB 2MKVA 1QVGO 3W67A 3QH9A 3L71J 3I55P 1L0LK 1BGYJ 3PHLA 3AECC 1JY2N 1ZMEC 1BCCE 3VOPA 3MTUE 1JY2P 1DD3A 3V4QA 3TYYA 1BCCG 1JCCA 2ZYDA 3H32A 2NZ2A 2E74D 1LTAC 1AV1A 3JCUE 3CXHH 2B87B 2XDJA 3L75J 2NPSC 1M1JC 1H8AA 1U57A 2KLUA 3HD7C 3P8CE 3D6YA 2K88A 1S3JA 1JCDA 1BSHA 1LJ2A 1RY3A 4K3AA 2HPCA 2BEQD 2FYNC 1L0NK 1RE4C 1S2EA 2KSJA 2C0XA 3H1JD 2FXMA 4UB6H 1X8YA 3LIDA 1MKMA 2FFDC 3HE5B 2OYIC 2Q5UA 4C7RA 2XKMA 2O1JA 1LTTC 1MFZA 2WMMA 5APUA 1J1EC 1DD4A 2IBZI 4DJGA 4ZMDA 1JOCA 1PPJD 1NKZB 1M8OB 2A45H 3F89A 4WY4D 1NU1D 3N4XA 2NPSB 2LR2A 4DT0A 1M1JB 1M1KQ 2R32A 2N9BA 1J2JB 3CCQP 1P84H 1JO5A 3HD7B 5CMZA 1SQQK 1NAFA 5CCGA 3ABVC 4YPCA 3RK2D 2Q7CA 1ZLLA 3S1KA 1M90Q 1RE3A 2JJLA 2FYNB 1GW3A 4C7NA 1FU1A 2FFDB 2OYIB 1JTHB 3LW5H 5APSA 1J1EB 5APQA 3GW6A 3M06A 3VYIA 1GL2A 1ZOYC 1SQXJ 2E75D 1EQ7A 5E79H 3LIEA 3D6ZA 4KT0J 5B5EH 2A06E 3MZWB 2KXPB 5KJ7D 2ZVOB 2KYVA 4IL6E 5KAFE 3L72E 1SFCC 2J5UA 2B87A 3TF5A 1L0LD 3QWOC 1NTZJ 1IO4A 2QG4A 3L72G 4ZNCA 3KPEA 1IFPA 2E5TA 1HGZA 1GK4A 3RK3D 5AW6B 1Q86Q 1M56D 1SLQA 2Q6QA 1KC8Q 3A0HE 4R4MA 1KN7A 3H1IJ 1GK6A 4H13D 2IZ0A 2ZFCA 2KZJA 2VRSA 2N1TD 5AVUB 3HRNA 1FJKA 3CCMP 1LTBC 2IFNA 1SFCB 2OYHC 1KFMA 2OARA 1T6AA 2NPSA 1KILD 3MUDA 1M1JA 1LTJC 5BU8B 4HH2A 3G3ZA 3GHGA 3HD7A 2W6AA 1NTMK 5DJTB 2K3RA 3L74J 3L70E 1IK7A 1NVOA 1KQSO 2CPBA 3AEFC 1RF1C 1RE4A 4JPZB 3H1LE 1KB9E 1FOSE 3L70G 1T2KC 3H1KD 1L0NJ 2OYIA 3V4WA 3MP7B 3MGNA 3H1LG 1N73C 4GKGA 5B66H 4NPDA 1YQ4C 5AVZB 1SQQD 4GDOA 1S5LH 2OQQA 2WSSH 1W2EA 1AA0A 1HJ0A 3HE4B 2ZXEB 3A5TA 3BVHA 2FXPA 1IK9A 1LTJB 1OXZA 2ZT9C 2LKMA 2XNDH 4AYCA 1BCCJ 3TGUE 1W2BO 1SQQJ 1OFCX 3KQGA 1IC2A 1T3JA 3CXHE 1VQ9P 1SP4A 5K5GB 3TGUG 1W5CE 1XTCC 2HR3A 2YIUC 3L73D 1CI6B 1SQPE 1ZRTD 4WVZA 2KP8A 3M9HA 3OAKA 3VMXA 3FGAD 3VMAA 2WSCJ 4HJGH 1N73B 5KAIH 4LC1A 3SFDC 1SQPG 3G71P 2PGDA 1FZGA 1G2CB 4PJ0H 1SQBE 2JKVA 2YNYA 2FXOA 3OJAB 3L73J 1EDJA 3FWNA 4UB6E 3D71A 1OX3A 2ZT9B 1SQVD 3FXDA 1Q7YQ 1E5WA 2GA1A 2J58A 2R3CA 1SFCA 3CCRP 3U1AA 3EQ2A 4I7ZB 5BU5A 2YIUB 4YXDC 4EDFA 5KLVE 2XV5A 2LXBA 3V2NA 3AEEC 1P84E 3MIWA 1ZN5A 1KMIZ 3A2AA 2A45G 5APVA 2H43A 1WT6A 5KLVG 1URQC 4H0LD 1KQLA 2R3SA 3GF3A 2JDIH 1LGHB 1H89A 1FAVA 5KLIB 4OWFA 2L91A 1SQPK 3VP9A 2BCCE 3EWKA 2YMKA 4HYTB 1A02J 2FYUE 2OYHA 1AJYA 2QM7A 1OVVA 2BCCG 3GG2A 3D70A 5E79E 3E7KA 2FYUG 3SWYA 1YYCA 2E74B 1SQBK 5B5EE 1L4AD 2WT7A 1AVOA 2O01H 1NTMJ 2H88C 2C9LY 4EYYQ 1NWQA 1WRGA 3TNUB 3L4FA 1RF1A 2B88A 4WY4C 1PL5A 1QL1A 1URQB 3M0AA 4EOTA 1KQGB 3G6EP 1FS0E 2Q3IA 3BCCJ 3L72J 2RN0A 3M91A 1N73A 4JF7A 2FY8A 1GZLA 3NXSA 5KLVK 1VF5D 3NFQA 1G2CA 4ZKUA 4RKUJ 2R44A 1OW6A 2IBZE 2ZJSE 1BE3D 3RK3E 3WU2H 3RL0D 3A3YB 1JEKA 3PP5A 5AW3B 1UIIA 2IBZG 4XFJA 3CWBD 1Q82Q 1HH0A 3U59A 5BVZA 1NH4A 2M8RA 3C9IA 2Z5IA 3HTKB 4WY4B 2G3AA 5EFWB 1KORA 1Q90D 3L71D 1LTGC 3T97B 1BGYD 1YJ9P 5KJ7C 2FYUK 4TT3H 3VMYA 3FXEA 1PGOA 3VTPC 4PV1D 1NHLA 3CWBJ 2K1AA 2M3EA 1JUNA 2M5AA 4JYBA 1K73Q 2XNXA 4PD4D 2W8ZA 4N3YB 3O6QB 3RK3C 3L70J 4M3LA 3CC7P 2Y9ZA 1LP1B 2Q9IA 3Q5PA 1G1IA 1QEXA 2HFED 2WSFH 4D6TJ 1GU5A 3L75D 3H1LJ 1OMIA 5B66E 2JP3A 3H1KE 1S5LE 2YKOA 2E75B 1DX7A 2JWDA 4NPFX 4L76A 2B89A 3B8EB 3H1KG 4Y99B 1CW5A 1FZEA 5APXA 5AW2B 4MN4C 3TNUA 1ZP0C 2AEFA 1H88A 1YTZT 1URQA 3A7OA 3C1LA 4ZKPA 1LT9C 3TGUJ 3RK3B 3EFFK 1Y47A 4GOEA 3CMAP 1HJBA 1EZVD 5KAIE 2IX7C 4OVNF 2IPPA 1SQPJ 3CLQA 4H13B 1CSBA 1VQ7P 1Y9BA 4PJ0E 2N1TB 2BASA 5GTHH 5KTBA 3L36A 1VQKP 1RH5B 3WUVA 1MV8A 2Y0DA 2D2CD 5AW0B 1DIPA 1SQBJ 2IDBA 3G4SP 2IYOA 3Q2YA 1BDCA 1KILB 3CX5D 3T97A 4U3FE 2NRGA 4BWNA 1IFDA 1LT9B 1IJDB 1H0TA 3II6A 2QA4P 2AEJA 4WBAA 2K37A 5CCGD 1KFNA 1SQVG 4U3FG 2BEZF 1SQXD 4CPGA 2KB7P 2K9JB 1GTWA 2HODA 5KLVJ 1VQOP 1NTKE 4KJMA 2QJYB 3O6QA 1YJNP 2GUVA 1NTZD 1NTKG 4GIFA 1M7LA 1JMBA 3CCEP 3TK1A 1KZUB 1GL2D 4N78D 3IAOA 2BCCJ 5KJ7A 1R8EA 1YITP 1S4XA 3H1ID 1MUUA 2FYUJ 4BRYB 1K05A 2WPVB 2I1KA 5CJ0A 2UWJE 5AVXB 3VP8A 1K9MQ 1RQUA 2YKQA 1D7MA 2YO3A 3S4RA 3H1HD 2WPQA 3HE5A 1PGPA 3OW2O 1JNMA 2AXTH 2ZYAA 4H0LC 4A7PA 1AFOA 2KS1B 2KUBA 3L74D 1KV4A 3WU2E 1PGJA 1NTKK 3I5CA 2V7QJ 3H1HJ 3F5HA 3VMZA 1L0ND 1L2PA 1KYOD 2E76D 1S9KE 2G8YA 1L4AC 1OW8A 2W27A 2L5GB 3HUSB 1JY3N 3KZIH 3VN0A 2FFDA 1JTHA 1JY3P 1TU3F 3GMAA 2JWAA 1VQPP 4DZOA 4H0LB 3CC4P 1BCCD 2XU6A 1PP9E 1MFTA 3IFMA 3Q5SA 1VF5C 4XA4A 2Q1KA 1R5SA 2JEEA 1RF0C 1PP9G 3O8ZA 3RL0C 2WVRA 5M1BA 1GDTA 1NOHA 4O9BA 5CCHD 2DW3A 1L4AB 1N86A 2JR8A 4BRYA 2P2UA 1Z56A 3P8CD 4I7ZC 2H7HA 2W83C 3UIAA 1T3UA 1S1CX 3CPWO 4W7YA 4I2LC 2YMYA 4OH8B 4RO0A 2W6JH 3U1CA 3KDPB 4PV1C 5AW9B 1VF5B 2PP6A 3KHUA 4H44D 4DCKA 4OGQD 4UB8H 5KLIC 4LLHA 1N8RQ 2KS1A 3RL0B 3M9QA 1CZQA 1DH3A 3H1JE 2FBWC 1MZ9A 3PRJA 5GTHE 3AE4C 2P7JA 3ITKA 3CCVP 4W7ZA 1U7MA 5AVVB 1LTSC 1FZAA 1QGKB 3H1JG 1SFCD 3TDKA 1FBMA 1PPJE 2WPRA 2E74C 4EIJA 3CCUP 2H8PD 3CD6P 2N9YB 5TJHA 3BATA 1AQ5A 1NU1E 1VL2A 2OGUA 5APWA 1YBKA 1PPJG 4PV1B 4B86A 1FDIA 1N7SD 3AE9C 4U3FJ 2KI7B 2WSEH 1NU1G 3CCJP 2CK3H 4Z1MH 1NTMD 4IL6X 3HE4A 2HG5D 5AW5B 2QIWA 2A06D 4WWIA 3RL0g 1FOSF 3JSVC 1LTJA 1NTKJ 3WUUA 4PD4I 1ZR2A 3BCCD 3KXDA 3L72D 1IFMA 2QVAA 4XE5B 3IN6A 1JM0A 2OYOA 3H32B 1XTGB 1CI6A 2ZAEB 1HBWA 4KHXA 4BXLA 1L0LE 3W68A 3RK2C 2FKWB 1T2KD 1FZBA 5APTA 1KQFB 2O01J 1HGVA 1L0LG 3CI9A 1VQ8P 1NU1K 2WITA 2HPCB 3A0BH 2KOGA 2AEMA 2IYPA 2AXTE 1HVVA 2B9BA 2QSIA 2QJKC 4JQ0D 2D2CB 3CL3D 1VQ5P 1EZVI 2E75C 1BSNA 5GTIH
chains in the Genus database with same CATH topology
1EZVG 1SQQG 1NTKG 1BE3G 1NTZG 1SQPG 1SQXG 2FYUG 3L71G 1P84H 3BCCG 3CX5H 3H1IG 1BGYG 1KYOH 3L72G 1KB9H 3CXHH 3H1HG 3L70G 2IBZG 5KLVG 1NTMG 3H1KG 3TGUG 1L0NG 1PPJG 3CWBG 4D6TG 3L73G 1PP9G 4PD4H 3H1LG 2A06G 3L75G 2BCCG 3H1JG 3L74G 1SQVG 1L0LG 4U3FG 1SQBG 1BCCG 1NU1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EZV G;  1SQQ G;  1NTK G;  1BE3 G;  1NTZ G;  1SQP G;  1SQX G;  2FYU G;  3L71 G;  1P84 H;  3BCC G;  3CX5 H;  3H1I G;  1BGY G;  1KYO H;  3L72 G;  1KB9 H;  3CXH H;  3H1H G;  3L70 G;  2IBZ G;  5KLV G;  1NTM G;  3H1K G;  3TGU G;  1L0N G;  1PPJ G;  3CWB G;  4D6T G;  3L73 G;  1PP9 G;  4PD4 H;  3H1L G;  2A06 G;  3L75 G;  2BCC G;  3H1J G;  3L74 G;  1SQV G;  1L0L G;  4U3F G;  1SQB G;  1BCC G;  1NU1 G; 
#chains in the Genus database with same CATH topology
 1OZH A;  2V4H A;  1HTL C;  3GF7 A;  3L70 D;  1OW7 A;  2KZI A;  1GL2 C;  3OA7 A;  4Y99 C;  3PLN A;  3M0D C;  4D6T D;  1Y8A A;  3H1L D;  3BAS A;  3RK2 B;  4I1L A;  5AVS B;  1K04 A;  1KIL E;  5AVR B;  1S72 P;  2YXQ B;  1QL2 A;  5AVY B;  5DJU B;  1NO4 A;  3KZI E;  1AVY A;  2QEX P;  3CX5 I;  1FZC C;  3Q5R A;  3B5N D;  1JY2 O;  1LT1 A;  1RHZ B;  4C7N B;  3B71 A;  3RBX A;  3P7K A;  4PD4 H;  3Q1M A;  2YO2 A;  4AUW A;  2QJK B;  4H13 C;  5KKZ C;  1QVF O;  4I6M C;  1VQN P;  2N1T C;  3TGU D;  1SQQ E;  1GL2 B;  1PP9 J;  5AW4 B;  3CXH D;  3H25 A;  3V2R A;  2KNC B;  1SQP D;  1SQQ G;  2WSF J;  2QRX A;  4C46 A;  1KIL C;  3AE8 C;  1EXJ A;  4RES B;  4L74 A;  3AEG C;  2E76 C;  3SWF A;  5H2F H;  2O01 N;  4JBZ A;  1FZC B;  3MUD C;  1URQ D;  1SQB D;  1JB0 J;  3GHG C;  4GOF A;  4DOJ A;  2C9N Y;  1VDF A;  3L73 E;  1ZRT E;  5KKZ B;  5CHX A;  1IFI A;  2QJY C;  3L73 G;  3CCS P;  1VPC A;  1NKN A;  4UB8 E;  1G1J A;  3RGU A;  1BDD A;  3HTK A;  4WY4 A;  2YXR B;  1DEB A;  1NAY A;  5KLV D;  1Q81 Q;  4IFD K;  3CCL P;  1SQV E;  1P84 D;  2WTY A;  2E76 B;  1N7L A;  2ZYG A;  3H1J J;  3I56 P;  4R4L A;  1OVR A;  2O3J A;  1USE A;  2ITA A;  2WWW A;  4EI2 A;  3CX5 H;  3AE7 C;  5CCH C;  2RH0 A;  1ZXG A;  3GHG B;  3TSI A;  2XZR A;  1PIX A;  2O1K A;  3AED C;  1KYO I;  1USD A;  1ZV8 A;  2BCC D;  3MD0 A;  4ASW A;  1NYH A;  1EDI A;  1LP1 A;  2AXC A;  1NU1 J;  2WPS A;  2POH A;  3FWL A;  2FYU D;  1PV3 A;  1LTI C;  2P10 A;  2M3B A;  4H44 C;  1AQT A;  1YQ3 C;  4OGQ C;  5TIS H;  2KIK A;  3LW5 J;  2OTK E;  1IFN A;  5CBO A;  1NTM E;  1OIP A;  2JO1 A;  3M0D A;  2KNC A;  3Q3D A;  3GLM A;  3AE3 C;  1NTM G;  3L37 A;  3BCC E;  2A06 G;  2J59 M;  3P8M C;  2QJP C;  5AW7 B;  1FZC A;  3HUS C;  2E43 A;  1SQV K;  3BCC G;  4WB4 A;  2IBZ D;  2Z5H A;  2I8D A;  1N7S C;  3JC2 2;  4NPE A;  4H44 B;  4OGQ B;  2N1T A;  2V7Q H;  1L0L J;  2YKP A;  2M0B A;  3A0B E;  5AW8 B;  2E42 A;  4TLF A;  4U7J A;  4LGD E;  1R5L A;  1BE3 E;  1VQL P;  1KIL A;  2ZXX A;  1VQ4 P;  3SFE C;  4AQR D;  1NJI Q;  1LT9 A;  5GTI E;  2NPS D;  2ZVN B;  1BE3 G;  3CWB E;  2PRR A;  3NTN A;  2QJP B;  1IFJ A;  2RKL A;  3HD7 D;  1E79 H;  1KYO H;  5AVQ B;  2Q3E A;  2HLO A;  3PJS K;  3V2P A;  1JY3 O;  1X9V A;  2K9J A;  4Y28 J;  3CWB G;  3L71 E;  1YTZ I;  1BGY E;  2P58 A;  1N7S B;  2PFX A;  3E1I A;  1S5L X;  4D6T E;  3L71 G;  1BGY G;  4YTP C;  1OVU A;  1OWA A;  1VQM P;  4IFF A;  1FJP A;  4D6T G;  2Y0E A;  2LXC B;  2W6B A;  4PD4 E;  1A02 F;  1EC5 A;  3BRV B;  3L75 E;  2OYH B;  1HF9 A;  4K35 A;  3JCU H;  1KD1 Q;  2KSE A;  3H1K J;  2GM4 A;  2WSC H;  5CCH A;  3PH0 A;  1PFI A;  1VQ6 P;  2C0W A;  1X79 B;  3L75 G;  2WT7 B;  1J1D C;  3V6I A;  2OTJ P;  3SSU A;  1RF1 B;  1RQV A;  5H2F E;  1LWU C;  1FDM A;  3V2Q A;  3R2P A;  2HYN A;  2R5B A;  3ZDM A;  1YJW P;  1X0T A;  2IFM A;  2K9Y A;  2KLV A;  1PZQ A;  3B5N C;  2KK7 A;  3G9R A;  3USS A;  1U7J A;  1EZV E;  1IZN B;  1T8Z A;  3C8V A;  3AEB C;  4HKZ H;  1GMJ A;  1PGQ A;  1FC2 C;  4L75 A;  4U3F D;  3M9B A;  1SQB G;  1EZV G;  5CBN A;  3PTZ A;  1J1D B;  1YHQ P;  1HWT C;  1ZR4 A;  1ZW0 A;  5CJ4 A;  2Y9Y A;  3MHV A;  3HUS A;  3EFG A;  1HUC A;  2I1J A;  1LWU B;  1SQV J;  5AW1 B;  1EDK A;  2SPZ A;  1GW4 A;  1NTK D;  2WZ7 A;  3CX5 E;  1YIJ P;  5AVW B;  1N7S A;  1FDO A;  3L35 A;  1YI2 P;  2M5A B;  3CME P;  1SQX E;  3B5N B;  1KB9 I;  4ASV A;  3AE2 C;  3KYQ A;  2R5D A;  1DEE G;  1NGM B;  3NMD A;  1SQX G;  3SWK A;  3RBZ A;  3V5B A;  2WSE J;  4IOI H;  3P32 A;  3AE1 C;  5TIS E;  2P67 A;  1NTZ E;  1GU4 A;  4JYC A;  4W80 A;  3WUT A;  3B4S A;  4IL6 H;  1L4A A;  2D2C C;  5KAF H;  1UIX A;  3AEA C;  1NTZ G;  3K5B A;  4N78 E;  1FZF A;  2FYZ A;  1EDL A;  2IZ1 A;  5C39 A;  4GT1 A;  3H6P A;  3H1I E;  2RMZ A;  3CXH I;  5CCG C;  3E1R A;  4YXW H;  3CC2 P;  3IF4 A;  3A0H H;  3H1I G;  4L73 A;  1RF0 A;  1RE3 C;  2Y0C A;  3FX0 A;  2WQY C;  2P1J A;  2OTL P;  3N7N A;  1QLE D;  1WMK A;  3WMM 0;  3H1H E;  2ZT9 D;  1SVF A;  1JMM A;  5AVT B;  1M57 D;  2GUS A;  2QE7 H;  1X22 A;  1K8A Q;  1QX8 A;  1LNQ A;  1SQX K;  2E5Y A;  1S9K D;  3H1H G;  3L74 E;  4HB1 A;  5APY A;  5L8R J;  2MJZ A;  2CPS A;  1KB9 D;  1N2D C;  2QM8 A;  4QMA A;  1SS1 A;  3L74 G;  1KTM A;  3IR9 A;  2H89 C;  1L0N E;  2Z4E A;  1BE3 J;  2PAJ A;  1LWU A;  3AE6 C;  4GOD A;  1FE6 A;  2A45 I;  1KYO E;  1NTZ K;  4RJT A;  1H0T B;  1KB9 H;  4IFM A;  2W90 A;  3S9O A;  4N6J A;  1L0N G;  3AE5 C;  1GD2 E;  1P84 I;  1PP9 D;  1EXI A;  3R4Y A;  1Q2N A;  3BRT B;  3B5N A;  2HOD B;  2MKV A;  1QVG O;  3W67 A;  3QH9 A;  3L71 J;  3I55 P;  1L0L K;  1BGY J;  3PHL A;  3AEC C;  1JY2 N;  1ZME C;  1BCC E;  3VOP A;  3MTU E;  1JY2 P;  1DD3 A;  3V4Q A;  3TYY A;  1BCC G;  1JCC A;  2ZYD A;  3H32 A;  2NZ2 A;  2E74 D;  1LTA C;  1AV1 A;  3JCU E;  3CXH H;  2B87 B;  2XDJ A;  3L75 J;  2NPS C;  1M1J C;  1H8A A;  1U57 A;  2KLU A;  3HD7 C;  3P8C E;  3D6Y A;  2K88 A;  1S3J A;  1JCD A;  1BSH A;  1LJ2 A;  1RY3 A;  4K3A A;  2HPC A;  2BEQ D;  2FYN C;  1L0N K;  1RE4 C;  1S2E A;  2KSJ A;  2C0X A;  3H1J D;  2FXM A;  4UB6 H;  1X8Y A;  3LID A;  1MKM A;  2FFD C;  3HE5 B;  2OYI C;  2Q5U A;  4C7R A;  2XKM A;  2O1J A;  1LTT C;  1MFZ A;  2WMM A;  5APU A;  1J1E C;  1DD4 A;  2IBZ I;  4DJG A;  4ZMD A;  1JOC A;  1PPJ D;  1NKZ B;  1M8O B;  2A45 H;  3F89 A;  4WY4 D;  1NU1 D;  3N4X A;  2NPS B;  2LR2 A;  4DT0 A;  1M1J B;  1M1K Q;  2R32 A;  2N9B A;  1J2J B;  3CCQ P;  1P84 H;  1JO5 A;  3HD7 B;  5CMZ A;  1SQQ K;  1NAF A;  5CCG A;  3ABV C;  4YPC A;  3RK2 D;  2Q7C A;  1ZLL A;  3S1K A;  1M90 Q;  1RE3 A;  2JJL A;  2FYN B;  1GW3 A;  4C7N A;  1FU1 A;  2FFD B;  2OYI B;  1JTH B;  3LW5 H;  5APS A;  1J1E B;  5APQ A;  3GW6 A;  3M06 A;  3VYI A;  1GL2 A;  1ZOY C;  1SQX J;  2E75 D;  1EQ7 A;  5E79 H;  3LIE A;  3D6Z A;  4KT0 J;  5B5E H;  2A06 E;  3MZW B;  2KXP B;  5KJ7 D;  2ZVO B;  2KYV A;  4IL6 E;  5KAF E;  3L72 E;  1SFC C;  2J5U A;  2B87 A;  3TF5 A;  1L0L D;  3QWO C;  1NTZ J;  1IO4 A;  2QG4 A;  3L72 G;  4ZNC A;  3KPE A;  1IFP A;  2E5T A;  1HGZ A;  1GK4 A;  3RK3 D;  5AW6 B;  1Q86 Q;  1M56 D;  1SLQ A;  2Q6Q A;  1KC8 Q;  3A0H E;  4R4M A;  1KN7 A;  3H1I J;  1GK6 A;  4H13 D;  2IZ0 A;  2ZFC A;  2KZJ A;  2VRS A;  2N1T D;  5AVU B;  3HRN A;  1FJK A;  3CCM P;  1LTB C;  2IFN A;  1SFC B;  2OYH C;  1KFM A;  2OAR A;  1T6A A;  2NPS A;  1KIL D;  3MUD A;  1M1J A;  1LTJ C;  5BU8 B;  4HH2 A;  3G3Z A;  3GHG A;  3HD7 A;  2W6A A;  1NTM K;  5DJT B;  2K3R A;  3L74 J;  3L70 E;  1IK7 A;  1NVO A;  1KQS O;  2CPB A;  3AEF C;  1RF1 C;  1RE4 A;  4JPZ B;  3H1L E;  1KB9 E;  1FOS E;  3L70 G;  1T2K C;  3H1K D;  1L0N J;  2OYI A;  3V4W A;  3MP7 B;  3MGN A;  3H1L G;  1N73 C;  4GKG A;  5B66 H;  4NPD A;  1YQ4 C;  5AVZ B;  1SQQ D;  4GDO A;  1S5L H;  2OQQ A;  2WSS H;  1W2E A;  1AA0 A;  1HJ0 A;  3HE4 B;  2ZXE B;  3A5T A;  3BVH A;  2FXP A;  1IK9 A;  1LTJ B;  1OXZ A;  2ZT9 C;  2LKM A;  2XND H;  4AYC A;  1BCC J;  3TGU E;  1W2B O;  1SQQ J;  1OFC X;  3KQG A;  1IC2 A;  1T3J A;  3CXH E;  1VQ9 P;  1SP4 A;  5K5G B;  3TGU G;  1W5C E;  1XTC C;  2HR3 A;  2YIU C;  3L73 D;  1CI6 B;  1SQP E;  1ZRT D;  4WVZ A;  2KP8 A;  3M9H A;  3OAK A;  3VMX A;  3FGA D;  3VMA A;  2WSC J;  4HJG H;  1N73 B;  5KAI H;  4LC1 A;  3SFD C;  1SQP G;  3G71 P;  2PGD A;  1FZG A;  1G2C B;  4PJ0 H;  1SQB E;  2JKV A;  2YNY A;  2FXO A;  3OJA B;  3L73 J;  1EDJ A;  3FWN A;  4UB6 E;  3D71 A;  1OX3 A;  2ZT9 B;  1SQV D;  3FXD A;  1Q7Y Q;  1E5W A;  2GA1 A;  2J58 A;  2R3C A;  1SFC A;  3CCR P;  3U1A A;  3EQ2 A;  4I7Z B;  5BU5 A;  2YIU B;  4YXD C;  4EDF A;  5KLV E;  2XV5 A;  2LXB A;  3V2N A;  3AEE C;  1P84 E;  3MIW A;  1ZN5 A;  1KMI Z;  3A2A A;  2A45 G;  5APV A;  2H43 A;  1WT6 A;  5KLV G;  1URQ C;  4H0L D;  1KQL A;  2R3S A;  3GF3 A;  2JDI H;  1LGH B;  1H89 A;  1FAV A;  5KLI B;  4OWF A;  2L91 A;  1SQP K;  3VP9 A;  2BCC E;  3EWK A;  2YMK A;  4HYT B;  1A02 J;  2FYU E;  2OYH A;  1AJY A;  2QM7 A;  1OVV A;  2BCC G;  3GG2 A;  3D70 A;  5E79 E;  3E7K A;  2FYU G;  3SWY A;  1YYC A;  2E74 B;  1SQB K;  5B5E E;  1L4A D;  2WT7 A;  1AVO A;  2O01 H;  1NTM J;  2H88 C;  2C9L Y;  4EYY Q;  1NWQ A;  1WRG A;  3TNU B;  3L4F A;  1RF1 A;  2B88 A;  4WY4 C;  1PL5 A;  1QL1 A;  1URQ B;  3M0A A;  4EOT A;  1KQG B;  3G6E P;  1FS0 E;  2Q3I A;  3BCC J;  3L72 J;  2RN0 A;  3M91 A;  1N73 A;  4JF7 A;  2FY8 A;  1GZL A;  3NXS A;  5KLV K;  1VF5 D;  3NFQ A;  1G2C A;  4ZKU A;  4RKU J;  2R44 A;  1OW6 A;  2IBZ E;  2ZJS E;  1BE3 D;  3RK3 E;  3WU2 H;  3RL0 D;  3A3Y B;  1JEK A;  3PP5 A;  5AW3 B;  1UII A;  2IBZ G;  4XFJ A;  3CWB D;  1Q82 Q;  1HH0 A;  3U59 A;  5BVZ A;  1NH4 A;  2M8R A;  3C9I A;  2Z5I A;  3HTK B;  4WY4 B;  2G3A A;  5EFW B;  1KOR A;  1Q90 D;  3L71 D;  1LTG C;  3T97 B;  1BGY D;  1YJ9 P;  5KJ7 C;  2FYU K;  4TT3 H;  3VMY A;  3FXE A;  1PGO A;  3VTP C;  4PV1 D;  1NHL A;  3CWB J;  2K1A A;  2M3E A;  1JUN A;  2M5A A;  4JYB A;  1K73 Q;  2XNX A;  4PD4 D;  2W8Z A;  4N3Y B;  3O6Q B;  3RK3 C;  3L70 J;  4M3L A;  3CC7 P;  2Y9Z A;  1LP1 B;  2Q9I A;  3Q5P A;  1G1I A;  1QEX A;  2HFE D;  2WSF H;  4D6T J;  1GU5 A;  3L75 D;  3H1L J;  1OMI A;  5B66 E;  2JP3 A;  3H1K E;  1S5L E;  2YKO A;  2E75 B;  1DX7 A;  2JWD A;  4NPF X;  4L76 A;  2B89 A;  3B8E B;  3H1K G;  4Y99 B;  1CW5 A;  1FZE A;  5APX A;  5AW2 B;  4MN4 C;  3TNU A;  1ZP0 C;  2AEF A;  1H88 A;  1YTZ T;  1URQ A;  3A7O A;  3C1L A;  4ZKP A;  1LT9 C;  3TGU J;  3RK3 B;  3EFF K;  1Y47 A;  4GOE A;  3CMA P;  1HJB A;  1EZV D;  5KAI E;  2IX7 C;  4OVN F;  2IPP A;  1SQP J;  3CLQ A;  4H13 B;  1CSB A;  1VQ7 P;  1Y9B A;  4PJ0 E;  2N1T B;  2BAS A;  5GTH H;  5KTB A;  3L36 A;  1VQK P;  1RH5 B;  3WUV A;  1MV8 A;  2Y0D A;  2D2C D;  5AW0 B;  1DIP A;  1SQB J;  2IDB A;  3G4S P;  2IYO A;  3Q2Y A;  1BDC A;  1KIL B;  3CX5 D;  3T97 A;  4U3F E;  2NRG A;  4BWN A;  1IFD A;  1LT9 B;  1IJD B;  1H0T A;  3II6 A;  2QA4 P;  2AEJ A;  4WBA A;  2K37 A;  5CCG D;  1KFN A;  1SQV G;  4U3F G;  2BEZ F;  1SQX D;  4CPG A;  2KB7 P;  2K9J B;  1GTW A;  2HOD A;  5KLV J;  1VQO P;  1NTK E;  4KJM A;  2QJY B;  3O6Q A;  1YJN P;  2GUV A;  1NTZ D;  1NTK G;  4GIF A;  1M7L A;  1JMB A;  3CCE P;  3TK1 A;  1KZU B;  1GL2 D;  4N78 D;  3IAO A;  2BCC J;  5KJ7 A;  1R8E A;  1YIT P;  1S4X A;  3H1I D;  1MUU A;  2FYU J;  4BRY B;  1K05 A;  2WPV B;  2I1K A;  5CJ0 A;  2UWJ E;  5AVX B;  3VP8 A;  1K9M Q;  1RQU A;  2YKQ A;  1D7M A;  2YO3 A;  3S4R A;  3H1H D;  2WPQ A;  3HE5 A;  1PGP A;  3OW2 O;  1JNM A;  2AXT H;  2ZYA A;  4H0L C;  4A7P A;  1AFO A;  2KS1 B;  2KUB A;  3L74 D;  1KV4 A;  3WU2 E;  1PGJ A;  1NTK K;  3I5C A;  2V7Q J;  3H1H J;  3F5H A;  3VMZ A;  1L0N D;  1L2P A;  1KYO D;  2E76 D;  1S9K E;  2G8Y A;  1L4A C;  1OW8 A;  2W27 A;  2L5G B;  3HUS B;  1JY3 N;  3KZI H;  3VN0 A;  2FFD A;  1JTH A;  1JY3 P;  1TU3 F;  3GMA A;  2JWA A;  1VQP P;  4DZO A;  4H0L B;  3CC4 P;  1BCC D;  2XU6 A;  1PP9 E;  1MFT A;  3IFM A;  3Q5S A;  1VF5 C;  4XA4 A;  2Q1K A;  1R5S A;  2JEE A;  1RF0 C;  1PP9 G;  3O8Z A;  3RL0 C;  2WVR A;  5M1B A;  1GDT A;  1NOH A;  4O9B A;  5CCH D;  2DW3 A;  1L4A B;  1N86 A;  2JR8 A;  4BRY A;  2P2U A;  1Z56 A;  3P8C D;  4I7Z C;  2H7H A;  2W83 C;  3UIA A;  1T3U A;  1S1C X;  3CPW O;  4W7Y A;  4I2L C;  2YMY A;  4OH8 B;  4RO0 A;  2W6J H;  3U1C A;  3KDP B;  4PV1 C;  5AW9 B;  1VF5 B;  2PP6 A;  3KHU A;  4H44 D;  4DCK A;  4OGQ D;  4UB8 H;  5KLI C;  4LLH A;  1N8R Q;  2KS1 A;  3RL0 B;  3M9Q A;  1CZQ A;  1DH3 A;  3H1J E;  2FBW C;  1MZ9 A;  3PRJ A;  5GTH E;  3AE4 C;  2P7J A;  3ITK A;  3CCV P;  4W7Z A;  1U7M A;  5AVV B;  1LTS C;  1FZA A;  1QGK B;  3H1J G;  1SFC D;  3TDK A;  1FBM A;  1PPJ E;  2WPR A;  2E74 C;  4EIJ A;  3CCU P;  2H8P D;  3CD6 P;  2N9Y B;  5TJH A;  3BAT A;  1AQ5 A;  1NU1 E;  1VL2 A;  2OGU A;  5APW A;  1YBK A;  1PPJ G;  4PV1 B;  4B86 A;  1FDI A;  1N7S D;  3AE9 C;  4U3F J;  2KI7 B;  2WSE H;  1NU1 G;  3CCJ P;  2CK3 H;  4Z1M H;  1NTM D;  4IL6 X;  3HE4 A;  2HG5 D;  5AW5 B;  2QIW A;  2A06 D;  4WWI A;  3RL0 g;  1FOS F;  3JSV C;  1LTJ A;  1NTK J;  3WUU A;  4PD4 I;  1ZR2 A;  3BCC D;  3KXD A;  3L72 D;  1IFM A;  2QVA A;  4XE5 B;  3IN6 A;  1JM0 A;  2OYO A;  3H32 B;  1XTG B;  1CI6 A;  2ZAE B;  1HBW A;  4KHX A;  4BXL A;  1L0L E;  3W68 A;  3RK2 C;  2FKW B;  1T2K D;  1FZB A;  5APT A;  1KQF B;  2O01 J;  1HGV A;  1L0L G;  3CI9 A;  1VQ8 P;  1NU1 K;  2WIT A;  2HPC B;  3A0B H;  2KOG A;  2AEM A;  2IYP A;  2AXT E;  1HVV A;  2B9B A;  2QSI A;  2QJK C;  4JQ0 D;  2D2C B;  3CL3 D;  1VQ5 P;  1EZV I;  2E75 C;  1BSN A;  5GTI H; 
#chains in the Genus database with same CATH homology
 1EZV G;  1SQQ G;  1NTK G;  1BE3 G;  1NTZ G;  1SQP G;  1SQX G;  2FYU G;  3L71 G;  1P84 H;  3BCC G;  3CX5 H;  3H1I G;  1BGY G;  1KYO H;  3L72 G;  1KB9 H;  3CXH H;  3H1H G;  3L70 G;  2IBZ G;  5KLV G;  1NTM G;  3H1K G;  3TGU G;  1L0N G;  1PPJ G;  3CWB G;  4D6T G;  3L73 G;  1PP9 G;  4PD4 H;  3H1L G;  2A06 G;  3L75 G;  2BCC G;  3H1J G;  3L74 G;  1SQV G;  1L0L G;  4U3F G;  1SQB G;  1BCC G;  1NU1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...