1BGYG

Cytochrome bc1 complex from bovine
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYENDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME BC1 COMPLEX
total genus 22
structure length 81
sequence length 81
chains with identical sequence S
ec nomenclature
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1bgyG00
5KLVG 3CWBG 1L0LG 1L0NG 1PP9G 1SQBG 3L70G 2A06G 1KYOH 1KB9H 3L71G 3H1IG 1BE3G 4D6TG 3L74G 3L72G 3BCCG 1NU1G 1PPJG 3H1HG 3H1JG 1BCCG 1BGYG 1SQPG 1SQVG 4U3FG 3TGUG 1NTZG 1SQXG 1EZVG 3L73G 2FYUG 3L75G 3H1LG 2IBZG 1SQQG 3CXHH 4PD4H 1NTKG 3H1KG 1NTMG 2BCCG 3CX5H 1P84H
chains in the Genus database with same CATH superfamily
1NU1K 1NJIQ 2Z4EA 4GODA 4WVZA 5GTHE 3AEAC 3HD7B 1URQA 5AVVB 1YBKA 4PV1C 1KB9H 5CJ4A 3BRTB 2RKLA 3L73E 3TDKA 4PV1B 2HR3A 2ZAEB 4QMAA 1GD2E 4XE5B 1AVOA 1G2CB 3QH9A 2M5AA 3GW6A 2N1TD 1PV3A 1J1DB 3KZIE 1Q86Q 1J1EB 2O3JA 1PL5A 1HJ0A 3SWYA 1RF1B 4NPEA 1G1JA 2YNYA 1JMBA 4Z1MH 3D70A 5KLVE 3IN6A 2OQQA 1HVVA 2ZXXA 5KLVD 1Q7YQ 1L0NE 3RGUA 3V2NA 2WPSA 1NWQA 2AEJA 2HPCB 2ZYGA 4DCKA 1NTMK 2O1JA 3MZWB 3ITKA 1JCCA 2FBWC 3L75G 1L4AC 1T8ZA 1GU4A 1LT9A 1NU1E 2P10A 4OGQD 1GW4A 4EDFA 5AW2B 1PPJD 3M06A 2W90A 2WVRA 2LXCB 3RBXA 1PGJA 2RH0A 3H1KD 4RJTA 1AA0A 1Y47A 1YTZT 3L72J 4JBZA 3AE9C 1EXIA 1SQBG 1K73Q 1SQBK 1DEEG 1FE6A 2MKVA 2P1JA 2PP6A 2D2CB 2YO2A 4H0LB 5H2FE 4YXWH 1SQQD 1N2DC 2IDBA 3V6IA 1QGKB 4BXLA 1DD4A 2O01N 2Q3EA 3PHLA 5H2FH 5BU5A 2L5GB 1KZUB 1N8RQ 5GTIE 2QSIA 2KLUA 4Y99B 4GIFA 3K5BA 3AE7C 2WPRA 5APYA 1AQTA 1NTKD 1SLQA 1P84I 2ZYAA 4I7ZC 3V2QA 3B5NB 1YJ9P 5APVA 4AUWA 2HPCA 3RK2B 1EDJA 4BRYA 2E74B 3E7KA 3L37A 3GMAA 3S1KA 2HODA 2B89A 1N7SB 3H1JJ 2IBZG 3HD7A 3R4YA 4HH2A 5AVYB 2WT7A 1HJBA 1KV4A 3GF7A 3L35A 4WB4A 1FJPA 4H13B 2O01H 4YTPC 2QJKB 3ABVC 3MHVA 1PIXA 1JM0A 2ZT9B 1X0TA 2AEMA 2KB7P 1BSNA 4JQ0D 1FC2C 1ZLLA 4W7YA 2Y0CA 3TGUD 1YI2P 1BE3D 5AVQB 3L36A 2YXRB 5AW4B 3GF3A 4N78E 2R3SA 3L74G 2IBZE 4PD4E 2FYZA 1CZQA 4N78D 1J2JB 3PRJA 1LWUC 2ZFCA 5KLIB 2V4HA 3H1KE 2WWWA 1FZEA 3HUSA 3PP5A 1KYOD 2GUVA 2E75C 3C9IA 3I5CA 3LIDA 2A06E 2B87A 1W5CE 2L91A 3MD0A 4W7ZA 1EZVG 4WY4A 3AE3C 1SQPJ 3FGAD 4N3YB 3JC22 1KILA 2KK7A 3AE8C 1OVUA 3CXHH 1P84D 3H1HJ 4JF7A 2PGDA 3HTKB 1RF1C 4GOEA 3CX5H 1HH0A 4D6TJ 2O1KA 1M1JA 3H25A 1JNMA 2P58A 1L0LG 1AVYA 1L0NG 1X79B 2J5UA 3L70G 5KAFE 3VP9A 5CCHD 3M0AA 2M3BA 3L70J 4ZKUA 1G2CA 1GW3A 1JMMA 1KORA 1L0NJ 1NTMJ 1OIPA 1SQQE 2WSEJ 4B86A 2W83C 3RL0D 2A45I 1X22A 1FZCA 2E5YA 4GT1A 1IFIA 1U57A 1PFIA 2YKPA 4AYCA 3OJAB 1WRGA 2QM8A 1QLED 1USDA 3RK2D 3VOPA 5B5EE 1H89A 5AW7B 1L0LE 2D2CC 1LT1A 3H1LJ 1JUNA 1S5LX 1SQBE 2WSFJ 2C0XA 3A0HH 1W2BO 2M0BA 2W6JH 3II6A 3L73J 3TGUJ 4U3FJ 3L74D 3BASA 1NYHA 3PLNA 3WUVA 1LGHB 5KJ7A 5B66E 4Y99C 3Q1MA 4ZMDA 1CSBA 3SWFA 2W6AA 2RN0A 1S9KE 1HUCA 1S3JA 1MKMA 1N7SD 3FWLA 4PD4H 3VP8A 1N73B 2SPZA 4IL6X 1GTWA 1JTHB 1XTCC 2E75D 3TYYA 4UB6H 1RH5B 1KQLA 3CWBG 3L71J 1YIJP 3C8VA 1KC8Q 1KYOH 1PP9J 2IX7C 1MFTA 3G4SP 2OYIA 4UB8E 5GTHH 2Q9IA 4MN4C 5CBOA 4XFJA 3G71P 1JY2P 1NTKJ 1RF0C 1L0NK 1URQC 1VF5D 1M90Q 1URQB 1S9KD 1NTKE 1RE4A 1FAVA 1BGYG 2FYUJ 1GL2C 3A2AA 3MTUE 3P8CD 1KQSO 1IO4A 1VDFA 2R44A 4W80A 3CCQP 3MUDA 2KSEA 4RKUJ 1ZR4A 1ZR2A 3L71E 1SQVJ 3I55P 2XDJA 3CCEP 1KILB 2IBZD 2KIKA 4PD4D 1N7SA 5C39A 4DJGA 1JY3O 3CI9A 2OYHC 2KLVA 1FDOA 1YTZI 5KLVK 3AE1C 2FFDB 5KLIC 1JY3N 4YPCA 3H6PA 5AVSB 2FFDC 1S2EA 1VQLP 2GM4A 1BCCD 3D71A 4XA4A 1EXJA 2JO1A 2PFXA 3MP7B 2Q6QA 2QA4P 3AE2C 2Q7CA 2N9BA 1LTIC 1LTJA 4ASWA 2HFED 2N9YB 5CCHC 2K1AA 1D7MA 3L72G 2H43A 1PZQA 2MJZA 1JEKA 2Q5UA 1KQFB 1YYCA 5CHXA 3RL0g 2QJYB 1FDIA 3HUSB 3WUTA 4HB1A 4IL6E 1MZ9A 3I56P 2E5TA 4C46A 3B5ND 1SQXJ 1SQXG 3F5HA 3HE4B 1OFCX 1U7MA 1CI6B 2IPPA 2ZVOB 3LW5J 4IL6H 3CMEP 1JCDA 4D6TE 2D2CD 2QJKC 5M1BA 2IFNA 2WSEH 1ZN5A 2IZ0A 1USEA 2IFMA 4BRYB 2H7HA 3CLQA 3CXHE 3U59A 5KKZB 5GTIH 3GLMA 1HBWA 3L70D 1R5SA 2KI7B 2KNCB 4L73A 2NPSD 3NFQA 2N1TC 2Y9YA 1SQXE 2XKMA 5APSA 5KJ7D 3TNUB 1N7LA 4ZNCA 3Q5PA 2YIUC 1OWAA 3FX0A 2JDIH 3H1LE 1VQKP 3AE6C 4WWIA 1Q90D 1YJNP 1N73C 2E42A 3HRNA 2M8RA 2AXTH 1G1IA 1FS0E 4PJ0H 2Z5IA 4U3FD 1QL2A 2HYNA 3RBZA 1SFCD 1L4AD 5BU8B 2WSCH 1T3UA 4OWFA 5APWA 2M3EA 2LXBA 4NPDA 3NTNA 3L73G 1AV1A 3VN0A 5B5EH 1GL2D 4PV1D 4C7RA 2E43A 1BGYJ 2FYUG 3H1LG 1LJ2A 4LC1A 2AXCA 2R5DA 5APXA 3CCUP 1MFZA 1LTGC 1T6AA 1RQVA 2B88A 2B87B 2IYOA 2IZ1A 1ZRTD 2JP3A 2R32A 2WPQA 2K9JB 2IYPA 3BCCJ 3CWBD 3H1HD 1NTZD 3H1JE 1SQVE 1SQXD 1JO5A 3O8ZA 1JY3P 1VQ9P 1UIXA 2LKMA 1OW8A 3L71G 3H1IG 4WBAA 1LP1B 1DEBA 1EDKA 1NKNA 1M56D 2FYUE 1FBMA 3BATA 4EOTA 4NPFX 1NU1G 1RE3A 2FXMA 3MIWA 3CCRP 1SVFA 3W67A 3G6EP 1QX8A 1CI6A 1Q2NA 3V2PA 2OTJP 2NZ2A 1L4AA 3OAKA 1VQOP 1SQPD 1LT9C 2XNDH 1ZMEC 4I6MC 1M1JB 2NPSC 1OW7A 1Q82Q 4A7PA 1NTZK 1PP9E 1R5LA 1YITP 3BVHA 3OW2O 1YQ3C 3TF5A 1IFNA 1LTSC 1Q81Q 1X9VA 4N6JA 3CCMP 3B5NC 1KTMA 3SSUA 1BCCJ 1QVFO 2ZT9D 1P84E 1NU1J 3GHGB 5B66H 1NTMG 1OW6A 1BGYE 2K37A 1SP4A 1P84H 2KNCA 3NXSA 3OA7A 1JTHA 3H1IJ 3SFDC 1L4AB 3AE5C 2QRXA 2KS1A 3L73D 3O6QA 3PTZA 4ASVA 5CCGD 1PP9D 2CPSA 3M0DA 1L0LJ 2KSJA 3SFEC 1S4XA 3QWOC 3L72D 4D6TG 2WTYA 2WMMA 3CC2P 1VQ7P 5AVXB 1KN7A 1NKZB 3BCCG 1N86A 2YKOA 2QJPC 2XZRA 4KHXA 5KKZC 1EQ7A 2YXQB 2OYIC 3H1HG 2C0WA 1NTME 1H0TB 1KILC 2OYHB 5AVWB 3Q3DA 4IFDK 5AVUB 3H32B 3GHGA 3R2PA 2N1TB 2FKWB 3L71D 5APTA 3VYIA 2DW3A 1RE4C 1HTLC 1RQUA 4TLFA 3S4RA 1BE3E 4RESB 1FZCB 1VQ5P 5KTBA 1SFCC 1NTZJ 1OZHA 2RMZA 1QVGO 1CW5A 3L72E 3A3YB 4I7ZB 1HF9A 1LNQA 3T97A 2I1KA 3E1IA 1S1CX 1ZXGA 2KS1B 3KZIH 3L74J 1AQ5A 2GA1A 3VTPC 3W68A 1NO4A 2POHA 3A0BH 2NRGA 2A06G 3WU2H 2BEZF 2FFDA 3A0HE 1SQBJ 3WU2E 3EQ2A 3RK2C 2ZT9C 3CC7P 4JYCA 1DIPA 1A02J 3CX5D 4WY4B 3H1JG 2BCCE 2E76D 2ZXEB 1NGMB 1FZFA 2Z5HA 5KAIE 2JEEA 2ZJSE 4H13C 1GK4A 3L70E 4KJMA 3TSIA 1L0LD 1KB9I 2CK3H 3KHUA 4M3LA 3H1IE 1KMIZ 3FXEA 4L74A 3BCCD 4H44D 3G9RA 4LLHA 1NOHA 1M57D 2QE7H 1EZVI 5EFWB 5TISH 3RL0B 2ITAA 3CL3D 5DJTB 2WITA 3L4FA 1PPJE 3RL0C 1M8OB 1KILD 1PGQA 1JOCA 1W2EA 4I1LA 3RK3B 1RF0A 5KLVG 1IFDA 2GUSA 1S5LE 2Y0EA 3V4QA 1TU3F 1E79H 1K05A 4U7JA 2K3RA 4OH8B 4RO0A 1IFPA 2UWJE 1HGVA 1VL2A 2YMKA 1WMKA 3L75E 3IF4A 4R4LA 3V2RA 3EWKA 3BRVB 2BEQD 2BCCJ 2QJYC 5AVRB 1PPJG 3TNUA 1ZV8A 1K9MQ 2E76B 2OGUA 2QIWA 1N7SC 4Y28J 5AW1B 3H32A 5L8RJ 5CCGA 2J59M 4L75A 1IK9A 1SQVG 1KQGB 2A06D 5DJUB 1NAYA 1T2KD 3EFGA 1OMIA 1KYOI 1DX7A 1R8EA 3B8EB 3U1AA 1SQXK 5CBNA 3BCCE 1IJDB 3JCUE 1K04A 3N7NA 3PJSK 1GZLA 3WUUA 2Q3IA 2QJPB 4IFFA 4TT3H 1LTJC 1M7LA 1NTKK 1NTKG 1L2PA 1SQQK 1VF5C 1KB9D 2FYNB 2HG5D 3NMDA 1MV8A 3RK3E 1FDMA 4HYTB 5AW6B 1GU5A 3TGUE 2ZYDA 1NTZE 1PP9G 1RF1A 3CCVP 5K5GB 1BE3J 3C1LA 1K8AQ 3CWBJ 3FWNA 3IFMA 5BVZA 1LT9B 2E74D 2G8YA 2FXPA 3GG2A 3M9BA 2NPSB 1T3JA 1J1EC 2CPBA 2KUBA 2WPVB 3HE4A 4UB6E 1SQQJ 3P7KA 1EDIA 4K35A 1KD1Q 5APQA 2P7JA 3FXDA 4U3FG 3TGUG 3CMAP 1IFJA 3CD6P 1YQ4C 2WSCJ 5AW5B 3TK1A 2W6BA 4IFMA 1HGZA 3S9OA 4EYYQ 3CPWO 1NHLA 3L75D 5KAFH 1IC2A 2NPSA 2WQYC 4AQRD 1KFNA 3KDPB 3Q5SA 1L0LK 1WT6A 1MUUA 2ZVNB 3H1LD 1PGPA 3JSVC 1KILE 1YJWP 3MGNA 5CCHA 2Y0DA 1JY2N 2I8DA 3H1KG 2BCCG 1BCCE 2V7QH 3USSA 3V5BA 4HJGH 1SQPE 1KB9E 1SQBD 1T2KC 2Y9ZA 1EZVD 1ZP0C 1VQ4P 3AEDC 1EZVE 5AW0B 3G3ZA 3U1CA 2A45G 4KT0J 2M5AB 4WY4D 2YKQA 1ZOYC 2QVAA 1NVOA 3H1ID 3AEEC 3HE5A 3CXHI 5CMZA 1M1JC 5KLVJ 1NU1D 3AE4C 3M0DC 2VRSA 1FZGA 1VPCA 2I1JA 3MUDC 3CX5I 2JR8A 2O01J 1YHQP 1SQPG 4DZOA 1ZW0A 2OYHA 5AVZB 5CJ0A 1LTAC 1RY3A 3V4WA 1LWUA 5APUA 5AW9B 5KAIH 2E74C 1NH4A 4H13D 1GDTA 3GHGC 3D6ZA 3B4SA 3HUSC 2A45H 3CCSP 5AW8B 3AEFC 2HLOA 2J58A 3A7OA 1M1KQ 4L76A 1SS1A 4ZKPA 2YMYA 1JY2O 4GDOA 2PRRA 4UB8H 2P2UA 5E79H 3E1RA 3HTKA 4H44B 4HKZH 3T97B 4DT0A 1GL2B 2KP8A 2OTKE 3A0BE 3EFFK 4H0LD 3KXDA 1FJKA 2QEXP 1FOSE 1IFMA 4C7NA 2FYUD 1LTJB 1VF5B 3WMM0 2OYIB 2QG4A 2W8ZA 2KYVA 2IBZI 4PD4I 3RK3D 1VQMP 1BDCA 2K88A 3M9HA 3VMAA 2XU6A 1SQVD 2BASA 3B5NA 2YIUB 3CWBE 3F89A 4JPZB 1NTZG 3P8MC 3CCLP 1SFCB 3HD7C 2R3CA 1QEXA 2E75B 2Q1KA 1PGOA 3CCJP 2KZIA 1GK6A 1FZBA 2FY8A 3LW5H 1FZCC 1AFOA 2PAJA 3Q2YA 1U7JA 3CC4P 3KQGA 1BDDA 4PJ0E 1GL2A 1LTBC 3VMYA 3ZDMA 1J1DC 1BGYD 1HWTC 1BSHA 2P67A 1L0ND 1OX3A 1H0TA 4U3FE 3AEBC 3IR9A 2AEFA 3A5TA 1AJYA 1N73A 2R5BA 4EIJA 3B71A 1VQ8P 2XV5A 1FOSF 2JKVA 5AW3B 5AVTB 1X8YA 2OARA 4I2LC 4R4MA 5TISE 4WY4C 1OVRA 4LGDE 3PH0A 2W27A 1SFCA 1FZAA 1H88A 1BCCG 3L75J 1VQPP 1KFMA 1EDLA 1URQD 1NTMD 1FU1A 2LR2A 2WSFH 1OXZA 4H0LC 4DOJA 1E5WA 5TJHA 3AECC 5CCGC 2WZ7A 2G3AA 5E79E 2HODB 2WT7B 2C9NY 2H89C 4D6TD 3SWKA 1DD3A 1XTGB 2B9BA 1Y9BA 1SQPK 1ZRTE 3CX5E 2KXPB 2BCCD 4GOFA 3JCUH 3H1HE 3IAOA 2JWAA 3P8CE 3H1JD 2V7QJ 1S72P 4GKGA 4JYBA 2AXTE 1GMJA 1EC5A 2K9JA 1A02F 1VQ6P 2KOGA 3D6YA 1RE3C 4CPGA 2C9LY 1BE3G 1OVVA 3KPEA 2WSSH 3VMXA 1IK7A 3HE5B 4C7NB 2H88C 4EI2A 2XNXA 2E76C 2OYOA 3H1KJ 1LP1A 4OVNF 1H8AA 3M91A 4OGQB 4O9BA 3P32A 4OGQC 1Y8AA 2K9YA 2N1TA 1JB0J 3M9QA 2FYUK 1RHZB 2JJLA 4BWNA 4YXDC 1KYOE 1UIIA 2FXOA 4H44C 5KJ7C 3AEGC 2KZJA 1IZNB 1NAFA 3KYQA 3N4XA 1SQVK 3Q5RA 2JWDA 1S5LH 1VQNP 2QM7A 4K3AA 1Z56A 2H8PD 3VMZA 3L74E 2FYNC 3HD7D 1SQQG 2OTLP 1LWUB 2YO3A 3UIAA 3LIEA 1DH3A 3O6QB 1LTTC 3CXHD 4IOIH 1QL1A 3RK3C
chains in the Genus database with same CATH topology
5KLVG 3CWBG 1L0LG 1L0NG 1PP9G 1SQBG 3L70G 2A06G 1KYOH 1KB9H 3L71G 3H1IG 1BE3G 4D6TG 3L74G 3L72G 3BCCG 1NU1G 1PPJG 3H1HG 3H1JG 1BCCG 1BGYG 1SQPG 1SQVG 4U3FG 3TGUG 1NTZG 1SQXG 1EZVG 3L73G 2FYUG 3L75G 3H1LG 2IBZG 1SQQG 3CXHH 4PD4H 1NTKG 3H1KG 1NTMG 2BCCG 3CX5H 1P84H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLV G;  3CWB G;  1L0L G;  1L0N G;  1PP9 G;  1SQB G;  3L70 G;  2A06 G;  1KYO H;  1KB9 H;  3L71 G;  3H1I G;  1BE3 G;  4D6T G;  3L74 G;  3L72 G;  3BCC G;  1NU1 G;  1PPJ G;  3H1H G;  3H1J G;  1BCC G;  1BGY G;  1SQP G;  1SQV G;  4U3F G;  3TGU G;  1NTZ G;  1SQX G;  1EZV G;  3L73 G;  2FYU G;  3L75 G;  3H1L G;  2IBZ G;  1SQQ G;  3CXH H;  4PD4 H;  1NTK G;  3H1K G;  1NTM G;  2BCC G;  3CX5 H;  1P84 H; 
#chains in the Genus database with same CATH topology
 1NU1 K;  1NJI Q;  2Z4E A;  4GOD A;  4WVZ A;  5GTH E;  3AEA C;  3HD7 B;  1URQ A;  5AVV B;  1YBK A;  4PV1 C;  1KB9 H;  5CJ4 A;  3BRT B;  2RKL A;  3L73 E;  3TDK A;  4PV1 B;  2HR3 A;  2ZAE B;  4QMA A;  1GD2 E;  4XE5 B;  1AVO A;  1G2C B;  3QH9 A;  2M5A A;  3GW6 A;  2N1T D;  1PV3 A;  1J1D B;  3KZI E;  1Q86 Q;  1J1E B;  2O3J A;  1PL5 A;  1HJ0 A;  3SWY A;  1RF1 B;  4NPE A;  1G1J A;  2YNY A;  1JMB A;  4Z1M H;  3D70 A;  5KLV E;  3IN6 A;  2OQQ A;  1HVV A;  2ZXX A;  5KLV D;  1Q7Y Q;  1L0N E;  3RGU A;  3V2N A;  2WPS A;  1NWQ A;  2AEJ A;  2HPC B;  2ZYG A;  4DCK A;  1NTM K;  2O1J A;  3MZW B;  3ITK A;  1JCC A;  2FBW C;  3L75 G;  1L4A C;  1T8Z A;  1GU4 A;  1LT9 A;  1NU1 E;  2P10 A;  4OGQ D;  1GW4 A;  4EDF A;  5AW2 B;  1PPJ D;  3M06 A;  2W90 A;  2WVR A;  2LXC B;  3RBX A;  1PGJ A;  2RH0 A;  3H1K D;  4RJT A;  1AA0 A;  1Y47 A;  1YTZ T;  3L72 J;  4JBZ A;  3AE9 C;  1EXI A;  1SQB G;  1K73 Q;  1SQB K;  1DEE G;  1FE6 A;  2MKV A;  2P1J A;  2PP6 A;  2D2C B;  2YO2 A;  4H0L B;  5H2F E;  4YXW H;  1SQQ D;  1N2D C;  2IDB A;  3V6I A;  1QGK B;  4BXL A;  1DD4 A;  2O01 N;  2Q3E A;  3PHL A;  5H2F H;  5BU5 A;  2L5G B;  1KZU B;  1N8R Q;  5GTI E;  2QSI A;  2KLU A;  4Y99 B;  4GIF A;  3K5B A;  3AE7 C;  2WPR A;  5APY A;  1AQT A;  1NTK D;  1SLQ A;  1P84 I;  2ZYA A;  4I7Z C;  3V2Q A;  3B5N B;  1YJ9 P;  5APV A;  4AUW A;  2HPC A;  3RK2 B;  1EDJ A;  4BRY A;  2E74 B;  3E7K A;  3L37 A;  3GMA A;  3S1K A;  2HOD A;  2B89 A;  1N7S B;  3H1J J;  2IBZ G;  3HD7 A;  3R4Y A;  4HH2 A;  5AVY B;  2WT7 A;  1HJB A;  1KV4 A;  3GF7 A;  3L35 A;  4WB4 A;  1FJP A;  4H13 B;  2O01 H;  4YTP C;  2QJK B;  3ABV C;  3MHV A;  1PIX A;  1JM0 A;  2ZT9 B;  1X0T A;  2AEM A;  2KB7 P;  1BSN A;  4JQ0 D;  1FC2 C;  1ZLL A;  4W7Y A;  2Y0C A;  3TGU D;  1YI2 P;  1BE3 D;  5AVQ B;  3L36 A;  2YXR B;  5AW4 B;  3GF3 A;  4N78 E;  2R3S A;  3L74 G;  2IBZ E;  4PD4 E;  2FYZ A;  1CZQ A;  4N78 D;  1J2J B;  3PRJ A;  1LWU C;  2ZFC A;  5KLI B;  2V4H A;  3H1K E;  2WWW A;  1FZE A;  3HUS A;  3PP5 A;  1KYO D;  2GUV A;  2E75 C;  3C9I A;  3I5C A;  3LID A;  2A06 E;  2B87 A;  1W5C E;  2L91 A;  3MD0 A;  4W7Z A;  1EZV G;  4WY4 A;  3AE3 C;  1SQP J;  3FGA D;  4N3Y B;  3JC2 2;  1KIL A;  2KK7 A;  3AE8 C;  1OVU A;  3CXH H;  1P84 D;  3H1H J;  4JF7 A;  2PGD A;  3HTK B;  1RF1 C;  4GOE A;  3CX5 H;  1HH0 A;  4D6T J;  2O1K A;  1M1J A;  3H25 A;  1JNM A;  2P58 A;  1L0L G;  1AVY A;  1L0N G;  1X79 B;  2J5U A;  3L70 G;  5KAF E;  3VP9 A;  5CCH D;  3M0A A;  2M3B A;  3L70 J;  4ZKU A;  1G2C A;  1GW3 A;  1JMM A;  1KOR A;  1L0N J;  1NTM J;  1OIP A;  1SQQ E;  2WSE J;  4B86 A;  2W83 C;  3RL0 D;  2A45 I;  1X22 A;  1FZC A;  2E5Y A;  4GT1 A;  1IFI A;  1U57 A;  1PFI A;  2YKP A;  4AYC A;  3OJA B;  1WRG A;  2QM8 A;  1QLE D;  1USD A;  3RK2 D;  3VOP A;  5B5E E;  1H89 A;  5AW7 B;  1L0L E;  2D2C C;  1LT1 A;  3H1L J;  1JUN A;  1S5L X;  1SQB E;  2WSF J;  2C0X A;  3A0H H;  1W2B O;  2M0B A;  2W6J H;  3II6 A;  3L73 J;  3TGU J;  4U3F J;  3L74 D;  3BAS A;  1NYH A;  3PLN A;  3WUV A;  1LGH B;  5KJ7 A;  5B66 E;  4Y99 C;  3Q1M A;  4ZMD A;  1CSB A;  3SWF A;  2W6A A;  2RN0 A;  1S9K E;  1HUC A;  1S3J A;  1MKM A;  1N7S D;  3FWL A;  4PD4 H;  3VP8 A;  1N73 B;  2SPZ A;  4IL6 X;  1GTW A;  1JTH B;  1XTC C;  2E75 D;  3TYY A;  4UB6 H;  1RH5 B;  1KQL A;  3CWB G;  3L71 J;  1YIJ P;  3C8V A;  1KC8 Q;  1KYO H;  1PP9 J;  2IX7 C;  1MFT A;  3G4S P;  2OYI A;  4UB8 E;  5GTH H;  2Q9I A;  4MN4 C;  5CBO A;  4XFJ A;  3G71 P;  1JY2 P;  1NTK J;  1RF0 C;  1L0N K;  1URQ C;  1VF5 D;  1M90 Q;  1URQ B;  1S9K D;  1NTK E;  1RE4 A;  1FAV A;  1BGY G;  2FYU J;  1GL2 C;  3A2A A;  3MTU E;  3P8C D;  1KQS O;  1IO4 A;  1VDF A;  2R44 A;  4W80 A;  3CCQ P;  3MUD A;  2KSE A;  4RKU J;  1ZR4 A;  1ZR2 A;  3L71 E;  1SQV J;  3I55 P;  2XDJ A;  3CCE P;  1KIL B;  2IBZ D;  2KIK A;  4PD4 D;  1N7S A;  5C39 A;  4DJG A;  1JY3 O;  3CI9 A;  2OYH C;  2KLV A;  1FDO A;  1YTZ I;  5KLV K;  3AE1 C;  2FFD B;  5KLI C;  1JY3 N;  4YPC A;  3H6P A;  5AVS B;  2FFD C;  1S2E A;  1VQL P;  2GM4 A;  1BCC D;  3D71 A;  4XA4 A;  1EXJ A;  2JO1 A;  2PFX A;  3MP7 B;  2Q6Q A;  2QA4 P;  3AE2 C;  2Q7C A;  2N9B A;  1LTI C;  1LTJ A;  4ASW A;  2HFE D;  2N9Y B;  5CCH C;  2K1A A;  1D7M A;  3L72 G;  2H43 A;  1PZQ A;  2MJZ A;  1JEK A;  2Q5U A;  1KQF B;  1YYC A;  5CHX A;  3RL0 g;  2QJY B;  1FDI A;  3HUS B;  3WUT A;  4HB1 A;  4IL6 E;  1MZ9 A;  3I56 P;  2E5T A;  4C46 A;  3B5N D;  1SQX J;  1SQX G;  3F5H A;  3HE4 B;  1OFC X;  1U7M A;  1CI6 B;  2IPP A;  2ZVO B;  3LW5 J;  4IL6 H;  3CME P;  1JCD A;  4D6T E;  2D2C D;  2QJK C;  5M1B A;  2IFN A;  2WSE H;  1ZN5 A;  2IZ0 A;  1USE A;  2IFM A;  4BRY B;  2H7H A;  3CLQ A;  3CXH E;  3U59 A;  5KKZ B;  5GTI H;  3GLM A;  1HBW A;  3L70 D;  1R5S A;  2KI7 B;  2KNC B;  4L73 A;  2NPS D;  3NFQ A;  2N1T C;  2Y9Y A;  1SQX E;  2XKM A;  5APS A;  5KJ7 D;  3TNU B;  1N7L A;  4ZNC A;  3Q5P A;  2YIU C;  1OWA A;  3FX0 A;  2JDI H;  3H1L E;  1VQK P;  3AE6 C;  4WWI A;  1Q90 D;  1YJN P;  1N73 C;  2E42 A;  3HRN A;  2M8R A;  2AXT H;  1G1I A;  1FS0 E;  4PJ0 H;  2Z5I A;  4U3F D;  1QL2 A;  2HYN A;  3RBZ A;  1SFC D;  1L4A D;  5BU8 B;  2WSC H;  1T3U A;  4OWF A;  5APW A;  2M3E A;  2LXB A;  4NPD A;  3NTN A;  3L73 G;  1AV1 A;  3VN0 A;  5B5E H;  1GL2 D;  4PV1 D;  4C7R A;  2E43 A;  1BGY J;  2FYU G;  3H1L G;  1LJ2 A;  4LC1 A;  2AXC A;  2R5D A;  5APX A;  3CCU P;  1MFZ A;  1LTG C;  1T6A A;  1RQV A;  2B88 A;  2B87 B;  2IYO A;  2IZ1 A;  1ZRT D;  2JP3 A;  2R32 A;  2WPQ A;  2K9J B;  2IYP A;  3BCC J;  3CWB D;  3H1H D;  1NTZ D;  3H1J E;  1SQV E;  1SQX D;  1JO5 A;  3O8Z A;  1JY3 P;  1VQ9 P;  1UIX A;  2LKM A;  1OW8 A;  3L71 G;  3H1I G;  4WBA A;  1LP1 B;  1DEB A;  1EDK A;  1NKN A;  1M56 D;  2FYU E;  1FBM A;  3BAT A;  4EOT A;  4NPF X;  1NU1 G;  1RE3 A;  2FXM A;  3MIW A;  3CCR P;  1SVF A;  3W67 A;  3G6E P;  1QX8 A;  1CI6 A;  1Q2N A;  3V2P A;  2OTJ P;  2NZ2 A;  1L4A A;  3OAK A;  1VQO P;  1SQP D;  1LT9 C;  2XND H;  1ZME C;  4I6M C;  1M1J B;  2NPS C;  1OW7 A;  1Q82 Q;  4A7P A;  1NTZ K;  1PP9 E;  1R5L A;  1YIT P;  3BVH A;  3OW2 O;  1YQ3 C;  3TF5 A;  1IFN A;  1LTS C;  1Q81 Q;  1X9V A;  4N6J A;  3CCM P;  3B5N C;  1KTM A;  3SSU A;  1BCC J;  1QVF O;  2ZT9 D;  1P84 E;  1NU1 J;  3GHG B;  5B66 H;  1NTM G;  1OW6 A;  1BGY E;  2K37 A;  1SP4 A;  1P84 H;  2KNC A;  3NXS A;  3OA7 A;  1JTH A;  3H1I J;  3SFD C;  1L4A B;  3AE5 C;  2QRX A;  2KS1 A;  3L73 D;  3O6Q A;  3PTZ A;  4ASV A;  5CCG D;  1PP9 D;  2CPS A;  3M0D A;  1L0L J;  2KSJ A;  3SFE C;  1S4X A;  3QWO C;  3L72 D;  4D6T G;  2WTY A;  2WMM A;  3CC2 P;  1VQ7 P;  5AVX B;  1KN7 A;  1NKZ B;  3BCC G;  1N86 A;  2YKO A;  2QJP C;  2XZR A;  4KHX A;  5KKZ C;  1EQ7 A;  2YXQ B;  2OYI C;  3H1H G;  2C0W A;  1NTM E;  1H0T B;  1KIL C;  2OYH B;  5AVW B;  3Q3D A;  4IFD K;  5AVU B;  3H32 B;  3GHG A;  3R2P A;  2N1T B;  2FKW B;  3L71 D;  5APT A;  3VYI A;  2DW3 A;  1RE4 C;  1HTL C;  1RQU A;  4TLF A;  3S4R A;  1BE3 E;  4RES B;  1FZC B;  1VQ5 P;  5KTB A;  1SFC C;  1NTZ J;  1OZH A;  2RMZ A;  1QVG O;  1CW5 A;  3L72 E;  3A3Y B;  4I7Z B;  1HF9 A;  1LNQ A;  3T97 A;  2I1K A;  3E1I A;  1S1C X;  1ZXG A;  2KS1 B;  3KZI H;  3L74 J;  1AQ5 A;  2GA1 A;  3VTP C;  3W68 A;  1NO4 A;  2POH A;  3A0B H;  2NRG A;  2A06 G;  3WU2 H;  2BEZ F;  2FFD A;  3A0H E;  1SQB J;  3WU2 E;  3EQ2 A;  3RK2 C;  2ZT9 C;  3CC7 P;  4JYC A;  1DIP A;  1A02 J;  3CX5 D;  4WY4 B;  3H1J G;  2BCC E;  2E76 D;  2ZXE B;  1NGM B;  1FZF A;  2Z5H A;  5KAI E;  2JEE A;  2ZJS E;  4H13 C;  1GK4 A;  3L70 E;  4KJM A;  3TSI A;  1L0L D;  1KB9 I;  2CK3 H;  3KHU A;  4M3L A;  3H1I E;  1KMI Z;  3FXE A;  4L74 A;  3BCC D;  4H44 D;  3G9R A;  4LLH A;  1NOH A;  1M57 D;  2QE7 H;  1EZV I;  5EFW B;  5TIS H;  3RL0 B;  2ITA A;  3CL3 D;  5DJT B;  2WIT A;  3L4F A;  1PPJ E;  3RL0 C;  1M8O B;  1KIL D;  1PGQ A;  1JOC A;  1W2E A;  4I1L A;  3RK3 B;  1RF0 A;  5KLV G;  1IFD A;  2GUS A;  1S5L E;  2Y0E A;  3V4Q A;  1TU3 F;  1E79 H;  1K05 A;  4U7J A;  2K3R A;  4OH8 B;  4RO0 A;  1IFP A;  2UWJ E;  1HGV A;  1VL2 A;  2YMK A;  1WMK A;  3L75 E;  3IF4 A;  4R4L A;  3V2R A;  3EWK A;  3BRV B;  2BEQ D;  2BCC J;  2QJY C;  5AVR B;  1PPJ G;  3TNU A;  1ZV8 A;  1K9M Q;  2E76 B;  2OGU A;  2QIW A;  1N7S C;  4Y28 J;  5AW1 B;  3H32 A;  5L8R J;  5CCG A;  2J59 M;  4L75 A;  1IK9 A;  1SQV G;  1KQG B;  2A06 D;  5DJU B;  1NAY A;  1T2K D;  3EFG A;  1OMI A;  1KYO I;  1DX7 A;  1R8E A;  3B8E B;  3U1A A;  1SQX K;  5CBN A;  3BCC E;  1IJD B;  3JCU E;  1K04 A;  3N7N A;  3PJS K;  1GZL A;  3WUU A;  2Q3I A;  2QJP B;  4IFF A;  4TT3 H;  1LTJ C;  1M7L A;  1NTK K;  1NTK G;  1L2P A;  1SQQ K;  1VF5 C;  1KB9 D;  2FYN B;  2HG5 D;  3NMD A;  1MV8 A;  3RK3 E;  1FDM A;  4HYT B;  5AW6 B;  1GU5 A;  3TGU E;  2ZYD A;  1NTZ E;  1PP9 G;  1RF1 A;  3CCV P;  5K5G B;  1BE3 J;  3C1L A;  1K8A Q;  3CWB J;  3FWN A;  3IFM A;  5BVZ A;  1LT9 B;  2E74 D;  2G8Y A;  2FXP A;  3GG2 A;  3M9B A;  2NPS B;  1T3J A;  1J1E C;  2CPB A;  2KUB A;  2WPV B;  3HE4 A;  4UB6 E;  1SQQ J;  3P7K A;  1EDI A;  4K35 A;  1KD1 Q;  5APQ A;  2P7J A;  3FXD A;  4U3F G;  3TGU G;  3CMA P;  1IFJ A;  3CD6 P;  1YQ4 C;  2WSC J;  5AW5 B;  3TK1 A;  2W6B A;  4IFM A;  1HGZ A;  3S9O A;  4EYY Q;  3CPW O;  1NHL A;  3L75 D;  5KAF H;  1IC2 A;  2NPS A;  2WQY C;  4AQR D;  1KFN A;  3KDP B;  3Q5S A;  1L0L K;  1WT6 A;  1MUU A;  2ZVN B;  3H1L D;  1PGP A;  3JSV C;  1KIL E;  1YJW P;  3MGN A;  5CCH A;  2Y0D A;  1JY2 N;  2I8D A;  3H1K G;  2BCC G;  1BCC E;  2V7Q H;  3USS A;  3V5B A;  4HJG H;  1SQP E;  1KB9 E;  1SQB D;  1T2K C;  2Y9Z A;  1EZV D;  1ZP0 C;  1VQ4 P;  3AED C;  1EZV E;  5AW0 B;  3G3Z A;  3U1C A;  2A45 G;  4KT0 J;  2M5A B;  4WY4 D;  2YKQ A;  1ZOY C;  2QVA A;  1NVO A;  3H1I D;  3AEE C;  3HE5 A;  3CXH I;  5CMZ A;  1M1J C;  5KLV J;  1NU1 D;  3AE4 C;  3M0D C;  2VRS A;  1FZG A;  1VPC A;  2I1J A;  3MUD C;  3CX5 I;  2JR8 A;  2O01 J;  1YHQ P;  1SQP G;  4DZO A;  1ZW0 A;  2OYH A;  5AVZ B;  5CJ0 A;  1LTA C;  1RY3 A;  3V4W A;  1LWU A;  5APU A;  5AW9 B;  5KAI H;  2E74 C;  1NH4 A;  4H13 D;  1GDT A;  3GHG C;  3D6Z A;  3B4S A;  3HUS C;  2A45 H;  3CCS P;  5AW8 B;  3AEF C;  2HLO A;  2J58 A;  3A7O A;  1M1K Q;  4L76 A;  1SS1 A;  4ZKP A;  2YMY A;  1JY2 O;  4GDO A;  2PRR A;  4UB8 H;  2P2U A;  5E79 H;  3E1R A;  3HTK A;  4H44 B;  4HKZ H;  3T97 B;  4DT0 A;  1GL2 B;  2KP8 A;  2OTK E;  3A0B E;  3EFF K;  4H0L D;  3KXD A;  1FJK A;  2QEX P;  1FOS E;  1IFM A;  4C7N A;  2FYU D;  1LTJ B;  1VF5 B;  3WMM 0;  2OYI B;  2QG4 A;  2W8Z A;  2KYV A;  2IBZ I;  4PD4 I;  3RK3 D;  1VQM P;  1BDC A;  2K88 A;  3M9H A;  3VMA A;  2XU6 A;  1SQV D;  2BAS A;  3B5N A;  2YIU B;  3CWB E;  3F89 A;  4JPZ B;  1NTZ G;  3P8M C;  3CCL P;  1SFC B;  3HD7 C;  2R3C A;  1QEX A;  2E75 B;  2Q1K A;  1PGO A;  3CCJ P;  2KZI A;  1GK6 A;  1FZB A;  2FY8 A;  3LW5 H;  1FZC C;  1AFO A;  2PAJ A;  3Q2Y A;  1U7J A;  3CC4 P;  3KQG A;  1BDD A;  4PJ0 E;  1GL2 A;  1LTB C;  3VMY A;  3ZDM A;  1J1D C;  1BGY D;  1HWT C;  1BSH A;  2P67 A;  1L0N D;  1OX3 A;  1H0T A;  4U3F E;  3AEB C;  3IR9 A;  2AEF A;  3A5T A;  1AJY A;  1N73 A;  2R5B A;  4EIJ A;  3B71 A;  1VQ8 P;  2XV5 A;  1FOS F;  2JKV A;  5AW3 B;  5AVT B;  1X8Y A;  2OAR A;  4I2L C;  4R4M A;  5TIS E;  4WY4 C;  1OVR A;  4LGD E;  3PH0 A;  2W27 A;  1SFC A;  1FZA A;  1H88 A;  1BCC G;  3L75 J;  1VQP P;  1KFM A;  1EDL A;  1URQ D;  1NTM D;  1FU1 A;  2LR2 A;  2WSF H;  1OXZ A;  4H0L C;  4DOJ A;  1E5W A;  5TJH A;  3AEC C;  5CCG C;  2WZ7 A;  2G3A A;  5E79 E;  2HOD B;  2WT7 B;  2C9N Y;  2H89 C;  4D6T D;  3SWK A;  1DD3 A;  1XTG B;  2B9B A;  1Y9B A;  1SQP K;  1ZRT E;  3CX5 E;  2KXP B;  2BCC D;  4GOF A;  3JCU H;  3H1H E;  3IAO A;  2JWA A;  3P8C E;  3H1J D;  2V7Q J;  1S72 P;  4GKG A;  4JYB A;  2AXT E;  1GMJ A;  1EC5 A;  2K9J A;  1A02 F;  1VQ6 P;  2KOG A;  3D6Y A;  1RE3 C;  4CPG A;  2C9L Y;  1BE3 G;  1OVV A;  3KPE A;  2WSS H;  3VMX A;  1IK7 A;  3HE5 B;  4C7N B;  2H88 C;  4EI2 A;  2XNX A;  2E76 C;  2OYO A;  3H1K J;  1LP1 A;  4OVN F;  1H8A A;  3M91 A;  4OGQ B;  4O9B A;  3P32 A;  4OGQ C;  1Y8A A;  2K9Y A;  2N1T A;  1JB0 J;  3M9Q A;  2FYU K;  1RHZ B;  2JJL A;  4BWN A;  4YXD C;  1KYO E;  1UII A;  2FXO A;  4H44 C;  5KJ7 C;  3AEG C;  2KZJ A;  1IZN B;  1NAF A;  3KYQ A;  3N4X A;  1SQV K;  3Q5R A;  2JWD A;  1S5L H;  1VQN P;  2QM7 A;  4K3A A;  1Z56 A;  2H8P D;  3VMZ A;  3L74 E;  2FYN C;  3HD7 D;  1SQQ G;  2OTL P;  1LWU B;  2YO3 A;  3UIA A;  3LIE A;  1DH3 A;  3O6Q B;  1LTT C;  3CXH D;  4IOI H;  1QL1 A;  3RK3 C; 
#chains in the Genus database with same CATH homology
 5KLV G;  3CWB G;  1L0L G;  1L0N G;  1PP9 G;  1SQB G;  3L70 G;  2A06 G;  1KYO H;  1KB9 H;  3L71 G;  3H1I G;  1BE3 G;  4D6T G;  3L74 G;  3L72 G;  3BCC G;  1NU1 G;  1PPJ G;  3H1H G;  3H1J G;  1BCC G;  1BGY G;  1SQP G;  1SQV G;  4U3F G;  3TGU G;  1NTZ G;  1SQX G;  1EZV G;  3L73 G;  2FYU G;  3L75 G;  3H1L G;  2IBZ G;  1SQQ G;  3CXH H;  4PD4 H;  1NTK G;  3H1K G;  1NTM G;  2BCC G;  3CX5 H;  1P84 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...