1BGYG

Cytochrome bc1 complex from bovine
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
b'GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPAAYENDR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 22
structure length 81
sequence length 81
chains with identical sequence S
ec nomenclature
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1bgyG00
2FYUG 1L0LG 2A06G 3H1IG 1SQBG 3L70G 4PD4H 4D6TG 2BCCG 3L72G 1PP9G 2IBZG 1BCCG 3L74G 3H1HG 5KLVG 1SQVG 1NTZG 1KB9H 3CWBG 3L73G 1SQXG 3H1LG 3L71G 3TGUG 4U3FG 3BCCG 1BGYG 3H1KG 1KYOH 1P84H 1EZVG 1L0NG 1SQQG 1SQPG 1NU1G 1PPJG 3CX5H 3CXHH 3L75G 1NTKG 1NTMG 3H1JG 1BE3G
chains in the Genus database with same CATH superfamily
1L0LG 1JUNA 1URQC 2H88C 1PL5A 2KYVA 3KZIH 2IYPA 2IX7C 3SWFA 1PV3A 5APSA 3KXDA 1YJNP 1URQD 4BWNA 4GODA 4BXLA 3H1IE 2Q9IA 1VQKP 2Y9YA 1NKNA 2HLOA 5GTHE 2QSIA 2BCCG 3NXSA 1DEEG 4OH8B 3TGUE 1HVVA 3T97A 1SQQK 1IFDA 3V6IA 4C46A 4W80A 1RE3A 3H1HJ 2H89C 1LWUB 4LGDE 3B5NA 1IFNA 4WY4B 3F89A 5EFWB 1QVFO 5TISH 2OQQA 2GUVA 2KUBA 4IL6H 2WITA 1NAYA 3M0DA 2ZVNB 1SQXG 3H1JE 1HTLC 1LTJA 3TK1A 3AE9C 2I1JA 4H13B 3OJAB 2E5YA 2B87A 1BSNA 3G6EP 1L2PA 2WT7B 2OTJP 3RK3C 3HD7C 3PP5A 1SQVJ 1KYOD 2HODB 1SQQD 2POHA 1PPJD 1ZOYC 3HD7D 3RK3D 2C9LY 1RQVA 1TU3F 4PD4D 4XA4A 1NTMJ 1IFMA 2OYIC 1L0NK 2XU6A 4Z1MH 1PIXA 3BRVB 1A02J 2A45G 1J1EB 3H1KJ 2A06D 4JBZA 1FDOA 3V2NA 1VPCA 3F5HA 2AEMA 2Z5HA 3GG2A 3W68A 2FYNB 5KLVG 1MKMA 4OGQC 2VRSA 4N6JA 1EDLA 3A0HE 3H1ID 4OGQD 3VMAA 2L91A 1IK7A 3K5BA 3CLQA 2OTLP 1HGZA 1L0LJ 3O6QB 1NYHA 2OYOA 4I7ZC 3BVHA 3H1LJ 3L70E 1EXJA 2R3SA 5KKZB 1MUUA 1JY2O 5APYA 1AVOA 1RY3A 3CMEP 4TLFA 4EIJA 1H0TB 3FWLA 3FX0A 2BCCJ 1KMIZ 1ZXGA 2MJZA 3OAKA 1KZUB 1FZAA 2IFNA 2M3EA 3L71J 2DW3A 3Q3DA 2W8ZA 4IOIH 2KSJA 2FYUJ 2JR8A 1W5CE 1RF0C 1ZN5A 2K9YA 3HE4A 1GD2E 1BDDA 2WPQA 1S4XA 2WPRA 1NTKE 3BCCG 1N7SC 1URQA 2N9BA 3RK2C 3WU2H 3HUSA 3AE4C 3P8MC 3Q5RA 1N7SD 4D6TG 1NTZE 2KXPB 1PP9G 3B8EB 3C1LA 1ZP0C 3RK2D 3L4FA 3E1IA 1UIIA 1GW4A 4HJGH 3L74J 1S72P 3S4RA 1Q2NA 3MZWB 2A45I 4OVNF 2IDBA 1S2EA 2YKQA 3S9OA 3Q5PA 2M3BA 3AE6C 3IAOA 1VQOP 2R5BA 2IBZI 4GOEA 2FXPA 1AV1A 1SS1A 2W6AA 3WUVA 1VQPP 3VYIA 1L4AC 3R4YA 4WB4A 2O1JA 4WVZA 1L4AD 1P84I 1HUCA 1NU1G 3VN0A 3O6QA 1NTKK 1QX8A 3JCUH 5CCHA 1FJPA 2ZAEB 3L70D 4I1LA 1JY3P 2C0XA 5APUA 1SQXE 1H8AA 2O01N 1FDMA 2J58A 1LTSC 2NZ2A 1OW6A 1JOCA 1RF1B 4U3FD 3OW2O 4DJGA 5B5EE 1LTIC 2WPVB 4L73A 5H2FH 3HTKB 3HRNA 2Q1KA 3JCUE 1GK6A 4PV1C 1SLQA 4TT3H 1EDJA 4XFJA 3AEEC 1NTKD 4PV1D 4C7NB 1DIPA 1GZLA 2PAJA 1JY2P 1QL1A 1X22A 3CC4P 4DOJA 1BCCG 1H88A 5KJ7A 3H32A 4PJ0E 1S5LE 2E74C 3WUUA 1NAFA 2KIKA 1SFCB 3CXHI 5KLVE 2P7JA 3OA7A 3RGUA 3SSUA 3FGAD 2KLVA 3U1CA 1LJ2A 1LTGC 3LW5J 1BE3E 3RBZA 3MUDC 1VQ5P 1PGOA 2WSCJ 1FZCC 1OW7A 3KQGA 3U1AA 1SQBJ 2B89A 3H1HG 4GDOA 1KQFB 1GU4A 1AFOA 3GLMA 3CCUP 2PP6A 2N1TC 5B66E 1RHZB 3SWKA 1RF1A 1CI6A 1YITP 2SPZA 3CL3D 1LTBC 4N3YB 2WSFJ 4EDFA 1N7SA 1IFPA 1FDIA 2CPSA 1GK4A 1KYOH 4N78E 5AW2B 3MIWA 3T97B 3GMAA 3CX5I 4CPGA 1AA0A 3B5NB 3BCCE 5CBNA 4ASWA 2CK3H 1SQVG 3CWBD 3W67A 3L35A 1KB9I 2JKVA 4D6TE 4H44B 2QJYC 1PP9E 2PGDA 4UB6H 1YJ9P 2P58A 1L4AA 3I56P 4R4LA 2NPSA 1LTJB 4RJTA 2I8DA 4YPCA 3QWOC 4WY4C 5AVXB 1PGPA 4O9BA 3A5TA 2B87B 3IN6A 1NOHA 2ZYGA 1L0NJ 2E76C 4WY4D 1QGKB 1Q82Q 1Y9BA 5GTIE 2RN0A 5GTHH 2E76D 2ZT9B 3B4SA 2QJPC 1VQ7P 1NU1E 1BCCJ 3L37A 3P8CE 2K9JA 1YJWP 1KFNA 4RESB 2PRRA 1BE3D 3CCEP 3ZDMA 2W6JH 3RL0B 4QMAA 1E5WA 2QJKC 5AVWB 2YO3A 5CCGC 1LP1A 4K35A 3H1LG 3BASA 3G3ZA 5CCGD 1BGYJ 1GMJA 3PHLA 1YI2P 1KFMA 1XTCC 1KILE 4W7YA 2WWWA 2KI7B 4JPZB 5CJ4A 4IFFA 2W6BA 3L71G 3CX5E 1LT9A 1LTTC 2FFDC 1YIJP 4N78D 1LNQA 2FYUG 1USEA 4XE5B 1KB9E 2HFED 5AW3B 3GW6A 3WUTA 4KHXA 2RH0A 4ASVA 2O1KA 2QM8A 3N4XA 3IFMA 3VOPA 5BU8B 1HF9A 4D6TD 2QEXP 5AVTB 2M5AA 1PP9D 1W2BO 2QM7A 2B9BA 1VQ6P 3L74G 3CCQP 2Y0DA 3AE3C 1M1JA 1FS0E 1G2CA 2WQYC 4HH2A 4Y99B 2Q6QA 3HE4B 5E79H 3VMXA 3A3YB 1EZVG 2JP3A 3CCRP 3A0HH 1J1DC 1URQB 1ZLLA 3KDPB 2HR3A 3HUSB 2N1TA 2WTYA 1R8EA 3L36A 1VQLP 3I55P 1NU1D 4U3FJ 4KJMA 2J59M 3P8CD 3H1HE 2BASA 1DEBA 2IBZG 3AEFC 4IL6X 2ZVOB 2YIUB 3NMDA 2OYHC 3L73J 5E79E 1PGQA 1NHLA 1A02F 2R44A 3MGNA 1KILC 2KB7P 2JEEA 1YTZI 1DH3A 2RMZA 2WZ7A 1KILD 5KLIB 3TGUD 1Y8AA 5APXA 2Q3EA 2CPBA 3A7OA 1SQVE 3L75J 2KK7A 3V2QA 1T3UA 2IZ1A 4GOFA 2J5UA 1GL2A 4GT1A 1VL2A 3MP7B 2BEQD 2KS1A 1JMMA 1EDKA 3RK3B 3HD7B 1NTME 2O01H 3G4SP 1ZMEC 3RL0g 3H1JD 4I2LC 2D2CC 2YXRB 1SQPJ 1IFIA 2G8YA 1QLED 2AEFA 1FBMA 2D2CD 3H1KE 4L75A 1J2JB 1D7MA 3PJSK 2OYIB 2ZXEB 1YBKA 3O8ZA 1X0TA 1OX3A 2H43A 5M1BA 1EZVI 5CCGA 1X9VA 2M8RA 3H25A 1T2KC 2E75B 4UB8E 3RBXA 2YXQB 1R5LA 3VTPC 1T2KD 1L0LE 5DJTB 1FZFA 2E42A 2ZYAA 5AVSB 1SQBG 2KSEA 3H32B 2GM4A 3TF5A 3H1LE 3H1HD 2IYOA 2XZRA 4C7RA 3KYQA 1NTMK 2KOGA 1M57D 4IFDK 3CWBJ 2JJLA 2BCCE 1SQQG 1PPJG 3M06A 3GHGC 1VQ9P 5B5EH 3AE1C 1DD3A 3CC2P 3L71E 4AYCA 4B86A 2V7QJ 3M9HA 1LT1A 1SFCC 3M9QA 2FYUE 2WSSH 5APQA 1SP4A 1SFCD 3AEGC 1NTZK 2ZYDA 2A06G 1FE6A 1JNMA 3HD7A 2P10A 3L72J 5AVQB 2JWDA 2JWAA 3AE2C 1CI6B 1L0LK 2Q5UA 1M7LA 2A45H 1OFCX 3QH9A 1N73C 4PJ0H 1NTMD 1N7SB 3CC7P 1S5LH 4ZMDA 1YYCA 3L74E 2OYIA 3RK2B 2KNCA 4NPFX 2PFXA 3NFQA 3P7KA 3H1KD 3V2PA 1LTAC 4HYTB 1IO4A 1L0NG 3CMAP 2IFMA 3MD0A 2P1JA 4A7PA 4BRYA 3D6ZA 1RE4C 1OXZA 3EFGA 3CCLP 1NTZD 1JCDA 2FYUK 1L4AB 1YHQP 1AQTA 1RE3C 2E5TA 4JF7A 2NPSB 2FY8A 2IBZE 1L0LD 1SQXK 5B66H 2AXTH 3WMM0 1NH4A 1JTHB 4JQ0D 4EYYQ 3B5ND 3AEDC 1P84E 1X79B 1OWAA 1BGYG 2NRGA 4M3LA 1N2DC 1KYOI 1CSBA 1Q90D 4RO0A 2H8PD 3AEAC 1KQGB 1XTGB 1S5LX 2BCCD 2M0BA 2ZXXA 2XNXA 4PD4I 1G1JA 2K9JB 2IZ0A 4KT0J 2WVRA 1FZGA 2WPSA 5DJUB 3D71A 1VF5C 2FYUD 2AXTE 2V4HA 1LP1B 1SQQJ 1RF0A 1EDIA 1VF5D 2P67A 1KORA 1S1CX 1SQXD 2XNDH 1T8ZA 3JSVC 1WRGA 1JM0A 1OIPA 5KLVK 3RL0C 2QG4A 1LT9B 3USSA 3L74D 5C39A 4Y28J 1QVGO 3RL0D 2QRXA 1E79H 1MFTA 1VQNP 5GTIH 2WSEH 4WBAA 1IK9A 4NPEA 1Q7YQ 3TYYA 1JO5A 2E74B 5BU5A 1FZEA 3G71P 4LLHA 3EWKA 1FU1A 1EQ7A 3H1IJ 3CD6P 1LWUC 2QVAA 5AVZB 3E1RA 5AVYB 1JEKA 2M5AB 4U3FG 3GHGA 3CXHE 5KAIH 1SQBE 1JTHA 1Y47A 4LC1A 3TGUJ 3SWYA 1M1JB 4IFMA 2IBZD 1FZCB 1G2CB 1KD1Q 1K04A 1OW8A 2GUSA 1QEXA 1JMBA 5KLVD 1PPJE 3A0BE 3L73G 3RK3E 1NVOA 4ZNCA 1P84D 5CMZA 3R2PA 5TJHA 4H13C 3CX5H 3CCVP 2N1TB 2FXOA 2WMMA 2FKWB 3H1JJ 1GU5A 4U7JA 3GF3A 4H13D 2K37A 4R4MA 5APTA 3FWNA 1KB9H 5KAIE 1HJ0A 4OWFA 2A06E 3MHVA 2XV5A 3LIEA 3L75G 3KHUA 5CBOA 2K3RA 3HUSC 1BDCA 1GTWA 3V4WA 2LKMA 1LGHB 1SQBK 1FZBA 1X8YA 1J1EC 1W2EA 3C8VA 1YQ3C 1RE4A 1SQPG 3EQ2A 1RQUA 1U57A 3AECC 4DT0A 2QJYB 5AW8B 3HE5A 1VQ8P 2YIUC 2FYNC 4H0LB 3A2AA 1VQMP 1U7JA 3GF7A 1NU1K 1L0NE 4AQRD 3BCCD 3G9RA 3JC22 1AVYA 3V2RA 1GL2B 2FYZA 1WMKA 2JO1A 3KZIE 1JB0J 1BCCE 1KTMA 2KS1B 3PH0A 2E76B 1ZRTE 5KLIC 3D6YA 4DCKA 1KQLA 1NGMB 1FC2C 3MUDA 5KKZC 2QJPB 3CCJP 5AW9B 1FZCA 1WT6A 1ZR4A 5CCHC 4JYBA 3CXHD 3VP9A 1SQBD 5AW4B 1FOSF 2Y9ZA 3VMZA 1IC2A 2HPCA 2MKVA 3IR9A 3L70J 5CCHD 2FBWC 1BGYE 1FAVA 2N9YB 2AEJA 2AXCA 3CWBG 2QJKB 2R32A 4YXWH 5TISE 2Y0CA 1GDTA 3CI9A 2ZJSE 2QA4P 4IL6E 2FXMA 3V4QA 2RKLA 1QL2A 2H7HA 1K73Q 3Q1MA 1OMIA 1USDA 1UIXA 1G1IA 1JY3O 2FFDB 1GW3A 2E75C 1NTKJ 3L72G 1FOSE 4WWIA 3CCMP 1PZQA 4K3AA 2E75D 5APWA 1NTZJ 2ZFCA 1YTZT 3AEBC 5KJ7C 5AW7B 2L5GB 3CX5D 2O01J 1BE3G 2K1AA 1S9KE 1LWUA 5KJ7D 2YO2A 1M1KQ 2LXCB 2R5DA 4WY4A 3PRJA 3H6PA 1KB9D 4GIFA 5L8RJ 4UB8H 1L0ND 3VMYA 2C9NY 2LXBA 1FJKA 4U3FE 1BCCD 3M0AA 1MV8A 1ZRTD 1J1DB 2ITAA 3P32A 2KLUA 2WT7A 3Q2YA 2KNCB 4EI2A 1M90Q 2HODA 3L73E 1KQSO 3AE7C 1RF1C 3BRTB 1BGYD 2UWJE 4BRYB 3FXDA 5CJ0A 1SQXJ 5AW0B 2OYHB 1Z56A 2OGUA 3AE8C 4OGQB 2Z5IA 4HKZH 1SQVK 3CPWO 1PGJA 1EC5A 1M8OB 1ZV8A 1KILB 1AQ5A 2OTKE 1KC8Q 3L75E 2FFDA 3I5CA 2KZJA 1BSHA 1T3JA 4I7ZB 1CW5A 1HJBA 4YXDC 1K05A 1HGVA 1SQPE 2NPSC 3WU2E 1RH5B 2QE7H 1PFIA 2KZIA 4NPDA 5AVUB 2NPSD 4YTPC 1HBWA 1IFJA 3PLNA 1NKZB 2D2CB 1SVFA 4I6MC 1S9KD 1SQVD 1T6AA 5KLVJ 1DX7A 1H0TA 3IF4A 1KN7A 2E43A 1IJDB 2I1KA 3VP8A 2BEZF 3H1IG 2V7QH 5KTBA 2YKOA 1BE3J 2K88A 1OVVA 4ZKPA 1OVUA 2Z4EA 3FXEA 4HB1A 1HWTC 3SFDC 3TGUG 1CZQA 1EZVE 1P84H 2YNYA 1U7MA 2YMKA 5BVZA 2XKMA 2O3JA 3CWBE 3E7KA 2P2UA 3ABVC 2OYHA 1SQPK 5AVVB 3L73D 1M56D 4RKUJ 1N86A 2W27A 4GKGA 1KILA 2HG5D 1LT9C 3B5NC 3H1JG 3GHGB 1JCCA 2Q7CA 3TNUB 3H1LD 1NO4A 4H44C 1AJYA 1OVRA 2QIWA 5H2FE 3M0DC 4L76A 3L72E 3BCCJ 3L75D 3N7NA 1IZNB 2LR2A 4H44D 3D70A 1VDFA 1MZ9A 3AE5C 2E74D 1Q86Q 1LTJC 4D6TJ 1OZHA 3B71A 3KPEA 1PP9J 3LIDA 4JYCA 3L71D 5K5GB 3SFEC 1SQPD 1M1JC 1EXIA 1HH0A 1R5SA 1N73B 2ZT9C 2JDIH 1MFZA 3MTUE 3M9BA 2XDJA 3LW5H 1NWQA 3M91A 2ZT9D 1KV4A 3PTZA 4W7ZA 1JY3N 3V5BA 3EFFK 2WSCH 4PV1B 4DZOA 2WSEJ 3CXHH 3TSIA 2W90A 1NU1J 2N1TD 5KAFH 2B88A 4EOTA 1S3JA 3C9IA 2YMYA 3NTNA 3HTKA 1YQ4C 2IPPA 3HE5B 3II6A 2Q3IA 1DD4A 3A0BH 2KP8A 3ITKA 3UIAA 1EZVD 1N7LA 2WSFH 1ZW0A 3L70G 5CHXA 4PD4H 3Q5SA 1N8RQ 4C7NA 5AW6B 2Y0EA 5APVA 1JY2N 2GA1A 3CCSP 4H0LC 5KAFE 1NTMG 3TNUA 3TDKA 1Q81Q 2HYNA 2R3CA 2W83C 4H0LD 1SFCA 1KYOE 4AUWA 3S1KA 4L74A 1SQQE 3BATA 5AVRB 1GL2C 3H1KG 2HPCB 1K8AQ 4PD4E 1NTKG 1ZR2A 1GL2D 3L72D 3U59A 1VF5B 4MN4C 1VQ4P 4ZKUA 1K9MQ 1H89A 2C0WA 1NTZG 2YKPA 4Y99C 1N73A 4UB6E 5AW1B 2OARA 5AW5B 2G3AA 1NJIQ
chains in the Genus database with same CATH topology
2FYUG 1L0LG 2A06G 3H1IG 1SQBG 3L70G 4PD4H 4D6TG 2BCCG 3L72G 1PP9G 2IBZG 1BCCG 3L74G 3H1HG 5KLVG 1SQVG 1NTZG 1KB9H 3CWBG 3L73G 1SQXG 3H1LG 3L71G 3TGUG 4U3FG 3BCCG 1BGYG 3H1KG 1KYOH 1P84H 1EZVG 1L0NG 1SQQG 1SQPG 1NU1G 1PPJG 3CX5H 3CXHH 3L75G 1NTKG 1NTMG 3H1JG 1BE3G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU G;  1L0L G;  2A06 G;  3H1I G;  1SQB G;  3L70 G;  4PD4 H;  4D6T G;  2BCC G;  3L72 G;  1PP9 G;  2IBZ G;  1BCC G;  3L74 G;  3H1H G;  5KLV G;  1SQV G;  1NTZ G;  1KB9 H;  3CWB G;  3L73 G;  1SQX G;  3H1L G;  3L71 G;  3TGU G;  4U3F G;  3BCC G;  1BGY G;  3H1K G;  1KYO H;  1P84 H;  1EZV G;  1L0N G;  1SQQ G;  1SQP G;  1NU1 G;  1PPJ G;  3CX5 H;  3CXH H;  3L75 G;  1NTK G;  1NTM G;  3H1J G;  1BE3 G; 
#chains in the Genus database with same CATH topology
 1L0L G;  1JUN A;  1URQ C;  2H88 C;  1PL5 A;  2KYV A;  3KZI H;  2IYP A;  2IX7 C;  3SWF A;  1PV3 A;  5APS A;  3KXD A;  1YJN P;  1URQ D;  4BWN A;  4GOD A;  4BXL A;  3H1I E;  2Q9I A;  1VQK P;  2Y9Y A;  1NKN A;  2HLO A;  5GTH E;  2QSI A;  2BCC G;  3NXS A;  1DEE G;  4OH8 B;  3TGU E;  1HVV A;  3T97 A;  1SQQ K;  1IFD A;  3V6I A;  4C46 A;  4W80 A;  1RE3 A;  3H1H J;  2H89 C;  1LWU B;  4LGD E;  3B5N A;  1IFN A;  4WY4 B;  3F89 A;  5EFW B;  1QVF O;  5TIS H;  2OQQ A;  2GUV A;  2KUB A;  4IL6 H;  2WIT A;  1NAY A;  3M0D A;  2ZVN B;  1SQX G;  3H1J E;  1HTL C;  1LTJ A;  3TK1 A;  3AE9 C;  2I1J A;  4H13 B;  3OJA B;  2E5Y A;  2B87 A;  1BSN A;  3G6E P;  1L2P A;  2WT7 B;  2OTJ P;  3RK3 C;  3HD7 C;  3PP5 A;  1SQV J;  1KYO D;  2HOD B;  1SQQ D;  2POH A;  1PPJ D;  1ZOY C;  3HD7 D;  3RK3 D;  2C9L Y;  1RQV A;  1TU3 F;  4PD4 D;  4XA4 A;  1NTM J;  1IFM A;  2OYI C;  1L0N K;  2XU6 A;  4Z1M H;  1PIX A;  3BRV B;  1A02 J;  2A45 G;  1J1E B;  3H1K J;  2A06 D;  4JBZ A;  1FDO A;  3V2N A;  1VPC A;  3F5H A;  2AEM A;  2Z5H A;  3GG2 A;  3W68 A;  2FYN B;  5KLV G;  1MKM A;  4OGQ C;  2VRS A;  4N6J A;  1EDL A;  3A0H E;  3H1I D;  4OGQ D;  3VMA A;  2L91 A;  1IK7 A;  3K5B A;  3CLQ A;  2OTL P;  1HGZ A;  1L0L J;  3O6Q B;  1NYH A;  2OYO A;  4I7Z C;  3BVH A;  3H1L J;  3L70 E;  1EXJ A;  2R3S A;  5KKZ B;  1MUU A;  1JY2 O;  5APY A;  1AVO A;  1RY3 A;  3CME P;  4TLF A;  4EIJ A;  1H0T B;  3FWL A;  3FX0 A;  2BCC J;  1KMI Z;  1ZXG A;  2MJZ A;  3OAK A;  1KZU B;  1FZA A;  2IFN A;  2M3E A;  3L71 J;  2DW3 A;  3Q3D A;  2W8Z A;  4IOI H;  2KSJ A;  2FYU J;  2JR8 A;  1W5C E;  1RF0 C;  1ZN5 A;  2K9Y A;  3HE4 A;  1GD2 E;  1BDD A;  2WPQ A;  1S4X A;  2WPR A;  1NTK E;  3BCC G;  1N7S C;  1URQ A;  2N9B A;  3RK2 C;  3WU2 H;  3HUS A;  3AE4 C;  3P8M C;  3Q5R A;  1N7S D;  4D6T G;  1NTZ E;  2KXP B;  1PP9 G;  3B8E B;  3C1L A;  1ZP0 C;  3RK2 D;  3L4F A;  3E1I A;  1UII A;  1GW4 A;  4HJG H;  3L74 J;  1S72 P;  3S4R A;  1Q2N A;  3MZW B;  2A45 I;  4OVN F;  2IDB A;  1S2E A;  2YKQ A;  3S9O A;  3Q5P A;  2M3B A;  3AE6 C;  3IAO A;  1VQO P;  2R5B A;  2IBZ I;  4GOE A;  2FXP A;  1AV1 A;  1SS1 A;  2W6A A;  3WUV A;  1VQP P;  3VYI A;  1L4A C;  3R4Y A;  4WB4 A;  2O1J A;  4WVZ A;  1L4A D;  1P84 I;  1HUC A;  1NU1 G;  3VN0 A;  3O6Q A;  1NTK K;  1QX8 A;  3JCU H;  5CCH A;  1FJP A;  2ZAE B;  3L70 D;  4I1L A;  1JY3 P;  2C0X A;  5APU A;  1SQX E;  1H8A A;  2O01 N;  1FDM A;  2J58 A;  1LTS C;  2NZ2 A;  1OW6 A;  1JOC A;  1RF1 B;  4U3F D;  3OW2 O;  4DJG A;  5B5E E;  1LTI C;  2WPV B;  4L73 A;  5H2F H;  3HTK B;  3HRN A;  2Q1K A;  3JCU E;  1GK6 A;  4PV1 C;  1SLQ A;  4TT3 H;  1EDJ A;  4XFJ A;  3AEE C;  1NTK D;  4PV1 D;  4C7N B;  1DIP A;  1GZL A;  2PAJ A;  1JY2 P;  1QL1 A;  1X22 A;  3CC4 P;  4DOJ A;  1BCC G;  1H88 A;  5KJ7 A;  3H32 A;  4PJ0 E;  1S5L E;  2E74 C;  3WUU A;  1NAF A;  2KIK A;  1SFC B;  3CXH I;  5KLV E;  2P7J A;  3OA7 A;  3RGU A;  3SSU A;  3FGA D;  2KLV A;  3U1C A;  1LJ2 A;  1LTG C;  3LW5 J;  1BE3 E;  3RBZ A;  3MUD C;  1VQ5 P;  1PGO A;  2WSC J;  1FZC C;  1OW7 A;  3KQG A;  3U1A A;  1SQB J;  2B89 A;  3H1H G;  4GDO A;  1KQF B;  1GU4 A;  1AFO A;  3GLM A;  3CCU P;  2PP6 A;  2N1T C;  5B66 E;  1RHZ B;  3SWK A;  1RF1 A;  1CI6 A;  1YIT P;  2SPZ A;  3CL3 D;  1LTB C;  4N3Y B;  2WSF J;  4EDF A;  1N7S A;  1IFP A;  1FDI A;  2CPS A;  1GK4 A;  1KYO H;  4N78 E;  5AW2 B;  3MIW A;  3T97 B;  3GMA A;  3CX5 I;  4CPG A;  1AA0 A;  3B5N B;  3BCC E;  5CBN A;  4ASW A;  2CK3 H;  1SQV G;  3CWB D;  3W67 A;  3L35 A;  1KB9 I;  2JKV A;  4D6T E;  4H44 B;  2QJY C;  1PP9 E;  2PGD A;  4UB6 H;  1YJ9 P;  2P58 A;  1L4A A;  3I56 P;  4R4L A;  2NPS A;  1LTJ B;  4RJT A;  2I8D A;  4YPC A;  3QWO C;  4WY4 C;  5AVX B;  1PGP A;  4O9B A;  3A5T A;  2B87 B;  3IN6 A;  1NOH A;  2ZYG A;  1L0N J;  2E76 C;  4WY4 D;  1QGK B;  1Q82 Q;  1Y9B A;  5GTI E;  2RN0 A;  5GTH H;  2E76 D;  2ZT9 B;  3B4S A;  2QJP C;  1VQ7 P;  1NU1 E;  1BCC J;  3L37 A;  3P8C E;  2K9J A;  1YJW P;  1KFN A;  4RES B;  2PRR A;  1BE3 D;  3CCE P;  3ZDM A;  2W6J H;  3RL0 B;  4QMA A;  1E5W A;  2QJK C;  5AVW B;  2YO3 A;  5CCG C;  1LP1 A;  4K35 A;  3H1L G;  3BAS A;  3G3Z A;  5CCG D;  1BGY J;  1GMJ A;  3PHL A;  1YI2 P;  1KFM A;  1XTC C;  1KIL E;  4W7Y A;  2WWW A;  2KI7 B;  4JPZ B;  5CJ4 A;  4IFF A;  2W6B A;  3L71 G;  3CX5 E;  1LT9 A;  1LTT C;  2FFD C;  1YIJ P;  4N78 D;  1LNQ A;  2FYU G;  1USE A;  4XE5 B;  1KB9 E;  2HFE D;  5AW3 B;  3GW6 A;  3WUT A;  4KHX A;  2RH0 A;  4ASV A;  2O1K A;  2QM8 A;  3N4X A;  3IFM A;  3VOP A;  5BU8 B;  1HF9 A;  4D6T D;  2QEX P;  5AVT B;  2M5A A;  1PP9 D;  1W2B O;  2QM7 A;  2B9B A;  1VQ6 P;  3L74 G;  3CCQ P;  2Y0D A;  3AE3 C;  1M1J A;  1FS0 E;  1G2C A;  2WQY C;  4HH2 A;  4Y99 B;  2Q6Q A;  3HE4 B;  5E79 H;  3VMX A;  3A3Y B;  1EZV G;  2JP3 A;  3CCR P;  3A0H H;  1J1D C;  1URQ B;  1ZLL A;  3KDP B;  2HR3 A;  3HUS B;  2N1T A;  2WTY A;  1R8E A;  3L36 A;  1VQL P;  3I55 P;  1NU1 D;  4U3F J;  4KJM A;  2J59 M;  3P8C D;  3H1H E;  2BAS A;  1DEB A;  2IBZ G;  3AEF C;  4IL6 X;  2ZVO B;  2YIU B;  3NMD A;  2OYH C;  3L73 J;  5E79 E;  1PGQ A;  1NHL A;  1A02 F;  2R44 A;  3MGN A;  1KIL C;  2KB7 P;  2JEE A;  1YTZ I;  1DH3 A;  2RMZ A;  2WZ7 A;  1KIL D;  5KLI B;  3TGU D;  1Y8A A;  5APX A;  2Q3E A;  2CPB A;  3A7O A;  1SQV E;  3L75 J;  2KK7 A;  3V2Q A;  1T3U A;  2IZ1 A;  4GOF A;  2J5U A;  1GL2 A;  4GT1 A;  1VL2 A;  3MP7 B;  2BEQ D;  2KS1 A;  1JMM A;  1EDK A;  3RK3 B;  3HD7 B;  1NTM E;  2O01 H;  3G4S P;  1ZME C;  3RL0 g;  3H1J D;  4I2L C;  2D2C C;  2YXR B;  1SQP J;  1IFI A;  2G8Y A;  1QLE D;  2AEF A;  1FBM A;  2D2C D;  3H1K E;  4L75 A;  1J2J B;  1D7M A;  3PJS K;  2OYI B;  2ZXE B;  1YBK A;  3O8Z A;  1X0T A;  1OX3 A;  2H43 A;  5M1B A;  1EZV I;  5CCG A;  1X9V A;  2M8R A;  3H25 A;  1T2K C;  2E75 B;  4UB8 E;  3RBX A;  2YXQ B;  1R5L A;  3VTP C;  1T2K D;  1L0L E;  5DJT B;  1FZF A;  2E42 A;  2ZYA A;  5AVS B;  1SQB G;  2KSE A;  3H32 B;  2GM4 A;  3TF5 A;  3H1L E;  3H1H D;  2IYO A;  2XZR A;  4C7R A;  3KYQ A;  1NTM K;  2KOG A;  1M57 D;  4IFD K;  3CWB J;  2JJL A;  2BCC E;  1SQQ G;  1PPJ G;  3M06 A;  3GHG C;  1VQ9 P;  5B5E H;  3AE1 C;  1DD3 A;  3CC2 P;  3L71 E;  4AYC A;  4B86 A;  2V7Q J;  3M9H A;  1LT1 A;  1SFC C;  3M9Q A;  2FYU E;  2WSS H;  5APQ A;  1SP4 A;  1SFC D;  3AEG C;  1NTZ K;  2ZYD A;  2A06 G;  1FE6 A;  1JNM A;  3HD7 A;  2P10 A;  3L72 J;  5AVQ B;  2JWD A;  2JWA A;  3AE2 C;  1CI6 B;  1L0L K;  2Q5U A;  1M7L A;  2A45 H;  1OFC X;  3QH9 A;  1N73 C;  4PJ0 H;  1NTM D;  1N7S B;  3CC7 P;  1S5L H;  4ZMD A;  1YYC A;  3L74 E;  2OYI A;  3RK2 B;  2KNC A;  4NPF X;  2PFX A;  3NFQ A;  3P7K A;  3H1K D;  3V2P A;  1LTA C;  4HYT B;  1IO4 A;  1L0N G;  3CMA P;  2IFM A;  3MD0 A;  2P1J A;  4A7P A;  4BRY A;  3D6Z A;  1RE4 C;  1OXZ A;  3EFG A;  3CCL P;  1NTZ D;  1JCD A;  2FYU K;  1L4A B;  1YHQ P;  1AQT A;  1RE3 C;  2E5T A;  4JF7 A;  2NPS B;  2FY8 A;  2IBZ E;  1L0L D;  1SQX K;  5B66 H;  2AXT H;  3WMM 0;  1NH4 A;  1JTH B;  4JQ0 D;  4EYY Q;  3B5N D;  3AED C;  1P84 E;  1X79 B;  1OWA A;  1BGY G;  2NRG A;  4M3L A;  1N2D C;  1KYO I;  1CSB A;  1Q90 D;  4RO0 A;  2H8P D;  3AEA C;  1KQG B;  1XTG B;  1S5L X;  2BCC D;  2M0B A;  2ZXX A;  2XNX A;  4PD4 I;  1G1J A;  2K9J B;  2IZ0 A;  4KT0 J;  2WVR A;  1FZG A;  2WPS A;  5DJU B;  3D71 A;  1VF5 C;  2FYU D;  2AXT E;  2V4H A;  1LP1 B;  1SQQ J;  1RF0 A;  1EDI A;  1VF5 D;  2P67 A;  1KOR A;  1S1C X;  1SQX D;  2XND H;  1T8Z A;  3JSV C;  1WRG A;  1JM0 A;  1OIP A;  5KLV K;  3RL0 C;  2QG4 A;  1LT9 B;  3USS A;  3L74 D;  5C39 A;  4Y28 J;  1QVG O;  3RL0 D;  2QRX A;  1E79 H;  1MFT A;  1VQN P;  5GTI H;  2WSE H;  4WBA A;  1IK9 A;  4NPE A;  1Q7Y Q;  3TYY A;  1JO5 A;  2E74 B;  5BU5 A;  1FZE A;  3G71 P;  4LLH A;  3EWK A;  1FU1 A;  1EQ7 A;  3H1I J;  3CD6 P;  1LWU C;  2QVA A;  5AVZ B;  3E1R A;  5AVY B;  1JEK A;  2M5A B;  4U3F G;  3GHG A;  3CXH E;  5KAI H;  1SQB E;  1JTH A;  1Y47 A;  4LC1 A;  3TGU J;  3SWY A;  1M1J B;  4IFM A;  2IBZ D;  1FZC B;  1G2C B;  1KD1 Q;  1K04 A;  1OW8 A;  2GUS A;  1QEX A;  1JMB A;  5KLV D;  1PPJ E;  3A0B E;  3L73 G;  3RK3 E;  1NVO A;  4ZNC A;  1P84 D;  5CMZ A;  3R2P A;  5TJH A;  4H13 C;  3CX5 H;  3CCV P;  2N1T B;  2FXO A;  2WMM A;  2FKW B;  3H1J J;  1GU5 A;  4U7J A;  3GF3 A;  4H13 D;  2K37 A;  4R4M A;  5APT A;  3FWN A;  1KB9 H;  5KAI E;  1HJ0 A;  4OWF A;  2A06 E;  3MHV A;  2XV5 A;  3LIE A;  3L75 G;  3KHU A;  5CBO A;  2K3R A;  3HUS C;  1BDC A;  1GTW A;  3V4W A;  2LKM A;  1LGH B;  1SQB K;  1FZB A;  1X8Y A;  1J1E C;  1W2E A;  3C8V A;  1YQ3 C;  1RE4 A;  1SQP G;  3EQ2 A;  1RQU A;  1U57 A;  3AEC C;  4DT0 A;  2QJY B;  5AW8 B;  3HE5 A;  1VQ8 P;  2YIU C;  2FYN C;  4H0L B;  3A2A A;  1VQM P;  1U7J A;  3GF7 A;  1NU1 K;  1L0N E;  4AQR D;  3BCC D;  3G9R A;  3JC2 2;  1AVY A;  3V2R A;  1GL2 B;  2FYZ A;  1WMK A;  2JO1 A;  3KZI E;  1JB0 J;  1BCC E;  1KTM A;  2KS1 B;  3PH0 A;  2E76 B;  1ZRT E;  5KLI C;  3D6Y A;  4DCK A;  1KQL A;  1NGM B;  1FC2 C;  3MUD A;  5KKZ C;  2QJP B;  3CCJ P;  5AW9 B;  1FZC A;  1WT6 A;  1ZR4 A;  5CCH C;  4JYB A;  3CXH D;  3VP9 A;  1SQB D;  5AW4 B;  1FOS F;  2Y9Z A;  3VMZ A;  1IC2 A;  2HPC A;  2MKV A;  3IR9 A;  3L70 J;  5CCH D;  2FBW C;  1BGY E;  1FAV A;  2N9Y B;  2AEJ A;  2AXC A;  3CWB G;  2QJK B;  2R32 A;  4YXW H;  5TIS E;  2Y0C A;  1GDT A;  3CI9 A;  2ZJS E;  2QA4 P;  4IL6 E;  2FXM A;  3V4Q A;  2RKL A;  1QL2 A;  2H7H A;  1K73 Q;  3Q1M A;  1OMI A;  1USD A;  1UIX A;  1G1I A;  1JY3 O;  2FFD B;  1GW3 A;  2E75 C;  1NTK J;  3L72 G;  1FOS E;  4WWI A;  3CCM P;  1PZQ A;  4K3A A;  2E75 D;  5APW A;  1NTZ J;  2ZFC A;  1YTZ T;  3AEB C;  5KJ7 C;  5AW7 B;  2L5G B;  3CX5 D;  2O01 J;  1BE3 G;  2K1A A;  1S9K E;  1LWU A;  5KJ7 D;  2YO2 A;  1M1K Q;  2LXC B;  2R5D A;  4WY4 A;  3PRJ A;  3H6P A;  1KB9 D;  4GIF A;  5L8R J;  4UB8 H;  1L0N D;  3VMY A;  2C9N Y;  2LXB A;  1FJK A;  4U3F E;  1BCC D;  3M0A A;  1MV8 A;  1ZRT D;  1J1D B;  2ITA A;  3P32 A;  2KLU A;  2WT7 A;  3Q2Y A;  2KNC B;  4EI2 A;  1M90 Q;  2HOD A;  3L73 E;  1KQS O;  3AE7 C;  1RF1 C;  3BRT B;  1BGY D;  2UWJ E;  4BRY B;  3FXD A;  5CJ0 A;  1SQX J;  5AW0 B;  2OYH B;  1Z56 A;  2OGU A;  3AE8 C;  4OGQ B;  2Z5I A;  4HKZ H;  1SQV K;  3CPW O;  1PGJ A;  1EC5 A;  1M8O B;  1ZV8 A;  1KIL B;  1AQ5 A;  2OTK E;  1KC8 Q;  3L75 E;  2FFD A;  3I5C A;  2KZJ A;  1BSH A;  1T3J A;  4I7Z B;  1CW5 A;  1HJB A;  4YXD C;  1K05 A;  1HGV A;  1SQP E;  2NPS C;  3WU2 E;  1RH5 B;  2QE7 H;  1PFI A;  2KZI A;  4NPD A;  5AVU B;  2NPS D;  4YTP C;  1HBW A;  1IFJ A;  3PLN A;  1NKZ B;  2D2C B;  1SVF A;  4I6M C;  1S9K D;  1SQV D;  1T6A A;  5KLV J;  1DX7 A;  1H0T A;  3IF4 A;  1KN7 A;  2E43 A;  1IJD B;  2I1K A;  3VP8 A;  2BEZ F;  3H1I G;  2V7Q H;  5KTB A;  2YKO A;  1BE3 J;  2K88 A;  1OVV A;  4ZKP A;  1OVU A;  2Z4E A;  3FXE A;  4HB1 A;  1HWT C;  3SFD C;  3TGU G;  1CZQ A;  1EZV E;  1P84 H;  2YNY A;  1U7M A;  2YMK A;  5BVZ A;  2XKM A;  2O3J A;  3CWB E;  3E7K A;  2P2U A;  3ABV C;  2OYH A;  1SQP K;  5AVV B;  3L73 D;  1M56 D;  4RKU J;  1N86 A;  2W27 A;  4GKG A;  1KIL A;  2HG5 D;  1LT9 C;  3B5N C;  3H1J G;  3GHG B;  1JCC A;  2Q7C A;  3TNU B;  3H1L D;  1NO4 A;  4H44 C;  1AJY A;  1OVR A;  2QIW A;  5H2F E;  3M0D C;  4L76 A;  3L72 E;  3BCC J;  3L75 D;  3N7N A;  1IZN B;  2LR2 A;  4H44 D;  3D70 A;  1VDF A;  1MZ9 A;  3AE5 C;  2E74 D;  1Q86 Q;  1LTJ C;  4D6T J;  1OZH A;  3B71 A;  3KPE A;  1PP9 J;  3LID A;  4JYC A;  3L71 D;  5K5G B;  3SFE C;  1SQP D;  1M1J C;  1EXI A;  1HH0 A;  1R5S A;  1N73 B;  2ZT9 C;  2JDI H;  1MFZ A;  3MTU E;  3M9B A;  2XDJ A;  3LW5 H;  1NWQ A;  3M91 A;  2ZT9 D;  1KV4 A;  3PTZ A;  4W7Z A;  1JY3 N;  3V5B A;  3EFF K;  2WSC H;  4PV1 B;  4DZO A;  2WSE J;  3CXH H;  3TSI A;  2W90 A;  1NU1 J;  2N1T D;  5KAF H;  2B88 A;  4EOT A;  1S3J A;  3C9I A;  2YMY A;  3NTN A;  3HTK A;  1YQ4 C;  2IPP A;  3HE5 B;  3II6 A;  2Q3I A;  1DD4 A;  3A0B H;  2KP8 A;  3ITK A;  3UIA A;  1EZV D;  1N7L A;  2WSF H;  1ZW0 A;  3L70 G;  5CHX A;  4PD4 H;  3Q5S A;  1N8R Q;  4C7N A;  5AW6 B;  2Y0E A;  5APV A;  1JY2 N;  2GA1 A;  3CCS P;  4H0L C;  5KAF E;  1NTM G;  3TNU A;  3TDK A;  1Q81 Q;  2HYN A;  2R3C A;  2W83 C;  4H0L D;  1SFC A;  1KYO E;  4AUW A;  3S1K A;  4L74 A;  1SQQ E;  3BAT A;  5AVR B;  1GL2 C;  3H1K G;  2HPC B;  1K8A Q;  4PD4 E;  1NTK G;  1ZR2 A;  1GL2 D;  3L72 D;  3U59 A;  1VF5 B;  4MN4 C;  1VQ4 P;  4ZKU A;  1K9M Q;  1H89 A;  2C0W A;  1NTZ G;  2YKP A;  4Y99 C;  1N73 A;  4UB6 E;  5AW1 B;  2OAR A;  5AW5 B;  2G3A A;  1NJI Q; 
#chains in the Genus database with same CATH homology
 2FYU G;  1L0L G;  2A06 G;  3H1I G;  1SQB G;  3L70 G;  4PD4 H;  4D6T G;  2BCC G;  3L72 G;  1PP9 G;  2IBZ G;  1BCC G;  3L74 G;  3H1H G;  5KLV G;  1SQV G;  1NTZ G;  1KB9 H;  3CWB G;  3L73 G;  1SQX G;  3H1L G;  3L71 G;  3TGU G;  4U3F G;  3BCC G;  1BGY G;  3H1K G;  1KYO H;  1P84 H;  1EZV G;  1L0N G;  1SQQ G;  1SQP G;  1NU1 G;  1PPJ G;  3CX5 H;  3CXH H;  3L75 G;  1NTK G;  1NTM G;  3H1J G;  1BE3 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...