1FDMA

Fd major coat protein in sds micelles, nmr, 20 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
50
structure length
50
Chain Sequence
AEGDDPAKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FD MAJOR COAT PROTEIN
publication title fd coat protein structure in membrane environments: structural dynamics of the loop between the hydrophobic trans-membrane helix and the amphipathic in-plane helix.
pubmed doi rcsb
molecule tags Viral protein
total genus 9
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1997-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fdmA00
1NH4A 1HGZA 1IFDA 2CPBA 2MJZA 1HGVA 2CPSA 1FDMA 1IFIA 2C0WA 2C0XA 1IFJA 1HH0A
chains in the Genus database with same CATH superfamily
1OW6A 3IR9A 1URQB 2YXQB 1GW4A 1FDMA 1Y9BA 1SQQE 1JTHA 2B89A 3L70E 1H0TB 2ZT9C 2N9BA 2Q5UA 1SQPD 1BGYG 4U3FJ 2O01H 2QJYC 2N1TA 1SQVK 3KYQA 4WBAA 1OW7A 2KP8A 3HRNA 2VRSA 1JY3O 2GUVA 3L35A 1EQ7A 1BCCG 3CXHI 1N7SD 4OH8B 4PD4D 3QH9A 3LW5H 4U3FD 2O3JA 1LTJC 1H89A 3U1CA 2XV5A 3W68A 2I8DA 5GTIH 3HD7C 1RY3A 3HD7D 3M9QA 5GTHE 2KNCB 2HPCA 4GOEA 4N78D 2OTJP 1WRGA 3AEGC 4I6MC 1X22A 2UWJE 3HUSC 3FXDA 3RL0C 2OYHA 1ZP0C 2OYIC 1RE4C 4KHXA 1YIJP 1LNQA 3SFDC 4NPEA 1RF0A 1E79H 2HFED 3VMYA 4JYBA 4Y28J 2P67A 2K1AA 1VQMP 1EXIA 1MKMA 5CJ0A 5CCGC 3RBXA 5CCGD 2Y9ZA 2IBZG 1FZEA 1NU1K 1ZRTE 4YTPC 1KQGB 1IFPA 4M3LA 1S9KE 4HKZH 4H13C 1N2DC 4H13D 2PGDA 1NTZE 2J59M 2WPQA 5KJ7A 2FYUE 2FFDC 3L71J 1PGJA 2R5BA 2KK7A 1K04A 1EZVG 2O1KA 1GL2C 1GL2D 3OW2O 3VMZA 5APQA 4GODA 1JOCA 4UB6H 3RGUA 5KAIH 3L71E 1R5LA 2QSIA 1BDDA 1FZFA 3PH0A 2YIUC 3M9BA 1RE3C 3WMM0 3L71D 4GOFA 2WTYA 1W2EA 2V7QJ 2D2CB 3CWBJ 2KB7P 2HLOA 1EDIA 2N9YB 3H1KJ 3E1IA 4EYYQ 3HUSB 3M0AA 2N1TD 4Z1MH 1OVRA 1NTKK 3VMAA 2BCCD 3CWBE 3H1JJ 2KZJA 1SQBE 1SQPG 3B8EB 3JSVC 1KMIZ 3L70G 2JEEA 2P10A 1YBKA 1GMJA 1U7MA 1JMMA 5CCHC 3H1KD 1ZLLA 1SFCB 3H1JE 2QJPC 3D6YA 1L0NJ 3V4QA 1J1DB 2W8ZA 3E7KA 2Z5IA 4ZMDA 3U1AA 2Y0DA 3VMXA 4KJMA 3WU2H 2XDJA 2IFMA 1JB0J 1W2BO 4N6JA 4C7NA 3CCEP 2XKMA 2E75C 2IYPA 4EIJA 1GK4A 3FWLA 1NTME 1L0ND 2HODB 3CCVP 5B66H 2OTKE 3B5NA 3BVHA 3WUTA 4I7ZC 2ZVOB 3T97A 1VQ5P 2AXCA 3M91A 5TJHA 1EDLA 3CCQP 2WPVB 3L73J 1VQPP 2K3RA 3CPWO 3NMDA 1QEXA 4BRYB 2QJKB 5GTHH 5BU8B 2JP3A 4LGDE 4NPDA 3O6QA 1KORA 1L0LK 1LT9A 2K9YA 3L73E 3H1IJ 3NTNA 2ZYDA 3HTKB 1VF5B 5DJTB 5B5EE 1YHQP 4YXDC 3MHVA 3RK2B 3EQ2A 2WSFJ 2O01J 5KJ7D 1BGYJ 1GZLA 2K88A 2KS1B 3H1ID 5AVUB 3CCRP 4OGQC 2ZXEB 1JMBA 1P84E 2XZRA 2OGUA 1OMIA 4C7RA 2M5AA 1SQVJ 1HGVA 1NTZG 3CXHE 1IFMA 3AE2C 2FYUG 1BGYD 3GHGC 2XNDH 1VQ9P 5KLVJ 1VDFA 1SQVE 4WY4C 3A5TA 3H25A 1LTSC 1EDKA 3N4XA 1M7LA 4C46A 1NWQA 2C0XA 3L71G 4H44D 3V2PA 2QA4P 1KILB 3NXSA 1M57D 2RKLA 5KLVD 1N73C 2Q9IA 1JY2P 3CI9A 1KV4A 3EFFK 2H88C 1YJWP 4L75A 1LTJA 1URQC 1LTIC 2B87A 2KSJA 3CWBG 5AW4B 2V7QH 3H1KG 1LWUC 3L4FA 3HD7A 3CX5E 1T6AA 3HE4B 5AW8B 1NHLA 3H1JG 2FXPA 2ZYAA 3IFMA 3G6EP 1FS0E 4WWIA 1WMKA 2JDIH 2YMYA 3P7KA 2WMMA 1KYOE 2IYOA 1S5LX 5AW3B 1M1JC 1L0NG 1RE4A 2I1JA 2OYIA 3V2RA 5AW6B 1RF1B 3G71P 2IZ1A 2W6AA 1ZXGA 2Z4EA 1PGPA 5L8RJ 3U59A 3D6ZA 2K9JB 4ASVA 5CCGA 5AVVB 5AVTB 4PJ0H 4K3AA 1SVFA 3RK3B 2QE7H 2E5TA 2YXRB 1KB9I 1KD1Q 1YTZT 4GDOA 3L73G 2RMZA 1K73Q 2FFDA 1YJ9P 5CMZA 2JWAA 1LGHB 4HB1A 1SQQJ 2E43A 2QEXP 1GL2A 4GKGA 3A0HE 1L4AB 4OWFA 3H1IG 1ZR2A 3CC2P 2H7HA 3KZIE 4DOJA 3S9OA 1IFDA 1FBMA 2NRGA 2W6BA 2HYNA 2GA1A 3AEBC 1LWUB 3MUDC 3MD0A 1SQXJ 1NTKE 2HR3A 3HE5A 1R8EA 1JY2N 2ZT9D 4PV1C 2RH0A 1P84H 2E74C 4RKUJ 1SQQD 1K8AQ 3TNUA 2WSFH 2LXBA 2L91A 4BWNA 3L70D 1KQFB 3NFQA 1VQLP 1EDJA 1SQXE 4WVZA 2FBWC 1P84I 3CXHH 3D70A 1YYCA 3M0DC 2Q1KA 3L74J 2O01N 1SQVG 1M1JB 3TYYA 2KZIA 3OJAB 3B5NB 2KLVA 1G1JA 3VP8A 1L2PA 1XTGB 1X8YA 3L74E 5KLVG 4LLHA 1PFIA 2W90A 1PZQA 1AQTA 1BE3J 3K5BA 3L74D 2WT7B 1SS1A 1QLED 1IJDB 4YPCA 2D2CC 1PGQA 2D2CD 1X0TA 3JCUE 4RJTA 3O6QB 4JQ0D 4W7YA 5AVQB 1BE3E 1LTGC 2P2UA 2MKVA 3UIAA 3CMEP 1KZUB 1JCCA 3RL0D 2QIWA 2WZ7A 2IDBA 1FJKA 1JUNA 1Q82Q 3II6A 3B4SA 2P58A 2YNYA 1AJYA 3FGAD 4GIFA 2LXCB 2WSCJ 2Q6QA 5AW9B 5H2FH 3L75J 3AE5C 1L0LE 1FZCB 5APUA 3PHLA 4D6TJ 2P1JA 2WQYC 4DCKA 1SFCC 4JPZB 5KKZB 1SFCD 1S5LE 3VN0A 1J1DC 1Q90D 1M8OB 1ZW0A 3CX5I 3L75E 1G2CB 1NTZJ 1GK6A 1EXJA 4D6TE 1QL1A 1MUUA 4H0LB 1FOSE 1S3JA 3TK1A 2I1KA 2FYUJ 4I2LC 4PV1B 1JO5A 1T3JA 2KLUA 1H8AA 3CCUP 2E74B 1JY3N 3L75D 1DH3A 1CI6B 1KYOI 1ZRTD 3A2AA 1ZOYC 3D71A 3MTUE 1S9KD 1FDIA 1Z56A 3CLQA 2P7JA 3SFEC 1NTZD 3MIWA 4IFFA 5KLIB 2IFNA 3G3ZA 2FYUD 3SWKA 1DEEG 1OZHA 2YKOA 4DT0A 1H88A 2QJKC 3MZWB 3GW6A 2YKQA 3BCCE 1QVFO 2WPRA 1G1IA 3GHGA 5AW5B 1N7SB 3BATA 1M1KQ 2O1JA 1VQKP 5E79E 4WY4A 3CC4P 5KAFE 1GD2E 1NH4A 1SQBJ 2M3EA 1VF5C 1VF5D 1PIXA 2WWWA 5CHXA 3AE6C 1VQ8P 3A0HH 2XNXA 3RK2C 3RK2D 3CMAP 3L72J 4JBZA 3C8VA 1SQQG 3KZIH 1GU4A 1VQOP 1NTKG 1N73A 1VQNP 3P8CE 3CWBD 3IAOA 1SQPK 1OWAA 5CCHD 1FU1A 1SQBD 3H1LJ 1ZN5A 3TSIA 3L72E 3I55P 1UIXA 3EWKA 1NJIQ 1BSHA 1SQXG 4ZKPA 1URQA 1JNMA 3AECC 1NO4A 1W5CE 3H1JD 4K35A 1NTMJ 3I5CA 1OXZA 1IFJA 3H1LE 3VOPA 5APYA 1FE6A 2J58A 2KXPB 4IFMA 2E75D 1H0TA 3SWYA 3H32B 1KILE 5APWA 1AQ5A 3L74G 3FWNA 1AFOA 2NPSB 1YQ3C 3ABVC 1KILC 1LTAC 1NTMD 2FYNB 1KB9E 4R4MA 3AEAC 1LP1B 4HYTB 3A3YB 4N3YB 1BE3G 1JM0A 1MFTA 3GF7A 1T2KC 3CL3D 1T2KD 1HGZA 1PPJE 3RL0g 1HUCA 1ZR4A 2OYOA 2OARA 3R2PA 1GDTA 3G9RA 3AE1C 2A45I 3L73D 2GM4A 2Y0EA 2BEQD 4DZOA 3F5HA 2KNCA 1JTHB 2Z5HA 1GU5A 2BEZF 4W7ZA 3AE8C 3L75G 4D6TG 1T3UA 2WSCH 2YO2A 2N1TB 4OGQD 2R32A 1RF1C 1U7JA 4XA4A 4TLFA 3S4RA 1P84D 4JF7A 4LC1A 3TF5A 1KQLA 2Y0CA 4GT1A 2JJLA 1YITP 4WY4D 3CXHD 4L74A 3RK3E 3MUDA 3Q5SA 1PP9J 1SQVD 2A06E 3RK3C 2AXTE 1J1EB 3BCCG 3GF3A 1RH5B 1SLQA 2HPCB 4TT3H 1BCCE 1PP9E 3CCSP 3EFGA 2H43A 3M0DA 2HG5D 3L36A 1OVUA 1KFMA 3WUVA 3S1KA 5E79H 2OYHB 1PP9D 1L4AC 5GTIE 3KXDA 1URQD 3R4YA 2PP6A 3CD6P 1SQBG 1KFNA 1RHZB 2LR2A 4AYCA 2QRXA 2KIKA 1OW8A 1U57A 1S1CX 3L72G 1BSNA 3F89A 3HUSA 1Q86Q 3CX5D 2H89C 1NAYA 3H1HE 2POHA 1NU1J 1SP4A 3LIEA 3H1LG 1KYOD 3B5NC 4RO0A 1L0NK 1NTMG 2W83C 1M56D 1NU1E 1SFCA 2QVAA 2IBZE 3P32A 3VTPC 2WVRA 1NU1D 2M3BA 2AEJA 1KB9H 1FOSF 2JR8A 2PFXA 3C9IA 3OA7A 4BXLA 1FDOA 4U7JA 1S72P 4IFDK 4NPFX 2HODA 5BU5A 2E5YA 2IPPA 5KAIE 5AVXB 1QX8A 3V4WA 3PP5A 4H44B 1FZAA 1KN7A 1IFIA 1FZCC 3C1LA 1NTKJ 3BRVB 5B5EH 1DEBA 5APTA 4BRYA 2RN0A 3V2NA 5KKZC 3KQGA 3RBZA 3A7OA 4IOIH 1DX7A 1RE3A 2ITAA 2R5DA 1IFNA 4H0LC 4H0LD 2KI7B 2FYZA 4PV1D 2C9NY 3USSA 2MJZA 2R44A 2E74D 3HTKA 3E1RA 1NTKD 3KDPB 4C7NB 1SQPE 1IK7A 2B88A 3GG2A 4UB8E 2KS1A 1HVVA 1SQXD 5KLIC 3WU2E 1HJ0A 2E42A 2E76B 3Q2YA 5CCHA 5K5GB 2A06G 4HJGH 3T97B 2W6JH 2KYVA 4PD4E 5M1BA 2AXTH 2ZFCA 4U3FE 1WT6A 3Q5RA 5KLVK 1A02F 1PP9G 1PV3A 5AVWB 3TGUJ 1N7SC 3N7NA 1NVOA 5B66E 3V5BA 1LT9B 1RQUA 1L0LJ 3TGUE 1LTTC 4Y99B 4N78E 1Q2NA 1FJPA 2ZJSE 1BE3D 2CPSA 3VYIA 1KILA 1AVYA 3TGUD 1NYHA 2CPBA 1N86A 4R4LA 4IL6X 2Q7CA 1VQ7P 1IZNB 3CX5H 2YKPA 1L0LD 3ZDMA 3B71A 1OFCX 3H1HG 2M5AB 1VPCA 3Q1MA 5EFWB 1KYOH 4B86A 3PRJA 3L37A 2W27A 2BASA 4D6TD 1FAVA 3HE4A 1OX3A 1ZV8A 4I1LA 1QL2A 1NU1G 2NPSC 2NPSD 3KHUA 1DD3A 3SWFA 2ZT9B 2PRRA 2Y9YA 2FYNC 3BCCJ 3CCMP 3FX0A 2QJYB 1K9MQ 1T8ZA 1JEKA 2IBZI 1YTZI 1RF1A 1N8RQ 1VL2A 3AEFC 1AVOA 2G3AA 2QM8A 3MGNA 2H8PD 3V6IA 1CSBA 3A0BE 2PAJA 1NAFA 3BCCD 2K9JA 3MP7B 3QWOC 1PL5A 2OQQA 1LTJB 2B87B 3O8ZA 2KOGA 2BCCJ 1EZVI 2V4HA 1Y8AA 5AVRB 2YMKA 3HD7B 5AVYB 1Q81Q 1KQSO 2IZ0A 3G4SP 1BDCA 2XU6A 2BCCE 5BVZA 1A02J 2N1TC 1USEA 1YI2P 1SQQK 2C0WA 3RL0B 1LTBC 2FKWB 1S4XA 1NGMB 1NKNA 3P8CD 1L4AA 3H1KE 3SSUA 2OYIB 3L72D 1SQXK 3PJSK 2FXMA 1NOHA 4ZKUA 2Q3EA 4UB8H 1LWUA 3PLNA 2SPZA 5TISE 2R3CA 1HH0A 1IO4A 3H1LD 1XTCC 3AE4C 3KPEA 2AEMA 2FY8A 1UIIA 5CBNA 1J1EC 1EC5A 5AVZB 2NZ2A 4U3FG 4PD4H 3PTZA 1L0NE 4W80A 1KILD 2ZYGA 4ZNCA 4H13B 3WUUA 1M1JA 3IN6A 4PD4I 1ZMEC 1RQVA 1KB9D 2OYHC 2FFDB 2WITA 3JCUH 2A45G 3TGUG 1X79B 3BASA 4PJ0E 2K37A 3CC7P 2A45H 4IL6E 1CW5A 1GL2B 1VQ4P 1RF0C 4RESB 5C39A 2WT7A 1PPJD 2WSEJ 1L0LG 3FXEA 3GMAA 1YJNP 2YIUB 1AA0A 3M9HA 3AEDC 1AV1A 1CZQA 3GLMA 3HE5B 3W67A 1S5LH 2JKVA 1OIPA 5AW7B 5CJ4A 3P8MC 3TNUB 2ZXXA 1X9VA 3H1IE 1HJBA 5KJ7C 1FZCA 3JC22 5CBOA 3OAKA 4A7PA 3IF4A 4QMAA 2JO1A 3M06A 1NTZK 2Q3IA 2C9LY 4EI2A 2FYUK 1G2CA 2QJPB 4EDFA 2DW3A 4OVNF 1BGYE 5AVSB 2AEFA 1USDA 1BCCJ 2G8YA 3LW5J 3RK3D 1Y47A 3ITKA 1CI6A 1Q7YQ 2WPSA 4ASWA 2A06D 1FC2C 2E75B 1HWTC 2KUBA 4L73A 2M0BA 3A0BH 4H44C 1QGKB 5KLVE 1BCCD 1N7LA 5KAFH 4I7ZB 1D7MA 2LKMA 1J2JB 2QG4A 1IK9A 3Q5PA 1KC8Q 1L4AD 5AW0B 5AW1B 2L5GB 1VQ6P 1MFZA 2BCCG 1N7SA 2B9BA 1NKZB 1SQBK 3H1HJ 1LJ2A 5APXA 2WSSH 1IC2A 1FZBA 1S2EA 5H2FE 1HTLC 1KTMA 3CCJP 1MV8A 2JWDA 5KTBA 4JYCA 3H1HD 3Q3DA 3B5ND 1PGOA 1DIPA 1JY2O 2E76C 2E76D 2KSEA 5TISH 1YQ4C 3I56P 4OGQB 1DD4A 3AE9C 2M8RA 1NTMK 1HBWA 1OVVA 4HH2A 2J5UA 2IBZD 4WB4A 1MZ9A 3V2QA 2R3SA 4YXWH 3TDKA 5APSA 1K05A 3GHGB 2OTLP 4DJGA 1LT9C 2ZVNB 3H6PA 3H32A 1JCDA 2IX7C 5AW2B 4WY4B 1R5SA 2QM7A 2NPSA 4Y99C 4AUWA 1PPJG 1EZVE 3VP9A 3AEEC 4KT0J 5APVA 4UB6E 4XE5B 4IL6H 2GUSA 1EZVD 1HF9A 4CPGA 3BRTB 3CCLP 2CK3H 2ZAEB 2YO3A 1LP1A 1GW3A 1QVGO 3AE7C 1N73B 1LT1A 3AE3C 5DJUB 1M90Q 4XFJA 4O9BA 1FZGA 4EOTA 2FXOA 1TU3F 1JY3P 1E5WA 4AQRD 1SQPJ 3LIDA 2WSEH 1GTWA 4MN4C 4L76A 3L70J
chains in the Genus database with same CATH topology
1KILC 1ZV8A 3CI9A 4I1LA 1QL2A 3IR9A 1LTAC 1URQB 2NPSC 2NPSD 1GW4A 3SWFA 1FDMA 1LTJA 1JTHA 1URQC 4HYTB 1LTIC 3A3YB 4N3YB 2KSJA 5AW4B 1T8ZA 1T2KC 3CL3D 1T2KD 2N9BA 2Q5UA 1HGZA 1YTZI 1RF1A 1LWUC 3L4FA 2O01H 1HUCA 2N1TA 1ZR4A 1SQVK 3HD7A 2OARA 3R2PA 3KYQA 4WBAA 1GDTA 3HE4B 5AW8B 1NHLA 2QM8A 2KP8A 3HRNA 2VRSA 1JY3O 2GUVA 3MGNA 2A45I 2H8PD 3L35A 1CSBA 2GM4A 3IFMA 2PAJA 1NAFA 1EQ7A 2YMYA 4DZOA 3P7KA 1LTJB 1JTHB 2Z5HA 3O8ZA 1N7SD 2KOGA 4OH8B 1GU5A 4W7ZA 5AW3B 1M1JC 2OYIA 1RE4A 2I1JA 3LW5H 1LTJC 3V2RA 1H89A 5AW6B 1T3UA 1RF1B 2WSCH 5AVRB 2YO2A 3U1CA 2N1TB 2W6AA 5AVYB 3HD7B 2XV5A 2Z4EA 2R32A 2XU6A 3U59A 1RF1C 5BVZA 1A02J 4XA4A 2N1TC 3HD7C 1RY3A 3HD7D 1SQQK 2C0WA 3M9QA 3RL0B 4JF7A 1LTBC 5CCGA 4LC1A 2FKWB 2HPCA 5AVVB 4N78D 1KQLA 5AVTB 1NKNA 1WRGA 4I6MC 3HUSC 3P8CD 1SVFA 4GT1A 1L4AA 2JJLA 2OYIB 3RK3B 3RL0C 4WY4D 3MUDA 2OYHA 1SQXK 1YTZT 2FXMA 1NOHA 3RK3C 1RE4C 4ZKUA 2OYIC 4KHXA 1LWUA 2FFDA 1RF0A 1J1EB 2R3CA 1HH0A 1IO4A 1XTCC 3KPEA 5CMZA 1SLQA 1LGHB 2HPCB 2HFED 3EFGA 2H43A 3VMYA 3M0DA 4JYBA 2E43A 2P67A 1GL2A 2HG5D 4GKGA 1J1EC 3L36A 5AVZB 1L4AB 5CJ0A 4W80A 1KILD 1KFMA 5CCGC 5CCGD 1ZR2A 2OYHB 1FZEA 2H7HA 4DOJA 1NU1K 1L4AC 1M1JA 1IFDA 1FBMA 2W6BA 2HYNA 1URQD 1LWUB 3MD0A 2OYHC 2FFDB 2WITA 4M3LA 1S9KE 3HE5A 2PP6A 1JY2N 1N2DC 2A45G 1X79B 3BASA 2J59M 1KFNA 2WPQA 3TNUA 5KJ7A 2A45H 2WSFH 4AYCA 2FFDC 1CW5A 1GL2B 3NFQA 1RF0C 4RESB 2R5BA 2WT7A 1YYCA 3M0DC 2O1KA 3HUSA 1GL2C 1GL2D 3VMZA 1M1JB 5APQA 3TYYA 1JOCA 3M9HA 3OJAB 3B5NB 2KLVA 1G1JA 2POHA 1SP4A 3LIEA 3VP8A 1CZQA 3HE5B 1XTGB 1FZFA 3M9BA 5AW7B 1X8YA 5CJ4A 1RE3C 3P8MC 3WMM0 3TNUB 3B5NC 4LLHA 1PFIA 2WTYA 1W2EA 1L0NK 2KB7P 2HLOA 1X9VA 1SFCA 2WT7B 1HJBA 3E1IA 5KJ7C 1FZCA 3HUSB 1IJDB 3M0AA 2N1TD 3P32A 3VTPC 3OAKA 1NTKK 2M3BA 4W7YA 5AVQB 3M06A 1LTGC 1NTZK 2P2UA 1FOSF 3UIAA 2Q3IA 2C9LY 1KZUB 1JCCA 3B8EB 3C9IA 3OA7A 2FYUK 1G2CA 2WZ7A 3RL0D 1FJKA 1JUNA 5AVSB 2JEEA 3II6A 1JMMA 5CCHC 4IFDK 2YNYA 1ZLLA 2HODA 1SFCB 4GIFA 3RK3D 5AW9B 3V4QA 1J1DB 1CI6A 5BU5A 2Z5IA 1FZCB 5APUA 2IPPA 3U1AA 2WPSA 5AVXB 3VMXA 2P1JA 3V4WA 2XDJA 3PP5A 1SFCC 2IFMA 1FZAA 1SFCD 3VN0A 1J1DC 1IFIA 1HWTC 1FZCC 4N6JA 4C7NA 2XKMA 3BRVB 1DEBA 5APTA 1G2CB 1GK6A 3V2NA 1N7LA 1QL1A 3KQGA 4EIJA 1MUUA 2LKMA 1FOSE 1GK4A 1J2JB 3A7OA 1IK9A 3TK1A 2I1KA 4I2LC 1DX7A 1JO5A 1T3JA 1L4AD 5AW0B 5AW1B 2HODB 2L5GB 1H8AA 1RE3A 1JY3N 3B5NA 3BVHA 1DH3A 2R5DA 1CI6B 1IFNA 1MFZA 2FYZA 3T97A 3A2AA 2C9NY 3M91A 2MJZA 1N7SA 3HTKA 3MTUE 3KDPB 1NKZB 1S9KD 1SQBK 1Z56A 3CLQA 2P7JA 4C7NB 3MIWA 3NMDA 4IFFA 5APXA 5BU8B 2IFNA 3G3ZA 1IC2A 1FZBA 4LGDE 1HVVA 1HTLC 2YKOA 1H88A 1L0LK 1LT9A 2YKQA 2E42A 1MV8A 3NTNA 5CCHA 5KTBA 2WPRA 4JYCA 2KYVA 1G1IA 3GHGA 5AW5B 1N7SB 3HTKB 3BATA 3B5ND 2O1JA 1JY2O 4WY4A 2ZFCA 1WT6A 5KLVK 1A02F 3RK2B 1GD2E 3EQ2A 1NH4A 5AVWB 1N7SC 3N7NA 5KJ7D 2M8RA 2WWWA 1NTMK 5CHXA 1HBWA 1GZLA 3V5BA 2XNXA 3RK2C 3RK2D 4HH2A 5AVUB 1LT9B 2ZXEB 4WB4A 1MZ9A 2XZRA 3V2QA 1LTTC 4Y99B 1GU4A 4N78E 4C7RA 1HGVA 5APSA 1N73A 3GHGB 1FJPA 1LT9C 2CPSA 3H6PA 3P8CE 3VYIA 3H32A 1JCDA 2IX7C 5AW2B 1KILA 1SQPK 1OWAA 4WY4B 2QM7A 5CCHD 1IFMA 1FU1A 3TSIA 1ZN5A 2NPSA 4Y99C 4AUWA 2CPBA 1N86A 3GHGC 3VP9A 5APVA 2Q7CA 4XE5B 1VDFA 4WY4C 4ZKPA 2GUSA 1URQA 1JNMA 3A5TA 1LTSC 1NO4A 3N4XA 2YKPA 3I5CA 1OXZA 1M7LA 1IFJA 3BRTB 4C46A 1NWQA 3VOPA 2YO3A 5APYA 1GW3A 2J58A 2C0XA 4IFMA 1N73B 1VPCA 3V2PA 3SWYA 4B86A 3H32B 3L37A 1KILB 3NXSA 2W27A 4O9BA 1FZGA 4EOTA 5APWA 1AQ5A 2BASA 1AFOA 2NPSB 1JY3P 1E5WA 4AQRD 1N73C 3LIDA 2WSEH 2Q9IA 1FAVA 1GTWA 3HE4A 1JY2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NH4 A;  1HGZ A;  1IFD A;  2CPB A;  2MJZ A;  1HGV A;  2CPS A;  1FDM A;  1IFI A;  2C0W A;  2C0X A;  1IFJ A;  1HH0 A; 
#chains in the Genus database with same CATH topology
 1OW6 A;  3IR9 A;  1URQ B;  2YXQ B;  1GW4 A;  1FDM A;  1Y9B A;  1SQQ E;  1JTH A;  2B89 A;  3L70 E;  1H0T B;  2ZT9 C;  2N9B A;  2Q5U A;  1SQP D;  1BGY G;  4U3F J;  2O01 H;  2QJY C;  2N1T A;  1SQV K;  3KYQ A;  4WBA A;  1OW7 A;  2KP8 A;  3HRN A;  2VRS A;  1JY3 O;  2GUV A;  3L35 A;  1EQ7 A;  1BCC G;  3CXH I;  1N7S D;  4OH8 B;  4PD4 D;  3QH9 A;  3LW5 H;  4U3F D;  2O3J A;  1LTJ C;  1H89 A;  3U1C A;  2XV5 A;  3W68 A;  2I8D A;  5GTI H;  3HD7 C;  1RY3 A;  3HD7 D;  3M9Q A;  5GTH E;  2KNC B;  2HPC A;  4GOE A;  4N78 D;  2OTJ P;  1WRG A;  3AEG C;  4I6M C;  1X22 A;  2UWJ E;  3HUS C;  3FXD A;  3RL0 C;  2OYH A;  1ZP0 C;  2OYI C;  1RE4 C;  4KHX A;  1YIJ P;  1LNQ A;  3SFD C;  4NPE A;  1RF0 A;  1E79 H;  2HFE D;  3VMY A;  4JYB A;  4Y28 J;  2P67 A;  2K1A A;  1VQM P;  1EXI A;  1MKM A;  5CJ0 A;  5CCG C;  3RBX A;  5CCG D;  2Y9Z A;  2IBZ G;  1FZE A;  1NU1 K;  1ZRT E;  4YTP C;  1KQG B;  1IFP A;  4M3L A;  1S9K E;  4HKZ H;  4H13 C;  1N2D C;  4H13 D;  2PGD A;  1NTZ E;  2J59 M;  2WPQ A;  5KJ7 A;  2FYU E;  2FFD C;  3L71 J;  1PGJ A;  2R5B A;  2KK7 A;  1K04 A;  1EZV G;  2O1K A;  1GL2 C;  1GL2 D;  3OW2 O;  3VMZ A;  5APQ A;  4GOD A;  1JOC A;  4UB6 H;  3RGU A;  5KAI H;  3L71 E;  1R5L A;  2QSI A;  1BDD A;  1FZF A;  3PH0 A;  2YIU C;  3M9B A;  1RE3 C;  3WMM 0;  3L71 D;  4GOF A;  2WTY A;  1W2E A;  2V7Q J;  2D2C B;  3CWB J;  2KB7 P;  2HLO A;  1EDI A;  2N9Y B;  3H1K J;  3E1I A;  4EYY Q;  3HUS B;  3M0A A;  2N1T D;  4Z1M H;  1OVR A;  1NTK K;  3VMA A;  2BCC D;  3CWB E;  3H1J J;  2KZJ A;  1SQB E;  1SQP G;  3B8E B;  3JSV C;  1KMI Z;  3L70 G;  2JEE A;  2P10 A;  1YBK A;  1GMJ A;  1U7M A;  1JMM A;  5CCH C;  3H1K D;  1ZLL A;  1SFC B;  3H1J E;  2QJP C;  3D6Y A;  1L0N J;  3V4Q A;  1J1D B;  2W8Z A;  3E7K A;  2Z5I A;  4ZMD A;  3U1A A;  2Y0D A;  3VMX A;  4KJM A;  3WU2 H;  2XDJ A;  2IFM A;  1JB0 J;  1W2B O;  4N6J A;  4C7N A;  3CCE P;  2XKM A;  2E75 C;  2IYP A;  4EIJ A;  1GK4 A;  3FWL A;  1NTM E;  1L0N D;  2HOD B;  3CCV P;  5B66 H;  2OTK E;  3B5N A;  3BVH A;  3WUT A;  4I7Z C;  2ZVO B;  3T97 A;  1VQ5 P;  2AXC A;  3M91 A;  5TJH A;  1EDL A;  3CCQ P;  2WPV B;  3L73 J;  1VQP P;  2K3R A;  3CPW O;  3NMD A;  1QEX A;  4BRY B;  2QJK B;  5GTH H;  5BU8 B;  2JP3 A;  4LGD E;  4NPD A;  3O6Q A;  1KOR A;  1L0L K;  1LT9 A;  2K9Y A;  3L73 E;  3H1I J;  3NTN A;  2ZYD A;  3HTK B;  1VF5 B;  5DJT B;  5B5E E;  1YHQ P;  4YXD C;  3MHV A;  3RK2 B;  3EQ2 A;  2WSF J;  2O01 J;  5KJ7 D;  1BGY J;  1GZL A;  2K88 A;  2KS1 B;  3H1I D;  5AVU B;  3CCR P;  4OGQ C;  2ZXE B;  1JMB A;  1P84 E;  2XZR A;  2OGU A;  1OMI A;  4C7R A;  2M5A A;  1SQV J;  1HGV A;  1NTZ G;  3CXH E;  1IFM A;  3AE2 C;  2FYU G;  1BGY D;  3GHG C;  2XND H;  1VQ9 P;  5KLV J;  1VDF A;  1SQV E;  4WY4 C;  3A5T A;  3H25 A;  1LTS C;  1EDK A;  3N4X A;  1M7L A;  4C46 A;  1NWQ A;  2C0X A;  3L71 G;  4H44 D;  3V2P A;  2QA4 P;  1KIL B;  3NXS A;  1M57 D;  2RKL A;  5KLV D;  1N73 C;  2Q9I A;  1JY2 P;  3CI9 A;  1KV4 A;  3EFF K;  2H88 C;  1YJW P;  4L75 A;  1LTJ A;  1URQ C;  1LTI C;  2B87 A;  2KSJ A;  3CWB G;  5AW4 B;  2V7Q H;  3H1K G;  1LWU C;  3L4F A;  3HD7 A;  3CX5 E;  1T6A A;  3HE4 B;  5AW8 B;  1NHL A;  3H1J G;  2FXP A;  2ZYA A;  3IFM A;  3G6E P;  1FS0 E;  4WWI A;  1WMK A;  2JDI H;  2YMY A;  3P7K A;  2WMM A;  1KYO E;  2IYO A;  1S5L X;  5AW3 B;  1M1J C;  1L0N G;  1RE4 A;  2I1J A;  2OYI A;  3V2R A;  5AW6 B;  1RF1 B;  3G71 P;  2IZ1 A;  2W6A A;  1ZXG A;  2Z4E A;  1PGP A;  5L8R J;  3U59 A;  3D6Z A;  2K9J B;  4ASV A;  5CCG A;  5AVV B;  5AVT B;  4PJ0 H;  4K3A A;  1SVF A;  3RK3 B;  2QE7 H;  2E5T A;  2YXR B;  1KB9 I;  1KD1 Q;  1YTZ T;  4GDO A;  3L73 G;  2RMZ A;  1K73 Q;  2FFD A;  1YJ9 P;  5CMZ A;  2JWA A;  1LGH B;  4HB1 A;  1SQQ J;  2E43 A;  2QEX P;  1GL2 A;  4GKG A;  3A0H E;  1L4A B;  4OWF A;  3H1I G;  1ZR2 A;  3CC2 P;  2H7H A;  3KZI E;  4DOJ A;  3S9O A;  1IFD A;  1FBM A;  2NRG A;  2W6B A;  2HYN A;  2GA1 A;  3AEB C;  1LWU B;  3MUD C;  3MD0 A;  1SQX J;  1NTK E;  2HR3 A;  3HE5 A;  1R8E A;  1JY2 N;  2ZT9 D;  4PV1 C;  2RH0 A;  1P84 H;  2E74 C;  4RKU J;  1SQQ D;  1K8A Q;  3TNU A;  2WSF H;  2LXB A;  2L91 A;  4BWN A;  3L70 D;  1KQF B;  3NFQ A;  1VQL P;  1EDJ A;  1SQX E;  4WVZ A;  2FBW C;  1P84 I;  3CXH H;  3D70 A;  1YYC A;  3M0D C;  2Q1K A;  3L74 J;  2O01 N;  1SQV G;  1M1J B;  3TYY A;  2KZI A;  3OJA B;  3B5N B;  2KLV A;  1G1J A;  3VP8 A;  1L2P A;  1XTG B;  1X8Y A;  3L74 E;  5KLV G;  4LLH A;  1PFI A;  2W90 A;  1PZQ A;  1AQT A;  1BE3 J;  3K5B A;  3L74 D;  2WT7 B;  1SS1 A;  1QLE D;  1IJD B;  4YPC A;  2D2C C;  1PGQ A;  2D2C D;  1X0T A;  3JCU E;  4RJT A;  3O6Q B;  4JQ0 D;  4W7Y A;  5AVQ B;  1BE3 E;  1LTG C;  2P2U A;  2MKV A;  3UIA A;  3CME P;  1KZU B;  1JCC A;  3RL0 D;  2QIW A;  2WZ7 A;  2IDB A;  1FJK A;  1JUN A;  1Q82 Q;  3II6 A;  3B4S A;  2P58 A;  2YNY A;  1AJY A;  3FGA D;  4GIF A;  2LXC B;  2WSC J;  2Q6Q A;  5AW9 B;  5H2F H;  3L75 J;  3AE5 C;  1L0L E;  1FZC B;  5APU A;  3PHL A;  4D6T J;  2P1J A;  2WQY C;  4DCK A;  1SFC C;  4JPZ B;  5KKZ B;  1SFC D;  1S5L E;  3VN0 A;  1J1D C;  1Q90 D;  1M8O B;  1ZW0 A;  3CX5 I;  3L75 E;  1G2C B;  1NTZ J;  1GK6 A;  1EXJ A;  4D6T E;  1QL1 A;  1MUU A;  4H0L B;  1FOS E;  1S3J A;  3TK1 A;  2I1K A;  2FYU J;  4I2L C;  4PV1 B;  1JO5 A;  1T3J A;  2KLU A;  1H8A A;  3CCU P;  2E74 B;  1JY3 N;  3L75 D;  1DH3 A;  1CI6 B;  1KYO I;  1ZRT D;  3A2A A;  1ZOY C;  3D71 A;  3MTU E;  1S9K D;  1FDI A;  1Z56 A;  3CLQ A;  2P7J A;  3SFE C;  1NTZ D;  3MIW A;  4IFF A;  5KLI B;  2IFN A;  3G3Z A;  2FYU D;  3SWK A;  1DEE G;  1OZH A;  2YKO A;  4DT0 A;  1H88 A;  2QJK C;  3MZW B;  3GW6 A;  2YKQ A;  3BCC E;  1QVF O;  2WPR A;  1G1I A;  3GHG A;  5AW5 B;  1N7S B;  3BAT A;  1M1K Q;  2O1J A;  1VQK P;  5E79 E;  4WY4 A;  3CC4 P;  5KAF E;  1GD2 E;  1NH4 A;  1SQB J;  2M3E A;  1VF5 C;  1VF5 D;  1PIX A;  2WWW A;  5CHX A;  3AE6 C;  1VQ8 P;  3A0H H;  2XNX A;  3RK2 C;  3RK2 D;  3CMA P;  3L72 J;  4JBZ A;  3C8V A;  1SQQ G;  3KZI H;  1GU4 A;  1VQO P;  1NTK G;  1N73 A;  1VQN P;  3P8C E;  3CWB D;  3IAO A;  1SQP K;  1OWA A;  5CCH D;  1FU1 A;  1SQB D;  3H1L J;  1ZN5 A;  3TSI A;  3L72 E;  3I55 P;  1UIX A;  3EWK A;  1NJI Q;  1BSH A;  1SQX G;  4ZKP A;  1URQ A;  1JNM A;  3AEC C;  1NO4 A;  1W5C E;  3H1J D;  4K35 A;  1NTM J;  3I5C A;  1OXZ A;  1IFJ A;  3H1L E;  3VOP A;  5APY A;  1FE6 A;  2J58 A;  2KXP B;  4IFM A;  2E75 D;  1H0T A;  3SWY A;  3H32 B;  1KIL E;  5APW A;  1AQ5 A;  3L74 G;  3FWN A;  1AFO A;  2NPS B;  1YQ3 C;  3ABV C;  1KIL C;  1LTA C;  1NTM D;  2FYN B;  1KB9 E;  4R4M A;  3AEA C;  1LP1 B;  4HYT B;  3A3Y B;  4N3Y B;  1BE3 G;  1JM0 A;  1MFT A;  3GF7 A;  1T2K C;  3CL3 D;  1T2K D;  1HGZ A;  1PPJ E;  3RL0 g;  1HUC A;  1ZR4 A;  2OYO A;  2OAR A;  3R2P A;  1GDT A;  3G9R A;  3AE1 C;  2A45 I;  3L73 D;  2GM4 A;  2Y0E A;  2BEQ D;  4DZO A;  3F5H A;  2KNC A;  1JTH B;  2Z5H A;  1GU5 A;  2BEZ F;  4W7Z A;  3AE8 C;  3L75 G;  4D6T G;  1T3U A;  2WSC H;  2YO2 A;  2N1T B;  4OGQ D;  2R32 A;  1RF1 C;  1U7J A;  4XA4 A;  4TLF A;  3S4R A;  1P84 D;  4JF7 A;  4LC1 A;  3TF5 A;  1KQL A;  2Y0C A;  4GT1 A;  2JJL A;  1YIT P;  4WY4 D;  3CXH D;  4L74 A;  3RK3 E;  3MUD A;  3Q5S A;  1PP9 J;  1SQV D;  2A06 E;  3RK3 C;  2AXT E;  1J1E B;  3BCC G;  3GF3 A;  1RH5 B;  1SLQ A;  2HPC B;  4TT3 H;  1BCC E;  1PP9 E;  3CCS P;  3EFG A;  2H43 A;  3M0D A;  2HG5 D;  3L36 A;  1OVU A;  1KFM A;  3WUV A;  3S1K A;  5E79 H;  2OYH B;  1PP9 D;  1L4A C;  5GTI E;  3KXD A;  1URQ D;  3R4Y A;  2PP6 A;  3CD6 P;  1SQB G;  1KFN A;  1RHZ B;  2LR2 A;  4AYC A;  2QRX A;  2KIK A;  1OW8 A;  1U57 A;  1S1C X;  3L72 G;  1BSN A;  3F89 A;  3HUS A;  1Q86 Q;  3CX5 D;  2H89 C;  1NAY A;  3H1H E;  2POH A;  1NU1 J;  1SP4 A;  3LIE A;  3H1L G;  1KYO D;  3B5N C;  4RO0 A;  1L0N K;  1NTM G;  2W83 C;  1M56 D;  1NU1 E;  1SFC A;  2QVA A;  2IBZ E;  3P32 A;  3VTP C;  2WVR A;  1NU1 D;  2M3B A;  2AEJ A;  1KB9 H;  1FOS F;  2JR8 A;  2PFX A;  3C9I A;  3OA7 A;  4BXL A;  1FDO A;  4U7J A;  1S72 P;  4IFD K;  4NPF X;  2HOD A;  5BU5 A;  2E5Y A;  2IPP A;  5KAI E;  5AVX B;  1QX8 A;  3V4W A;  3PP5 A;  4H44 B;  1FZA A;  1KN7 A;  1IFI A;  1FZC C;  3C1L A;  1NTK J;  3BRV B;  5B5E H;  1DEB A;  5APT A;  4BRY A;  2RN0 A;  3V2N A;  5KKZ C;  3KQG A;  3RBZ A;  3A7O A;  4IOI H;  1DX7 A;  1RE3 A;  2ITA A;  2R5D A;  1IFN A;  4H0L C;  4H0L D;  2KI7 B;  2FYZ A;  4PV1 D;  2C9N Y;  3USS A;  2MJZ A;  2R44 A;  2E74 D;  3HTK A;  3E1R A;  1NTK D;  3KDP B;  4C7N B;  1SQP E;  1IK7 A;  2B88 A;  3GG2 A;  4UB8 E;  2KS1 A;  1HVV A;  1SQX D;  5KLI C;  3WU2 E;  1HJ0 A;  2E42 A;  2E76 B;  3Q2Y A;  5CCH A;  5K5G B;  2A06 G;  4HJG H;  3T97 B;  2W6J H;  2KYV A;  4PD4 E;  5M1B A;  2AXT H;  2ZFC A;  4U3F E;  1WT6 A;  3Q5R A;  5KLV K;  1A02 F;  1PP9 G;  1PV3 A;  5AVW B;  3TGU J;  1N7S C;  3N7N A;  1NVO A;  5B66 E;  3V5B A;  1LT9 B;  1RQU A;  1L0L J;  3TGU E;  1LTT C;  4Y99 B;  4N78 E;  1Q2N A;  1FJP A;  2ZJS E;  1BE3 D;  2CPS A;  3VYI A;  1KIL A;  1AVY A;  3TGU D;  1NYH A;  2CPB A;  1N86 A;  4R4L A;  4IL6 X;  2Q7C A;  1VQ7 P;  1IZN B;  3CX5 H;  2YKP A;  1L0L D;  3ZDM A;  3B71 A;  1OFC X;  3H1H G;  2M5A B;  1VPC A;  3Q1M A;  5EFW B;  1KYO H;  4B86 A;  3PRJ A;  3L37 A;  2W27 A;  2BAS A;  4D6T D;  1FAV A;  3HE4 A;  1OX3 A;  1ZV8 A;  4I1L A;  1QL2 A;  1NU1 G;  2NPS C;  2NPS D;  3KHU A;  1DD3 A;  3SWF A;  2ZT9 B;  2PRR A;  2Y9Y A;  2FYN C;  3BCC J;  3CCM P;  3FX0 A;  2QJY B;  1K9M Q;  1T8Z A;  1JEK A;  2IBZ I;  1YTZ I;  1RF1 A;  1N8R Q;  1VL2 A;  3AEF C;  1AVO A;  2G3A A;  2QM8 A;  3MGN A;  2H8P D;  3V6I A;  1CSB A;  3A0B E;  2PAJ A;  1NAF A;  3BCC D;  2K9J A;  3MP7 B;  3QWO C;  1PL5 A;  2OQQ A;  1LTJ B;  2B87 B;  3O8Z A;  2KOG A;  2BCC J;  1EZV I;  2V4H A;  1Y8A A;  5AVR B;  2YMK A;  3HD7 B;  5AVY B;  1Q81 Q;  1KQS O;  2IZ0 A;  3G4S P;  1BDC A;  2XU6 A;  2BCC E;  5BVZ A;  1A02 J;  2N1T C;  1USE A;  1YI2 P;  1SQQ K;  2C0W A;  3RL0 B;  1LTB C;  2FKW B;  1S4X A;  1NGM B;  1NKN A;  3P8C D;  1L4A A;  3H1K E;  3SSU A;  2OYI B;  3L72 D;  1SQX K;  3PJS K;  2FXM A;  1NOH A;  4ZKU A;  2Q3E A;  4UB8 H;  1LWU A;  3PLN A;  2SPZ A;  5TIS E;  2R3C A;  1HH0 A;  1IO4 A;  3H1L D;  1XTC C;  3AE4 C;  3KPE A;  2AEM A;  2FY8 A;  1UII A;  5CBN A;  1J1E C;  1EC5 A;  5AVZ B;  2NZ2 A;  4U3F G;  4PD4 H;  3PTZ A;  1L0N E;  4W80 A;  1KIL D;  2ZYG A;  4ZNC A;  4H13 B;  3WUU A;  1M1J A;  3IN6 A;  4PD4 I;  1ZME C;  1RQV A;  1KB9 D;  2OYH C;  2FFD B;  2WIT A;  3JCU H;  2A45 G;  3TGU G;  1X79 B;  3BAS A;  4PJ0 E;  2K37 A;  3CC7 P;  2A45 H;  4IL6 E;  1CW5 A;  1GL2 B;  1VQ4 P;  1RF0 C;  4RES B;  5C39 A;  2WT7 A;  1PPJ D;  2WSE J;  1L0L G;  3FXE A;  3GMA A;  1YJN P;  2YIU B;  1AA0 A;  3M9H A;  3AED C;  1AV1 A;  1CZQ A;  3GLM A;  3HE5 B;  3W67 A;  1S5L H;  2JKV A;  1OIP A;  5AW7 B;  5CJ4 A;  3P8M C;  3TNU B;  2ZXX A;  1X9V A;  3H1I E;  1HJB A;  5KJ7 C;  1FZC A;  3JC2 2;  5CBO A;  3OAK A;  4A7P A;  3IF4 A;  4QMA A;  2JO1 A;  3M06 A;  1NTZ K;  2Q3I A;  2C9L Y;  4EI2 A;  2FYU K;  1G2C A;  2QJP B;  4EDF A;  2DW3 A;  4OVN F;  1BGY E;  5AVS B;  2AEF A;  1USD A;  1BCC J;  2G8Y A;  3LW5 J;  3RK3 D;  1Y47 A;  3ITK A;  1CI6 A;  1Q7Y Q;  2WPS A;  4ASW A;  2A06 D;  1FC2 C;  2E75 B;  1HWT C;  2KUB A;  4L73 A;  2M0B A;  3A0B H;  4H44 C;  1QGK B;  5KLV E;  1BCC D;  1N7L A;  5KAF H;  4I7Z B;  1D7M A;  2LKM A;  1J2J B;  2QG4 A;  1IK9 A;  3Q5P A;  1KC8 Q;  1L4A D;  5AW0 B;  5AW1 B;  2L5G B;  1VQ6 P;  1MFZ A;  2BCC G;  1N7S A;  2B9B A;  1NKZ B;  1SQB K;  3H1H J;  1LJ2 A;  5APX A;  2WSS H;  1IC2 A;  1FZB A;  1S2E A;  5H2F E;  1HTL C;  1KTM A;  3CCJ P;  1MV8 A;  2JWD A;  5KTB A;  4JYC A;  3H1H D;  3Q3D A;  3B5N D;  1PGO A;  1DIP A;  1JY2 O;  2E76 C;  2E76 D;  2KSE A;  5TIS H;  1YQ4 C;  3I56 P;  4OGQ B;  1DD4 A;  3AE9 C;  2M8R A;  1NTM K;  1HBW A;  1OVV A;  4HH2 A;  2J5U A;  2IBZ D;  4WB4 A;  1MZ9 A;  3V2Q A;  2R3S A;  4YXW H;  3TDK A;  5APS A;  1K05 A;  3GHG B;  2OTL P;  4DJG A;  1LT9 C;  2ZVN B;  3H6P A;  3H32 A;  1JCD A;  2IX7 C;  5AW2 B;  4WY4 B;  1R5S A;  2QM7 A;  2NPS A;  4Y99 C;  4AUW A;  1PPJ G;  1EZV E;  3VP9 A;  3AEE C;  4KT0 J;  5APV A;  4UB6 E;  4XE5 B;  4IL6 H;  2GUS A;  1EZV D;  1HF9 A;  4CPG A;  3BRT B;  3CCL P;  2CK3 H;  2ZAE B;  2YO3 A;  1LP1 A;  1GW3 A;  1QVG O;  3AE7 C;  1N73 B;  1LT1 A;  3AE3 C;  5DJU B;  1M90 Q;  4XFJ A;  4O9B A;  1FZG A;  4EOT A;  2FXO A;  1TU3 F;  1JY3 P;  1E5W A;  4AQR D;  1SQP J;  3LID A;  2WSE H;  1GTW A;  4MN4 C;  4L76 A;  3L70 J; 
#chains in the Genus database with same CATH homology
 1KIL C;  1ZV8 A;  3CI9 A;  4I1L A;  1QL2 A;  3IR9 A;  1LTA C;  1URQ B;  2NPS C;  2NPS D;  1GW4 A;  3SWF A;  1FDM A;  1LTJ A;  1JTH A;  1URQ C;  4HYT B;  1LTI C;  3A3Y B;  4N3Y B;  2KSJ A;  5AW4 B;  1T8Z A;  1T2K C;  3CL3 D;  1T2K D;  2N9B A;  2Q5U A;  1HGZ A;  1YTZ I;  1RF1 A;  1LWU C;  3L4F A;  2O01 H;  1HUC A;  2N1T A;  1ZR4 A;  1SQV K;  3HD7 A;  2OAR A;  3R2P A;  3KYQ A;  4WBA A;  1GDT A;  3HE4 B;  5AW8 B;  1NHL A;  2QM8 A;  2KP8 A;  3HRN A;  2VRS A;  1JY3 O;  2GUV A;  3MGN A;  2A45 I;  2H8P D;  3L35 A;  1CSB A;  2GM4 A;  3IFM A;  2PAJ A;  1NAF A;  1EQ7 A;  2YMY A;  4DZO A;  3P7K A;  1LTJ B;  1JTH B;  2Z5H A;  3O8Z A;  1N7S D;  2KOG A;  4OH8 B;  1GU5 A;  4W7Z A;  5AW3 B;  1M1J C;  2OYI A;  1RE4 A;  2I1J A;  3LW5 H;  1LTJ C;  3V2R A;  1H89 A;  5AW6 B;  1T3U A;  1RF1 B;  2WSC H;  5AVR B;  2YO2 A;  3U1C A;  2N1T B;  2W6A A;  5AVY B;  3HD7 B;  2XV5 A;  2Z4E A;  2R32 A;  2XU6 A;  3U59 A;  1RF1 C;  5BVZ A;  1A02 J;  4XA4 A;  2N1T C;  3HD7 C;  1RY3 A;  3HD7 D;  1SQQ K;  2C0W A;  3M9Q A;  3RL0 B;  4JF7 A;  1LTB C;  5CCG A;  4LC1 A;  2FKW B;  2HPC A;  5AVV B;  4N78 D;  1KQL A;  5AVT B;  1NKN A;  1WRG A;  4I6M C;  3HUS C;  3P8C D;  1SVF A;  4GT1 A;  1L4A A;  2JJL A;  2OYI B;  3RK3 B;  3RL0 C;  4WY4 D;  3MUD A;  2OYH A;  1SQX K;  1YTZ T;  2FXM A;  1NOH A;  3RK3 C;  1RE4 C;  4ZKU A;  2OYI C;  4KHX A;  1LWU A;  2FFD A;  1RF0 A;  1J1E B;  2R3C A;  1HH0 A;  1IO4 A;  1XTC C;  3KPE A;  5CMZ A;  1SLQ A;  1LGH B;  2HPC B;  2HFE D;  3EFG A;  2H43 A;  3VMY A;  3M0D A;  4JYB A;  2E43 A;  2P67 A;  1GL2 A;  2HG5 D;  4GKG A;  1J1E C;  3L36 A;  5AVZ B;  1L4A B;  5CJ0 A;  4W80 A;  1KIL D;  1KFM A;  5CCG C;  5CCG D;  1ZR2 A;  2OYH B;  1FZE A;  2H7H A;  4DOJ A;  1NU1 K;  1L4A C;  1M1J A;  1IFD A;  1FBM A;  2W6B A;  2HYN A;  1URQ D;  1LWU B;  3MD0 A;  2OYH C;  2FFD B;  2WIT A;  4M3L A;  1S9K E;  3HE5 A;  2PP6 A;  1JY2 N;  1N2D C;  2A45 G;  1X79 B;  3BAS A;  2J59 M;  1KFN A;  2WPQ A;  3TNU A;  5KJ7 A;  2A45 H;  2WSF H;  4AYC A;  2FFD C;  1CW5 A;  1GL2 B;  3NFQ A;  1RF0 C;  4RES B;  2R5B A;  2WT7 A;  1YYC A;  3M0D C;  2O1K A;  3HUS A;  1GL2 C;  1GL2 D;  3VMZ A;  1M1J B;  5APQ A;  3TYY A;  1JOC A;  3M9H A;  3OJA B;  3B5N B;  2KLV A;  1G1J A;  2POH A;  1SP4 A;  3LIE A;  3VP8 A;  1CZQ A;  3HE5 B;  1XTG B;  1FZF A;  3M9B A;  5AW7 B;  1X8Y A;  5CJ4 A;  1RE3 C;  3P8M C;  3WMM 0;  3TNU B;  3B5N C;  4LLH A;  1PFI A;  2WTY A;  1W2E A;  1L0N K;  2KB7 P;  2HLO A;  1X9V A;  1SFC A;  2WT7 B;  1HJB A;  3E1I A;  5KJ7 C;  1FZC A;  3HUS B;  1IJD B;  3M0A A;  2N1T D;  3P32 A;  3VTP C;  3OAK A;  1NTK K;  2M3B A;  4W7Y A;  5AVQ B;  3M06 A;  1LTG C;  1NTZ K;  2P2U A;  1FOS F;  3UIA A;  2Q3I A;  2C9L Y;  1KZU B;  1JCC A;  3B8E B;  3C9I A;  3OA7 A;  2FYU K;  1G2C A;  2WZ7 A;  3RL0 D;  1FJK A;  1JUN A;  5AVS B;  2JEE A;  3II6 A;  1JMM A;  5CCH C;  4IFD K;  2YNY A;  1ZLL A;  2HOD A;  1SFC B;  4GIF A;  3RK3 D;  5AW9 B;  3V4Q A;  1J1D B;  1CI6 A;  5BU5 A;  2Z5I A;  1FZC B;  5APU A;  2IPP A;  3U1A A;  2WPS A;  5AVX B;  3VMX A;  2P1J A;  3V4W A;  2XDJ A;  3PP5 A;  1SFC C;  2IFM A;  1FZA A;  1SFC D;  3VN0 A;  1J1D C;  1IFI A;  1HWT C;  1FZC C;  4N6J A;  4C7N A;  2XKM A;  3BRV B;  1DEB A;  5APT A;  1G2C B;  1GK6 A;  3V2N A;  1N7L A;  1QL1 A;  3KQG A;  4EIJ A;  1MUU A;  2LKM A;  1FOS E;  1GK4 A;  1J2J B;  3A7O A;  1IK9 A;  3TK1 A;  2I1K A;  4I2L C;  1DX7 A;  1JO5 A;  1T3J A;  1L4A D;  5AW0 B;  5AW1 B;  2HOD B;  2L5G B;  1H8A A;  1RE3 A;  1JY3 N;  3B5N A;  3BVH A;  1DH3 A;  2R5D A;  1CI6 B;  1IFN A;  1MFZ A;  2FYZ A;  3T97 A;  3A2A A;  2C9N Y;  3M91 A;  2MJZ A;  1N7S A;  3HTK A;  3MTU E;  3KDP B;  1NKZ B;  1S9K D;  1SQB K;  1Z56 A;  3CLQ A;  2P7J A;  4C7N B;  3MIW A;  3NMD A;  4IFF A;  5APX A;  5BU8 B;  2IFN A;  3G3Z A;  1IC2 A;  1FZB A;  4LGD E;  1HVV A;  1HTL C;  2YKO A;  1H88 A;  1L0L K;  1LT9 A;  2YKQ A;  2E42 A;  1MV8 A;  3NTN A;  5CCH A;  5KTB A;  2WPR A;  4JYC A;  2KYV A;  1G1I A;  3GHG A;  5AW5 B;  1N7S B;  3HTK B;  3BAT A;  3B5N D;  2O1J A;  1JY2 O;  4WY4 A;  2ZFC A;  1WT6 A;  5KLV K;  1A02 F;  3RK2 B;  1GD2 E;  3EQ2 A;  1NH4 A;  5AVW B;  1N7S C;  3N7N A;  5KJ7 D;  2M8R A;  2WWW A;  1NTM K;  5CHX A;  1HBW A;  1GZL A;  3V5B A;  2XNX A;  3RK2 C;  3RK2 D;  4HH2 A;  5AVU B;  1LT9 B;  2ZXE B;  4WB4 A;  1MZ9 A;  2XZR A;  3V2Q A;  1LTT C;  4Y99 B;  1GU4 A;  4N78 E;  4C7R A;  1HGV A;  5APS A;  1N73 A;  3GHG B;  1FJP A;  1LT9 C;  2CPS A;  3H6P A;  3P8C E;  3VYI A;  3H32 A;  1JCD A;  2IX7 C;  5AW2 B;  1KIL A;  1SQP K;  1OWA A;  4WY4 B;  2QM7 A;  5CCH D;  1IFM A;  1FU1 A;  3TSI A;  1ZN5 A;  2NPS A;  4Y99 C;  4AUW A;  2CPB A;  1N86 A;  3GHG C;  3VP9 A;  5APV A;  2Q7C A;  4XE5 B;  1VDF A;  4WY4 C;  4ZKP A;  2GUS A;  1URQ A;  1JNM A;  3A5T A;  1LTS C;  1NO4 A;  3N4X A;  2YKP A;  3I5C A;  1OXZ A;  1M7L A;  1IFJ A;  3BRT B;  4C46 A;  1NWQ A;  3VOP A;  2YO3 A;  5APY A;  1GW3 A;  2J58 A;  2C0X A;  4IFM A;  1N73 B;  1VPC A;  3V2P A;  3SWY A;  4B86 A;  3H32 B;  3L37 A;  1KIL B;  3NXS A;  2W27 A;  4O9B A;  1FZG A;  4EOT A;  5APW A;  1AQ5 A;  2BAS A;  1AFO A;  2NPS B;  1JY3 P;  1E5W A;  4AQR D;  1N73 C;  3LID A;  2WSE H;  2Q9I A;  1FAV A;  1GTW A;  3HE4 A;  1JY2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...