1FDMA

Fd major coat protein in sds micelles, nmr, 20 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
50
structure length
50
Chain Sequence
b'AEGDDPAKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FD MAJOR COAT PROTEIN
publication title fd coat protein structure in membrane environments: structural dynamics of the loop between the hydrophobic trans-membrane helix and the amphipathic in-plane helix.
pubmed doi rcsb
molecule tags Viral protein
total genus 9
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1997-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fdmA00
2C0WA 1IFIA 1IFDA 2CPBA 2MJZA 2C0XA 1HGVA 2CPSA 1HH0A 1IFJA 1HGZA 1FDMA 1NH4A
chains in the Genus database with same CATH superfamily
5KLIB 1L0LE 3A0HH 1LTAC 1PFIA 1BSHA 3RBZA 3H1ID 3I5CA 1SQPD 1VQNP 3OAKA 2E76C 1BCCG 2P58A 3WUUA 1KV4A 2P67A 2I1JA 1HUCA 2A06G 3RBXA 5B5EH 1N7SB 1OW7A 1PZQA 4O9BA 2Y0EA 5B66E 2I1KA 2XU6A 3CCLP 3N7NA 1P84H 3B5NC 1AVYA 1SQBG 5H2FH 3AEFC 5APTA 3PLNA 3VMAA 1LTSC 2PFXA 3TYYA 1PGOA 3M9BA 5CCHA 3F89A 3A0HE 2GM4A 2QRXA 2QM7A 5TISH 1H0TA 1KZUB 5AW1B 2R5BA 2E74B 3WMM0 2A45I 2YKQA 1ZN5A 4WY4C 2KIKA 1OVRA 5B5EE 1FJKA 3GHGC 4TLFA 4PV1C 1P84E 2JP3A 3BCCG 1NWQA 4U3FD 3MUDC 3H1JE 2MJZA 2C9NY 5AVUB 4H13B 1KYOE 2ZT9B 1URQB 2NPSA 1SFCC 4H13D 2WTYA 1VQLP 1XTGB 1M56D 5TISE 5E79H 3BVHA 5APUA 1NU1J 1PGQA 2ZVOB 1EZVG 1NTKG 3HRNA 2BCCJ 4JBZA 4N78D 4WWIA 4RJTA 4IL6H 2WT7A 3ABVC 1T3UA 3GLMA 5KLVK 3RL0D 2K9YA 1JY3O 4RESB 1OXZA 2E75D 4M3LA 3HTKB 2YKOA 2IZ1A 1AQTA 3A3YB 3KXDA 1SQVJ 1VQKP 2YKPA 1BGYE 2HYNA 2M5AB 5E79E 2H43A 3RK3C 4EI2A 4NPDA 3TNUB 2V7QJ 2GUSA 2FYUK 2R5DA 1Z56A 1FDOA 4IL6E 1LT1A 3IR9A 1K8AQ 4DZOA 2OARA 5KLVE 4H0LD 1KYOD 5AW6B 4C7NA 2ZYDA 3C8VA 3U1AA 2K1AA 3FGAD 1NTMG 3L37A 2O01H 1L0NK 4YXDC 2KSJA 1HJBA 2WITA 3WU2H 2B87B 1S1CX 1X9VA 1VL2A 2DW3A 1LWUC 1BE3G 1M57D 3KYQA 1YIJP 3MTUE 3H1HG 2C0WA 1LTIC 2D2CC 5C39A 3VOPA 4OGQC 3L72J 2FYUE 3SSUA 1W5CE 2HG5D 2WPSA 2FXPA 1KILC 1N7LA 3L75E 3FX0A 3UIAA 1LT9A 1G2CB 2OYIC 1S5LH 2FYNB 5KKZC 1Y47A 2A45G 3WU2E 1L0NE 4NPEA 2PAJA 3CWBE 4U3FJ 2W27A 1KQGB 2Q5UA 2PGDA 4AUWA 3HD7D 1ZRTE 4H44B 4DT0A 1LTGC 4D6TE 2LXCB 2M0BA 4LC1A 2KB7P 2ZJSE 5CCHC 4K3AA 3HTKA 1PPJE 1PGJA 3NMDA 1SVFA 2N1TD 1X22A 1GU5A 1GZLA 3CCJP 1S5LE 1NVOA 1OIPA 1PP9E 5K5GB 3K5BA 4MN4C 1AFOA 2QVAA 3Q1MA 1QGKB 2KXPB 3TNUA 1K73Q 1NTKJ 1NTZD 3O8ZA 3CC2P 2V4HA 3B4SA 1VQ4P 1FZAA 3S1KA 3MZWB 2QJYC 1OW8A 1ZP0C 2P10A 1OWAA 1AQ5A 3L75D 2NPSC 2AEMA 3H1LG 1RE3A 2OGUA 3RK2C 3L36A 3OJAB 2B87A 1MZ9A 3PH0A 1JY3N 3MP7B 1QL1A 3BASA 3H6PA 1FZBA 3AE6C 2Q3EA 4BWNA 4C46A 1S9KD 1WT6A 1PGPA 3GW6A 3S4RA 2ZYAA 1OVVA 3HE4A 3L73G 5DJUB 4GT1A 3FXDA 5KLIC 2IBZI 1KORA 1M7LA 3VTPC 1NU1K 4I7ZC 3L70J 4Y99B 2MKVA 1Q90D 1U57A 5APVA 1SQXG 1JY3P 1N7SC 1KQLA 3SWYA 1QVFO 1EXJA 3TGUG 5CCGD 4YPCA 3A5TA 5BU5A 3CC4P 3AE9C 1SQVK 4NPFX 5GTHH 1IJDB 3H1KG 3VMXA 1VPCA 4JPZB 2E74C 4AYCA 4ASVA 2V7QH 2BCCE 4KJMA 2IZ0A 2W90A 1M8OB 5CJ4A 2NRGA 1R5SA 2HPCB 2E5YA 3IF4A 2E5TA 2FFDB 2QJKB 1KC8Q 1N73B 3FWNA 4H13C 3IN6A 1N86A 3CCMP 3U59A 2ZT9C 1URQC 2ITAA 1SQVE 4GKGA 5GTHE 3EQ2A 4GIFA 2YIUB 3L74G 4UB6E 2JWDA 1NTZJ 2IFNA 1IFIA 3CLQA 1GW3A 2FYZA 5TJHA 2WMMA 3KHUA 1IFMA 1AA0A 3H1IE 3CCRP 1H0TB 1SQPE 1NJIQ 1ZMEC 2RKLA 1RF0A 4GOEA 4LLHA 1QVGO 2WSCH 3LIDA 1NHLA 3W67A 1NU1D 2G3AA 1J1EB 5CCGA 2WZ7A 5AW4B 2QJPB 4HKZH 2BCCD 5APXA 4L76A 2W8ZA 1FS0E 3L72E 4YTPC 5AVZB 1SS1A 1X0TA 5DJTB 1USDA 2IBZG 4L75A 1VQ7P 3VN0A 1Y9BA 3L73J 3L71G 3CMAP 1LGHB 1MUUA 5CBOA 2PRRA 3NTNA 5AVQB 1YYCA 4U3FE 1NTKK 3ITKA 2K37A 1KYOI 1OVUA 2H8PD 1SQPG 2HPCA 3VP9A 3TGUJ 1J1DB 4RO0A 2KP8A 2R44A 2FFDA 1N73A 4I6MC 1LTJB 4QMAA 2Q9IA 3VMZA 5CBNA 4N78E 3N4XA 2M3EA 2FYNC 4DJGA 1BCCD 2AXTH 2ZYGA 3VYIA 3B8EB 1KYOH 4C7NB 1GL2D 5KJ7D 4L74A 1M1JA 3AEEC 3L72D 4H44C 3CCVP 2HLOA 4KT0J 3V2NA 1SQBD 3H32B 4OH8B 1JY2O 2RN0A 1L4AD 1KB9D 1SQQG 1NTMK 1HGVA 3AE7C 1FZCB 2ZXEB 3MHVA 1OW6A 2LXBA 2AXTE 1DD3A 1L0LG 3AE3C 2Y9ZA 2I8DA 1T2KC 2QA4P 1GK4A 1LT9B 3L4FA 3D71A 1YJNP 1IK9A 3HE5B 1HGZA 4L73A 3GF3A 2OYHB 2HFED 3RL0B 3CCUP 1S3JA 2WSEJ 1NKZB 2E75B 2BASA 3V4WA 2O1KA 1S72P 4JF7A 1Q81Q 1EZVD 1NTKD 1VQ6P 1LJ2A 1LTTC 2Z5HA 3JSVC 2W6BA 1BSNA 5AW0B 1RF0C 1CI6B 1HWTC 1FOSF 1ZR2A 2UWJE 5BU8B 1LTJA 1Q82Q 1NTZK 3M0DA 2E42A 1A02J 4IOIH 3G6EP 4H0LB 4Y99C 3H1JG 1JM0A 2E43A 3M9HA 1GL2A 2JR8A 3CXHD 2N9BA 4R4LA 2AXCA 3CCQP 2FXMA 1CZQA 3BATA 2JDIH 3D6YA 2KLUA 2OTJP 1OX3A 1VF5B 3H32A 2JO1A 4LGDE 3L70D 1BCCJ 1VF5D 4IFDK 4GDOA 1RF1C 4HYTB 2IDBA 2Y0DA 1NTZE 1NTMD 3AE4C 1FZCA 3AEGC 3HE4B 4AQRD 1VQ9P 1SQBJ 1BE3D 2XKMA 3KZIH 4OVNF 3H1HD 5CJ0A 1DX7A 2H88C 4HH2A 2WVRA 1BGYG 2CPBA 2QJKC 2H89C 4RKUJ 3HE5A 3HD7B 3TK1A 2E76D 1GTWA 2IPPA 1IZNB 2OYHA 2Z5IA 1EDJA 5KTBA 1A02F 3B5NB 2YIUC 1S9KE 1SQQJ 5KLVG 1WRGA 3H25A 3P8CD 1SQXK 1VDFA 1PV3A 5L8RJ 3B5ND 2N1TB 1JY2N 2SPZA 1QEXA 4C7RA 3S9OA 3BCCJ 2YO3A 2GUVA 1UIIA 1KN7A 3KZIE 1L0LJ 2O1JA 1IFPA 1RQVA 1YI2P 3CPWO 1CI6A 1FC2C 2AEFA 1WMKA 2IFMA 4WY4D 2FYUG 4PV1B 1J1EC 1IO4A 4PV1D 2BEZF 3L75G 3II6A 1JY2P 2WSFJ 3R4YA 5AW3B 1K9MQ 1L0NG 5AVTB 1HVVA 1SFCD 3CWBG 5AW8B 4EYYQ 3Q2YA 2KNCB 1NKNA 3V5BA 4D6TG 3H1LD 1K04A 2JKVA 3FWLA 1S4XA 3IFMA 2OTKE 2IX7C 3PP5A 2K88A 2Q6QA 1PPJG 3E7KA 4ZMDA 1N2DC 2FBWC 4IFFA 3SFDC 4K35A 4N6JA 2N9YB 1FOSE 2KK7A 1PP9G 3GG2A 4BXLA 1K05A 2W6AA 1NTMJ 2WSEH 3L73D 3HD7A 1LTJC 1FDMA 2OTLP 1KD1Q 1QX8A 1LNQA 1BE3J 2Q1KA 3B5NA 3RK3D 3H1HJ 3E1RA 2IYOA 2KS1A 4XA4A 2K9JA 4BRYA 2N1TA 5M1BA 1SQXD 1KQFB 4W7YA 3AEAC 1DEEG 3TGUD 1D7MA 1ZV8A 2IYPA 4UB6H 2L91A 2KI7B 1NU1E 4JYCA 3D70A 1JB0J 1LWUB 3AE8C 2WWWA 3I56P 4XFJA 2D2CB 1FZCC 3H1KD 3GHGA 3E1IA 2D2CD 1KQSO 1IFNA 1GDTA 4OGQD 1R5LA 2XNXA 1LT9C 5CHXA 1KILD 1SFCA 3EFFK 1E79H 2OYIB 1R8EA 5EFWB 4PD4D 4ZNCA 3AE1C 3RL0C 2KNCA 3BRVB 1M1JB 3SWFA 1Q7YQ 3GMAA 2E75C 1SQBK 3L74D 2FKWB 4Y28J 1PL5A 2O01N 4ASWA 2Y9YA 3CC7P 4TT3H 1DIPA 1W2BO 1NU1G 5CCHD 3KQGA 2YXRB 2W83C 3H1LJ 1BCCE 1GU4A 2BCCG 2XDJA 1EDLA 2O01J 1YHQP 1SQQK 3VP8A 1EZVI 4DCKA 3CMEP 4H0LC 1JMMA 4I2LC 1SQBE 2YMKA 3V2PA 1L0LK 1SP4A 1ZOYC 4W7ZA 1UIXA 3M0AA 2LKMA 2Q7CA 1SQVG 2WSSH 3LIEA 2JWAA 1RE3C 1MKMA 1KB9E 3TSIA 2LR2A 1M1KQ 1FZEA 1RE4A 2G8YA 3D6ZA 2NPSD 1USEA 3RK2B 3F5HA 4U7JA 4Z1MH 1ZXGA 2Z4EA 3CXHI 2IBZD 1LWUA 3RK2D 3SWKA 5KAFH 1RY3A 2HODB 3H1IG 3L71D 1SQXJ 3U1CA 4KHXA 2HR3A 3MIWA 3MGNA 1FZFA 2WSFH 1W2EA 2KUBA 1L2PA 1BDCA 1KILA 2JJLA 1AVOA 4I7ZB 2R32A 2OYIA 3CL3D 1GL2B 3CXHH 1M90Q 3H1KJ 3HD7C 1RHZB 1KTMA 2XZRA 2A06D 5AVSB 3G9RA 1EZVE 1NTKE 3RGUA 3L72G 3PRJA 5KAFE 3PHLA 2B88A 1N7SD 4WBAA 1HF9A 1L4AB 2QG4A 2C0XA 5APSA 3MD0A 4JQ0D 4R4MA 1S2EA 2N1TC 3TF5A 3V2RA 2FXOA 2BEQD 1JOCA 3P32A 1NOHA 2KZJA 3AE2C 1RQUA 4U3FG 3AE5C 3EWKA 3CXHE 1OZHA 3L74J 2E74D 3CX5D 2KSEA 1SQQD 1CW5A 1EDKA 1NAYA 3BCCD 1QL2A 5H2FE 2WPRA 3C1LA 3O6QB 1JEKA 1L0LD 3FXEA 3L70E 5APQA 3P8MC 2J59M 2H7HA 1JUNA 2GA1A 4HB1A 2ZT9D 1NAFA 1NTME 1URQD 3KDPB 2A45H 1Y8AA 1G1IA 2J58A 1IC2A 1BE3E 1QLED 3HUSB 3W68A 2HODA 3H1HE 3RL0g 2O3JA 2ZFCA 3P7KA 5BVZA 3G3ZA 3M9QA 4W80A 4OWFA 5CCGC 3L71J 3P8CE 2ZVNB 3B71A 3SFEC 5KJ7A 3QH9A 4YXWH 1GW4A 3AECC 1N7SA 1LTBC 1RH5B 1P84D 3CD6P 2QIWA 2QM8A 1L4AA 3H1IJ 1JNMA 3H1JD 5AW2B 1SQPJ 3M06A 1VQ8P 1JCDA 4WVZA 5AW5B 3L70G 1U7JA 3Q3DA 3JCUH 1HJ0A 3AEDC 3NXSA 3CI9A 1RE4C 4A7PA 1YQ3C 1GK6A 2J5UA 2ZAEB 1YBKA 4GOFA 2OYOA 3WUTA 1H8AA 1DD4A 3A0BH 4IFMA 3QWOC 2WQYC 2PP6A 5KAIH 2E76B 1PIXA 1VQOP 2FFDC 1AJYA 5APYA 4CPGA 1N73C 3O6QA 3JCUE 2VRSA 2RH0A 1DEBA 1URQA 5AVWB 2WSCJ 3H1LE 2CK3H 1BGYD 2KS1B 2OQQA 1DH3A 1CSBA 2K9JB 1HTLC 3USSA 4BRYB 1IFJA 1FU1A 1FE6A 1M1JC 2XV5A 4HJGH 3KPEA 3HUSA 3LW5J 1KFMA 3A0BE 4ZKPA 3EFGA 1T3JA 5KAIE 5KLVD 4H44D 1HBWA 1T6AA 4PD4I 1JCCA 2KLVA 4WY4B 5CMZA 3L73E 1MV8A 2CPSA 4DOJA 1EDIA 4IL6X 1NH4A 3A7OA 3OA7A 1NTZG 3GHGB 2P2UA 3RK3E 2C9LY 4EDFA 2QJPC 2M5AA 2R3CA 1ZLLA 4UB8H 3JC22 1G1JA 1SQXE 1YITP 3TGUE 1SFCB 3V6IA 4N3YB 1LP1B 2FYUD 4XE5B 1H89A 1T2KD 4PD4H 3Q5PA 1TU3F 1YTZI 2W6JH 3L35A 1XTCC 3IAOA 3T97B 3TDKA 3H1KE 5AVRB 1L0ND 2WPQA 3G71P 2B89A 3CWBD 2KZIA 4PJ0H 1HH0A 3H1JJ 4UB8E 3BRTB 2L5GB 1ZRTD 2KOGA 4D6TD 1KILE 3VMYA 1J1DC 1AV1A 2K3RA 4ZKUA 4PD4E 1J2JB 2FY8A 4GODA 1PPJD 3M0DC 3CCSP 3RK3B 2QE7H 1BDDA 3ZDMA 1NYHA 4EIJA 2R3SA 5AVVB 4JYBA 1G2CA 1NO4A 3NFQA 1GL2C 5GTIH 1PP9D 5KJ7C 3L74E 3R2PA 5APWA 1IK7A 2M3BA 2Q3IA 2YO2A 4PJ0E 1YJWP 1S5LX 1N8RQ 3PJSK 1GD2E 1X8YA 1L4AC 1FDIA 1BGYJ 4I1LA 4WY4A 2Y0CA 1U7MA 4WB4A 1RF1B 1EXIA 1Q2NA 1JTHB 4OGQB 1X79B 1T8ZA 1FAVA 5GTIE 3MUDA 1KILB 5KLVJ 1SQPK 3V2QA 1KB9I 2WPVB 2YXQB 5AW9B 3I55P 1Q86Q 1EQ7A 1ZW0A 2P1JA 1LP1A 5KKZB 1NGMB 2IBZE 1JMBA 2OYHC 3CX5I 2XNDH 3AEBC 1ZR4A 3L71E 3T97A 3M91A 2QSIA 2FYUJ 1YTZT 2YMYA 1KB9H 3HUSC 1MFTA 4EOTA 3V4QA 3L75J 1YQ4C 3PTZA 1FBMA 1IFDA 2P7JA 3Q5SA 1JO5A 3CCEP 2POHA 2KYVA 2YNYA 2A06E 1L0NJ 3CX5H 1VQMP 3CWBJ 1VQ5P 1EC5A 1OFCX 3G4SP 3WUVA 2M8RA 4D6TJ 2QJYB 5AW7B 3LW5H 2NPSB 3C9IA 3GF7A 3OW2O 1KFNA 1OMIA 3Q5RA 2JEEA 1VQPP 1VF5C 2RMZA 1KMIZ 5AVYB 1H88A 1E5WA 2QEXP 5AVXB 1YJ9P 1SLQA 2ZXXA 1PP9J 5B66H 1SQVD 2NZ2A 3CX5E 2WT7B 2B9BA 1SQQE 1GMJA 1RF1A 4B86A 1MFZA 1P84I 1FJPA 1JTHA 2AEJA 3BCCE 1FZGA 3A2AA
chains in the Genus database with same CATH topology
1LTAC 1PFIA 5CJ4A 3I5CA 2IFMA 3G3ZA 3M9QA 2HPCB 4WY4D 4W80A 3OAKA 1J1EC 5CCGC 2P67A 2FFDB 3P8CE 5KJ7A 2I1JA 1HUCA 1N73B 1IO4A 1N86A 3U59A 1N7SB 1GW4A 3II6A 1JY2P 4O9BA 1URQC 1N7SA 2I1KA 2XU6A 1LTBC 3N7NA 4GKGA 3B5NC 3EQ2A 4GIFA 5AW3B 2QM8A 5AVTB 1L4AA 1JNMA 1HVVA 1SFCD 5AW2B 3M06A 2IFNA 1IFIA 5APTA 1JCDA 3CLQA 1LTSC 5AW5B 5AW8B 3TYYA 3M9BA 1GW3A 2FYZA 1NKNA 5CCHA 3NXSA 3V5BA 2GM4A 1IFMA 3CI9A 1RE4C 2QM7A 1KZUB 5AW1B 2R5BA 3IFMA 1GK6A 1RF0A 4LLHA 3WMM0 2IX7C 2A45I 3PP5A 2YKQA 1ZN5A 4WY4C 1N2DC 2WSCH 3LIDA 1H8AA 4IFFA 1FJKA 4N6JA 3GHGC 1NHLA 1FOSE 4IFMA 2PP6A 1NWQA 1J1EB 2W6AA 2FFDC 5APYA 5CCGA 2WZ7A 5AW4B 1N73C 2MJZA 2WSEH 2C9NY 5APXA 5AVUB 3HD7A 1LTJC 1FDMA 2VRSA 1DEBA 1URQB 2NPSA 1SFCC 1URQA 5AVWB 2WTYA 3B5NA 3RK3D 1XTGB 5AVZB 3BVHA 4XA4A 1DH3A 1CSBA 5APUA 1HTLC 1IFJA 1FU1A 2N1TA 4W7YA 1M1JC 2XV5A 3HRNA 3VN0A 3KPEA 4N78D 3HUSA 1LGHB 2WT7A 1ZV8A 1T3UA 1MUUA 5KLVK 3RL0D 4JYCA 1KFMA 3NTNA 5AVQB 3EFGA 4ZKPA 1T3JA 1JY3O 1YYCA 1NTKK 4RESB 1HBWA 1OXZA 1JCCA 1LWUB 2KLVA 4M3LA 3HTKB 4WY4B 2WWWA 5CMZA 1MV8A 2CPSA 2YKOA 4DOJA 1NH4A 2H8PD 3A7OA 3OA7A 3A3YB 3GHGB 1FZCC 2HPCA 3VP9A 3GHGA 2YKPA 3E1IA 2P2UA 2HYNA 1J1DB 2C9LY 2KP8A 2R3CA 2FFDA 1IFNA 1ZLLA 2H43A 1GDTA 1N73A 4I6MC 1G1JA 1LTJB 3RK3C 2XNXA 3TNUB 2Q9IA 1LT9C 2GUSA 3VMZA 5CHXA 1SFCB 2FYUK 2R5DA 1Z56A 4N78E 1KILD 1SFCA 3N4XA 4N3YB 2OYIB 4XE5B 3IR9A 1H89A 4DZOA 1T2KD 2OARA 3VYIA 3B8EB 4C7NB 1YTZI 5AW6B 4C7NA 1GL2D 3RL0C 3BRVB 1M1JB 3L35A 5KJ7D 3SWFA 3U1AA 1XTCC 1M1JA 2HLOA 1SQBK 3L37A 2O01H 1L0NK 3V2NA 2KSJA 1HJBA 5AVRB 2WITA 3H32B 1X9VA 2WPQA 2FKWB 4OH8B 1JY2O 1LWUC 1L4AD 3KYQA 1HH0A 3MTUE 3BRTB 2L5GB 2C0WA 1NTMK 1HGVA 1LTIC 2KOGA 5CCHD 3KQGA 3VOPA 3VMYA 1FZCB 2ZXEB 1J1DC 4ZKUA 2HG5D 2WPSA 1GU4A 1J2JB 2XDJA 1KILC 1SQQK 1N7LA 3M0DC 3VP8A 3RK3B 1T2KC 4EIJA 1GK4A 1LT9B 5AVVB 3L4FA 3UIAA 1LT9A 4JYBA 1G2CB 2OYIC 1G2CA 1NO4A 1IK9A 3NFQA 1JMMA 4I2LC 1GL2C 2A45G 5KJ7C 1L0LK 1SP4A 3V2PA 3R2PA 3HE5B 4W7ZA 1HGZA 2PAJA 3M0AA 5APWA 2LKMA 2Q7CA 3LIEA 2W27A 2M3BA 2Q5UA 2Q3IA 2HFED 2OYHB 2YO2A 3RL0B 4AUWA 1RE3C 3TSIA 3HD7D 1NKZB 1GD2E 1X8YA 1FZEA 1LTGC 1L4AC 1RE4A 2BASA 2NPSD 3V4WA 2O1KA 3RK2B 4JF7A 4LC1A 2Z4EA 2KB7P 5CCHC 1LWUA 4I1LA 3RK2D 3HTKA 4WY4A 1LTTC 2Z5HA 1RY3A 3NMDA 2HODB 1SVFA 2N1TD 4WB4A 1RF1B 2W6BA 5AW0B 3U1CA 4KHXA 1GU5A 3MIWA 1GZLA 1RF0C 1JTHB 3MGNA 1CI6B 1X79B 1FZFA 1HWTC 1FOSF 1T8ZA 1ZR2A 1FAVA 5BU8B 2WSFH 1W2EA 3MUDA 1KILB 1KILA 1LTJA 1SQPK 1NTZK 2JJLA 3V2QA 1AFOA 3M0DA 3TNUA 2E42A 1A02J 5AW9B 1EQ7A 3O8ZA 2R32A 4Y99C 2OYIA 2P1JA 3CL3D 1FZAA 1GL2B 2E43A 3M9HA 1GL2A 3HD7C 2N9BA 2XZRA 5AVSB 2FXMA 1OWAA 2OYHC 1AQ5A 2NPSC 1CZQA 3BATA 1RE3A 1ZR4A 1N7SD 3T97A 4WBAA 3M91A 3RK2C 1L4AB 3L36A 2C0XA 5APSA 3OJAB 3MD0A 3H32A 1MZ9A 1JY3N 2N1TC 1QL1A 1YTZT 3BASA 3H6PA 3V2RA 4LGDE 2YMYA 1FZBA 4IFDK 3HUSC 1JOCA 3P32A 1RF1C 4C46A 4HYTB 4EOTA 1S9KD 1NOHA 1WT6A 3V4QA 1FZCA 1FBMA 1IFDA 3HE4B 2P7JA 4AQRD 3HE4A 1JO5A 2POHA 4GT1A 2KYVA 2YNYA 2XKMA 1M7LA 3VTPC 5CJ0A 1NU1K 1DX7A 1CW5A 4HH2A 4Y99B 2CPBA 2M8RA 1QL2A 2WPRA 5APVA 5AW7B 3HE5A 3HD7B 3TK1A 1JY3P 3LW5H 1N7SC 1KQLA 3SWYA 5APQA 1GTWA 2IPPA 5CCGD 2NPSB 3C9IA 2OYHA 3P8MC 2J59M 2Z5IA 2H7HA 1JUNA 5KTBA 3A5TA 1A02F 3B5NB 1S9KE 1KFNA 2JEEA 1NAFA 1URQD 5AVYB 1WRGA 2A45H 3KDPB 3P8CD 1G1IA 5BU5A 1SQXK 1VDFA 1H88A 3B5ND 1E5WA 2N1TB 1SQVK 1JY2N 5AVXB 4C7RA 1SLQA 2YO3A 2J58A 1IC2A 2GUVA 3HUSB 2WT7B 1IJDB 2HODA 2O1JA 3VMXA 1RF1A 1VPCA 4B86A 1MFZA 1FJPA 2ZFCA 1JTHA 4AYCA 3P7KA 1CI6A 5BVZA 1FZGA 3A2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0W A;  1IFI A;  1IFD A;  2CPB A;  2MJZ A;  2C0X A;  1HGV A;  2CPS A;  1HH0 A;  1IFJ A;  1HGZ A;  1FDM A;  1NH4 A; 
#chains in the Genus database with same CATH topology
 5KLI B;  1L0L E;  3A0H H;  1LTA C;  1PFI A;  1BSH A;  3RBZ A;  3H1I D;  3I5C A;  1SQP D;  1VQN P;  3OAK A;  2E76 C;  1BCC G;  2P58 A;  3WUU A;  1KV4 A;  2P67 A;  2I1J A;  1HUC A;  2A06 G;  3RBX A;  5B5E H;  1N7S B;  1OW7 A;  1PZQ A;  4O9B A;  2Y0E A;  5B66 E;  2I1K A;  2XU6 A;  3CCL P;  3N7N A;  1P84 H;  3B5N C;  1AVY A;  1SQB G;  5H2F H;  3AEF C;  5APT A;  3PLN A;  3VMA A;  1LTS C;  2PFX A;  3TYY A;  1PGO A;  3M9B A;  5CCH A;  3F89 A;  3A0H E;  2GM4 A;  2QRX A;  2QM7 A;  5TIS H;  1H0T A;  1KZU B;  5AW1 B;  2R5B A;  2E74 B;  3WMM 0;  2A45 I;  2YKQ A;  1ZN5 A;  4WY4 C;  2KIK A;  1OVR A;  5B5E E;  1FJK A;  3GHG C;  4TLF A;  4PV1 C;  1P84 E;  2JP3 A;  3BCC G;  1NWQ A;  4U3F D;  3MUD C;  3H1J E;  2MJZ A;  2C9N Y;  5AVU B;  4H13 B;  1KYO E;  2ZT9 B;  1URQ B;  2NPS A;  1SFC C;  4H13 D;  2WTY A;  1VQL P;  1XTG B;  1M56 D;  5TIS E;  5E79 H;  3BVH A;  5APU A;  1NU1 J;  1PGQ A;  2ZVO B;  1EZV G;  1NTK G;  3HRN A;  2BCC J;  4JBZ A;  4N78 D;  4WWI A;  4RJT A;  4IL6 H;  2WT7 A;  3ABV C;  1T3U A;  3GLM A;  5KLV K;  3RL0 D;  2K9Y A;  1JY3 O;  4RES B;  1OXZ A;  2E75 D;  4M3L A;  3HTK B;  2YKO A;  2IZ1 A;  1AQT A;  3A3Y B;  3KXD A;  1SQV J;  1VQK P;  2YKP A;  1BGY E;  2HYN A;  2M5A B;  5E79 E;  2H43 A;  3RK3 C;  4EI2 A;  4NPD A;  3TNU B;  2V7Q J;  2GUS A;  2FYU K;  2R5D A;  1Z56 A;  1FDO A;  4IL6 E;  1LT1 A;  3IR9 A;  1K8A Q;  4DZO A;  2OAR A;  5KLV E;  4H0L D;  1KYO D;  5AW6 B;  4C7N A;  2ZYD A;  3C8V A;  3U1A A;  2K1A A;  3FGA D;  1NTM G;  3L37 A;  2O01 H;  1L0N K;  4YXD C;  2KSJ A;  1HJB A;  2WIT A;  3WU2 H;  2B87 B;  1S1C X;  1X9V A;  1VL2 A;  2DW3 A;  1LWU C;  1BE3 G;  1M57 D;  3KYQ A;  1YIJ P;  3MTU E;  3H1H G;  2C0W A;  1LTI C;  2D2C C;  5C39 A;  3VOP A;  4OGQ C;  3L72 J;  2FYU E;  3SSU A;  1W5C E;  2HG5 D;  2WPS A;  2FXP A;  1KIL C;  1N7L A;  3L75 E;  3FX0 A;  3UIA A;  1LT9 A;  1G2C B;  2OYI C;  1S5L H;  2FYN B;  5KKZ C;  1Y47 A;  2A45 G;  3WU2 E;  1L0N E;  4NPE A;  2PAJ A;  3CWB E;  4U3F J;  2W27 A;  1KQG B;  2Q5U A;  2PGD A;  4AUW A;  3HD7 D;  1ZRT E;  4H44 B;  4DT0 A;  1LTG C;  4D6T E;  2LXC B;  2M0B A;  4LC1 A;  2KB7 P;  2ZJS E;  5CCH C;  4K3A A;  3HTK A;  1PPJ E;  1PGJ A;  3NMD A;  1SVF A;  2N1T D;  1X22 A;  1GU5 A;  1GZL A;  3CCJ P;  1S5L E;  1NVO A;  1OIP A;  1PP9 E;  5K5G B;  3K5B A;  4MN4 C;  1AFO A;  2QVA A;  3Q1M A;  1QGK B;  2KXP B;  3TNU A;  1K73 Q;  1NTK J;  1NTZ D;  3O8Z A;  3CC2 P;  2V4H A;  3B4S A;  1VQ4 P;  1FZA A;  3S1K A;  3MZW B;  2QJY C;  1OW8 A;  1ZP0 C;  2P10 A;  1OWA A;  1AQ5 A;  3L75 D;  2NPS C;  2AEM A;  3H1L G;  1RE3 A;  2OGU A;  3RK2 C;  3L36 A;  3OJA B;  2B87 A;  1MZ9 A;  3PH0 A;  1JY3 N;  3MP7 B;  1QL1 A;  3BAS A;  3H6P A;  1FZB A;  3AE6 C;  2Q3E A;  4BWN A;  4C46 A;  1S9K D;  1WT6 A;  1PGP A;  3GW6 A;  3S4R A;  2ZYA A;  1OVV A;  3HE4 A;  3L73 G;  5DJU B;  4GT1 A;  3FXD A;  5KLI C;  2IBZ I;  1KOR A;  1M7L A;  3VTP C;  1NU1 K;  4I7Z C;  3L70 J;  4Y99 B;  2MKV A;  1Q90 D;  1U57 A;  5APV A;  1SQX G;  1JY3 P;  1N7S C;  1KQL A;  3SWY A;  1QVF O;  1EXJ A;  3TGU G;  5CCG D;  4YPC A;  3A5T A;  5BU5 A;  3CC4 P;  3AE9 C;  1SQV K;  4NPF X;  5GTH H;  1IJD B;  3H1K G;  3VMX A;  1VPC A;  4JPZ B;  2E74 C;  4AYC A;  4ASV A;  2V7Q H;  2BCC E;  4KJM A;  2IZ0 A;  2W90 A;  1M8O B;  5CJ4 A;  2NRG A;  1R5S A;  2HPC B;  2E5Y A;  3IF4 A;  2E5T A;  2FFD B;  2QJK B;  1KC8 Q;  1N73 B;  3FWN A;  4H13 C;  3IN6 A;  1N86 A;  3CCM P;  3U59 A;  2ZT9 C;  1URQ C;  2ITA A;  1SQV E;  4GKG A;  5GTH E;  3EQ2 A;  4GIF A;  2YIU B;  3L74 G;  4UB6 E;  2JWD A;  1NTZ J;  2IFN A;  1IFI A;  3CLQ A;  1GW3 A;  2FYZ A;  5TJH A;  2WMM A;  3KHU A;  1IFM A;  1AA0 A;  3H1I E;  3CCR P;  1H0T B;  1SQP E;  1NJI Q;  1ZME C;  2RKL A;  1RF0 A;  4GOE A;  4LLH A;  1QVG O;  2WSC H;  3LID A;  1NHL A;  3W67 A;  1NU1 D;  2G3A A;  1J1E B;  5CCG A;  2WZ7 A;  5AW4 B;  2QJP B;  4HKZ H;  2BCC D;  5APX A;  4L76 A;  2W8Z A;  1FS0 E;  3L72 E;  4YTP C;  5AVZ B;  1SS1 A;  1X0T A;  5DJT B;  1USD A;  2IBZ G;  4L75 A;  1VQ7 P;  3VN0 A;  1Y9B A;  3L73 J;  3L71 G;  3CMA P;  1LGH B;  1MUU A;  5CBO A;  2PRR A;  3NTN A;  5AVQ B;  1YYC A;  4U3F E;  1NTK K;  3ITK A;  2K37 A;  1KYO I;  1OVU A;  2H8P D;  1SQP G;  2HPC A;  3VP9 A;  3TGU J;  1J1D B;  4RO0 A;  2KP8 A;  2R44 A;  2FFD A;  1N73 A;  4I6M C;  1LTJ B;  4QMA A;  2Q9I A;  3VMZ A;  5CBN A;  4N78 E;  3N4X A;  2M3E A;  2FYN C;  4DJG A;  1BCC D;  2AXT H;  2ZYG A;  3VYI A;  3B8E B;  1KYO H;  4C7N B;  1GL2 D;  5KJ7 D;  4L74 A;  1M1J A;  3AEE C;  3L72 D;  4H44 C;  3CCV P;  2HLO A;  4KT0 J;  3V2N A;  1SQB D;  3H32 B;  4OH8 B;  1JY2 O;  2RN0 A;  1L4A D;  1KB9 D;  1SQQ G;  1NTM K;  1HGV A;  3AE7 C;  1FZC B;  2ZXE B;  3MHV A;  1OW6 A;  2LXB A;  2AXT E;  1DD3 A;  1L0L G;  3AE3 C;  2Y9Z A;  2I8D A;  1T2K C;  2QA4 P;  1GK4 A;  1LT9 B;  3L4F A;  3D71 A;  1YJN P;  1IK9 A;  3HE5 B;  1HGZ A;  4L73 A;  3GF3 A;  2OYH B;  2HFE D;  3RL0 B;  3CCU P;  1S3J A;  2WSE J;  1NKZ B;  2E75 B;  2BAS A;  3V4W A;  2O1K A;  1S72 P;  4JF7 A;  1Q81 Q;  1EZV D;  1NTK D;  1VQ6 P;  1LJ2 A;  1LTT C;  2Z5H A;  3JSV C;  2W6B A;  1BSN A;  5AW0 B;  1RF0 C;  1CI6 B;  1HWT C;  1FOS F;  1ZR2 A;  2UWJ E;  5BU8 B;  1LTJ A;  1Q82 Q;  1NTZ K;  3M0D A;  2E42 A;  1A02 J;  4IOI H;  3G6E P;  4H0L B;  4Y99 C;  3H1J G;  1JM0 A;  2E43 A;  3M9H A;  1GL2 A;  2JR8 A;  3CXH D;  2N9B A;  4R4L A;  2AXC A;  3CCQ P;  2FXM A;  1CZQ A;  3BAT A;  2JDI H;  3D6Y A;  2KLU A;  2OTJ P;  1OX3 A;  1VF5 B;  3H32 A;  2JO1 A;  4LGD E;  3L70 D;  1BCC J;  1VF5 D;  4IFD K;  4GDO A;  1RF1 C;  4HYT B;  2IDB A;  2Y0D A;  1NTZ E;  1NTM D;  3AE4 C;  1FZC A;  3AEG C;  3HE4 B;  4AQR D;  1VQ9 P;  1SQB J;  1BE3 D;  2XKM A;  3KZI H;  4OVN F;  3H1H D;  5CJ0 A;  1DX7 A;  2H88 C;  4HH2 A;  2WVR A;  1BGY G;  2CPB A;  2QJK C;  2H89 C;  4RKU J;  3HE5 A;  3HD7 B;  3TK1 A;  2E76 D;  1GTW A;  2IPP A;  1IZN B;  2OYH A;  2Z5I A;  1EDJ A;  5KTB A;  1A02 F;  3B5N B;  2YIU C;  1S9K E;  1SQQ J;  5KLV G;  1WRG A;  3H25 A;  3P8C D;  1SQX K;  1VDF A;  1PV3 A;  5L8R J;  3B5N D;  2N1T B;  1JY2 N;  2SPZ A;  1QEX A;  4C7R A;  3S9O A;  3BCC J;  2YO3 A;  2GUV A;  1UII A;  1KN7 A;  3KZI E;  1L0L J;  2O1J A;  1IFP A;  1RQV A;  1YI2 P;  3CPW O;  1CI6 A;  1FC2 C;  2AEF A;  1WMK A;  2IFM A;  4WY4 D;  2FYU G;  4PV1 B;  1J1E C;  1IO4 A;  4PV1 D;  2BEZ F;  3L75 G;  3II6 A;  1JY2 P;  2WSF J;  3R4Y A;  5AW3 B;  1K9M Q;  1L0N G;  5AVT B;  1HVV A;  1SFC D;  3CWB G;  5AW8 B;  4EYY Q;  3Q2Y A;  2KNC B;  1NKN A;  3V5B A;  4D6T G;  3H1L D;  1K04 A;  2JKV A;  3FWL A;  1S4X A;  3IFM A;  2OTK E;  2IX7 C;  3PP5 A;  2K88 A;  2Q6Q A;  1PPJ G;  3E7K A;  4ZMD A;  1N2D C;  2FBW C;  4IFF A;  3SFD C;  4K35 A;  4N6J A;  2N9Y B;  1FOS E;  2KK7 A;  1PP9 G;  3GG2 A;  4BXL A;  1K05 A;  2W6A A;  1NTM J;  2WSE H;  3L73 D;  3HD7 A;  1LTJ C;  1FDM A;  2OTL P;  1KD1 Q;  1QX8 A;  1LNQ A;  1BE3 J;  2Q1K A;  3B5N A;  3RK3 D;  3H1H J;  3E1R A;  2IYO A;  2KS1 A;  4XA4 A;  2K9J A;  4BRY A;  2N1T A;  5M1B A;  1SQX D;  1KQF B;  4W7Y A;  3AEA C;  1DEE G;  3TGU D;  1D7M A;  1ZV8 A;  2IYP A;  4UB6 H;  2L91 A;  2KI7 B;  1NU1 E;  4JYC A;  3D70 A;  1JB0 J;  1LWU B;  3AE8 C;  2WWW A;  3I56 P;  4XFJ A;  2D2C B;  1FZC C;  3H1K D;  3GHG A;  3E1I A;  2D2C D;  1KQS O;  1IFN A;  1GDT A;  4OGQ D;  1R5L A;  2XNX A;  1LT9 C;  5CHX A;  1KIL D;  1SFC A;  3EFF K;  1E79 H;  2OYI B;  1R8E A;  5EFW B;  4PD4 D;  4ZNC A;  3AE1 C;  3RL0 C;  2KNC A;  3BRV B;  1M1J B;  3SWF A;  1Q7Y Q;  3GMA A;  2E75 C;  1SQB K;  3L74 D;  2FKW B;  4Y28 J;  1PL5 A;  2O01 N;  4ASW A;  2Y9Y A;  3CC7 P;  4TT3 H;  1DIP A;  1W2B O;  1NU1 G;  5CCH D;  3KQG A;  2YXR B;  2W83 C;  3H1L J;  1BCC E;  1GU4 A;  2BCC G;  2XDJ A;  1EDL A;  2O01 J;  1YHQ P;  1SQQ K;  3VP8 A;  1EZV I;  4DCK A;  3CME P;  4H0L C;  1JMM A;  4I2L C;  1SQB E;  2YMK A;  3V2P A;  1L0L K;  1SP4 A;  1ZOY C;  4W7Z A;  1UIX A;  3M0A A;  2LKM A;  2Q7C A;  1SQV G;  2WSS H;  3LIE A;  2JWA A;  1RE3 C;  1MKM A;  1KB9 E;  3TSI A;  2LR2 A;  1M1K Q;  1FZE A;  1RE4 A;  2G8Y A;  3D6Z A;  2NPS D;  1USE A;  3RK2 B;  3F5H A;  4U7J A;  4Z1M H;  1ZXG A;  2Z4E A;  3CXH I;  2IBZ D;  1LWU A;  3RK2 D;  3SWK A;  5KAF H;  1RY3 A;  2HOD B;  3H1I G;  3L71 D;  1SQX J;  3U1C A;  4KHX A;  2HR3 A;  3MIW A;  3MGN A;  1FZF A;  2WSF H;  1W2E A;  2KUB A;  1L2P A;  1BDC A;  1KIL A;  2JJL A;  1AVO A;  4I7Z B;  2R32 A;  2OYI A;  3CL3 D;  1GL2 B;  3CXH H;  1M90 Q;  3H1K J;  3HD7 C;  1RHZ B;  1KTM A;  2XZR A;  2A06 D;  5AVS B;  3G9R A;  1EZV E;  1NTK E;  3RGU A;  3L72 G;  3PRJ A;  5KAF E;  3PHL A;  2B88 A;  1N7S D;  4WBA A;  1HF9 A;  1L4A B;  2QG4 A;  2C0X A;  5APS A;  3MD0 A;  4JQ0 D;  4R4M A;  1S2E A;  2N1T C;  3TF5 A;  3V2R A;  2FXO A;  2BEQ D;  1JOC A;  3P32 A;  1NOH A;  2KZJ A;  3AE2 C;  1RQU A;  4U3F G;  3AE5 C;  3EWK A;  3CXH E;  1OZH A;  3L74 J;  2E74 D;  3CX5 D;  2KSE A;  1SQQ D;  1CW5 A;  1EDK A;  1NAY A;  3BCC D;  1QL2 A;  5H2F E;  2WPR A;  3C1L A;  3O6Q B;  1JEK A;  1L0L D;  3FXE A;  3L70 E;  5APQ A;  3P8M C;  2J59 M;  2H7H A;  1JUN A;  2GA1 A;  4HB1 A;  2ZT9 D;  1NAF A;  1NTM E;  1URQ D;  3KDP B;  2A45 H;  1Y8A A;  1G1I A;  2J58 A;  1IC2 A;  1BE3 E;  1QLE D;  3HUS B;  3W68 A;  2HOD A;  3H1H E;  3RL0 g;  2O3J A;  2ZFC A;  3P7K A;  5BVZ A;  3G3Z A;  3M9Q A;  4W80 A;  4OWF A;  5CCG C;  3L71 J;  3P8C E;  2ZVN B;  3B71 A;  3SFE C;  5KJ7 A;  3QH9 A;  4YXW H;  1GW4 A;  3AEC C;  1N7S A;  1LTB C;  1RH5 B;  1P84 D;  3CD6 P;  2QIW A;  2QM8 A;  1L4A A;  3H1I J;  1JNM A;  3H1J D;  5AW2 B;  1SQP J;  3M06 A;  1VQ8 P;  1JCD A;  4WVZ A;  5AW5 B;  3L70 G;  1U7J A;  3Q3D A;  3JCU H;  1HJ0 A;  3AED C;  3NXS A;  3CI9 A;  1RE4 C;  4A7P A;  1YQ3 C;  1GK6 A;  2J5U A;  2ZAE B;  1YBK A;  4GOF A;  2OYO A;  3WUT A;  1H8A A;  1DD4 A;  3A0B H;  4IFM A;  3QWO C;  2WQY C;  2PP6 A;  5KAI H;  2E76 B;  1PIX A;  1VQO P;  2FFD C;  1AJY A;  5APY A;  4CPG A;  1N73 C;  3O6Q A;  3JCU E;  2VRS A;  2RH0 A;  1DEB A;  1URQ A;  5AVW B;  2WSC J;  3H1L E;  2CK3 H;  1BGY D;  2KS1 B;  2OQQ A;  1DH3 A;  1CSB A;  2K9J B;  1HTL C;  3USS A;  4BRY B;  1IFJ A;  1FU1 A;  1FE6 A;  1M1J C;  2XV5 A;  4HJG H;  3KPE A;  3HUS A;  3LW5 J;  1KFM A;  3A0B E;  4ZKP A;  3EFG A;  1T3J A;  5KAI E;  5KLV D;  4H44 D;  1HBW A;  1T6A A;  4PD4 I;  1JCC A;  2KLV A;  4WY4 B;  5CMZ A;  3L73 E;  1MV8 A;  2CPS A;  4DOJ A;  1EDI A;  4IL6 X;  1NH4 A;  3A7O A;  3OA7 A;  1NTZ G;  3GHG B;  2P2U A;  3RK3 E;  2C9L Y;  4EDF A;  2QJP C;  2M5A A;  2R3C A;  1ZLL A;  4UB8 H;  3JC2 2;  1G1J A;  1SQX E;  1YIT P;  3TGU E;  1SFC B;  3V6I A;  4N3Y B;  1LP1 B;  2FYU D;  4XE5 B;  1H89 A;  1T2K D;  4PD4 H;  3Q5P A;  1TU3 F;  1YTZ I;  2W6J H;  3L35 A;  1XTC C;  3IAO A;  3T97 B;  3TDK A;  3H1K E;  5AVR B;  1L0N D;  2WPQ A;  3G71 P;  2B89 A;  3CWB D;  2KZI A;  4PJ0 H;  1HH0 A;  3H1J J;  4UB8 E;  3BRT B;  2L5G B;  1ZRT D;  2KOG A;  4D6T D;  1KIL E;  3VMY A;  1J1D C;  1AV1 A;  2K3R A;  4ZKU A;  4PD4 E;  1J2J B;  2FY8 A;  4GOD A;  1PPJ D;  3M0D C;  3CCS P;  3RK3 B;  2QE7 H;  1BDD A;  3ZDM A;  1NYH A;  4EIJ A;  2R3S A;  5AVV B;  4JYB A;  1G2C A;  1NO4 A;  3NFQ A;  1GL2 C;  5GTI H;  1PP9 D;  5KJ7 C;  3L74 E;  3R2P A;  5APW A;  1IK7 A;  2M3B A;  2Q3I A;  2YO2 A;  4PJ0 E;  1YJW P;  1S5L X;  1N8R Q;  3PJS K;  1GD2 E;  1X8Y A;  1L4A C;  1FDI A;  1BGY J;  4I1L A;  4WY4 A;  2Y0C A;  1U7M A;  4WB4 A;  1RF1 B;  1EXI A;  1Q2N A;  1JTH B;  4OGQ B;  1X79 B;  1T8Z A;  1FAV A;  5GTI E;  3MUD A;  1KIL B;  5KLV J;  1SQP K;  3V2Q A;  1KB9 I;  2WPV B;  2YXQ B;  5AW9 B;  3I55 P;  1Q86 Q;  1EQ7 A;  1ZW0 A;  2P1J A;  1LP1 A;  5KKZ B;  1NGM B;  2IBZ E;  1JMB A;  2OYH C;  3CX5 I;  2XND H;  3AEB C;  1ZR4 A;  3L71 E;  3T97 A;  3M91 A;  2QSI A;  2FYU J;  1YTZ T;  2YMY A;  1KB9 H;  3HUS C;  1MFT A;  4EOT A;  3V4Q A;  3L75 J;  1YQ4 C;  3PTZ A;  1FBM A;  1IFD A;  2P7J A;  3Q5S A;  1JO5 A;  3CCE P;  2POH A;  2KYV A;  2YNY A;  2A06 E;  1L0N J;  3CX5 H;  1VQM P;  3CWB J;  1VQ5 P;  1EC5 A;  1OFC X;  3G4S P;  3WUV A;  2M8R A;  4D6T J;  2QJY B;  5AW7 B;  3LW5 H;  2NPS B;  3C9I A;  3GF7 A;  3OW2 O;  1KFN A;  1OMI A;  3Q5R A;  2JEE A;  1VQP P;  1VF5 C;  2RMZ A;  1KMI Z;  5AVY B;  1H88 A;  1E5W A;  2QEX P;  5AVX B;  1YJ9 P;  1SLQ A;  2ZXX A;  1PP9 J;  5B66 H;  1SQV D;  2NZ2 A;  3CX5 E;  2WT7 B;  2B9B A;  1SQQ E;  1GMJ A;  1RF1 A;  4B86 A;  1MFZ A;  1P84 I;  1FJP A;  1JTH A;  2AEJ A;  3BCC E;  1FZG A;  3A2A A; 
#chains in the Genus database with same CATH homology
 1LTA C;  1PFI A;  5CJ4 A;  3I5C A;  2IFM A;  3G3Z A;  3M9Q A;  2HPC B;  4WY4 D;  4W80 A;  3OAK A;  1J1E C;  5CCG C;  2P67 A;  2FFD B;  3P8C E;  5KJ7 A;  2I1J A;  1HUC A;  1N73 B;  1IO4 A;  1N86 A;  3U59 A;  1N7S B;  1GW4 A;  3II6 A;  1JY2 P;  4O9B A;  1URQ C;  1N7S A;  2I1K A;  2XU6 A;  1LTB C;  3N7N A;  4GKG A;  3B5N C;  3EQ2 A;  4GIF A;  5AW3 B;  2QM8 A;  5AVT B;  1L4A A;  1JNM A;  1HVV A;  1SFC D;  5AW2 B;  3M06 A;  2IFN A;  1IFI A;  5APT A;  1JCD A;  3CLQ A;  1LTS C;  5AW5 B;  5AW8 B;  3TYY A;  3M9B A;  1GW3 A;  2FYZ A;  1NKN A;  5CCH A;  3NXS A;  3V5B A;  2GM4 A;  1IFM A;  3CI9 A;  1RE4 C;  2QM7 A;  1KZU B;  5AW1 B;  2R5B A;  3IFM A;  1GK6 A;  1RF0 A;  4LLH A;  3WMM 0;  2IX7 C;  2A45 I;  3PP5 A;  2YKQ A;  1ZN5 A;  4WY4 C;  1N2D C;  2WSC H;  3LID A;  1H8A A;  4IFF A;  1FJK A;  4N6J A;  3GHG C;  1NHL A;  1FOS E;  4IFM A;  2PP6 A;  1NWQ A;  1J1E B;  2W6A A;  2FFD C;  5APY A;  5CCG A;  2WZ7 A;  5AW4 B;  1N73 C;  2MJZ A;  2WSE H;  2C9N Y;  5APX A;  5AVU B;  3HD7 A;  1LTJ C;  1FDM A;  2VRS A;  1DEB A;  1URQ B;  2NPS A;  1SFC C;  1URQ A;  5AVW B;  2WTY A;  3B5N A;  3RK3 D;  1XTG B;  5AVZ B;  3BVH A;  4XA4 A;  1DH3 A;  1CSB A;  5APU A;  1HTL C;  1IFJ A;  1FU1 A;  2N1T A;  4W7Y A;  1M1J C;  2XV5 A;  3HRN A;  3VN0 A;  3KPE A;  4N78 D;  3HUS A;  1LGH B;  2WT7 A;  1ZV8 A;  1T3U A;  1MUU A;  5KLV K;  3RL0 D;  4JYC A;  1KFM A;  3NTN A;  5AVQ B;  3EFG A;  4ZKP A;  1T3J A;  1JY3 O;  1YYC A;  1NTK K;  4RES B;  1HBW A;  1OXZ A;  1JCC A;  1LWU B;  2KLV A;  4M3L A;  3HTK B;  4WY4 B;  2WWW A;  5CMZ A;  1MV8 A;  2CPS A;  2YKO A;  4DOJ A;  1NH4 A;  2H8P D;  3A7O A;  3OA7 A;  3A3Y B;  3GHG B;  1FZC C;  2HPC A;  3VP9 A;  3GHG A;  2YKP A;  3E1I A;  2P2U A;  2HYN A;  1J1D B;  2C9L Y;  2KP8 A;  2R3C A;  2FFD A;  1IFN A;  1ZLL A;  2H43 A;  1GDT A;  1N73 A;  4I6M C;  1G1J A;  1LTJ B;  3RK3 C;  2XNX A;  3TNU B;  2Q9I A;  1LT9 C;  2GUS A;  3VMZ A;  5CHX A;  1SFC B;  2FYU K;  2R5D A;  1Z56 A;  4N78 E;  1KIL D;  1SFC A;  3N4X A;  4N3Y B;  2OYI B;  4XE5 B;  3IR9 A;  1H89 A;  4DZO A;  1T2K D;  2OAR A;  3VYI A;  3B8E B;  4C7N B;  1YTZ I;  5AW6 B;  4C7N A;  1GL2 D;  3RL0 C;  3BRV B;  1M1J B;  3L35 A;  5KJ7 D;  3SWF A;  3U1A A;  1XTC C;  1M1J A;  2HLO A;  1SQB K;  3L37 A;  2O01 H;  1L0N K;  3V2N A;  2KSJ A;  1HJB A;  5AVR B;  2WIT A;  3H32 B;  1X9V A;  2WPQ A;  2FKW B;  4OH8 B;  1JY2 O;  1LWU C;  1L4A D;  3KYQ A;  1HH0 A;  3MTU E;  3BRT B;  2L5G B;  2C0W A;  1NTM K;  1HGV A;  1LTI C;  2KOG A;  5CCH D;  3KQG A;  3VOP A;  3VMY A;  1FZC B;  2ZXE B;  1J1D C;  4ZKU A;  2HG5 D;  2WPS A;  1GU4 A;  1J2J B;  2XDJ A;  1KIL C;  1SQQ K;  1N7L A;  3M0D C;  3VP8 A;  3RK3 B;  1T2K C;  4EIJ A;  1GK4 A;  1LT9 B;  5AVV B;  3L4F A;  3UIA A;  1LT9 A;  4JYB A;  1G2C B;  2OYI C;  1G2C A;  1NO4 A;  1IK9 A;  3NFQ A;  1JMM A;  4I2L C;  1GL2 C;  2A45 G;  5KJ7 C;  1L0L K;  1SP4 A;  3V2P A;  3R2P A;  3HE5 B;  4W7Z A;  1HGZ A;  2PAJ A;  3M0A A;  5APW A;  2LKM A;  2Q7C A;  3LIE A;  2W27 A;  2M3B A;  2Q5U A;  2Q3I A;  2HFE D;  2OYH B;  2YO2 A;  3RL0 B;  4AUW A;  1RE3 C;  3TSI A;  3HD7 D;  1NKZ B;  1GD2 E;  1X8Y A;  1FZE A;  1LTG C;  1L4A C;  1RE4 A;  2BAS A;  2NPS D;  3V4W A;  2O1K A;  3RK2 B;  4JF7 A;  4LC1 A;  2Z4E A;  2KB7 P;  5CCH C;  1LWU A;  4I1L A;  3RK2 D;  3HTK A;  4WY4 A;  1LTT C;  2Z5H A;  1RY3 A;  3NMD A;  2HOD B;  1SVF A;  2N1T D;  4WB4 A;  1RF1 B;  2W6B A;  5AW0 B;  3U1C A;  4KHX A;  1GU5 A;  3MIW A;  1GZL A;  1RF0 C;  1JTH B;  3MGN A;  1CI6 B;  1X79 B;  1FZF A;  1HWT C;  1FOS F;  1T8Z A;  1ZR2 A;  1FAV A;  5BU8 B;  2WSF H;  1W2E A;  3MUD A;  1KIL B;  1KIL A;  1LTJ A;  1SQP K;  1NTZ K;  2JJL A;  3V2Q A;  1AFO A;  3M0D A;  3TNU A;  2E42 A;  1A02 J;  5AW9 B;  1EQ7 A;  3O8Z A;  2R32 A;  4Y99 C;  2OYI A;  2P1J A;  3CL3 D;  1FZA A;  1GL2 B;  2E43 A;  3M9H A;  1GL2 A;  3HD7 C;  2N9B A;  2XZR A;  5AVS B;  2FXM A;  1OWA A;  2OYH C;  1AQ5 A;  2NPS C;  1CZQ A;  3BAT A;  1RE3 A;  1ZR4 A;  1N7S D;  3T97 A;  4WBA A;  3M91 A;  3RK2 C;  1L4A B;  3L36 A;  2C0X A;  5APS A;  3OJA B;  3MD0 A;  3H32 A;  1MZ9 A;  1JY3 N;  2N1T C;  1QL1 A;  1YTZ T;  3BAS A;  3H6P A;  3V2R A;  4LGD E;  2YMY A;  1FZB A;  4IFD K;  3HUS C;  1JOC A;  3P32 A;  1RF1 C;  4C46 A;  4HYT B;  4EOT A;  1S9K D;  1NOH A;  1WT6 A;  3V4Q A;  1FZC A;  1FBM A;  1IFD A;  3HE4 B;  2P7J A;  4AQR D;  3HE4 A;  1JO5 A;  2POH A;  4GT1 A;  2KYV A;  2YNY A;  2XKM A;  1M7L A;  3VTP C;  5CJ0 A;  1NU1 K;  1DX7 A;  1CW5 A;  4HH2 A;  4Y99 B;  2CPB A;  2M8R A;  1QL2 A;  2WPR A;  5APV A;  5AW7 B;  3HE5 A;  3HD7 B;  3TK1 A;  1JY3 P;  3LW5 H;  1N7S C;  1KQL A;  3SWY A;  5APQ A;  1GTW A;  2IPP A;  5CCG D;  2NPS B;  3C9I A;  2OYH A;  3P8M C;  2J59 M;  2Z5I A;  2H7H A;  1JUN A;  5KTB A;  3A5T A;  1A02 F;  3B5N B;  1S9K E;  1KFN A;  2JEE A;  1NAF A;  1URQ D;  5AVY B;  1WRG A;  2A45 H;  3KDP B;  3P8C D;  1G1I A;  5BU5 A;  1SQX K;  1VDF A;  1H88 A;  3B5N D;  1E5W A;  2N1T B;  1SQV K;  1JY2 N;  5AVX B;  4C7R A;  1SLQ A;  2YO3 A;  2J58 A;  1IC2 A;  2GUV A;  3HUS B;  2WT7 B;  1IJD B;  2HOD A;  2O1J A;  3VMX A;  1RF1 A;  1VPC A;  4B86 A;  1MFZ A;  1FJP A;  2ZFC A;  1JTH A;  4AYC A;  3P7K A;  1CI6 A;  5BVZ A;  1FZG A;  3A2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...