1FDMA

Fd major coat protein in sds micelles, nmr, 20 structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
50
structure length
50
Chain Sequence
AEGDDPAKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords FD MAJOR COAT PROTEIN
publication title fd coat protein structure in membrane environments: structural dynamics of the loop between the hydrophobic trans-membrane helix and the amphipathic in-plane helix.
pubmed doi rcsb
total genus 9
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1997-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fdmA00
2C0WA 2CPSA 1HH0A 1IFDA 2MJZA 1IFIA 1NH4A 2C0XA 2CPBA 1FDMA 1HGVA 1HGZA 1IFJA
chains in the Genus database with same CATH superfamily
3P8CE 2NPSB 1VQ5P 1KYOH 1LP1A 1S4XA 2ZAEB 4W7YA 2G8YA 4RJTA 3H1KJ 1RHZB 3Q5SA 5KJ7C 2O3JA 1L4AC 1J1DB 1OFCX 2E74B 3U59A 4ZMDA 3KXDA 3AE6C 5BU5A 3HTKB 2HR3A 3S9OA 4JQ0D 1NTKK 3L74J 1N7SA 1IFIA 2J5UA 3H1HE 2WPQA 1NO4A 1LT9A 4Y99B 3L73E 2IPPA 1RF1A 3L70J 3AECC 5APWA 5B5EH 3TYYA 3SFEC 1W2EA 1FOSF 2E42A 4H44C 3AE1C 3CX5H 1X79B 5KLVG 1FZEA 2QM8A 3VTPC 1BE3G 2ZXXA 2FXMA 1L0LG 1KYOE 5KJ7A 1SS1A 2L91A 2FFDC 1L4AA 2N1TC 1JO5A 2Y0CA 4LC1A 2K9JB 3L71G 3TDKA 3HE5B 2D2CB 1XTCC 1BSNA 2R3CA 5CJ4A 5AVQB 4N78E 1K73Q 1FDIA 2A06D 3CCMP 1EZVI 2CPBA 4RO0A 1ZP0C 5DJTB 2R5BA 1Q86Q 4JPZB 1L2PA 5DJUB 5AW7B 2E5YA 2YO3A 2OTJP 5AVXB 1KILC 2ZYGA 2PAJA 5KLVE 1BE3E 2H8PD 2KLVA 4YTPC 3OJAB 1KD1Q 5B5EE 1EDLA 3CMEP 2O1JA 4OGQB 1Q2NA 2WT7B 1BDDA 2B87B 4IOIH 3CX5E 2KZJA 2N1TA 1ZMEC 3L71E 4GODA 1IK9A 3H25A 2Y0DA 1WT6A 1KQGB 4XFJA 2XDJA 5CMZA 3WUUA 3M9QA 3V2NA 5BU8B 2W83C 1NTZJ 1DEEG 1EDKA 4MN4C 1KFNA 1FS0E 2WSFH 5CHXA 4DJGA 3IFMA 1KILA 1KB9D 2B9BA 2IYOA 3R2PA 2BCCG 2RH0A 3IAOA 3JCUH 1JCDA 3I5CA 1IC2A 2IZ0A 4PD4I 5E79H 3I55P 2A06G 2OARA 2WVRA 3L4FA 3PRJA 3V2PA 1YJWP 5C39A 5M1BA 2HODA 3V2QA 4TT3H 1LTTC 3CC7P 3L70D 3N7NA 1SQBJ 1YJNP 3AEFC 1GL2D 5GTHH 3HE4A 1AVYA 2OYHC 1LWUC 4EOTA 3H32A 2M5AA 2KS1B 3RK3E 1L0NJ 2BCCE 1JY3N 3C1LA 1CSBA 3PLNA 3ITKA 2KK7A 1LTSC 1NTMJ 1ZR4A 4HB1A 1FZBA 1HBWA 4C7NA 4DT0A 1W5CE 3JCUE 3ZDMA 1OVRA 2WQYC 3FWNA 2P7JA 5E79E 3GHGC 2XNDH 1JM0A 1PPJG 1HH0A 4AUWA 2NPSD 2W8ZA 4JF7A 4PV1C 2OTKE 4ZNCA 4UB6E 2OYHA 1VQ9P 1LWUA 2ZVOB 5AW1B 3CD6P 5GTHE 2IZ1A 1FZCC 4K35A 1FU1A 1VPCA 3A7OA 1OVUA 2QJYB 2M3EA 3UIAA 3HD7C 3BATA 5TJHA 2HPCB 1SQPG 4C7RA 1IK7A 3TGUD 1JY2O 4HJGH 1NVOA 1HUCA 3BCCE 1OMIA 2OQQA 4W7ZA 2E74C 3CCQP 3CPWO 1NTZD 1FJPA 1KV4A 1PPJE 3GHGA 4ZKUA 1YQ3C 2AEFA 1VQ8P 2AXTH 1G2CB 1U7JA 4OWFA 1OIPA 3GG2A 5GTIH 5KAFH 1YTZI 1GD2E 1BDCA 4GKGA 1HVVA 1BSHA 1NTKJ 5CCGD 2PRRA 2AEMA 1FZCA 3AE4C 2E75D 1AQTA 1CI6B 1SQPE 3HD7A 1JMMA 4Z1MH 1X22A 2C0XA 4IFFA 4L76A 3WUVA 2Y0EA 1BCCG 1NKNA 4HH2A 3VMZA 1NH4A 2E5TA 5TISH 1VF5D 1SQXK 2YMYA 3L72G 3NXSA 5AVSB 2WSSH 3VMXA 1VQPP 1SQQK 1L0ND 3BVHA 1SFCC 3TGUG 1QGKB 1ZXGA 2Q1KA 2R3SA 1NTMD 1EZVG 1EQ7A 3T97A 2AXTE 3P7KA 3P8MC 5KAFE 5GTIE 1E5WA 3SWFA 1SQBK 2JP3A 4UB8H 4JYBA 2KP8A 2Y9YA 4I1LA 1VQNP 1BCCE 2XKMA 2KB7P 1S72P 1IO4A 1MKMA 2J58A 2KNCA 3CLQA 1QL1A 1RF0C 2XZRA 4I7ZC 1VDFA 2KXPB 3VP8A 2ZVNB 2FXPA 3L72E 4IL6X 4B86A 2O01J 3HE5A 1GK6A 1GL2B 1R8EA 1AV1A 3CXHD 3NFQA 5TISE 3L75J 3H1JE 1QVFO 4OH8B 3CL3D 1SFCA 1OW8A 1DD4A 1EZVE 3PP5A 4D6TJ 2WPRA 1Q90D 4I2LC 1YJ9P 3FXEA 4KHXA 5KLIB 1X0TA 1IFMA 2YO2A 3CCVP 2R44A 3H1IG 4PD4H 3RL0C 1T2KC 4N3YB 3B8EB 1KQFB 2I1KA 1JB0J 3CI9A 3PHLA 1M1JB 1BGYD 3VYIA 1HJ0A 3K5BA 3KPEA 1OW7A 2OYIC 2AXCA 3CMAP 1N73B 1DH3A 4UB8E 1JNMA 1N7SD 2XU6A 1RF0A 2E76C 2LR2A 2HG5D 5AW5B 2ITAA 2Q6QA 1PP9G 2KSJA 1NTKD 3S1KA 1NU1J 2WSCJ 3AEDC 3LW5H 3Q3DA 3FXDA 3B5NC 4H13D 1EXJA 3CCSP 3H1IE 2PFXA 1G1IA 3D6ZA 1SQVG 2V7QH 1IFNA 3HRNA 4XA4A 1L4AD 1FZFA 2IBZD 1FDMA 4GT1A 3PH0A 5KLVK 3AE2C 4PD4E 2WTYA 2OYIA 4YXWH 2WWWA 1KC8Q 1QVGO 3AE9C 4H0LD 1PP9E 3Q5PA 1GTWA 1IFPA 1GZLA 1ZLLA 3CCEP 4WY4C 2QM7A 1PFIA 5CJ0A 4H44D 1BGYG 3B5NA 1YITP 1FC2C 1OZHA 2E75B 2R32A 1SQVE 3SWKA 4U3FG 5K5GB 1S9KE 1H0TB 3CXHE 2N1TD 1PGQA 1R5SA 2FBWC 3M91A 4XE5B 2YIUB 1VF5B 2HFED 1Q82Q 3L75D 3RK3C 2QJPB 1RF1C 4D6TD 2QSIA 4RKUJ 3GF3A 2Q7CA 3M0DC 3LIEA 2QE7H 3M06A 2Q9IA 1JMBA 1AQ5A 2IBZG 4WY4A 3RK2D 1FZGA 3AEBC 1L0LE 2IX7C 2QJKC 1IZNB 1DX7A 4U3FE 2WSEH 1OXZA 3CWBJ 3IN6A 2LKMA 2FFDA 3FWLA 1FJKA 2YKPA 1LTJC 1YQ4C 3AE8C 3H1LJ 2RMZA 3OAKA 4I6MC 2BEZF 1USDA 1LJ2A 2H88C 3O6QA 3RBZA 1K04A 4NPFX 1JTHB 1HGZA 1AA0A 3H1KD 2IDBA 2W6AA 3A2AA 3M0DA 3IF4A 5AVRB 2BEQD 2IBZE 1KFMA 1Q81Q 1SQXJ 3D6YA 1QEXA 2I1JA 3P32A 2ZT9C 2Z5IA 3L75G 1TU3F 1QL2A 3L37A 1DIPA 3VOPA 1SQQJ 5KKZC 3RBXA 3L74D 1NU1K 1LTJA 4D6TG 3A0BH 1M57D 1VL2A 1GDTA 1KN7A 4UB6H 2KYVA 4KT0J 3Q2YA 2Q3EA 1UIXA 1N7SB 5APUA 3SFDC 2FYUJ 1J1EB 1URQC 1GU4A 1LT9B 5AVZB 1RF1B 3F5HA 4U7JA 2JDIH 2L5GB 5AVWB 3Q5RA 1RY3A 4WVZA 2KLUA 1PGOA 3CXHI 4H13B 3CCLP 1LNQA 1U57A 3HUSC 1T3UA 2FYNC 2R5DA 2A06E 3AE7C 1KB9H 1ZW0A 2YKQA 5AVVB 1L4AB 5CBNA 3E1RA 3H1KG 1PGJA 2A45H 2M3BA 2OTLP 1JCCA 2WZ7A 5AVYB 3H1HJ 3BRTB 3CC4P 1SQPK 3E1IA 4H0LB 3L73J 3A0BE 4L73A 1URQA 2GUSA 3OW2O 2A45G 2J59M 4WB4A 2B89A 1SVFA 1DD3A 2UWJE 3L74G 3V5BA 4L75A 2NRGA 4YPCA 2NPSC 3SWYA 3Q1MA 1CW5A 5CCHD 3CWBD 5AW6B 4H44B 2Q3IA 2ZJSE 1IFJA 1ZRTD 3HUSA 3L70G 2O01N 1MV8A 3H1LD 3TNUA 2H43A 1P84D 3G71P 1A02J 3W68A 1NAFA 3C9IA 2N1TB 4GOEA 1J1DC 2Q5UA 2VRSA 2P2UA 3FX0A 1KB9E 2FYZA 2OGUA 2IBZI 1M56D 1GK4A 2QG4A 4AYCA 3U1CA 2JR8A 1SQXD 4IFMA 3L74E 5KLVJ 4Y99C 1VQ7P 1BE3J 1HGVA 2NPSA 3LIDA 3RK2B 1KILB 2KSEA 1SQQD 3GF7A 3VP9A 1OWAA 3L70E 3D70A 2POHA 5CCGC 3BRVB 2QRXA 2YXRB 3L71J 3EWKA 3MIWA 2I8DA 1D7MA 1N7LA 1SQBD 2N9BA 1RE3C 2FYUD 3W67A 3P8CD 3E7KA 1P84H 2HODB 5AVTB 2CK3H 4DOJA 3HTKA 3NTNA 1GW3A 2DW3A 2D2CC 2YIUC 3R4YA 1YYCA 1FDOA 3HE4B 1QLED 5L8RJ 1SFCD 3H32B 1JY2N 5APYA 4BXLA 3C8VA 2M5AB 1DEBA 1NTZG 1VQ6P 2FYUK 1PIXA 1VQMP 5CCGA 3II6A 4C7NB 2KI7B 4OGQC 5AW3B 3H1HD 1FOSE 2WSEJ 2KZIA 3MGNA 1N2DC 2P67A 1RH5B 1RE3A 1M1KQ 3L73D 1KQLA 4ASWA 2AEJA 5AW0B 4IFDK 2YXQB 2K9JA 1KZUB 3TGUE 1P84E 5APSA 2PP6A 1KYOD 4BRYB 1PGPA 1GMJA 2BCCJ 2OYHB 1LWUB 3FGAD 3PJSK 1SQBG 4Y28J 2WSFJ 1NTZE 1J2JB 1WMKA 1LTBC 1LT1A 4DZOA 1KB9I 3RL0D 3M0AA 1KMIZ 1OVVA 3MP7B 1L0NG 3V4WA 2XV5A 2WT7A 2B87A 2C0WA 3TSIA 3V2RA 3GLMA 1NTMG 2A45I 2IFNA 4EI2A 1R5LA 3AE5C 2ZFCA 1EDIA 1RQUA 1SQVK 3M9BA 3S4RA 1IFDA 5KLVD 3GHGB 1Y47A 1X8YA 2CPSA 3G9RA 4PV1B 2MKVA 1LGHB 1LTIC 3CCJP 1HTLC 3CX5D 3CXHH 2E43A 3EQ2A 3B5ND 3L73G 3L71D 1FZCB 5KTBA 5KJ7D 1EXIA 1JY3P 4H13C 4PJ0E 1ZN5A 3HD7B 3BCCJ 1SLQA 1L0NE 2JO1A 1VQOP 3KZIH 2ZXEB 4QMAA 1NTME 1S3JA 2Y9ZA 1L0LK 3GMAA 2RN0A 3D71A 4JYCA 1NJIQ 1MFZA 2P58A 1N86A 2XNXA 1YI2P 4TLFA 2H89C 1NAYA 2MJZA 4H0LC 3KYQA 2KIKA 1W2BO 2BASA 5APVA 4WY4D 3T97B 1SQPJ 2K88A 1LTAC 2KS1A 2W6BA 1U7MA 1PV3A 2QJYC 5AW2B 1NTKG 1T8ZA 4EDFA 3B71A 5BVZA 3AE3C 2K9YA 1P84I 1XTGB 1JOCA 2KNCB 5CBOA 3MTUE 3KZIE 3RK3D 1RE4C 2N9YB 1ZOYC 2BCCD 3G3ZA 4HKZH 4L74A 3A0HH 1SFCB 3L36A 1KILD 1BGYE 2NZ2A 1MZ9A 3VMAA 4R4MA 5H2FH 1MFTA 3RK2C 2V4HA 1USEA 1BCCJ 3V4QA 4GIFA 1GW4A 4KJMA 1NTKE 1NYHA 3EFGA 3RL0g 2O1KA 1NHLA 1FAVA 2W27A 4LLHA 5APTA 5AVUB 2HPCA 2WMMA 4EIJA 2LXBA 1RQVA 2QIWA 2YNYA 1NU1D 3L72J 2H7HA 1JY3O 3F89A 1FBMA 5KAIH 5B66H 3H1JJ 4I7ZB 3TGUJ 2O01H 3AEGC 1RE4A 1HF9A 1ZV8A 2JJLA 3VN0A 1VQ4P 1LP1B 1G2CA 1Q7YQ 3JSVC 3I56P 3A0HE 1JEKA 3BCCD 3KDPB 1HWTC 1JY2P 3WU2H 2ZT9D 1M90Q 4JBZA 3MHVA 3RL0B 1PL5A 3V6IA 1K9MQ 1CI6A 3QWOC 1PPJD 1Z56A 5H2FE 4NPEA 1FE6A 4ZKPA 3EFFK 2K1AA 2LXCB 2OYIB 2GA1A 1NKZB 2JEEA 1YIJP 3O8ZA 5EFWB 2E76B 3KQGA 1URQD 2GM4A 4WBAA 2RKLA 4R4LA 1GL2C 2WSCH 1PZQA 1SQPD 4A7PA 3U1AA 4NPDA 1T3JA 4DCKA 5KAIE 3OA7A 5B66E 3H1IJ 3WMM0 1AFOA 3B5NB 1A02F 3L75E 1X9VA 1KYOI 1NU1G 5KLIC 1N8RQ 5AW9B 5APXA 4D6TE 1YBKA 3B4SA 1M7LA 1VQLP 3QH9A 3WU2E 4IL6H 1KILE 4AQRD 1GU5A 3A3YB 1EDJA 1M1JC 2IFMA 2GUVA 1PP9J 1N73C 1NOHA 3BCCG 2SPZA 1VQKP 1YTZT 3USSA 1WRGA 4N6JA 4PV1D 2JWDA 3TF5A 1K8AQ 1OW6A 3ABVC 1GL2A 1QX8A 3RGUA 2KOGA 1BCCD 4WY4B 1H88A 1SQVJ 3LW5J 2ZYDA 4BRYA 3M9HA 1NU1E 4GDOA 2FY8A 2HLOA 2M8RA 1YHQP 5CCHC 3HD7D 2M0BA 2QA4P 2P1JA 3CX5I 1SP4A 1S5LH 3WUTA 2FFDB 3H1KE 1UIIA 3TK1A 3L72D 2V7QJ 2OYOA 2E74D 3H1JD 3JC22 2FXOA 1M1JA 3MD0A 1AVOA 1EZVD 1N73A 2JWAA 5APQA 3O6QB 2JKVA 3RK3B 2KUBA 4IL6E 1G1JA 1BGYJ 2Z4EA 1M8OB 1L0LJ 1KORA 1KTMA 3MZWB 1MUUA 4U3FJ 1CZQA 3G4SP 2QJKB 4CPGA 5CCHA 2K3RA 2E75C 4RESB 1LTJB 1ZR2A 4M3LA 3KHUA 1NGMB 3SSUA 1Y9BA 1NTZK 3CWBG 3MUDC 2IYPA 1S5LE 2PGDA 1T6AA 5AW8B 1VF5C 3H1LG 2D2CD 3N4XA 4K3AA 3L35A 2ZYAA 2QJPC 2P10A 3H1ID 1LTGC 3AEAC 4W80A 4OVNF 2W6JH 4BWNA 3G6EP 2G3AA 1H89A 1JUNA 2C9LY 4LGDE 1S2EA 3H1JG 3PTZA 4PD4D 2WPVB 2ZT9B 2C9NY 4C46A 1SQXG 5KKZB 4OGQD 1Y8AA 2WITA 1PP9D 1H0TA 3AEEC 3CWBE 5AW4B 1SQQG 3MUDA 3VMYA 2B88A 1ZRTE 3BASA 1FZAA 3NMDA 4HYTB 1KQSO 3CCRP 3H1LE 1OX3A 4EYYQ 1L0NK 1URQB 2YKOA 1SQVD 2HYNA 1S9KD 1NTMK 4PJ0H 1E79H 1K05A 2FYUG 2W90A 4WWIA 4O9BA 4YXDC 1AJYA 3CCUP 3HUSB 2QEXP 1T2KD 2FYNB 3TNUB 2K37A 4N78D 1SQXE 2WPSA 1NWQA 4ASVA 2FKWB 1SQQE 1H8AA 1S1CX 1BE3D 2E76D 3CC2P 2YMKA 1IJDB 3IR9A 1N7SC 1L0LD 3H6PA 1S5LX 1J1EC 3GW6A 4U3FD 1JTHA 2QVAA 2Z5HA 1EC5A 3H1HG 1LT9C 1SQBE 4GOFA 3A5TA 1HJBA 2FYUE
chains in the Genus database with same CATH topology
3P8CE 2NPSB 3V4QA 4GIFA 1GW4A 2A45H 2M3BA 2YMYA 1JCCA 3EFGA 3NXSA 5AVSB 2O1KA 2WZ7A 5AVYB 1NHLA 1FAVA 2W27A 4W7YA 3BRTB 4LLHA 5APTA 5AVUB 3VMXA 2HPCA 1SQQK 3BVHA 4EIJA 1SFCC 1SQPK 3E1IA 1URQA 2GUSA 5KJ7C 2YNYA 1EQ7A 2A45G 2H7HA 1JY3O 2J59M 3T97A 4WB4A 3P7KA 1SVFA 1FBMA 1L4AC 3P8MC 3V5BA 1J1DB 3U59A 1E5WA 2NPSC 2O01H 3SWYA 3SWFA 1RE4A 1SQBK 1ZV8A 1CW5A 2JJLA 3VN0A 3HTKB 5BU5A 5CCHD 5AW6B 4JYBA 2KP8A 2Q3IA 4I1LA 1IFJA 3HUSA 1G2CA 1NTKK 1MV8A 1N7SA 2XKMA 3TNUA 2KB7P 2H43A 1IO4A 1IFIA 1A02J 2WPQA 1NO4A 3KDPB 1NAFA 1LT9A 1HWTC 2J58A 1JY2P 4Y99B 3C9IA 2N1TB 3CLQA 2IPPA 1RF1A 1QL1A 1RF0C 2XZRA 1J1DC 5APWA 1VDFA 2Q5UA 2VRSA 3VP8A 2P2UA 3RL0B 3TYYA 4B86A 3HE5A 1W2EA 1CI6A 1GK6A 1GL2B 1FOSF 2FYZA 2E42A 1Z56A 3NFQA 1X79B 1FZEA 2QM8A 3VTPC 4OH8B 3CL3D 1GK4A 1SFCA 4ZKPA 2FXMA 4AYCA 3U1CA 3PP5A 2OYIB 2WPRA 4I2LC 5KJ7A 1NKZB 2JEEA 4IFMA 4KHXA 3O8ZA 4Y99C 2FFDC 1IFMA 1L4AA 2N1TC 2YO2A 1JO5A 1HGVA 3KQGA 2NPSA 3LIDA 1URQD 3RK2B 4LC1A 3RL0C 4WBAA 1KILB 4N3YB 1T2KC 3B8EB 2GM4A 1GL2C 2I1KA 2WSCH 3VP9A 3HE5B 1OWAA 3CI9A 3U1AA 1T3JA 2POHA 5CCGC 1XTCC 3OA7A 2R3CA 3BRVB 5AVQB 3WMM0 5CJ4A 1AFOA 4N78E 1M1JB 3VYIA 3KPEA 3B5NB 2OYIC 1DH3A 1N73B 1A02F 1X9VA 3MIWA 2CPBA 1JNMA 2R5BA 1N7LA 1N7SD 2N9BA 1RE3C 5AW7B 2YO3A 2XU6A 1RF0A 5APXA 5AW9B 2HG5D 5AW5B 3P8CD 5AVXB 1KILC 2HODB 5AVTB 4DOJA 2PAJA 2KSJA 3HTKA 1M7LA 3NTNA 1GW3A 3LW5H 2H8PD 4AQRD 2KLVA 1GU5A 3OJAB 3A3YB 1M1JC 1YYCA 2IFMA 2O1JA 2GUVA 3B5NC 3HE4B 2WT7B 1N73C 1NOHA 1SFCD 1YTZT 2N1TA 1G1IA 1JY2N 1WRGA 3H32B 5APYA 4N6JA 1DEBA 1IFNA 1GL2A 3HRNA 4XA4A 1IK9A 1L4AD 1FZFA 2FYUK 1WT6A 2KOGA 5CCGA 1FDMA 4GT1A 3II6A 4WY4B 2XDJA 1H88A 5CMZA 5KLVK 3M9QA 3V2NA 4C7NB 3M9HA 2WTYA 2OYIA 5BU8B 5AW3B 2WWWA 1FOSE 2HLOA 2M8RA 5CCHC 1KFNA 3HD7D 3MGNA 1N2DC 2P67A 2P1JA 1RE3A 1SP4A 2WSFH 5CHXA 1KQLA 2FFDB 1GTWA 5AW0B 3IFMA 4IFDK 3TK1A 1KILA 1KZUB 1GZLA 3R2PA 1ZLLA 1JCDA 4WY4C 3I5CA 2QM7A 1IC2A 1PFIA 1M1JA 3MD0A 5CJ0A 3B5NA 5APSA 2PP6A 1N73A 2OARA 5APQA 3L4FA 3V2PA 3RK3B 2R32A 2OYHB 1LWUB 1S9KE 1G1JA 2HODA 2Z4EA 1J2JB 3V2QA 2N1TD 1LTBC 1LTTC 3M91A 1MUUA 3N7NA 4DZOA 3RL0D 4XE5B 3M0AA 1GL2D 1CZQA 3V4WA 3HE4A 2XV5A 2WT7A 2HFED 2C0WA 3TSIA 5CCHA 3RK3C 3V2RA 2OYHC 1LWUC 4EOTA 2A45I 2IFNA 3H32A 4RESB 1RF1C 2ZFCA 1HJBA 2Q7CA 1LTJB 1ZR2A 1SQVK 3M9BA 3M0DC 4M3LA 1IFDA 1JY3N 3LIEA 1CSBA 3GHGB 1NTZK 1LTSC 3M06A 1ZR4A 2Q9IA 1AQ5A 4WY4A 3RK2D 1FZBA 1FZGA 1HBWA 4C7NA 1X8YA 2CPSA 5AW8B 2IX7C 1DX7A 2WSEH 1LGHB 1LTIC 3N4XA 1HTLC 3L35A 1OXZA 2E43A 3EQ2A 1LTGC 2LKMA 3B5ND 2FFDA 1FJKA 2YKPA 1LTJC 4W80A 1FZCB 5KTBA 2P7JA 5KJ7D 1JY3P 3GHGC 1H89A 1JUNA 2C9LY 4LGDE 1ZN5A 3HD7B 3OAKA 4I6MC 1HH0A 1SLQA 4AUWA 2NPSD 2ZXEB 4JF7A 2C9NY 2OYHA 1JTHB 1LWUA 4C46A 1L0LK 1HGZA 5AW1B 2WITA 2W6AA 3A2AA 1FZCC 3M0DA 4JYCA 1FU1A 1VPCA 1MFZA 3A7OA 5AVRB 5AW4B 1N86A 2XNXA 1KFMA 3MUDA 3UIAA 3VMYA 3HD7C 3BASA 1FZAA 2MJZA 3BATA 2HPCB 3NMDA 4C7RA 2I1JA 3KYQA 1JY2O 4HYTB 3P32A 2Z5IA 2BASA 5APVA 1L0NK 1URQB 3L37A 1HUCA 1QL2A 2YKOA 4WY4D 3VOPA 2HYNA 4W7ZA 1S9KD 1NTMK 1LTAC 1NU1K 1LTJA 2W6BA 1FJPA 4O9BA 3GHGA 5AW2B 4ZKUA 1GDTA 1T8ZA 3HUSB 5BVZA 1G2CB 2KYVA 1T2KD 1N7SB 5APUA 3TNUB 1J1EB 4N78D 1YTZI 1GD2E 1URQC 2WPSA 4GKGA 1NWQA 1XTGB 1HVVA 1GU4A 1JOCA 5CCGD 1LT9B 3MTUE 5AVZB 1RF1B 1FZCA 3RK3D 1RE4C 2FKWB 2L5GB 3G3ZA 1CI6B 5AVWB 1H8AA 1RY3A 3HD7A 1JMMA 2C0XA 3HUSC 4IFFA 1T3UA 1IJDB 3IR9A 1SFCB 3L36A 1KILD 1N7SC 3H6PA 2R5DA 1NKNA 4HH2A 3VMZA 1J1EC 1NH4A 1JTHA 2YKQA 2Z5HA 5AVVB 1LT9C 1MZ9A 1L4AB 3RK2C 3A5TA 1SQXK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0W A;  2CPS A;  1HH0 A;  1IFD A;  2MJZ A;  1IFI A;  1NH4 A;  2C0X A;  2CPB A;  1FDM A;  1HGV A;  1HGZ A;  1IFJ A; 
#chains in the Genus database with same CATH topology
 3P8C E;  2NPS B;  1VQ5 P;  1KYO H;  1LP1 A;  1S4X A;  2ZAE B;  4W7Y A;  2G8Y A;  4RJT A;  3H1K J;  1RHZ B;  3Q5S A;  5KJ7 C;  2O3J A;  1L4A C;  1J1D B;  1OFC X;  2E74 B;  3U59 A;  4ZMD A;  3KXD A;  3AE6 C;  5BU5 A;  3HTK B;  2HR3 A;  3S9O A;  4JQ0 D;  1NTK K;  3L74 J;  1N7S A;  1IFI A;  2J5U A;  3H1H E;  2WPQ A;  1NO4 A;  1LT9 A;  4Y99 B;  3L73 E;  2IPP A;  1RF1 A;  3L70 J;  3AEC C;  5APW A;  5B5E H;  3TYY A;  3SFE C;  1W2E A;  1FOS F;  2E42 A;  4H44 C;  3AE1 C;  3CX5 H;  1X79 B;  5KLV G;  1FZE A;  2QM8 A;  3VTP C;  1BE3 G;  2ZXX A;  2FXM A;  1L0L G;  1KYO E;  5KJ7 A;  1SS1 A;  2L91 A;  2FFD C;  1L4A A;  2N1T C;  1JO5 A;  2Y0C A;  4LC1 A;  2K9J B;  3L71 G;  3TDK A;  3HE5 B;  2D2C B;  1XTC C;  1BSN A;  2R3C A;  5CJ4 A;  5AVQ B;  4N78 E;  1K73 Q;  1FDI A;  2A06 D;  3CCM P;  1EZV I;  2CPB A;  4RO0 A;  1ZP0 C;  5DJT B;  2R5B A;  1Q86 Q;  4JPZ B;  1L2P A;  5DJU B;  5AW7 B;  2E5Y A;  2YO3 A;  2OTJ P;  5AVX B;  1KIL C;  2ZYG A;  2PAJ A;  5KLV E;  1BE3 E;  2H8P D;  2KLV A;  4YTP C;  3OJA B;  1KD1 Q;  5B5E E;  1EDL A;  3CME P;  2O1J A;  4OGQ B;  1Q2N A;  2WT7 B;  1BDD A;  2B87 B;  4IOI H;  3CX5 E;  2KZJ A;  2N1T A;  1ZME C;  3L71 E;  4GOD A;  1IK9 A;  3H25 A;  2Y0D A;  1WT6 A;  1KQG B;  4XFJ A;  2XDJ A;  5CMZ A;  3WUU A;  3M9Q A;  3V2N A;  5BU8 B;  2W83 C;  1NTZ J;  1DEE G;  1EDK A;  4MN4 C;  1KFN A;  1FS0 E;  2WSF H;  5CHX A;  4DJG A;  3IFM A;  1KIL A;  1KB9 D;  2B9B A;  2IYO A;  3R2P A;  2BCC G;  2RH0 A;  3IAO A;  3JCU H;  1JCD A;  3I5C A;  1IC2 A;  2IZ0 A;  4PD4 I;  5E79 H;  3I55 P;  2A06 G;  2OAR A;  2WVR A;  3L4F A;  3PRJ A;  3V2P A;  1YJW P;  5C39 A;  5M1B A;  2HOD A;  3V2Q A;  4TT3 H;  1LTT C;  3CC7 P;  3L70 D;  3N7N A;  1SQB J;  1YJN P;  3AEF C;  1GL2 D;  5GTH H;  3HE4 A;  1AVY A;  2OYH C;  1LWU C;  4EOT A;  3H32 A;  2M5A A;  2KS1 B;  3RK3 E;  1L0N J;  2BCC E;  1JY3 N;  3C1L A;  1CSB A;  3PLN A;  3ITK A;  2KK7 A;  1LTS C;  1NTM J;  1ZR4 A;  4HB1 A;  1FZB A;  1HBW A;  4C7N A;  4DT0 A;  1W5C E;  3JCU E;  3ZDM A;  1OVR A;  2WQY C;  3FWN A;  2P7J A;  5E79 E;  3GHG C;  2XND H;  1JM0 A;  1PPJ G;  1HH0 A;  4AUW A;  2NPS D;  2W8Z A;  4JF7 A;  4PV1 C;  2OTK E;  4ZNC A;  4UB6 E;  2OYH A;  1VQ9 P;  1LWU A;  2ZVO B;  5AW1 B;  3CD6 P;  5GTH E;  2IZ1 A;  1FZC C;  4K35 A;  1FU1 A;  1VPC A;  3A7O A;  1OVU A;  2QJY B;  2M3E A;  3UIA A;  3HD7 C;  3BAT A;  5TJH A;  2HPC B;  1SQP G;  4C7R A;  1IK7 A;  3TGU D;  1JY2 O;  4HJG H;  1NVO A;  1HUC A;  3BCC E;  1OMI A;  2OQQ A;  4W7Z A;  2E74 C;  3CCQ P;  3CPW O;  1NTZ D;  1FJP A;  1KV4 A;  1PPJ E;  3GHG A;  4ZKU A;  1YQ3 C;  2AEF A;  1VQ8 P;  2AXT H;  1G2C B;  1U7J A;  4OWF A;  1OIP A;  3GG2 A;  5GTI H;  5KAF H;  1YTZ I;  1GD2 E;  1BDC A;  4GKG A;  1HVV A;  1BSH A;  1NTK J;  5CCG D;  2PRR A;  2AEM A;  1FZC A;  3AE4 C;  2E75 D;  1AQT A;  1CI6 B;  1SQP E;  3HD7 A;  1JMM A;  4Z1M H;  1X22 A;  2C0X A;  4IFF A;  4L76 A;  3WUV A;  2Y0E A;  1BCC G;  1NKN A;  4HH2 A;  3VMZ A;  1NH4 A;  2E5T A;  5TIS H;  1VF5 D;  1SQX K;  2YMY A;  3L72 G;  3NXS A;  5AVS B;  2WSS H;  3VMX A;  1VQP P;  1SQQ K;  1L0N D;  3BVH A;  1SFC C;  3TGU G;  1QGK B;  1ZXG A;  2Q1K A;  2R3S A;  1NTM D;  1EZV G;  1EQ7 A;  3T97 A;  2AXT E;  3P7K A;  3P8M C;  5KAF E;  5GTI E;  1E5W A;  3SWF A;  1SQB K;  2JP3 A;  4UB8 H;  4JYB A;  2KP8 A;  2Y9Y A;  4I1L A;  1VQN P;  1BCC E;  2XKM A;  2KB7 P;  1S72 P;  1IO4 A;  1MKM A;  2J58 A;  2KNC A;  3CLQ A;  1QL1 A;  1RF0 C;  2XZR A;  4I7Z C;  1VDF A;  2KXP B;  3VP8 A;  2ZVN B;  2FXP A;  3L72 E;  4IL6 X;  4B86 A;  2O01 J;  3HE5 A;  1GK6 A;  1GL2 B;  1R8E A;  1AV1 A;  3CXH D;  3NFQ A;  5TIS E;  3L75 J;  3H1J E;  1QVF O;  4OH8 B;  3CL3 D;  1SFC A;  1OW8 A;  1DD4 A;  1EZV E;  3PP5 A;  4D6T J;  2WPR A;  1Q90 D;  4I2L C;  1YJ9 P;  3FXE A;  4KHX A;  5KLI B;  1X0T A;  1IFM A;  2YO2 A;  3CCV P;  2R44 A;  3H1I G;  4PD4 H;  3RL0 C;  1T2K C;  4N3Y B;  3B8E B;  1KQF B;  2I1K A;  1JB0 J;  3CI9 A;  3PHL A;  1M1J B;  1BGY D;  3VYI A;  1HJ0 A;  3K5B A;  3KPE A;  1OW7 A;  2OYI C;  2AXC A;  3CMA P;  1N73 B;  1DH3 A;  4UB8 E;  1JNM A;  1N7S D;  2XU6 A;  1RF0 A;  2E76 C;  2LR2 A;  2HG5 D;  5AW5 B;  2ITA A;  2Q6Q A;  1PP9 G;  2KSJ A;  1NTK D;  3S1K A;  1NU1 J;  2WSC J;  3AED C;  3LW5 H;  3Q3D A;  3FXD A;  3B5N C;  4H13 D;  1EXJ A;  3CCS P;  3H1I E;  2PFX A;  1G1I A;  3D6Z A;  1SQV G;  2V7Q H;  1IFN A;  3HRN A;  4XA4 A;  1L4A D;  1FZF A;  2IBZ D;  1FDM A;  4GT1 A;  3PH0 A;  5KLV K;  3AE2 C;  4PD4 E;  2WTY A;  2OYI A;  4YXW H;  2WWW A;  1KC8 Q;  1QVG O;  3AE9 C;  4H0L D;  1PP9 E;  3Q5P A;  1GTW A;  1IFP A;  1GZL A;  1ZLL A;  3CCE P;  4WY4 C;  2QM7 A;  1PFI A;  5CJ0 A;  4H44 D;  1BGY G;  3B5N A;  1YIT P;  1FC2 C;  1OZH A;  2E75 B;  2R32 A;  1SQV E;  3SWK A;  4U3F G;  5K5G B;  1S9K E;  1H0T B;  3CXH E;  2N1T D;  1PGQ A;  1R5S A;  2FBW C;  3M91 A;  4XE5 B;  2YIU B;  1VF5 B;  2HFE D;  1Q82 Q;  3L75 D;  3RK3 C;  2QJP B;  1RF1 C;  4D6T D;  2QSI A;  4RKU J;  3GF3 A;  2Q7C A;  3M0D C;  3LIE A;  2QE7 H;  3M06 A;  2Q9I A;  1JMB A;  1AQ5 A;  2IBZ G;  4WY4 A;  3RK2 D;  1FZG A;  3AEB C;  1L0L E;  2IX7 C;  2QJK C;  1IZN B;  1DX7 A;  4U3F E;  2WSE H;  1OXZ A;  3CWB J;  3IN6 A;  2LKM A;  2FFD A;  3FWL A;  1FJK A;  2YKP A;  1LTJ C;  1YQ4 C;  3AE8 C;  3H1L J;  2RMZ A;  3OAK A;  4I6M C;  2BEZ F;  1USD A;  1LJ2 A;  2H88 C;  3O6Q A;  3RBZ A;  1K04 A;  4NPF X;  1JTH B;  1HGZ A;  1AA0 A;  3H1K D;  2IDB A;  2W6A A;  3A2A A;  3M0D A;  3IF4 A;  5AVR B;  2BEQ D;  2IBZ E;  1KFM A;  1Q81 Q;  1SQX J;  3D6Y A;  1QEX A;  2I1J A;  3P32 A;  2ZT9 C;  2Z5I A;  3L75 G;  1TU3 F;  1QL2 A;  3L37 A;  1DIP A;  3VOP A;  1SQQ J;  5KKZ C;  3RBX A;  3L74 D;  1NU1 K;  1LTJ A;  4D6T G;  3A0B H;  1M57 D;  1VL2 A;  1GDT A;  1KN7 A;  4UB6 H;  2KYV A;  4KT0 J;  3Q2Y A;  2Q3E A;  1UIX A;  1N7S B;  5APU A;  3SFD C;  2FYU J;  1J1E B;  1URQ C;  1GU4 A;  1LT9 B;  5AVZ B;  1RF1 B;  3F5H A;  4U7J A;  2JDI H;  2L5G B;  5AVW B;  3Q5R A;  1RY3 A;  4WVZ A;  2KLU A;  1PGO A;  3CXH I;  4H13 B;  3CCL P;  1LNQ A;  1U57 A;  3HUS C;  1T3U A;  2FYN C;  2R5D A;  2A06 E;  3AE7 C;  1KB9 H;  1ZW0 A;  2YKQ A;  5AVV B;  1L4A B;  5CBN A;  3E1R A;  3H1K G;  1PGJ A;  2A45 H;  2M3B A;  2OTL P;  1JCC A;  2WZ7 A;  5AVY B;  3H1H J;  3BRT B;  3CC4 P;  1SQP K;  3E1I A;  4H0L B;  3L73 J;  3A0B E;  4L73 A;  1URQ A;  2GUS A;  3OW2 O;  2A45 G;  2J59 M;  4WB4 A;  2B89 A;  1SVF A;  1DD3 A;  2UWJ E;  3L74 G;  3V5B A;  4L75 A;  2NRG A;  4YPC A;  2NPS C;  3SWY A;  3Q1M A;  1CW5 A;  5CCH D;  3CWB D;  5AW6 B;  4H44 B;  2Q3I A;  2ZJS E;  1IFJ A;  1ZRT D;  3HUS A;  3L70 G;  2O01 N;  1MV8 A;  3H1L D;  3TNU A;  2H43 A;  1P84 D;  3G71 P;  1A02 J;  3W68 A;  1NAF A;  3C9I A;  2N1T B;  4GOE A;  1J1D C;  2Q5U A;  2VRS A;  2P2U A;  3FX0 A;  1KB9 E;  2FYZ A;  2OGU A;  2IBZ I;  1M56 D;  1GK4 A;  2QG4 A;  4AYC A;  3U1C A;  2JR8 A;  1SQX D;  4IFM A;  3L74 E;  5KLV J;  4Y99 C;  1VQ7 P;  1BE3 J;  1HGV A;  2NPS A;  3LID A;  3RK2 B;  1KIL B;  2KSE A;  1SQQ D;  3GF7 A;  3VP9 A;  1OWA A;  3L70 E;  3D70 A;  2POH A;  5CCG C;  3BRV B;  2QRX A;  2YXR B;  3L71 J;  3EWK A;  3MIW A;  2I8D A;  1D7M A;  1N7L A;  1SQB D;  2N9B A;  1RE3 C;  2FYU D;  3W67 A;  3P8C D;  3E7K A;  1P84 H;  2HOD B;  5AVT B;  2CK3 H;  4DOJ A;  3HTK A;  3NTN A;  1GW3 A;  2DW3 A;  2D2C C;  2YIU C;  3R4Y A;  1YYC A;  1FDO A;  3HE4 B;  1QLE D;  5L8R J;  1SFC D;  3H32 B;  1JY2 N;  5APY A;  4BXL A;  3C8V A;  2M5A B;  1DEB A;  1NTZ G;  1VQ6 P;  2FYU K;  1PIX A;  1VQM P;  5CCG A;  3II6 A;  4C7N B;  2KI7 B;  4OGQ C;  5AW3 B;  3H1H D;  1FOS E;  2WSE J;  2KZI A;  3MGN A;  1N2D C;  2P67 A;  1RH5 B;  1RE3 A;  1M1K Q;  3L73 D;  1KQL A;  4ASW A;  2AEJ A;  5AW0 B;  4IFD K;  2YXQ B;  2K9J A;  1KZU B;  3TGU E;  1P84 E;  5APS A;  2PP6 A;  1KYO D;  4BRY B;  1PGP A;  1GMJ A;  2BCC J;  2OYH B;  1LWU B;  3FGA D;  3PJS K;  1SQB G;  4Y28 J;  2WSF J;  1NTZ E;  1J2J B;  1WMK A;  1LTB C;  1LT1 A;  4DZO A;  1KB9 I;  3RL0 D;  3M0A A;  1KMI Z;  1OVV A;  3MP7 B;  1L0N G;  3V4W A;  2XV5 A;  2WT7 A;  2B87 A;  2C0W A;  3TSI A;  3V2R A;  3GLM A;  1NTM G;  2A45 I;  2IFN A;  4EI2 A;  1R5L A;  3AE5 C;  2ZFC A;  1EDI A;  1RQU A;  1SQV K;  3M9B A;  3S4R A;  1IFD A;  5KLV D;  3GHG B;  1Y47 A;  1X8Y A;  2CPS A;  3G9R A;  4PV1 B;  2MKV A;  1LGH B;  1LTI C;  3CCJ P;  1HTL C;  3CX5 D;  3CXH H;  2E43 A;  3EQ2 A;  3B5N D;  3L73 G;  3L71 D;  1FZC B;  5KTB A;  5KJ7 D;  1EXI A;  1JY3 P;  4H13 C;  4PJ0 E;  1ZN5 A;  3HD7 B;  3BCC J;  1SLQ A;  1L0N E;  2JO1 A;  1VQO P;  3KZI H;  2ZXE B;  4QMA A;  1NTM E;  1S3J A;  2Y9Z A;  1L0L K;  3GMA A;  2RN0 A;  3D71 A;  4JYC A;  1NJI Q;  1MFZ A;  2P58 A;  1N86 A;  2XNX A;  1YI2 P;  4TLF A;  2H89 C;  1NAY A;  2MJZ A;  4H0L C;  3KYQ A;  2KIK A;  1W2B O;  2BAS A;  5APV A;  4WY4 D;  3T97 B;  1SQP J;  2K88 A;  1LTA C;  2KS1 A;  2W6B A;  1U7M A;  1PV3 A;  2QJY C;  5AW2 B;  1NTK G;  1T8Z A;  4EDF A;  3B71 A;  5BVZ A;  3AE3 C;  2K9Y A;  1P84 I;  1XTG B;  1JOC A;  2KNC B;  5CBO A;  3MTU E;  3KZI E;  3RK3 D;  1RE4 C;  2N9Y B;  1ZOY C;  2BCC D;  3G3Z A;  4HKZ H;  4L74 A;  3A0H H;  1SFC B;  3L36 A;  1KIL D;  1BGY E;  2NZ2 A;  1MZ9 A;  3VMA A;  4R4M A;  5H2F H;  1MFT A;  3RK2 C;  2V4H A;  1USE A;  1BCC J;  3V4Q A;  4GIF A;  1GW4 A;  4KJM A;  1NTK E;  1NYH A;  3EFG A;  3RL0 g;  2O1K A;  1NHL A;  1FAV A;  2W27 A;  4LLH A;  5APT A;  5AVU B;  2HPC A;  2WMM A;  4EIJ A;  2LXB A;  1RQV A;  2QIW A;  2YNY A;  1NU1 D;  3L72 J;  2H7H A;  1JY3 O;  3F89 A;  1FBM A;  5KAI H;  5B66 H;  3H1J J;  4I7Z B;  3TGU J;  2O01 H;  3AEG C;  1RE4 A;  1HF9 A;  1ZV8 A;  2JJL A;  3VN0 A;  1VQ4 P;  1LP1 B;  1G2C A;  1Q7Y Q;  3JSV C;  3I56 P;  3A0H E;  1JEK A;  3BCC D;  3KDP B;  1HWT C;  1JY2 P;  3WU2 H;  2ZT9 D;  1M90 Q;  4JBZ A;  3MHV A;  3RL0 B;  1PL5 A;  3V6I A;  1K9M Q;  1CI6 A;  3QWO C;  1PPJ D;  1Z56 A;  5H2F E;  4NPE A;  1FE6 A;  4ZKP A;  3EFF K;  2K1A A;  2LXC B;  2OYI B;  2GA1 A;  1NKZ B;  2JEE A;  1YIJ P;  3O8Z A;  5EFW B;  2E76 B;  3KQG A;  1URQ D;  2GM4 A;  4WBA A;  2RKL A;  4R4L A;  1GL2 C;  2WSC H;  1PZQ A;  1SQP D;  4A7P A;  3U1A A;  4NPD A;  1T3J A;  4DCK A;  5KAI E;  3OA7 A;  5B66 E;  3H1I J;  3WMM 0;  1AFO A;  3B5N B;  1A02 F;  3L75 E;  1X9V A;  1KYO I;  1NU1 G;  5KLI C;  1N8R Q;  5AW9 B;  5APX A;  4D6T E;  1YBK A;  3B4S A;  1M7L A;  1VQL P;  3QH9 A;  3WU2 E;  4IL6 H;  1KIL E;  4AQR D;  1GU5 A;  3A3Y B;  1EDJ A;  1M1J C;  2IFM A;  2GUV A;  1PP9 J;  1N73 C;  1NOH A;  3BCC G;  2SPZ A;  1VQK P;  1YTZ T;  3USS A;  1WRG A;  4N6J A;  4PV1 D;  2JWD A;  3TF5 A;  1K8A Q;  1OW6 A;  3ABV C;  1GL2 A;  1QX8 A;  3RGU A;  2KOG A;  1BCC D;  4WY4 B;  1H88 A;  1SQV J;  3LW5 J;  2ZYD A;  4BRY A;  3M9H A;  1NU1 E;  4GDO A;  2FY8 A;  2HLO A;  2M8R A;  1YHQ P;  5CCH C;  3HD7 D;  2M0B A;  2QA4 P;  2P1J A;  3CX5 I;  1SP4 A;  1S5L H;  3WUT A;  2FFD B;  3H1K E;  1UII A;  3TK1 A;  3L72 D;  2V7Q J;  2OYO A;  2E74 D;  3H1J D;  3JC2 2;  2FXO A;  1M1J A;  3MD0 A;  1AVO A;  1EZV D;  1N73 A;  2JWA A;  5APQ A;  3O6Q B;  2JKV A;  3RK3 B;  2KUB A;  4IL6 E;  1G1J A;  1BGY J;  2Z4E A;  1M8O B;  1L0L J;  1KOR A;  1KTM A;  3MZW B;  1MUU A;  4U3F J;  1CZQ A;  3G4S P;  2QJK B;  4CPG A;  5CCH A;  2K3R A;  2E75 C;  4RES B;  1LTJ B;  1ZR2 A;  4M3L A;  3KHU A;  1NGM B;  3SSU A;  1Y9B A;  1NTZ K;  3CWB G;  3MUD C;  2IYP A;  1S5L E;  2PGD A;  1T6A A;  5AW8 B;  1VF5 C;  3H1L G;  2D2C D;  3N4X A;  4K3A A;  3L35 A;  2ZYA A;  2QJP C;  2P10 A;  3H1I D;  1LTG C;  3AEA C;  4W80 A;  4OVN F;  2W6J H;  4BWN A;  3G6E P;  2G3A A;  1H89 A;  1JUN A;  2C9L Y;  4LGD E;  1S2E A;  3H1J G;  3PTZ A;  4PD4 D;  2WPV B;  2ZT9 B;  2C9N Y;  4C46 A;  1SQX G;  5KKZ B;  4OGQ D;  1Y8A A;  2WIT A;  1PP9 D;  1H0T A;  3AEE C;  3CWB E;  5AW4 B;  1SQQ G;  3MUD A;  3VMY A;  2B88 A;  1ZRT E;  3BAS A;  1FZA A;  3NMD A;  4HYT B;  1KQS O;  3CCR P;  3H1L E;  1OX3 A;  4EYY Q;  1L0N K;  1URQ B;  2YKO A;  1SQV D;  2HYN A;  1S9K D;  1NTM K;  4PJ0 H;  1E79 H;  1K05 A;  2FYU G;  2W90 A;  4WWI A;  4O9B A;  4YXD C;  1AJY A;  3CCU P;  3HUS B;  2QEX P;  1T2K D;  2FYN B;  3TNU B;  2K37 A;  4N78 D;  1SQX E;  2WPS A;  1NWQ A;  4ASV A;  2FKW B;  1SQQ E;  1H8A A;  1S1C X;  1BE3 D;  2E76 D;  3CC2 P;  2YMK A;  1IJD B;  3IR9 A;  1N7S C;  1L0L D;  3H6P A;  1S5L X;  1J1E C;  3GW6 A;  4U3F D;  1JTH A;  2QVA A;  2Z5H A;  1EC5 A;  3H1H G;  1LT9 C;  1SQB E;  4GOF A;  3A5T A;  1HJB A;  2FYU E; 
#chains in the Genus database with same CATH homology
 3P8C E;  2NPS B;  3V4Q A;  4GIF A;  1GW4 A;  2A45 H;  2M3B A;  2YMY A;  1JCC A;  3EFG A;  3NXS A;  5AVS B;  2O1K A;  2WZ7 A;  5AVY B;  1NHL A;  1FAV A;  2W27 A;  4W7Y A;  3BRT B;  4LLH A;  5APT A;  5AVU B;  3VMX A;  2HPC A;  1SQQ K;  3BVH A;  4EIJ A;  1SFC C;  1SQP K;  3E1I A;  1URQ A;  2GUS A;  5KJ7 C;  2YNY A;  1EQ7 A;  2A45 G;  2H7H A;  1JY3 O;  2J59 M;  3T97 A;  4WB4 A;  3P7K A;  1SVF A;  1FBM A;  1L4A C;  3P8M C;  3V5B A;  1J1D B;  3U59 A;  1E5W A;  2NPS C;  2O01 H;  3SWY A;  3SWF A;  1RE4 A;  1SQB K;  1ZV8 A;  1CW5 A;  2JJL A;  3VN0 A;  3HTK B;  5BU5 A;  5CCH D;  5AW6 B;  4JYB A;  2KP8 A;  2Q3I A;  4I1L A;  1IFJ A;  3HUS A;  1G2C A;  1NTK K;  1MV8 A;  1N7S A;  2XKM A;  3TNU A;  2KB7 P;  2H43 A;  1IO4 A;  1IFI A;  1A02 J;  2WPQ A;  1NO4 A;  3KDP B;  1NAF A;  1LT9 A;  1HWT C;  2J58 A;  1JY2 P;  4Y99 B;  3C9I A;  2N1T B;  3CLQ A;  2IPP A;  1RF1 A;  1QL1 A;  1RF0 C;  2XZR A;  1J1D C;  5APW A;  1VDF A;  2Q5U A;  2VRS A;  3VP8 A;  2P2U A;  3RL0 B;  3TYY A;  4B86 A;  3HE5 A;  1W2E A;  1CI6 A;  1GK6 A;  1GL2 B;  1FOS F;  2FYZ A;  2E42 A;  1Z56 A;  3NFQ A;  1X79 B;  1FZE A;  2QM8 A;  3VTP C;  4OH8 B;  3CL3 D;  1GK4 A;  1SFC A;  4ZKP A;  2FXM A;  4AYC A;  3U1C A;  3PP5 A;  2OYI B;  2WPR A;  4I2L C;  5KJ7 A;  1NKZ B;  2JEE A;  4IFM A;  4KHX A;  3O8Z A;  4Y99 C;  2FFD C;  1IFM A;  1L4A A;  2N1T C;  2YO2 A;  1JO5 A;  1HGV A;  3KQG A;  2NPS A;  3LID A;  1URQ D;  3RK2 B;  4LC1 A;  3RL0 C;  4WBA A;  1KIL B;  4N3Y B;  1T2K C;  3B8E B;  2GM4 A;  1GL2 C;  2I1K A;  2WSC H;  3VP9 A;  3HE5 B;  1OWA A;  3CI9 A;  3U1A A;  1T3J A;  2POH A;  5CCG C;  1XTC C;  3OA7 A;  2R3C A;  3BRV B;  5AVQ B;  3WMM 0;  5CJ4 A;  1AFO A;  4N78 E;  1M1J B;  3VYI A;  3KPE A;  3B5N B;  2OYI C;  1DH3 A;  1N73 B;  1A02 F;  1X9V A;  3MIW A;  2CPB A;  1JNM A;  2R5B A;  1N7L A;  1N7S D;  2N9B A;  1RE3 C;  5AW7 B;  2YO3 A;  2XU6 A;  1RF0 A;  5APX A;  5AW9 B;  2HG5 D;  5AW5 B;  3P8C D;  5AVX B;  1KIL C;  2HOD B;  5AVT B;  4DOJ A;  2PAJ A;  2KSJ A;  3HTK A;  1M7L A;  3NTN A;  1GW3 A;  3LW5 H;  2H8P D;  4AQR D;  2KLV A;  1GU5 A;  3OJA B;  3A3Y B;  1M1J C;  1YYC A;  2IFM A;  2O1J A;  2GUV A;  3B5N C;  3HE4 B;  2WT7 B;  1N73 C;  1NOH A;  1SFC D;  1YTZ T;  2N1T A;  1G1I A;  1JY2 N;  1WRG A;  3H32 B;  5APY A;  4N6J A;  1DEB A;  1IFN A;  1GL2 A;  3HRN A;  4XA4 A;  1IK9 A;  1L4A D;  1FZF A;  2FYU K;  1WT6 A;  2KOG A;  5CCG A;  1FDM A;  4GT1 A;  3II6 A;  4WY4 B;  2XDJ A;  1H88 A;  5CMZ A;  5KLV K;  3M9Q A;  3V2N A;  4C7N B;  3M9H A;  2WTY A;  2OYI A;  5BU8 B;  5AW3 B;  2WWW A;  1FOS E;  2HLO A;  2M8R A;  5CCH C;  1KFN A;  3HD7 D;  3MGN A;  1N2D C;  2P67 A;  2P1J A;  1RE3 A;  1SP4 A;  2WSF H;  5CHX A;  1KQL A;  2FFD B;  1GTW A;  5AW0 B;  3IFM A;  4IFD K;  3TK1 A;  1KIL A;  1KZU B;  1GZL A;  3R2P A;  1ZLL A;  1JCD A;  4WY4 C;  3I5C A;  2QM7 A;  1IC2 A;  1PFI A;  1M1J A;  3MD0 A;  5CJ0 A;  3B5N A;  5APS A;  2PP6 A;  1N73 A;  2OAR A;  5APQ A;  3L4F A;  3V2P A;  3RK3 B;  2R32 A;  2OYH B;  1LWU B;  1S9K E;  1G1J A;  2HOD A;  2Z4E A;  1J2J B;  3V2Q A;  2N1T D;  1LTB C;  1LTT C;  3M91 A;  1MUU A;  3N7N A;  4DZO A;  3RL0 D;  4XE5 B;  3M0A A;  1GL2 D;  1CZQ A;  3V4W A;  3HE4 A;  2XV5 A;  2WT7 A;  2HFE D;  2C0W A;  3TSI A;  5CCH A;  3RK3 C;  3V2R A;  2OYH C;  1LWU C;  4EOT A;  2A45 I;  2IFN A;  3H32 A;  4RES B;  1RF1 C;  2ZFC A;  1HJB A;  2Q7C A;  1LTJ B;  1ZR2 A;  1SQV K;  3M9B A;  3M0D C;  4M3L A;  1IFD A;  1JY3 N;  3LIE A;  1CSB A;  3GHG B;  1NTZ K;  1LTS C;  3M06 A;  1ZR4 A;  2Q9I A;  1AQ5 A;  4WY4 A;  3RK2 D;  1FZB A;  1FZG A;  1HBW A;  4C7N A;  1X8Y A;  2CPS A;  5AW8 B;  2IX7 C;  1DX7 A;  2WSE H;  1LGH B;  1LTI C;  3N4X A;  1HTL C;  3L35 A;  1OXZ A;  2E43 A;  3EQ2 A;  1LTG C;  2LKM A;  3B5N D;  2FFD A;  1FJK A;  2YKP A;  1LTJ C;  4W80 A;  1FZC B;  5KTB A;  2P7J A;  5KJ7 D;  1JY3 P;  3GHG C;  1H89 A;  1JUN A;  2C9L Y;  4LGD E;  1ZN5 A;  3HD7 B;  3OAK A;  4I6M C;  1HH0 A;  1SLQ A;  4AUW A;  2NPS D;  2ZXE B;  4JF7 A;  2C9N Y;  2OYH A;  1JTH B;  1LWU A;  4C46 A;  1L0L K;  1HGZ A;  5AW1 B;  2WIT A;  2W6A A;  3A2A A;  1FZC C;  3M0D A;  4JYC A;  1FU1 A;  1VPC A;  1MFZ A;  3A7O A;  5AVR B;  5AW4 B;  1N86 A;  2XNX A;  1KFM A;  3MUD A;  3UIA A;  3VMY A;  3HD7 C;  3BAS A;  1FZA A;  2MJZ A;  3BAT A;  2HPC B;  3NMD A;  4C7R A;  2I1J A;  3KYQ A;  1JY2 O;  4HYT B;  3P32 A;  2Z5I A;  2BAS A;  5APV A;  1L0N K;  1URQ B;  3L37 A;  1HUC A;  1QL2 A;  2YKO A;  4WY4 D;  3VOP A;  2HYN A;  4W7Z A;  1S9K D;  1NTM K;  1LTA C;  1NU1 K;  1LTJ A;  2W6B A;  1FJP A;  4O9B A;  3GHG A;  5AW2 B;  4ZKU A;  1GDT A;  1T8Z A;  3HUS B;  5BVZ A;  1G2C B;  2KYV A;  1T2K D;  1N7S B;  5APU A;  3TNU B;  1J1E B;  4N78 D;  1YTZ I;  1GD2 E;  1URQ C;  2WPS A;  4GKG A;  1NWQ A;  1XTG B;  1HVV A;  1GU4 A;  1JOC A;  5CCG D;  1LT9 B;  3MTU E;  5AVZ B;  1RF1 B;  1FZC A;  3RK3 D;  1RE4 C;  2FKW B;  2L5G B;  3G3Z A;  1CI6 B;  5AVW B;  1H8A A;  1RY3 A;  3HD7 A;  1JMM A;  2C0X A;  3HUS C;  4IFF A;  1T3U A;  1IJD B;  3IR9 A;  1SFC B;  3L36 A;  1KIL D;  1N7S C;  3H6P A;  2R5D A;  1NKN A;  4HH2 A;  3VMZ A;  1J1E C;  1NH4 A;  1JTH A;  2YKQ A;  2Z5H A;  5AVV B;  1LT9 C;  1MZ9 A;  1L4A B;  3RK2 C;  3A5T A;  1SQX K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...