4Z1MH

Bovine f1-atpase inhibited by three copies of the inhibitor protein if1 crystallised in the presence of thiophosphate.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
41
structure length
41
Chain Sequence
SSAGAVRDAGGAFGKREQAEEERYFRARAAEQLAALKKHHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP synthase subunit alpha, mitochondrial
publication title How release of phosphate from mammalian F1-ATPase generates a rotary substep.
pubmed doi rcsb
source organism Bos taurus
total genus 13
structure length 41
sequence length 41
chains with identical sequence I, J
ec nomenclature
pdb deposition date 2015-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.500 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4z1mH00
2V7QJ 4TT3H 4Z1MH 1HF9A 1GMJA
chains in the Genus database with same CATH superfamily
3A7OA 1VQ6P 1J1DB 1E5WA 4K3AA 1PP9D 1HGVA 3CCVP 1X0TA 5BU5A 4GKGA 3H1LG 1PGJA 4NPEA 2KIKA 3L35A 1ZRTD 4U3FG 5CCGD 1L0LE 3JCUH 2BCCD 2IYOA 3GHGA 1RF1A 2XNXA 2A45G 1AVYA 2IBZE 2J5UA 3G3ZA 3L74J 3CWBE 2QVAA 2QJYB 2Z5IA 3GF3A 2HR3A 2AXTE 1NTME 5KLVG 1ZP0C 1HVVA 5B66E 3BCCG 1ZXGA 1NKZB 2FBWC 3PJSK 1FJPA 4PJ0H 5APUA 3CX5H 1URQC 2JP3A 3JCUE 3V4WA 4HKZH 2PFXA 2HLOA 2V4HA 4WVZA 5AW3B 3L71J 4EOTA 3M9QA 4AQRD 4M3LA 2WSFJ 1QLED 3A5TA 1SQQG 3NMDA 5AVTB 1WMKA 2E76D 2WMMA 1MV8A 3H1JG 3M0AA 1N8RQ 2YKOA 1LTJA 1JY3O 3OJAB 1Y47A 2W6BA 1Q90D 1FZEA 3HRNA 3IAOA 4H13D 1EDJA 5DJUB 5TISH 3H6PA 1FZBA 1E79H 1GL2A 1AQTA 1JCCA 1NAFA 3CCRP 4H0LC 3BRTB 2Z5HA 1KILD 1SQBD 4OGQD 1OVVA 4N78E 3MP7B 1L4AC 3KZIH 3A0BE 4BWNA 1LP1A 3Q2YA 1BE3J 2YO2A 2W27A 1OMIA 4HH2A 3HTKA 5E79E 3TF5A 1IK7A 1U57A 2A06D 1Q2NA 3L73D 1DIPA 1SP4A 1RQVA 1VQMP 3RBZA 1SQBK 3KZIE 1KMIZ 1DD4A 1RE3C 1URQB 1P84E 4GOEA 5GTIH 2Q3IA 2V7QJ 1BDDA 1L0LG 2KNCB 1PPJD 1NYHA 1YTZI 1IFJA 5CBNA 3QWOC 2IBZG 5B5EH 1T2KD 3HD7B 1VQ8P 3CWBG 2N1TA 4XE5B 5KJ7D 2QRXA 2K3RA 4I2LC 4L73A 3MUDA 4K35A 1HH0A 5APSA 1NTMG 1BCCJ 4WY4B 1KV4A 2LXCB 2YIUC 1S5LX 1XTGB 3CPWO 1PL5A 2YXQB 1KB9I 1X22A 1FDIA 1EXIA 2A45I 1IZNB 1JY2N 1NTKJ 3M9HA 5B5EE 4TT3H 2OYHC 4B86A 1GW4A 3L72G 1VQ5P 3H1LD 1EDKA 1CI6B 4H0LB 4U3FD 4N6JA 1A02F 1BGYJ 2WSEJ 1RY3A 3O6QA 3GG2A 3RK3D 3WMM0 3H1HD 1IFPA 2RH0A 4I6MC 4IFMA 3CMEP 4IL6H 5KLVD 1CZQA 3FXDA 3G71P 3KHUA 3BCCD 4DZOA 3CCLP 2ZAEB 1JY2O 3VMAA 2IZ0A 3VYIA 2R5DA 1NJIQ 2G3AA 5AW5B 5APQA 3EWKA 2E75D 5K5GB 5AVQB 2P7JA 2WVRA 2FXOA 5KLVK 2K9JA 3H1KJ 2FFDC 1QVFO 1SQQD 1S4XA 1PFIA 1BDCA 1JMMA 1QEXA 2YIUB 3TGUJ 1HWTC 1KZUB 3CXHD 3CCUP 1NU1D 1LT9C 4HJGH 1YI2P 1YQ4C 3WUVA 3L75J 1NAYA 3C8VA 1SQQK 2Q5UA 1IFMA 3IR9A 3ZDMA 1LJ2A 1XTCC 2YMKA 1FZFA 1YJ9P 3VTPC 1LTGC 1KFNA 2G8YA 2WPVB 2C9LY 5DJTB 1RE4A 1AV1A 4Y28J 2ZT9D 5C39A 2JO1A 2IBZI 1NOHA 4L75A 2KYVA 1NVOA 5AVYB 1VPCA 1L0LD 1U7JA 3PH0A 2M5AB 1M57D 1FZCC 1NTZJ 2IBZD 4PV1D 3CCQP 3CWBD 2NPSA 1PGPA 3CCSP 3RK2D 1NTMD 1SFCA 1ZLLA 3ITKA 1KYOH 2FYUE 1AQ5A 4CPGA 5APVA 2P1JA 1L0LK 5CHXA 4BXLA 4A7PA 5KAFH 1R5LA 1GD2E 2QIWA 3CX5I 5CCHC 4RKUJ 1KFMA 1YJWP 1LT9B 3A3YB 3L72D 1TU3F 1NTMK 1QVGO 2DW3A 1KYOE 3TK1A 3MD0A 2JWAA 4ZMDA 4RJTA 2KS1A 2BASA 4LGDE 3R4YA 1CW5A 1VQOP 2BEZF 2QE7H 1LTAC 1ZR2A 1PGQA 1SQBJ 1K04A 4N3YB 1LTBC 3RGUA 1G1JA 3G6EP 4ZKPA 1HBWA 2HFED 2ITAA 3V2PA 3CC2P 1DEEG 3L70J 2E42A 1PIXA 4XFJA 3A2AA 3NXSA 4N78D 3D6ZA 2K9YA 3Q5RA 1FZCB 3PTZA 3CXHH 4EDFA 1SVFA 2Z4EA 2IX7C 2KSEA 1OX3A 1U7MA 1ZN5A 1SQXG 1KTMA 2HYNA 2W6JH 1ZR4A 2HPCB 1J1EC 3C9IA 3AE1C 5APYA 3L74E 3PP5A 4I7ZC 2KOGA 4AUWA 1P84D 4W7ZA 1CSBA 2OYIA 2Y9YA 1VQNP 2K88A 2GA1A 4Z1MH 4IFFA 3HE5B 2D2CC 2XDJA 2O01H 1N7SC 2GUVA 4LC1A 3IN6A 4D6TG 4IFDK 1MKMA 2NPSD 1EXJA 1KILA 3RBXA 1VQPP 1HUCA 1VQ4P 2O01N 1FJKA 2FYUG 3L71E 1S3JA 1KQSO 4U3FJ 3B5ND 3FGAD 1USEA 2AEMA 1LTSC 1YITP 3M06A 1H89A 1SQVJ 5KLVJ 2AXTH 3KXDA 2IDBA 1KD1Q 3BVHA 5B66H 4O9BA 4GOFA 1RF0C 1S72P 2Q6QA 4YXWH 2H88C 4RO0A 5KJ7A 3H1HG 4PD4E 3B8EB 3RL0C 1L0NG 2W6AA 3T97B 2IFMA 2ZYDA 3VP9A 2PAJA 1BE3E 1SQPJ 1J1EB 3H1JJ 1D7MA 1FBMA 2H8PD 4NPFX 2HG5D 4H44B 3HD7A 1RF1C 2WSCH 4WY4A 3PRJA 3JC22 3AEDC 2D2CB 1OFCX 5APXA 1N7SB 3JSVC 5CJ0A 2NRGA 1N73B 1H88A 3TNUB 3H1IJ 1KC8Q 3LW5J 1HGZA 3MHVA 5AVUB 2QJPC 3A0BH 2E74C 1YBKA 3H32A 1IFNA 1AJYA 1BCCE 5E79H 3D71A 2R3CA 4C46A 1FC2C 2YKPA 1NU1G 2AEJA 3HUSA 2OTLP 2WITA 4L74A 1G2CA 3BRVB 2WWWA 3L4FA 1NTKE 1EZVE 3MIWA 3L71G 1P84H 1LTJC 2YNYA 1JTHA 1JMBA 5KLIC 4QMAA 1SQXD 3CWBJ 2H43A 3RL0B 3V6IA 1BGYE 1GL2C 1S9KE 1NTMJ 1W2EA 3KQGA 1X79B 2YKQA 4JQ0D 4IL6X 1R8EA 1Y8AA 1FAVA 3P8MC 1RF1B 1VDFA 4D6TD 5AW9B 1SQXK 1DH3A 3M91A 3L72J 4XA4A 2FYUD 3S4RA 1KYOI 1URQD 4BRYA 1JB0J 1BE3G 3FXEA 3H1KE 3WUTA 3QH9A 2QJPB 2WPSA 2E74B 1EDLA 3HD7D 1KQLA 3AEGC 1FOSE 1VF5C 3K5BA 4U7JA 3TGUE 4WY4D 1VQKP 1KYOD 3I5CA 2Q9IA 2N1TC 2FYUK 3MUDC 3BATA 2M0BA 2ZXXA 2XV5A 3FWNA 3L75E 1L4AB 2O1JA 2JJLA 2LXBA 3A0HE 2R3SA 1LTJB 2YXRB 2I1JA 1L0ND 2B87A 2M3BA 5L8RJ 3MZWB 2PP6A 4GDOA 2KK7A 1BCCG 4H0LD 2M5AA 1GL2B 4JF7A 2KZJA 3AEAC 2IZ1A 4Y99C 3AE6C 3VN0A 1FE6A 1NTKG 1EZVG 1HTLC 1L0NK 1QL2A 1LP1B 1VL2A 1K73Q 3CXHI 3HTKB 2M3EA 3CD6P 1NGMB 2MKVA 1YYCA 3CL3D 1BGYG 2KI7B 2XNDH 4AYCA 3W68A 1NTZE 1M90Q 4OWFA 4ASWA 3USSA 3L74D 2NZ2A 1NO4A 2KLVA 3HE4B 1JY3P 1VF5B 4YXDC 2OYHB 3V5BA 2JEEA 3EQ2A 1YQ3C 3TYYA 2P2UA 2VRSA 4YPCA 3I56P 4WBAA 3AE5C 5H2FH 1PP9J 5AVZB 3L71D 3IFMA 1ZOYC 3GW6A 1OZHA 3H1KG 3FWLA 2FXPA 1JUNA 2BCCJ 4NPDA 1NU1K 3F89A 3FX0A 1OW6A 1FOSF 3SFEC 1S2EA 2RN0A 2E5YA 3TGUG 2CPSA 5AVXB 2Y9ZA 2HODA 2CK3H 1LTTC 5H2FE 3U1AA 3M0DC 2I8DA 1H8AA 4Y99B 3Q5SA 1IO4A 4C7NA 1Q86Q 1FS0E 1G1IA 1DD3A 3O6QB 3L75G 1USDA 2QEXP 1RE4C 2QM8A 3L70E 4PD4D 2ZYAA 1PV3A 3AE3C 2FFDB 3SSUA 1BE3D 1IJDB 3HE5A 1KQFB 3B5NA 4GT1A 2B9BA 1H0TA 2ZFCA 5CBOA 2JKVA 2KXPB 2SPZA 1M1JA 2NPSC 1X8YA 3KYQA 2B89A 2K9JB 1LWUA 3I55P 1SFCC 2R32A 5AVSB 3CI9A 2WPQA 1MFZA 1GZLA 1NTZG 2QJKC 3P8CE 3O8ZA 4UB8E 2H89C 1YJNP 1EZVI 2FYNC 1KORA 1BCCD 1ZW0A 1KB9E 1SLQA 4WWIA 5GTHH 1PGOA 1R5SA 4U3FE 1SQXJ 5EFWB 1NWQA 2OQQA 3C1LA 2JWDA 1NTKD 3L73J 1ZMEC 4JPZB 5CCGC 1LNQA 3M9BA 1EZVD 1JY2P 1SQVE 1BSNA 1J1DC 1K05A 5KLVE 1VQLP 2ZYGA 1OWAA 1JOCA 1OW7A 1P84I 1GU5A 1GTWA 4D6TJ 5GTHE 1BGYD 3S9OA 1M56D 1PZQA 3WU2E 1S9KD 3CC7P 1JO5A 2WZ7A 1NTKK 1GK6A 1GDTA 1JEKA 1GMJA 3F5HA 1KN7A 3D6YA 2QJYC 2WSSH 1OVRA 2AEFA 2XKMA 4R4LA 2WSFH 2YMYA 3E1RA 1N73A 1SQPE 1EQ7A 2JR8A 3H1JE 1YTZT 4IOIH 3TNUA 5APTA 3VMYA 3L70G 1Y9BA 1NH4A 4DT0A 2E76C 1SFCB 1Q81Q 4WB4A 3H1LJ 3CCMP 5AW4B 3H1KD 5CCHD 1QGKB 4H13C 4UB6E 3AE7C 3IF4A 2OYIC 1JCDA 3H1HJ 2YO3A 1L0NJ 3TGUD 3AE4C 4PD4H 3H1IE 3U1CA 1W2BO 2N9BA 2UWJE 3V2NA 1KILC 4OGQC 3BCCJ 4KJMA 3LIEA 3Q3DA 3L75D 3GMAA 4HYTB 1X9VA 2WT7B 1NHLA 1URQA 2GUSA 1SQQJ 1W5CE 2V7QH 2KNCA 1UIXA 2PGDA 3VMXA 4I7ZB 3CC4P 3EFFK 3P7KA 1SQVG 4LLHA 3GHGC 2P58A 1JY3N 1T2KC 4KHXA 3U59A 2FYZA 3AE2C 1LT1A 5KJ7C 1NU1J 2C0XA 4TLFA 4L76A 1FDOA 2E76B 3SWFA 1NTZD 4H44D 3AECC 1N86A 3N4XA 4YTPC 3L74G 3HD7C 3L72E 2D2CD 4H13B 1RH5B 1N7SD 1CI6A 2OYIB 4WY4C 3CLQA 2O01J 1SQPG 3VP8A 3AE9C 1T8ZA 2WSEH 1L4AA 4PJ0E 1T3UA 3CX5E 1NTZK 1KILB 1M8OB 2Y0EA 4OGQB 2IYPA 3RK3C 3TSIA 1SS1A 3V2QA 1L0LJ 2Q3EA 2P67A 5BVZA 3NTNA 2IFNA 2K1AA 4JBZA 4GODA 3HUSC 1K9MQ 3D70A 3H1IG 1RE3A 1IFIA 1HJ0A 1GU4A 1OW8A 2ZJSE 2Y0DA 4DCKA 2KZIA 5TISE 5CJ4A 3KPEA 2E75C 3B4SA 2C9NY 2Q1KA 3RL0D 3GHGB 3L70D 3SWYA 1RQUA 3OW2O 3HE4A 2Q7CA 2H7HA 1Q7YQ 3GLMA 1FZAA 2OARA 3II6A 1A02J 2OYHA 1IC2A 1GW3A 1Z56A 3A0HH 2WSCJ 1BSHA 1QL1A 3E1IA 3KDPB 1J2JB 5GTIE 1MFTA 2OTJP 1L2PA 3RK3B 4C7RA 2E74D 3P8CD 1DEBA 2ZT9C 3GF7A 3H32B 1PP9E 1KB9D 5KLIB 1IK9A 3HUSB 4MN4C 1ZRTE 1LTIC 2O3JA 3TDKA 2BCCE 1G2CB 1L4AD 3EFGA 1SQVD 2CPBA 2WPRA 2BEQD 4PV1C 2FFDA 1NKNA 2E75B 1M1KQ 3RK2C 1T3JA 3B71A 1N7LA 2I1KA 1JM0A 1ZV8A 1GL2D 5CMZA 3CMAP 1JTHB 1N2DC 2L5GB 3VMZA 3E7KA 2RMZA 1LT9A 5AW7B 1S5LH 1SQVK 4IL6E 5KKZC 3LIDA 2R5BA 5AW0B 1VQ7P 1FZGA 1SQPD 3OA7A 3H1JD 2ZVNB 1YHQP 2N1TB 5APWA 1IFDA 3R2PA 3NFQA 1HF9A 2WQYC 1S5LE 4BRYB 2C0WA 3V2RA 3H25A 1K8AQ 1VF5D 2ZT9B 1SQPK 1WT6A 1DX7A 2KLUA 3M0DA 1OXZA 2O1KA 3H1ID 2N1TD 3G9RA 3AEFC 1KILE 1SQBE 4PD4I 1UIIA 1AA0A 4JYBA 1FZCA 5KTBA 1GK4A 2QG4A 2RKLA 4ZKUA 1KQGB 1SQXE 4PV1B 2A06E 2HPCA 2FXMA 5TJHA 1WRGA 2W90A 2E5TA 3RK2B 3L73E 2B87B 2QM7A 1MZ9A 4ZNCA 1PP9G 1Q82Q 4EYYQ 2Y0CA 2KP8A 2B88A 5KAIH 3OAKA 3G4SP 3V4QA 3MTUE 4GIFA 5CCHA 4KT0J 4EIJA 2N9YB 3CCJP 2BCCG 4DJGA 1PPJE 4D6TE 3CCEP 5KKZB 4OH8B 4UB8H 1HJBA 5BU8B 2QA4P 2W8ZA 1KB9H 2L91A 3RL0g 3W67A 5KAIE 2QSIA 2A45H 2GM4A 3Q1MA 1M7LA 4ASVA 5AVWB 1FDMA 3B5NC 4I1LA 1YIJP 1EC5A 3PHLA 3SWKA 2JDIH 1QX8A 3Q5PA 1T6AA 4JYCA 2PRRA 3H1LE 5AW8B 3S1KA 2LKMA 5CCGA 2OYOA 1M1JC 1VQ9P 3L36A 4DOJA 3WU2H 3CX5D 1LWUC 5KAFE 2FY8A 2XU6A 5AW6B 3RK3E 2J58A 2M8RA 2J59M 2W83C 3H1HE 5AW1B 2E43A 2P10A 1L0NE 2WT7A 3T97A 2R44A 3SFDC 2IPPA 2KB7P 1OIPA 3AE8C 3BCCE 3PLNA 3UIAA 3AEBC 3P32A 2ZVOB 3BASA 2KUBA 4OVNF 1SQBG 2FYUJ 2HODB 1S1CX 4W7YA 4RESB 1N7SA 2OGUA 2LR2A 4R4MA 1RHZB 4W80A 4C7NB 3ABVC 1AVOA 1SQQE 4UB6H 2MJZA 2A06G 5M1BA 3MGNA 5AVRB 2NPSB 5AVVB 3L73G 3LW5H 1MUUA 4H44C 3VOPA 1JNMA 2KSJA 4EI2A 2ZXEB 3N7NA 3CXHE 2OTKE 1EDIA 1FU1A 1NU1E 2POHA 3AEEC 2K37A 3B5NB 2WTYA 2QJKB 1PPJG 3L37A 2FYNB 1H0TB 1N73C 4HB1A 1SFCD 1LGHB 1M1JB 2AXCA 1RF0A 5AW2B 3WUUA 1OVUA 2XZRA 1LWUB 1AFOA 2FKWB 2KS1B
chains in the Genus database with same CATH topology
1YQ4C 1TU3F 2P10A 1MKMA 3C8VA 1KQGB 4TT3H 1EXJA 1UIXA 1GMJA 2BEQD 1KQFB 4PV1C 4PV1B 3D6YA 2E75C 2E75B 4I7ZB 3SFDC 1JB0J 2QJYC 4H0LC 4H0LB 3R4YA 2BEZF 3AE8C 3LW5J 2NZ2A 4R4LA 3B71A 2YMKA 2QJPC 2WSEJ 4OGQD 1K04A 2E74C 2E74B 3O6QA 3AE2C 3AEBC 2G8YA 3FGAD 2WPVB 3AEGC 1AJYA 1Y9BA 1VF5C 1VF5B 3D71A 1RQUA 3Q2YA 4U7JA 1FDOA 1OMIA 4Y28J 4KT0J 2ZT9D 4YXDC 2E76C 2E76B 4H44D 1S1CX 1YQ3C 2JO1A 3AECC 2J5UA 1IK7A 1U57A 3GLMA 3AE5C 3GF3A 2IDBA 5KKZC 4R4MA 4YTPC 3ABVC 1DIPA 2QJKC 1PIXA 1ZP0C 1ZOYC 4XFJA 5M1BA 1RQVA 2D2CD 2H89C 4H13B 4H13C 2WSCJ 2FYNC 3AE7C 3D6ZA 2K9YA 1KORA 2FXPA 3RL0g 2FBWC 4H44C 2H88C 3Q5RA 2O01J 2G3AA 1KMIZ 1OW6A 1DD4A 2JP3A 2QSIA 3AE4C 3AE9C 3EWKA 5KLIC 5L8RJ 2V7QJ 3SFEC 4PV1D 2E75D 4GDOA 1NYHA 4H0LD 3Q1MA 2OQQA 1HF9A 2WQYC 4OGQC 4OGQB 3T97B 3AEEC 1KTMA 2E74D 1ZMEC 3AEAC 3Q3DA 2WSFJ 3Q5SA 3AE6C 3H25A 3AE1C 1VF5D 2ZT9C 2ZT9B 3Q5PA 1K05A 4IL6X 1R8EA 4H44B 2YIUC 1WMKA 1DD3A 2E76D 3GF7A 4I7ZC 1S5LX 3GMAA 1PL5A 1OW7A 3G9RA 3AEFC 1FDIA 1EXIA 2QIWA 1VL2A 1KILE 4Z1MH 4RKUJ 1PV3A 3S9OA 3AE3C 3RK3E 1NGMB 3D70A 3AEDC 2D2CC 1Q90D 2D2CB 2MKVA 1ZRTE 3IAOA 1HJ0A 4H13D 3IN6A 1OW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V7Q J;  4TT3 H;  4Z1M H;  1HF9 A;  1GMJ A; 
#chains in the Genus database with same CATH topology
 3A7O A;  1VQ6 P;  1J1D B;  1E5W A;  4K3A A;  1PP9 D;  1HGV A;  3CCV P;  1X0T A;  5BU5 A;  4GKG A;  3H1L G;  1PGJ A;  4NPE A;  2KIK A;  3L35 A;  1ZRT D;  4U3F G;  5CCG D;  1L0L E;  3JCU H;  2BCC D;  2IYO A;  3GHG A;  1RF1 A;  2XNX A;  2A45 G;  1AVY A;  2IBZ E;  2J5U A;  3G3Z A;  3L74 J;  3CWB E;  2QVA A;  2QJY B;  2Z5I A;  3GF3 A;  2HR3 A;  2AXT E;  1NTM E;  5KLV G;  1ZP0 C;  1HVV A;  5B66 E;  3BCC G;  1ZXG A;  1NKZ B;  2FBW C;  3PJS K;  1FJP A;  4PJ0 H;  5APU A;  3CX5 H;  1URQ C;  2JP3 A;  3JCU E;  3V4W A;  4HKZ H;  2PFX A;  2HLO A;  2V4H A;  4WVZ A;  5AW3 B;  3L71 J;  4EOT A;  3M9Q A;  4AQR D;  4M3L A;  2WSF J;  1QLE D;  3A5T A;  1SQQ G;  3NMD A;  5AVT B;  1WMK A;  2E76 D;  2WMM A;  1MV8 A;  3H1J G;  3M0A A;  1N8R Q;  2YKO A;  1LTJ A;  1JY3 O;  3OJA B;  1Y47 A;  2W6B A;  1Q90 D;  1FZE A;  3HRN A;  3IAO A;  4H13 D;  1EDJ A;  5DJU B;  5TIS H;  3H6P A;  1FZB A;  1E79 H;  1GL2 A;  1AQT A;  1JCC A;  1NAF A;  3CCR P;  4H0L C;  3BRT B;  2Z5H A;  1KIL D;  1SQB D;  4OGQ D;  1OVV A;  4N78 E;  3MP7 B;  1L4A C;  3KZI H;  3A0B E;  4BWN A;  1LP1 A;  3Q2Y A;  1BE3 J;  2YO2 A;  2W27 A;  1OMI A;  4HH2 A;  3HTK A;  5E79 E;  3TF5 A;  1IK7 A;  1U57 A;  2A06 D;  1Q2N A;  3L73 D;  1DIP A;  1SP4 A;  1RQV A;  1VQM P;  3RBZ A;  1SQB K;  3KZI E;  1KMI Z;  1DD4 A;  1RE3 C;  1URQ B;  1P84 E;  4GOE A;  5GTI H;  2Q3I A;  2V7Q J;  1BDD A;  1L0L G;  2KNC B;  1PPJ D;  1NYH A;  1YTZ I;  1IFJ A;  5CBN A;  3QWO C;  2IBZ G;  5B5E H;  1T2K D;  3HD7 B;  1VQ8 P;  3CWB G;  2N1T A;  4XE5 B;  5KJ7 D;  2QRX A;  2K3R A;  4I2L C;  4L73 A;  3MUD A;  4K35 A;  1HH0 A;  5APS A;  1NTM G;  1BCC J;  4WY4 B;  1KV4 A;  2LXC B;  2YIU C;  1S5L X;  1XTG B;  3CPW O;  1PL5 A;  2YXQ B;  1KB9 I;  1X22 A;  1FDI A;  1EXI A;  2A45 I;  1IZN B;  1JY2 N;  1NTK J;  3M9H A;  5B5E E;  4TT3 H;  2OYH C;  4B86 A;  1GW4 A;  3L72 G;  1VQ5 P;  3H1L D;  1EDK A;  1CI6 B;  4H0L B;  4U3F D;  4N6J A;  1A02 F;  1BGY J;  2WSE J;  1RY3 A;  3O6Q A;  3GG2 A;  3RK3 D;  3WMM 0;  3H1H D;  1IFP A;  2RH0 A;  4I6M C;  4IFM A;  3CME P;  4IL6 H;  5KLV D;  1CZQ A;  3FXD A;  3G71 P;  3KHU A;  3BCC D;  4DZO A;  3CCL P;  2ZAE B;  1JY2 O;  3VMA A;  2IZ0 A;  3VYI A;  2R5D A;  1NJI Q;  2G3A A;  5AW5 B;  5APQ A;  3EWK A;  2E75 D;  5K5G B;  5AVQ B;  2P7J A;  2WVR A;  2FXO A;  5KLV K;  2K9J A;  3H1K J;  2FFD C;  1QVF O;  1SQQ D;  1S4X A;  1PFI A;  1BDC A;  1JMM A;  1QEX A;  2YIU B;  3TGU J;  1HWT C;  1KZU B;  3CXH D;  3CCU P;  1NU1 D;  1LT9 C;  4HJG H;  1YI2 P;  1YQ4 C;  3WUV A;  3L75 J;  1NAY A;  3C8V A;  1SQQ K;  2Q5U A;  1IFM A;  3IR9 A;  3ZDM A;  1LJ2 A;  1XTC C;  2YMK A;  1FZF A;  1YJ9 P;  3VTP C;  1LTG C;  1KFN A;  2G8Y A;  2WPV B;  2C9L Y;  5DJT B;  1RE4 A;  1AV1 A;  4Y28 J;  2ZT9 D;  5C39 A;  2JO1 A;  2IBZ I;  1NOH A;  4L75 A;  2KYV A;  1NVO A;  5AVY B;  1VPC A;  1L0L D;  1U7J A;  3PH0 A;  2M5A B;  1M57 D;  1FZC C;  1NTZ J;  2IBZ D;  4PV1 D;  3CCQ P;  3CWB D;  2NPS A;  1PGP A;  3CCS P;  3RK2 D;  1NTM D;  1SFC A;  1ZLL A;  3ITK A;  1KYO H;  2FYU E;  1AQ5 A;  4CPG A;  5APV A;  2P1J A;  1L0L K;  5CHX A;  4BXL A;  4A7P A;  5KAF H;  1R5L A;  1GD2 E;  2QIW A;  3CX5 I;  5CCH C;  4RKU J;  1KFM A;  1YJW P;  1LT9 B;  3A3Y B;  3L72 D;  1TU3 F;  1NTM K;  1QVG O;  2DW3 A;  1KYO E;  3TK1 A;  3MD0 A;  2JWA A;  4ZMD A;  4RJT A;  2KS1 A;  2BAS A;  4LGD E;  3R4Y A;  1CW5 A;  1VQO P;  2BEZ F;  2QE7 H;  1LTA C;  1ZR2 A;  1PGQ A;  1SQB J;  1K04 A;  4N3Y B;  1LTB C;  3RGU A;  1G1J A;  3G6E P;  4ZKP A;  1HBW A;  2HFE D;  2ITA A;  3V2P A;  3CC2 P;  1DEE G;  3L70 J;  2E42 A;  1PIX A;  4XFJ A;  3A2A A;  3NXS A;  4N78 D;  3D6Z A;  2K9Y A;  3Q5R A;  1FZC B;  3PTZ A;  3CXH H;  4EDF A;  1SVF A;  2Z4E A;  2IX7 C;  2KSE A;  1OX3 A;  1U7M A;  1ZN5 A;  1SQX G;  1KTM A;  2HYN A;  2W6J H;  1ZR4 A;  2HPC B;  1J1E C;  3C9I A;  3AE1 C;  5APY A;  3L74 E;  3PP5 A;  4I7Z C;  2KOG A;  4AUW A;  1P84 D;  4W7Z A;  1CSB A;  2OYI A;  2Y9Y A;  1VQN P;  2K88 A;  2GA1 A;  4Z1M H;  4IFF A;  3HE5 B;  2D2C C;  2XDJ A;  2O01 H;  1N7S C;  2GUV A;  4LC1 A;  3IN6 A;  4D6T G;  4IFD K;  1MKM A;  2NPS D;  1EXJ A;  1KIL A;  3RBX A;  1VQP P;  1HUC A;  1VQ4 P;  2O01 N;  1FJK A;  2FYU G;  3L71 E;  1S3J A;  1KQS O;  4U3F J;  3B5N D;  3FGA D;  1USE A;  2AEM A;  1LTS C;  1YIT P;  3M06 A;  1H89 A;  1SQV J;  5KLV J;  2AXT H;  3KXD A;  2IDB A;  1KD1 Q;  3BVH A;  5B66 H;  4O9B A;  4GOF A;  1RF0 C;  1S72 P;  2Q6Q A;  4YXW H;  2H88 C;  4RO0 A;  5KJ7 A;  3H1H G;  4PD4 E;  3B8E B;  3RL0 C;  1L0N G;  2W6A A;  3T97 B;  2IFM A;  2ZYD A;  3VP9 A;  2PAJ A;  1BE3 E;  1SQP J;  1J1E B;  3H1J J;  1D7M A;  1FBM A;  2H8P D;  4NPF X;  2HG5 D;  4H44 B;  3HD7 A;  1RF1 C;  2WSC H;  4WY4 A;  3PRJ A;  3JC2 2;  3AED C;  2D2C B;  1OFC X;  5APX A;  1N7S B;  3JSV C;  5CJ0 A;  2NRG A;  1N73 B;  1H88 A;  3TNU B;  3H1I J;  1KC8 Q;  3LW5 J;  1HGZ A;  3MHV A;  5AVU B;  2QJP C;  3A0B H;  2E74 C;  1YBK A;  3H32 A;  1IFN A;  1AJY A;  1BCC E;  5E79 H;  3D71 A;  2R3C A;  4C46 A;  1FC2 C;  2YKP A;  1NU1 G;  2AEJ A;  3HUS A;  2OTL P;  2WIT A;  4L74 A;  1G2C A;  3BRV B;  2WWW A;  3L4F A;  1NTK E;  1EZV E;  3MIW A;  3L71 G;  1P84 H;  1LTJ C;  2YNY A;  1JTH A;  1JMB A;  5KLI C;  4QMA A;  1SQX D;  3CWB J;  2H43 A;  3RL0 B;  3V6I A;  1BGY E;  1GL2 C;  1S9K E;  1NTM J;  1W2E A;  3KQG A;  1X79 B;  2YKQ A;  4JQ0 D;  4IL6 X;  1R8E A;  1Y8A A;  1FAV A;  3P8M C;  1RF1 B;  1VDF A;  4D6T D;  5AW9 B;  1SQX K;  1DH3 A;  3M91 A;  3L72 J;  4XA4 A;  2FYU D;  3S4R A;  1KYO I;  1URQ D;  4BRY A;  1JB0 J;  1BE3 G;  3FXE A;  3H1K E;  3WUT A;  3QH9 A;  2QJP B;  2WPS A;  2E74 B;  1EDL A;  3HD7 D;  1KQL A;  3AEG C;  1FOS E;  1VF5 C;  3K5B A;  4U7J A;  3TGU E;  4WY4 D;  1VQK P;  1KYO D;  3I5C A;  2Q9I A;  2N1T C;  2FYU K;  3MUD C;  3BAT A;  2M0B A;  2ZXX A;  2XV5 A;  3FWN A;  3L75 E;  1L4A B;  2O1J A;  2JJL A;  2LXB A;  3A0H E;  2R3S A;  1LTJ B;  2YXR B;  2I1J A;  1L0N D;  2B87 A;  2M3B A;  5L8R J;  3MZW B;  2PP6 A;  4GDO A;  2KK7 A;  1BCC G;  4H0L D;  2M5A A;  1GL2 B;  4JF7 A;  2KZJ A;  3AEA C;  2IZ1 A;  4Y99 C;  3AE6 C;  3VN0 A;  1FE6 A;  1NTK G;  1EZV G;  1HTL C;  1L0N K;  1QL2 A;  1LP1 B;  1VL2 A;  1K73 Q;  3CXH I;  3HTK B;  2M3E A;  3CD6 P;  1NGM B;  2MKV A;  1YYC A;  3CL3 D;  1BGY G;  2KI7 B;  2XND H;  4AYC A;  3W68 A;  1NTZ E;  1M90 Q;  4OWF A;  4ASW A;  3USS A;  3L74 D;  2NZ2 A;  1NO4 A;  2KLV A;  3HE4 B;  1JY3 P;  1VF5 B;  4YXD C;  2OYH B;  3V5B A;  2JEE A;  3EQ2 A;  1YQ3 C;  3TYY A;  2P2U A;  2VRS A;  4YPC A;  3I56 P;  4WBA A;  3AE5 C;  5H2F H;  1PP9 J;  5AVZ B;  3L71 D;  3IFM A;  1ZOY C;  3GW6 A;  1OZH A;  3H1K G;  3FWL A;  2FXP A;  1JUN A;  2BCC J;  4NPD A;  1NU1 K;  3F89 A;  3FX0 A;  1OW6 A;  1FOS F;  3SFE C;  1S2E A;  2RN0 A;  2E5Y A;  3TGU G;  2CPS A;  5AVX B;  2Y9Z A;  2HOD A;  2CK3 H;  1LTT C;  5H2F E;  3U1A A;  3M0D C;  2I8D A;  1H8A A;  4Y99 B;  3Q5S A;  1IO4 A;  4C7N A;  1Q86 Q;  1FS0 E;  1G1I A;  1DD3 A;  3O6Q B;  3L75 G;  1USD A;  2QEX P;  1RE4 C;  2QM8 A;  3L70 E;  4PD4 D;  2ZYA A;  1PV3 A;  3AE3 C;  2FFD B;  3SSU A;  1BE3 D;  1IJD B;  3HE5 A;  1KQF B;  3B5N A;  4GT1 A;  2B9B A;  1H0T A;  2ZFC A;  5CBO A;  2JKV A;  2KXP B;  2SPZ A;  1M1J A;  2NPS C;  1X8Y A;  3KYQ A;  2B89 A;  2K9J B;  1LWU A;  3I55 P;  1SFC C;  2R32 A;  5AVS B;  3CI9 A;  2WPQ A;  1MFZ A;  1GZL A;  1NTZ G;  2QJK C;  3P8C E;  3O8Z A;  4UB8 E;  2H89 C;  1YJN P;  1EZV I;  2FYN C;  1KOR A;  1BCC D;  1ZW0 A;  1KB9 E;  1SLQ A;  4WWI A;  5GTH H;  1PGO A;  1R5S A;  4U3F E;  1SQX J;  5EFW B;  1NWQ A;  2OQQ A;  3C1L A;  2JWD A;  1NTK D;  3L73 J;  1ZME C;  4JPZ B;  5CCG C;  1LNQ A;  3M9B A;  1EZV D;  1JY2 P;  1SQV E;  1BSN A;  1J1D C;  1K05 A;  5KLV E;  1VQL P;  2ZYG A;  1OWA A;  1JOC A;  1OW7 A;  1P84 I;  1GU5 A;  1GTW A;  4D6T J;  5GTH E;  1BGY D;  3S9O A;  1M56 D;  1PZQ A;  3WU2 E;  1S9K D;  3CC7 P;  1JO5 A;  2WZ7 A;  1NTK K;  1GK6 A;  1GDT A;  1JEK A;  1GMJ A;  3F5H A;  1KN7 A;  3D6Y A;  2QJY C;  2WSS H;  1OVR A;  2AEF A;  2XKM A;  4R4L A;  2WSF H;  2YMY A;  3E1R A;  1N73 A;  1SQP E;  1EQ7 A;  2JR8 A;  3H1J E;  1YTZ T;  4IOI H;  3TNU A;  5APT A;  3VMY A;  3L70 G;  1Y9B A;  1NH4 A;  4DT0 A;  2E76 C;  1SFC B;  1Q81 Q;  4WB4 A;  3H1L J;  3CCM P;  5AW4 B;  3H1K D;  5CCH D;  1QGK B;  4H13 C;  4UB6 E;  3AE7 C;  3IF4 A;  2OYI C;  1JCD A;  3H1H J;  2YO3 A;  1L0N J;  3TGU D;  3AE4 C;  4PD4 H;  3H1I E;  3U1C A;  1W2B O;  2N9B A;  2UWJ E;  3V2N A;  1KIL C;  4OGQ C;  3BCC J;  4KJM A;  3LIE A;  3Q3D A;  3L75 D;  3GMA A;  4HYT B;  1X9V A;  2WT7 B;  1NHL A;  1URQ A;  2GUS A;  1SQQ J;  1W5C E;  2V7Q H;  2KNC A;  1UIX A;  2PGD A;  3VMX A;  4I7Z B;  3CC4 P;  3EFF K;  3P7K A;  1SQV G;  4LLH A;  3GHG C;  2P58 A;  1JY3 N;  1T2K C;  4KHX A;  3U59 A;  2FYZ A;  3AE2 C;  1LT1 A;  5KJ7 C;  1NU1 J;  2C0X A;  4TLF A;  4L76 A;  1FDO A;  2E76 B;  3SWF A;  1NTZ D;  4H44 D;  3AEC C;  1N86 A;  3N4X A;  4YTP C;  3L74 G;  3HD7 C;  3L72 E;  2D2C D;  4H13 B;  1RH5 B;  1N7S D;  1CI6 A;  2OYI B;  4WY4 C;  3CLQ A;  2O01 J;  1SQP G;  3VP8 A;  3AE9 C;  1T8Z A;  2WSE H;  1L4A A;  4PJ0 E;  1T3U A;  3CX5 E;  1NTZ K;  1KIL B;  1M8O B;  2Y0E A;  4OGQ B;  2IYP A;  3RK3 C;  3TSI A;  1SS1 A;  3V2Q A;  1L0L J;  2Q3E A;  2P67 A;  5BVZ A;  3NTN A;  2IFN A;  2K1A A;  4JBZ A;  4GOD A;  3HUS C;  1K9M Q;  3D70 A;  3H1I G;  1RE3 A;  1IFI A;  1HJ0 A;  1GU4 A;  1OW8 A;  2ZJS E;  2Y0D A;  4DCK A;  2KZI A;  5TIS E;  5CJ4 A;  3KPE A;  2E75 C;  3B4S A;  2C9N Y;  2Q1K A;  3RL0 D;  3GHG B;  3L70 D;  3SWY A;  1RQU A;  3OW2 O;  3HE4 A;  2Q7C A;  2H7H A;  1Q7Y Q;  3GLM A;  1FZA A;  2OAR A;  3II6 A;  1A02 J;  2OYH A;  1IC2 A;  1GW3 A;  1Z56 A;  3A0H H;  2WSC J;  1BSH A;  1QL1 A;  3E1I A;  3KDP B;  1J2J B;  5GTI E;  1MFT A;  2OTJ P;  1L2P A;  3RK3 B;  4C7R A;  2E74 D;  3P8C D;  1DEB A;  2ZT9 C;  3GF7 A;  3H32 B;  1PP9 E;  1KB9 D;  5KLI B;  1IK9 A;  3HUS B;  4MN4 C;  1ZRT E;  1LTI C;  2O3J A;  3TDK A;  2BCC E;  1G2C B;  1L4A D;  3EFG A;  1SQV D;  2CPB A;  2WPR A;  2BEQ D;  4PV1 C;  2FFD A;  1NKN A;  2E75 B;  1M1K Q;  3RK2 C;  1T3J A;  3B71 A;  1N7L A;  2I1K A;  1JM0 A;  1ZV8 A;  1GL2 D;  5CMZ A;  3CMA P;  1JTH B;  1N2D C;  2L5G B;  3VMZ A;  3E7K A;  2RMZ A;  1LT9 A;  5AW7 B;  1S5L H;  1SQV K;  4IL6 E;  5KKZ C;  3LID A;  2R5B A;  5AW0 B;  1VQ7 P;  1FZG A;  1SQP D;  3OA7 A;  3H1J D;  2ZVN B;  1YHQ P;  2N1T B;  5APW A;  1IFD A;  3R2P A;  3NFQ A;  1HF9 A;  2WQY C;  1S5L E;  4BRY B;  2C0W A;  3V2R A;  3H25 A;  1K8A Q;  1VF5 D;  2ZT9 B;  1SQP K;  1WT6 A;  1DX7 A;  2KLU A;  3M0D A;  1OXZ A;  2O1K A;  3H1I D;  2N1T D;  3G9R A;  3AEF C;  1KIL E;  1SQB E;  4PD4 I;  1UII A;  1AA0 A;  4JYB A;  1FZC A;  5KTB A;  1GK4 A;  2QG4 A;  2RKL A;  4ZKU A;  1KQG B;  1SQX E;  4PV1 B;  2A06 E;  2HPC A;  2FXM A;  5TJH A;  1WRG A;  2W90 A;  2E5T A;  3RK2 B;  3L73 E;  2B87 B;  2QM7 A;  1MZ9 A;  4ZNC A;  1PP9 G;  1Q82 Q;  4EYY Q;  2Y0C A;  2KP8 A;  2B88 A;  5KAI H;  3OAK A;  3G4S P;  3V4Q A;  3MTU E;  4GIF A;  5CCH A;  4KT0 J;  4EIJ A;  2N9Y B;  3CCJ P;  2BCC G;  4DJG A;  1PPJ E;  4D6T E;  3CCE P;  5KKZ B;  4OH8 B;  4UB8 H;  1HJB A;  5BU8 B;  2QA4 P;  2W8Z A;  1KB9 H;  2L91 A;  3RL0 g;  3W67 A;  5KAI E;  2QSI A;  2A45 H;  2GM4 A;  3Q1M A;  1M7L A;  4ASV A;  5AVW B;  1FDM A;  3B5N C;  4I1L A;  1YIJ P;  1EC5 A;  3PHL A;  3SWK A;  2JDI H;  1QX8 A;  3Q5P A;  1T6A A;  4JYC A;  2PRR A;  3H1L E;  5AW8 B;  3S1K A;  2LKM A;  5CCG A;  2OYO A;  1M1J C;  1VQ9 P;  3L36 A;  4DOJ A;  3WU2 H;  3CX5 D;  1LWU C;  5KAF E;  2FY8 A;  2XU6 A;  5AW6 B;  3RK3 E;  2J58 A;  2M8R A;  2J59 M;  2W83 C;  3H1H E;  5AW1 B;  2E43 A;  2P10 A;  1L0N E;  2WT7 A;  3T97 A;  2R44 A;  3SFD C;  2IPP A;  2KB7 P;  1OIP A;  3AE8 C;  3BCC E;  3PLN A;  3UIA A;  3AEB C;  3P32 A;  2ZVO B;  3BAS A;  2KUB A;  4OVN F;  1SQB G;  2FYU J;  2HOD B;  1S1C X;  4W7Y A;  4RES B;  1N7S A;  2OGU A;  2LR2 A;  4R4M A;  1RHZ B;  4W80 A;  4C7N B;  3ABV C;  1AVO A;  1SQQ E;  4UB6 H;  2MJZ A;  2A06 G;  5M1B A;  3MGN A;  5AVR B;  2NPS B;  5AVV B;  3L73 G;  3LW5 H;  1MUU A;  4H44 C;  3VOP A;  1JNM A;  2KSJ A;  4EI2 A;  2ZXE B;  3N7N A;  3CXH E;  2OTK E;  1EDI A;  1FU1 A;  1NU1 E;  2POH A;  3AEE C;  2K37 A;  3B5N B;  2WTY A;  2QJK B;  1PPJ G;  3L37 A;  2FYN B;  1H0T B;  1N73 C;  4HB1 A;  1SFC D;  1LGH B;  1M1J B;  2AXC A;  1RF0 A;  5AW2 B;  3WUU A;  1OVU A;  2XZR A;  1LWU B;  1AFO A;  2FKW B;  2KS1 B; 
#chains in the Genus database with same CATH homology
 1YQ4 C;  1TU3 F;  2P10 A;  1MKM A;  3C8V A;  1KQG B;  4TT3 H;  1EXJ A;  1UIX A;  1GMJ A;  2BEQ D;  1KQF B;  4PV1 C;  4PV1 B;  3D6Y A;  2E75 C;  2E75 B;  4I7Z B;  3SFD C;  1JB0 J;  2QJY C;  4H0L C;  4H0L B;  3R4Y A;  2BEZ F;  3AE8 C;  3LW5 J;  2NZ2 A;  4R4L A;  3B71 A;  2YMK A;  2QJP C;  2WSE J;  4OGQ D;  1K04 A;  2E74 C;  2E74 B;  3O6Q A;  3AE2 C;  3AEB C;  2G8Y A;  3FGA D;  2WPV B;  3AEG C;  1AJY A;  1Y9B A;  1VF5 C;  1VF5 B;  3D71 A;  1RQU A;  3Q2Y A;  4U7J A;  1FDO A;  1OMI A;  4Y28 J;  4KT0 J;  2ZT9 D;  4YXD C;  2E76 C;  2E76 B;  4H44 D;  1S1C X;  1YQ3 C;  2JO1 A;  3AEC C;  2J5U A;  1IK7 A;  1U57 A;  3GLM A;  3AE5 C;  3GF3 A;  2IDB A;  5KKZ C;  4R4M A;  4YTP C;  3ABV C;  1DIP A;  2QJK C;  1PIX A;  1ZP0 C;  1ZOY C;  4XFJ A;  5M1B A;  1RQV A;  2D2C D;  2H89 C;  4H13 B;  4H13 C;  2WSC J;  2FYN C;  3AE7 C;  3D6Z A;  2K9Y A;  1KOR A;  2FXP A;  3RL0 g;  2FBW C;  4H44 C;  2H88 C;  3Q5R A;  2O01 J;  2G3A A;  1KMI Z;  1OW6 A;  1DD4 A;  2JP3 A;  2QSI A;  3AE4 C;  3AE9 C;  3EWK A;  5KLI C;  5L8R J;  2V7Q J;  3SFE C;  4PV1 D;  2E75 D;  4GDO A;  1NYH A;  4H0L D;  3Q1M A;  2OQQ A;  1HF9 A;  2WQY C;  4OGQ C;  4OGQ B;  3T97 B;  3AEE C;  1KTM A;  2E74 D;  1ZME C;  3AEA C;  3Q3D A;  2WSF J;  3Q5S A;  3AE6 C;  3H25 A;  3AE1 C;  1VF5 D;  2ZT9 C;  2ZT9 B;  3Q5P A;  1K05 A;  4IL6 X;  1R8E A;  4H44 B;  2YIU C;  1WMK A;  1DD3 A;  2E76 D;  3GF7 A;  4I7Z C;  1S5L X;  3GMA A;  1PL5 A;  1OW7 A;  3G9R A;  3AEF C;  1FDI A;  1EXI A;  2QIW A;  1VL2 A;  1KIL E;  4Z1M H;  4RKU J;  1PV3 A;  3S9O A;  3AE3 C;  3RK3 E;  1NGM B;  3D70 A;  3AED C;  2D2C C;  1Q90 D;  2D2C B;  2MKV A;  1ZRT E;  3IAO A;  1HJ0 A;  4H13 D;  3IN6 A;  1OW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...