2KS1B

Heterodimeric association of transmembrane domains of erbb1 and erbb2 receptors enabling kinase activation
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
44
structure length
44
Chain Sequence
EGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFMRRRHIVRKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Receptor tyrosine-protein kinase erbB-2
publication title Spatial Structure of the Transmembrane Domain Heterodimer of ErbB1 and ErbB2 Receptor Tyrosine Kinases
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 44
sequence length 44
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2009-12-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2ks1B01
5DJTB 1BDCA 5EFWB 2JWDA 2KZJA 4ASWA 1EDJA 4ZNCA 1X0TA 4WWIA 2RKLA 1EC5A 4EYYQ 4GODA 3MHVA 5DJUB 2KUBA 4IOIH 1SS1A 2B87A 3FXEA 5CBOA 2WMMA 4ZMDA 4NPEA 3QWOC 2LXCB 1EDIA 2HR3A 4HB1A 1DEEG 1U7MA 2OTKE 1BDDA 2B89A 3S1KA 1JMBA 1OVRA 1Q2NA 4NPDA 4BXLA 1H0TA 2KI7B 4K3AA 2M0BA 1LP1B 1Y47A 1S3JA 3ZDMA 2Q1KA 2I8DA 4GOEA 2KS1B 1OVUA 4MN4C 2M5AB 4GOFA 5C39A 1NVOA 1ZXGA 2LR2A 4K35A 1ZW0A 4ASVA 4NPFX 2UWJE 1LT1A 4CPGA 2B87B 1EDKA 2KZIA 2QVAA 1JM0A 4HKZH 5CBNA 4JBZA 2LXBA 5K5GB 4KJMA 2SPZA 2ZAEB 2P58A 3PH0A 1EDLA 2QRXA 3FXDA 1LP1A 2KIKA 3RGUA 1H0TB 1U7JA 2R44A 4HJGH 2K3RA 3MZWB 1OVVA 2B88A 1FC2C 2M5AA 1MFTA
chains in the Genus database with same CATH superfamily
2RH0A 3V6IA 1SQVD 1JY2P 2W83C 1EZVD 1S5LH 2FY8A 4ASWA 1SQQJ 3LIEA 1KFMA 3H6PA 2GUSA 3L72E 3AEEC 2IFMA 5KLIB 2P2UA 3N4XA 1BE3J 4KT0J 2W8ZA 4ZMDA 1IO4A 4PD4D 1N7SC 5E79E 5KLVK 2A06E 3QH9A 1USDA 1OZHA 3CCEP 2R3SA 4DCKA 2O1KA 1AJYA 3V4WA 3HTKA 3ZDMA 1VPCA 3RK3C 1BSNA 1SQXJ 1K9MQ 5CCGC 5KJ7C 1RQUA 3L70D 1NVOA 1N7SA 3RK2D 4H44B 4JQ0D 4U3FE 2IZ1A 1N2DC 4KHXA 1YIJP 4Y99C 1G2CB 3B5ND 2N1TD 4RO0A 1G1JA 3JCUE 2KXPB 2IYPA 1BCCG 2IBZG 1NTKD 1FOSE 4WY4C 1Q82Q 1XTGB 2BCCE 2YKQA 1P84D 1L0NJ 3AEAC 1YQ3C 1OW8A 2ITAA 3KYQA 3HUSA 2KZJA 1AVYA 5CJ0A 2Q9IA 5AVYB 2RKLA 2WSCJ 2YO3A 3L73E 4H13C 3KQGA 1MFZA 3HE4B 4EIJA 2W90A 3G6EP 1SQQG 1T3JA 4M3LA 1ZV8A 4IFFA 1ZRTD 1UIIA 5B66E 1BE3G 5AVQB 3VOPA 3FGAD 2R5BA 1X79B 1Y47A 2QJYB 3H1IE 3ABVC 2M5AB 1SQVK 3OAKA 1IFIA 1NAYA 1PGPA 2NPSB 1VF5C 1SQXG 3S9OA 2AXTH 2YNYA 1FBMA 5AW6B 1LT9C 3SSUA 3CCMP 1ZMEC 3TGUE 2LXBA 3GF7A 4PV1C 3L75D 2FYNB 4I7ZB 1LP1A 1VQPP 1ZOYC 2YXRB 5GTIE 1NH4A 3C1LA 3RL0D 2JO1A 3A0HH 1FC2C 2E74D 3BVHA 3WUVA 3AE8C 5DJTB 4C46A 1K8AQ 3PP5A 1FZGA 1N73A 1L0NG 2HODA 1W2EA 1YJ9P 1RE4C 3CCQP 5AW3B 1T6AA 1KC8Q 3H1JE 1L0LD 2OYIB 4EI2A 3PJSK 2Z5HA 2ZT9B 3K5BA 1NJIQ 1RE4A 1NTKK 2QEXP 4BXLA 3MGNA 2K1AA 3L71D 2GM4A 1RE3A 4W7ZA 2I8DA 1IFPA 3M0DC 3F5HA 3H1KD 1A02J 3BASA 3WU2E 3CX5H 1NU1K 5AVZB 4WVZA 3WUUA 2A45H 1M1JC 1PZQA 3RK2C 4N6JA 1DD4A 3CWBE 3C9IA 1J1EB 1L4AA 5APUA 3L75J 4DOJA 1P84I 5KKZB 4L76A 1BGYD 3B5NC 4OGQD 2N1TC 1R5SA 2ZAEB 5APTA 1KD1Q 3II6A 1JCDA 2E76B 2KLVA 2FXMA 3CXHI 2J58A 1MV8A 3OW2O 2PP6A 1S1CX 3SFDC 1JTHB 1J1DB 1Y9BA 1Q86Q 4PJ0E 2R32A 2WSFJ 3L35A 4AQRD 3W68A 3B5NA 5AW4B 3TYYA 4WWIA 3AE5C 1EC5A 1VQNP 4TLFA 1CZQA 2IX7C 1GD2E 1IFMA 1SS1A 3E1IA 2ZVOB 3AE9C 1L0LJ 3L72D 2Y9ZA 2C9LY 5BU5A 3T97A 1MKMA 1NU1E 1AA0A 4D6TE 1Q2NA 2E75B 2HPCB 2A06D 4K3AA 5AW0B 3GHGC 1G1IA 3AECC 3AE3C 1LTTC 3V5BA 2AXCA 4W80A 2QJKB 1GK4A 4H0LD 1YTZI 1ZN5A 2FKWB 1VL2A 4K35A 3O6QB 2O1JA 3M0AA 4U3FD 1VQ8P 2FBWC 1RF1A 1OIPA 4DZOA 2AEMA 1VQOP 1FJKA 1FAVA 1HVVA 2JWAA 3VN0A 1N7SB 3LW5H 2WPVB 2ZVNB 1EXJA 1PFIA 2IZ0A 1JNMA 1S72P 1EDLA 2QE7H 1IZNB 1LTIC 1H0TB 1CI6B 2BCCD 5AVRB 4I1LA 3RK3B 3L75G 3N7NA 1SVFA 4LGDE 1YI2P 1DH3A 4YTPC 2H8PD 2QA4P 1GL2D 3RL0C 1ZP0C 2B87A 5CBOA 4Y99B 2J59M 3L73D 5KTBA 4NPEA 1JY3P 1DEEG 3VTPC 1SFCC 3HRNA 3CLQA 1HF9A 1L0LG 4WY4B 2E43A 3LIDA 2A45I 2YXQB 1LTAC 2JR8A 1DIPA 1A02F 2R3CA 1NOHA 3H1ID 2OYHC 1FDOA 1KB9H 1LTJA 2ZYGA 2FFDC 4NPFX 3TSIA 2NZ2A 4U3FJ 1KYOI 3A0BE 1VQ6P 1AV1A 5CMZA 2IYOA 3ITKA 4HKZH 3IN6A 3CX5E 4Z1MH 1LTGC 1SP4A 3FWLA 2L5GB 4RESB 1YQ4C 3TGUD 3O8ZA 5APQA 2K3RA 3SFEC 3HD7C 2P1JA 3TK1A 5KAIE 4OGQC 1KILE 3L74E 5KLVJ 3FWNA 5BVZA 2ZJSE 3M06A 5EFWB 3H1LE 3TDKA 3VP8A 2FYZA 1PL5A 4GODA 3CL3D 1VF5B 4RJTA 1FZFA 2KK7A 2QM8A 3L73J 5AW1B 1TU3F 1LJ2A 4UB8H 1LT9B 5GTHH 3H1JD 1FZEA 2PAJA 2G8YA 1PP9J 2KNCB 4PV1B 3AE2C 3VMZA 2P10A 3MTUE 4UB6E 3EWKA 2A06G 3H1IJ 2M3BA 1S5LX 1YYCA 1AQTA 2HFED 1S4XA 4CPGA 1OX3A 1L4AD 2WSCH 4H0LC 1KN7A 3GW6A 1NTMK 3CCUP 4TT3H 3CWBD 1RF0C 2SPZA 4U3FG 3TGUJ 2J5UA 1E5WA 3Q5PA 1S2EA 2K9JA 3JC22 2IBZI 4U7JA 4EDFA 3MZWB 1NAFA 1NYHA 3RK3E 1NKZB 2C0WA 1RF0A 3Q2YA 3HUSC 3RBZA 1IK7A 5H2FH 1MZ9A 3SWKA 5DJUB 5TJHA 5KLVG 1M1JB 2WMMA 2WITA 2LXCB 3H1JJ 1SQPE 1SQVJ 1R5LA 3P8CE 4AYCA 3Q5SA 1BCCE 1BDDA 1M56D 1KB9I 3L73G 2O01J 2N1TB 1D7MA 1P84H 2JKVA 1NU1D 2JJLA 4D6TD 2CPBA 3A3YB 1K04A 2IDBA 3MD0A 2Q1KA 1GL2A 1NTME 3CXHH 1PP9G 5BU8B 1ZR2A 1GU4A 1YJWP 2OTLP 1WT6A 2YKPA 3V2QA 2WTYA 1YITP 1GTWA 4OH8B 1LWUA 4W7YA 3H1IG 2NPSD 2OYOA 2H7HA 2P67A 2QJPC 3OJAB 3L70J 2FXPA 3CCSP 1SQQE 4IFMA 2Q6QA 5KAFH 3RGUA 1U7JA 3U59A 1VQLP 3HE5B 1H89A 3TGUG 1M8OB 3GHGB 2D2CC 2W6JH 3Q3DA 1KTMA 4YPCA 1MUUA 3W67A 1NTKJ 3KZIH 1N73C 3TNUB 1FJPA 3CCLP 4EYYQ 3AE4C 4IOIH 2KOGA 1L2PA 1M57D 3FXEA 3SWFA 1Y8AA 1HWTC 2YIUC 3JSVC 1E79H 2QM7A 1EDIA 1EZVI 1KQGB 3VYIA 4BWNA 1U7MA 4IL6H 2WPRA 1NU1J 2LKMA 3P8MC 4WB4A 1NTZK 2RN0A 1FZCC 1FS0E 2G3AA 2WT7A 2KSEA 2M0BA 3H1JG 1SQVG 1EZVG 1RE3C 5AVSB 4GOEA 5B5EH 4PD4I 1S5LE 3D6YA 2WSFH 1NKNA 1L0NE 3RL0B 1FZCA 1ZW0A 2CPSA 2YKOA 2O3JA 1KQFB 1PPJE 3IFMA 5AVXB 3CD6P 1PGQA 1OMIA 3CC2P 1IFNA 5AVUB 1SFCB 1L4AC 2XZRA 3GLMA 1GU5A 3CX5D 3E7KA 3V2RA 4BRYB 3H32B 3L70G 1RY3A 1M1KQ 3AEBC 2QG4A 4LC1A 2W6AA 2YMYA 1NTZE 1KILD 4QMAA 3Q1MA 3CC7P 1N8RQ 3L74D 2OYHB 1JO5A 1URQD 2FFDB 3H1LD 3I5CA 1G2CA 1JEKA 1KYOH 1NTKG 5H2FE 2HLOA 3D6ZA 1YJNP 1X9VA 1IFJA 1IK9A 3HD7B 2KS1B 1HTLC 1NU1G 2H89C 3KDPB 1HGZA 5AVVB 1DEBA 2I1KA 3L71J 4OVNF 3CXHE 2C9NY 1ZLLA 1JY3O 3HE4A 1CW5A 1JUNA 1RF1C 2ZXXA 3H1KJ 2OTJP 2NPSC 2WPQA 4EOTA 5APYA 1OWAA 2N9YB 3HTKB 3EFGA 1JOCA 2M5AA 1VQ5P 1MFTA 1IFDA 5KAFE 2E42A 1BGYJ 3RK3D 2NPSA 3H1HE 5CCGD 2AXTE 5KJ7D 3D70A 3RL0g 4H0LB 3KZIE 2K37A 3AE6C 3A2AA 1QVGO 4JPZB 1SQPD 4C7NA 3P8CD 3A0HE 2E74C 1BCCD 3A7OA 2GUVA 1JY3N 3L72J 1AFOA 3EFFK 2XDJA 1KQSO 2XNDH 3A5TA 2PFXA 1NTMD 3M9QA 1GW3A 3HUSB 2WZ7A 1LTJC 2OYIA 1EDKA 5CCHA 1Z56A 1JMMA 2QVAA 1JM0A 3G3ZA 3M9BA 3WMM0 3L71G 1FZAA 1H8AA 2FYUK 4GDOA 3AE1C 1GK6A 1VQKP 1T3UA 1SQQD 3H1KG 4H13B 3M9HA 3KPEA 3P7KA 3S4RA 2KP8A 1GZLA 1OFCX 1BDCA 3BCCE 2JWDA 3I55P 4ZNCA 2KUBA 2ZYAA 2BCCJ 1FU1A 1FE6A 1KILC 1SLQA 3PLNA 2Y0EA 4I6MC 3L74G 1BGYG 2QJPB 2Y0DA 1URQC 4HB1A 1VQ9P 1SQPJ 3V4QA 1SQBE 4L74A 4N78E 2Q7CA 1DD3A 1FDIA 1ZR4A 1KYOE 2KSJA 4YXWH 2KI7B 1LP1B 1KILA 1JTHA 1GW4A 5GTIH 2FYUE 3MIWA 1NTMJ 2D2CB 1URQA 1WRGA 3L4FA 3L72G 1N73B 1N7LA 2HODB 2PGDA 5L8RJ 1IC2A 1AQ5A 1L0ND 2BEZF 3GMAA 2N9BA 1PPJD 2YIUB 2QIWA 1LNQA 5CBNA 5K5GB 3CMAP 5AW7B 1S9KE 1SQPK 5TISH 2HPCA 3BRVB 3PH0A 2XU6A 1FZCB 1U57A 2O01H 2C0XA 2AEFA 4H44D 3R2PA 4PD4H 2K88A 1M90Q 2WSEJ 3VMXA 1KV4A 3O6QA 1NTZD 1NWQA 3WU2H 5APXA 1AVOA 3QWOC 4LLHA 2OTKE 1L4AB 2BCCG 2WPSA 3G71P 5CHXA 1USEA 4NPDA 1H0TA 1CI6A 1SQQK 3PHLA 3GG2A 4HYTB 1SQPG 4RKUJ 1GL2C 5CCGA 1HBWA 3RK2B 5KJ7A 4GOFA 5C39A 3B4SA 4PJ0H 1QX8A 3B5NB 2IBZE 3SWYA 1LGHB 1NTMG 1LWUC 3U1AA 3CXHD 5KLVE 1KQLA 1SQXK 3T97B 4WY4A 3D71A 3BRTB 2MKVA 2P58A 3PRJA 1VDFA 3FXDA 2IFNA 1R8EA 4DT0A 2R44A 4IFDK 2Y0CA 3MP7B 5AW8B 1CSBA 3UIAA 1HJ0A 1HUCA 2DW3A 3AEFC 2BEQD 3L37A 3VP9A 1FOSF 1PP9E 3CWBJ 1KB9E 1UIXA 1NTZJ 2V7QH 1Q7YQ 2KYVA 4L75A 3PTZA 2WSSH 1BE3E 3P32A 3H1HD 1HGVA 1L0NK 2JP3A 2MJZA 1T2KD 2H43A 1RF1B 2HR3A 1XTCC 1K73Q 3V2PA 2W27A 1KZUB 3CI9A 1KMIZ 2JEEA 1OXZA 3MUDC 1SQXE 3FX0A 2CK3H 2RMZA 4DJGA 2R5DA 1OVUA 2V4HA 4GT1A 2OQQA 3RBXA 5CCHD 2LR2A 4D6TJ 4C7NB 3AEGC 4ASVA 2XV5A 2ZT9D 5KLIC 1LTSC 1K05A 4UB8E 3MUDA 1NGMB 2B87B 5GTHE 3V2NA 1LT9A 3CCVP 2ZFCA 4IL6X 2L91A 2OGUA 2KNCA 2V7QJ 1PPJG 1YBKA 1SFCD 2E74B 4R4MA 1SQVE 1EZVE 2B9BA 5AW9B 5TISE 4I2LC 3F89A 1W2BO 4JYCA 1QL1A 4H44C 2Y9YA 4ZKUA 1EDJA 4L73A 4GIFA 4JYBA 1X0TA 3H1HJ 3BCCD 1LTJB 1NHLA 1H88A 4PD4E 3CWBG 1M7LA 1NTZG 3A0BH 2E76D 2YO2A 5AVTB 5AW2B 3S1KA 5APSA 3M91A 2K9YA 2XNXA 1SQBD 2Q3IA 4N78D 4B86A 1OW6A 3KXDA 2VRSA 1S3JA 1KYOD 2KB7P 3L70E 3M0DA 1KORA 4OWFA 2FXOA 5KAIH 3HD7D 4YXDC 2FYUD 2Q3EA 3NXSA 4XA4A 1QEXA 3BATA 3R4YA 2HG5D 2AEJA 3VMYA 1LT1A 1M1JA 1KILB 4XE5B 1GDTA 1YTZT 2E75D 4OGQB 1NTKE 1URQB 4D6TG 3CMEP 1P84E 5CJ4A 3KHUA 2N1TA 2XKMA 4AUWA 2JDIH 2POHA 3H25A 1S9KD 2QJYC 3I56P 1J2JB 1KFNA 2PRRA 1IJDB 2B88A 2WQYC 2M8RA 1OW7A 2E5YA 1WMKA 4R4LA 4UB6H 3BCCJ 3CPWO 2IPPA 1EXIA 3MHVA 2M3EA 5E79H 1FZBA 1N7SD 5M1BA 1RHZB 3IR9A 1RQVA 1ZRTE 4JF7A 1BSHA 3CCRP 3NMDA 3H1HG 3L74J 2B89A 1JMBA 1SQBJ 1Q90D 2FYNC 4I7ZC 1T2KC 4WBAA 3AE7C 3H1LJ 2K9JB 5AVWB 3HE5A 3GHGA 3OA7A 1L0LK 2BASA 4ZKPA 2FYUJ 3TNUA 3C8VA 1HH0A 3U1CA 2HYNA 3JCUH 1RH5B 1W5CE 2ZYDA 2UWJE 1Q81Q 5APVA 2IBZD 5AW5B 2OYIC 4WY4D 3EQ2A 2KZIA 5CCHC 4IL6E 2Z5IA 2ZT9C 3L75E 2GA1A 5KLVD 4O9BA 2YMKA 2P7JA 2Q5UA 2QRXA 3GF3A 1SQBK 5B5EE 2OARA 1QGKB 1GMJA 3G9RA 3IAOA 1GL2B 1FDMA 4H13D 4A7PA 2O01N 3CCJP 1PGJA 2WVRA 1DX7A 3CX5I 1PP9D 1T8ZA 1PV3A 1KB9D 1QLED 5B66H 1EQ7A 1L0LE 2QSIA 3L36A 1LTBC 1YHQP 1LWUB 3CC4P 4Y28J 3WUTA 2WWWA 2ZXEB 1JY2O 1BE3D 1J1EC 3BCCG 1SFCA 3LW5J 3Q5RA 2A45G 5KKZC 3L71E 1VQMP 1OVRA 4BRYA 3H32A 4N3YB 1X22A 2I1JA 3NTNA 2E76C 3TF5A 3B71A 3H1KE 1X8YA 1J1DC 1VF5D 1SQXD 1SQBG 4MN4C 4GKGA 1ZXGA 3H1LG 1JB0J 2WSEH 2OYHA 2D2CD 2FFDA 1N86A 1BCCJ 5APWA 3NFQA 3E1RA 4PV1D 2FYUG 4HH2A 2KLUA 1QVFO 1NO4A 1BGYE 1JCCA 4JBZA 1VQ7P 3USSA 4KJMA 3VMAA 2E5TA 2Z4EA 1HJBA 2E75C 4C7RA 2KIKA 1PIXA 1QL2A 4HJGH 2WT7B 3HD7A 1PGOA 1JY2N 1OVVA 3B8EB 2KS1A 2H88C 3G4SP 1VQ4P 3AEDC 2NRGA 3IF4A 2W6BA 4XFJA 2QJKC
chains in the Genus database with same CATH topology
5DJTB 1BDCA 5EFWB 2JWDA 2KZJA 4ASWA 1EDJA 4ZNCA 1X0TA 4WWIA 2RKLA 1EC5A 4EYYQ 4GODA 3MHVA 5DJUB 2KUBA 4IOIH 1SS1A 2B87A 3FXEA 5CBOA 2WMMA 4ZMDA 4NPEA 3QWOC 2LXCB 1EDIA 2HR3A 4HB1A 1DEEG 1U7MA 2OTKE 1BDDA 2B89A 3S1KA 1JMBA 1OVRA 1Q2NA 4NPDA 4BXLA 1H0TA 2KI7B 4K3AA 2M0BA 1LP1B 1Y47A 1S3JA 3ZDMA 2Q1KA 2I8DA 4GOEA 2KS1B 1OVUA 4MN4C 2M5AB 4GOFA 5C39A 1NVOA 1ZXGA 2LR2A 4K35A 1ZW0A 4ASVA 4NPFX 2UWJE 1LT1A 4CPGA 2B87B 1EDKA 2KZIA 2QVAA 1JM0A 4HKZH 5CBNA 4JBZA 2LXBA 5K5GB 4KJMA 2SPZA 2ZAEB 2P58A 3PH0A 1EDLA 2QRXA 3FXDA 1LP1A 2KIKA 3RGUA 1H0TB 1U7JA 2R44A 4HJGH 2K3RA 3MZWB 1OVVA 2B88A 1FC2C 2M5AA 1MFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DJT B;  1BDC A;  5EFW B;  2JWD A;  2KZJ A;  4ASW A;  1EDJ A;  4ZNC A;  1X0T A;  4WWI A;  2RKL A;  1EC5 A;  4EYY Q;  4GOD A;  3MHV A;  5DJU B;  2KUB A;  4IOI H;  1SS1 A;  2B87 A;  3FXE A;  5CBO A;  2WMM A;  4ZMD A;  4NPE A;  3QWO C;  2LXC B;  1EDI A;  2HR3 A;  4HB1 A;  1DEE G;  1U7M A;  2OTK E;  1BDD A;  2B89 A;  3S1K A;  1JMB A;  1OVR A;  1Q2N A;  4NPD A;  4BXL A;  1H0T A;  2KI7 B;  4K3A A;  2M0B A;  1LP1 B;  1Y47 A;  1S3J A;  3ZDM A;  2Q1K A;  2I8D A;  4GOE A;  2KS1 B;  1OVU A;  4MN4 C;  2M5A B;  4GOF A;  5C39 A;  1NVO A;  1ZXG A;  2LR2 A;  4K35 A;  1ZW0 A;  4ASV A;  4NPF X;  2UWJ E;  1LT1 A;  4CPG A;  2B87 B;  1EDK A;  2KZI A;  2QVA A;  1JM0 A;  4HKZ H;  5CBN A;  4JBZ A;  2LXB A;  5K5G B;  4KJM A;  2SPZ A;  2ZAE B;  2P58 A;  3PH0 A;  1EDL A;  2QRX A;  3FXD A;  1LP1 A;  2KIK A;  3RGU A;  1H0T B;  1U7J A;  2R44 A;  4HJG H;  2K3R A;  3MZW B;  1OVV A;  2B88 A;  1FC2 C;  2M5A A;  1MFT A; 
#chains in the Genus database with same CATH topology
 2RH0 A;  3V6I A;  1SQV D;  1JY2 P;  2W83 C;  1EZV D;  1S5L H;  2FY8 A;  4ASW A;  1SQQ J;  3LIE A;  1KFM A;  3H6P A;  2GUS A;  3L72 E;  3AEE C;  2IFM A;  5KLI B;  2P2U A;  3N4X A;  1BE3 J;  4KT0 J;  2W8Z A;  4ZMD A;  1IO4 A;  4PD4 D;  1N7S C;  5E79 E;  5KLV K;  2A06 E;  3QH9 A;  1USD A;  1OZH A;  3CCE P;  2R3S A;  4DCK A;  2O1K A;  1AJY A;  3V4W A;  3HTK A;  3ZDM A;  1VPC A;  3RK3 C;  1BSN A;  1SQX J;  1K9M Q;  5CCG C;  5KJ7 C;  1RQU A;  3L70 D;  1NVO A;  1N7S A;  3RK2 D;  4H44 B;  4JQ0 D;  4U3F E;  2IZ1 A;  1N2D C;  4KHX A;  1YIJ P;  4Y99 C;  1G2C B;  3B5N D;  2N1T D;  4RO0 A;  1G1J A;  3JCU E;  2KXP B;  2IYP A;  1BCC G;  2IBZ G;  1NTK D;  1FOS E;  4WY4 C;  1Q82 Q;  1XTG B;  2BCC E;  2YKQ A;  1P84 D;  1L0N J;  3AEA C;  1YQ3 C;  1OW8 A;  2ITA A;  3KYQ A;  3HUS A;  2KZJ A;  1AVY A;  5CJ0 A;  2Q9I A;  5AVY B;  2RKL A;  2WSC J;  2YO3 A;  3L73 E;  4H13 C;  3KQG A;  1MFZ A;  3HE4 B;  4EIJ A;  2W90 A;  3G6E P;  1SQQ G;  1T3J A;  4M3L A;  1ZV8 A;  4IFF A;  1ZRT D;  1UII A;  5B66 E;  1BE3 G;  5AVQ B;  3VOP A;  3FGA D;  2R5B A;  1X79 B;  1Y47 A;  2QJY B;  3H1I E;  3ABV C;  2M5A B;  1SQV K;  3OAK A;  1IFI A;  1NAY A;  1PGP A;  2NPS B;  1VF5 C;  1SQX G;  3S9O A;  2AXT H;  2YNY A;  1FBM A;  5AW6 B;  1LT9 C;  3SSU A;  3CCM P;  1ZME C;  3TGU E;  2LXB A;  3GF7 A;  4PV1 C;  3L75 D;  2FYN B;  4I7Z B;  1LP1 A;  1VQP P;  1ZOY C;  2YXR B;  5GTI E;  1NH4 A;  3C1L A;  3RL0 D;  2JO1 A;  3A0H H;  1FC2 C;  2E74 D;  3BVH A;  3WUV A;  3AE8 C;  5DJT B;  4C46 A;  1K8A Q;  3PP5 A;  1FZG A;  1N73 A;  1L0N G;  2HOD A;  1W2E A;  1YJ9 P;  1RE4 C;  3CCQ P;  5AW3 B;  1T6A A;  1KC8 Q;  3H1J E;  1L0L D;  2OYI B;  4EI2 A;  3PJS K;  2Z5H A;  2ZT9 B;  3K5B A;  1NJI Q;  1RE4 A;  1NTK K;  2QEX P;  4BXL A;  3MGN A;  2K1A A;  3L71 D;  2GM4 A;  1RE3 A;  4W7Z A;  2I8D A;  1IFP A;  3M0D C;  3F5H A;  3H1K D;  1A02 J;  3BAS A;  3WU2 E;  3CX5 H;  1NU1 K;  5AVZ B;  4WVZ A;  3WUU A;  2A45 H;  1M1J C;  1PZQ A;  3RK2 C;  4N6J A;  1DD4 A;  3CWB E;  3C9I A;  1J1E B;  1L4A A;  5APU A;  3L75 J;  4DOJ A;  1P84 I;  5KKZ B;  4L76 A;  1BGY D;  3B5N C;  4OGQ D;  2N1T C;  1R5S A;  2ZAE B;  5APT A;  1KD1 Q;  3II6 A;  1JCD A;  2E76 B;  2KLV A;  2FXM A;  3CXH I;  2J58 A;  1MV8 A;  3OW2 O;  2PP6 A;  1S1C X;  3SFD C;  1JTH B;  1J1D B;  1Y9B A;  1Q86 Q;  4PJ0 E;  2R32 A;  2WSF J;  3L35 A;  4AQR D;  3W68 A;  3B5N A;  5AW4 B;  3TYY A;  4WWI A;  3AE5 C;  1EC5 A;  1VQN P;  4TLF A;  1CZQ A;  2IX7 C;  1GD2 E;  1IFM A;  1SS1 A;  3E1I A;  2ZVO B;  3AE9 C;  1L0L J;  3L72 D;  2Y9Z A;  2C9L Y;  5BU5 A;  3T97 A;  1MKM A;  1NU1 E;  1AA0 A;  4D6T E;  1Q2N A;  2E75 B;  2HPC B;  2A06 D;  4K3A A;  5AW0 B;  3GHG C;  1G1I A;  3AEC C;  3AE3 C;  1LTT C;  3V5B A;  2AXC A;  4W80 A;  2QJK B;  1GK4 A;  4H0L D;  1YTZ I;  1ZN5 A;  2FKW B;  1VL2 A;  4K35 A;  3O6Q B;  2O1J A;  3M0A A;  4U3F D;  1VQ8 P;  2FBW C;  1RF1 A;  1OIP A;  4DZO A;  2AEM A;  1VQO P;  1FJK A;  1FAV A;  1HVV A;  2JWA A;  3VN0 A;  1N7S B;  3LW5 H;  2WPV B;  2ZVN B;  1EXJ A;  1PFI A;  2IZ0 A;  1JNM A;  1S72 P;  1EDL A;  2QE7 H;  1IZN B;  1LTI C;  1H0T B;  1CI6 B;  2BCC D;  5AVR B;  4I1L A;  3RK3 B;  3L75 G;  3N7N A;  1SVF A;  4LGD E;  1YI2 P;  1DH3 A;  4YTP C;  2H8P D;  2QA4 P;  1GL2 D;  3RL0 C;  1ZP0 C;  2B87 A;  5CBO A;  4Y99 B;  2J59 M;  3L73 D;  5KTB A;  4NPE A;  1JY3 P;  1DEE G;  3VTP C;  1SFC C;  3HRN A;  3CLQ A;  1HF9 A;  1L0L G;  4WY4 B;  2E43 A;  3LID A;  2A45 I;  2YXQ B;  1LTA C;  2JR8 A;  1DIP A;  1A02 F;  2R3C A;  1NOH A;  3H1I D;  2OYH C;  1FDO A;  1KB9 H;  1LTJ A;  2ZYG A;  2FFD C;  4NPF X;  3TSI A;  2NZ2 A;  4U3F J;  1KYO I;  3A0B E;  1VQ6 P;  1AV1 A;  5CMZ A;  2IYO A;  3ITK A;  4HKZ H;  3IN6 A;  3CX5 E;  4Z1M H;  1LTG C;  1SP4 A;  3FWL A;  2L5G B;  4RES B;  1YQ4 C;  3TGU D;  3O8Z A;  5APQ A;  2K3R A;  3SFE C;  3HD7 C;  2P1J A;  3TK1 A;  5KAI E;  4OGQ C;  1KIL E;  3L74 E;  5KLV J;  3FWN A;  5BVZ A;  2ZJS E;  3M06 A;  5EFW B;  3H1L E;  3TDK A;  3VP8 A;  2FYZ A;  1PL5 A;  4GOD A;  3CL3 D;  1VF5 B;  4RJT A;  1FZF A;  2KK7 A;  2QM8 A;  3L73 J;  5AW1 B;  1TU3 F;  1LJ2 A;  4UB8 H;  1LT9 B;  5GTH H;  3H1J D;  1FZE A;  2PAJ A;  2G8Y A;  1PP9 J;  2KNC B;  4PV1 B;  3AE2 C;  3VMZ A;  2P10 A;  3MTU E;  4UB6 E;  3EWK A;  2A06 G;  3H1I J;  2M3B A;  1S5L X;  1YYC A;  1AQT A;  2HFE D;  1S4X A;  4CPG A;  1OX3 A;  1L4A D;  2WSC H;  4H0L C;  1KN7 A;  3GW6 A;  1NTM K;  3CCU P;  4TT3 H;  3CWB D;  1RF0 C;  2SPZ A;  4U3F G;  3TGU J;  2J5U A;  1E5W A;  3Q5P A;  1S2E A;  2K9J A;  3JC2 2;  2IBZ I;  4U7J A;  4EDF A;  3MZW B;  1NAF A;  1NYH A;  3RK3 E;  1NKZ B;  2C0W A;  1RF0 A;  3Q2Y A;  3HUS C;  3RBZ A;  1IK7 A;  5H2F H;  1MZ9 A;  3SWK A;  5DJU B;  5TJH A;  5KLV G;  1M1J B;  2WMM A;  2WIT A;  2LXC B;  3H1J J;  1SQP E;  1SQV J;  1R5L A;  3P8C E;  4AYC A;  3Q5S A;  1BCC E;  1BDD A;  1M56 D;  1KB9 I;  3L73 G;  2O01 J;  2N1T B;  1D7M A;  1P84 H;  2JKV A;  1NU1 D;  2JJL A;  4D6T D;  2CPB A;  3A3Y B;  1K04 A;  2IDB A;  3MD0 A;  2Q1K A;  1GL2 A;  1NTM E;  3CXH H;  1PP9 G;  5BU8 B;  1ZR2 A;  1GU4 A;  1YJW P;  2OTL P;  1WT6 A;  2YKP A;  3V2Q A;  2WTY A;  1YIT P;  1GTW A;  4OH8 B;  1LWU A;  4W7Y A;  3H1I G;  2NPS D;  2OYO A;  2H7H A;  2P67 A;  2QJP C;  3OJA B;  3L70 J;  2FXP A;  3CCS P;  1SQQ E;  4IFM A;  2Q6Q A;  5KAF H;  3RGU A;  1U7J A;  3U59 A;  1VQL P;  3HE5 B;  1H89 A;  3TGU G;  1M8O B;  3GHG B;  2D2C C;  2W6J H;  3Q3D A;  1KTM A;  4YPC A;  1MUU A;  3W67 A;  1NTK J;  3KZI H;  1N73 C;  3TNU B;  1FJP A;  3CCL P;  4EYY Q;  3AE4 C;  4IOI H;  2KOG A;  1L2P A;  1M57 D;  3FXE A;  3SWF A;  1Y8A A;  1HWT C;  2YIU C;  3JSV C;  1E79 H;  2QM7 A;  1EDI A;  1EZV I;  1KQG B;  3VYI A;  4BWN A;  1U7M A;  4IL6 H;  2WPR A;  1NU1 J;  2LKM A;  3P8M C;  4WB4 A;  1NTZ K;  2RN0 A;  1FZC C;  1FS0 E;  2G3A A;  2WT7 A;  2KSE A;  2M0B A;  3H1J G;  1SQV G;  1EZV G;  1RE3 C;  5AVS B;  4GOE A;  5B5E H;  4PD4 I;  1S5L E;  3D6Y A;  2WSF H;  1NKN A;  1L0N E;  3RL0 B;  1FZC A;  1ZW0 A;  2CPS A;  2YKO A;  2O3J A;  1KQF B;  1PPJ E;  3IFM A;  5AVX B;  3CD6 P;  1PGQ A;  1OMI A;  3CC2 P;  1IFN A;  5AVU B;  1SFC B;  1L4A C;  2XZR A;  3GLM A;  1GU5 A;  3CX5 D;  3E7K A;  3V2R A;  4BRY B;  3H32 B;  3L70 G;  1RY3 A;  1M1K Q;  3AEB C;  2QG4 A;  4LC1 A;  2W6A A;  2YMY A;  1NTZ E;  1KIL D;  4QMA A;  3Q1M A;  3CC7 P;  1N8R Q;  3L74 D;  2OYH B;  1JO5 A;  1URQ D;  2FFD B;  3H1L D;  3I5C A;  1G2C A;  1JEK A;  1KYO H;  1NTK G;  5H2F E;  2HLO A;  3D6Z A;  1YJN P;  1X9V A;  1IFJ A;  1IK9 A;  3HD7 B;  2KS1 B;  1HTL C;  1NU1 G;  2H89 C;  3KDP B;  1HGZ A;  5AVV B;  1DEB A;  2I1K A;  3L71 J;  4OVN F;  3CXH E;  2C9N Y;  1ZLL A;  1JY3 O;  3HE4 A;  1CW5 A;  1JUN A;  1RF1 C;  2ZXX A;  3H1K J;  2OTJ P;  2NPS C;  2WPQ A;  4EOT A;  5APY A;  1OWA A;  2N9Y B;  3HTK B;  3EFG A;  1JOC A;  2M5A A;  1VQ5 P;  1MFT A;  1IFD A;  5KAF E;  2E42 A;  1BGY J;  3RK3 D;  2NPS A;  3H1H E;  5CCG D;  2AXT E;  5KJ7 D;  3D70 A;  3RL0 g;  4H0L B;  3KZI E;  2K37 A;  3AE6 C;  3A2A A;  1QVG O;  4JPZ B;  1SQP D;  4C7N A;  3P8C D;  3A0H E;  2E74 C;  1BCC D;  3A7O A;  2GUV A;  1JY3 N;  3L72 J;  1AFO A;  3EFF K;  2XDJ A;  1KQS O;  2XND H;  3A5T A;  2PFX A;  1NTM D;  3M9Q A;  1GW3 A;  3HUS B;  2WZ7 A;  1LTJ C;  2OYI A;  1EDK A;  5CCH A;  1Z56 A;  1JMM A;  2QVA A;  1JM0 A;  3G3Z A;  3M9B A;  3WMM 0;  3L71 G;  1FZA A;  1H8A A;  2FYU K;  4GDO A;  3AE1 C;  1GK6 A;  1VQK P;  1T3U A;  1SQQ D;  3H1K G;  4H13 B;  3M9H A;  3KPE A;  3P7K A;  3S4R A;  2KP8 A;  1GZL A;  1OFC X;  1BDC A;  3BCC E;  2JWD A;  3I55 P;  4ZNC A;  2KUB A;  2ZYA A;  2BCC J;  1FU1 A;  1FE6 A;  1KIL C;  1SLQ A;  3PLN A;  2Y0E A;  4I6M C;  3L74 G;  1BGY G;  2QJP B;  2Y0D A;  1URQ C;  4HB1 A;  1VQ9 P;  1SQP J;  3V4Q A;  1SQB E;  4L74 A;  4N78 E;  2Q7C A;  1DD3 A;  1FDI A;  1ZR4 A;  1KYO E;  2KSJ A;  4YXW H;  2KI7 B;  1LP1 B;  1KIL A;  1JTH A;  1GW4 A;  5GTI H;  2FYU E;  3MIW A;  1NTM J;  2D2C B;  1URQ A;  1WRG A;  3L4F A;  3L72 G;  1N73 B;  1N7L A;  2HOD B;  2PGD A;  5L8R J;  1IC2 A;  1AQ5 A;  1L0N D;  2BEZ F;  3GMA A;  2N9B A;  1PPJ D;  2YIU B;  2QIW A;  1LNQ A;  5CBN A;  5K5G B;  3CMA P;  5AW7 B;  1S9K E;  1SQP K;  5TIS H;  2HPC A;  3BRV B;  3PH0 A;  2XU6 A;  1FZC B;  1U57 A;  2O01 H;  2C0X A;  2AEF A;  4H44 D;  3R2P A;  4PD4 H;  2K88 A;  1M90 Q;  2WSE J;  3VMX A;  1KV4 A;  3O6Q A;  1NTZ D;  1NWQ A;  3WU2 H;  5APX A;  1AVO A;  3QWO C;  4LLH A;  2OTK E;  1L4A B;  2BCC G;  2WPS A;  3G71 P;  5CHX A;  1USE A;  4NPD A;  1H0T A;  1CI6 A;  1SQQ K;  3PHL A;  3GG2 A;  4HYT B;  1SQP G;  4RKU J;  1GL2 C;  5CCG A;  1HBW A;  3RK2 B;  5KJ7 A;  4GOF A;  5C39 A;  3B4S A;  4PJ0 H;  1QX8 A;  3B5N B;  2IBZ E;  3SWY A;  1LGH B;  1NTM G;  1LWU C;  3U1A A;  3CXH D;  5KLV E;  1KQL A;  1SQX K;  3T97 B;  4WY4 A;  3D71 A;  3BRT B;  2MKV A;  2P58 A;  3PRJ A;  1VDF A;  3FXD A;  2IFN A;  1R8E A;  4DT0 A;  2R44 A;  4IFD K;  2Y0C A;  3MP7 B;  5AW8 B;  1CSB A;  3UIA A;  1HJ0 A;  1HUC A;  2DW3 A;  3AEF C;  2BEQ D;  3L37 A;  3VP9 A;  1FOS F;  1PP9 E;  3CWB J;  1KB9 E;  1UIX A;  1NTZ J;  2V7Q H;  1Q7Y Q;  2KYV A;  4L75 A;  3PTZ A;  2WSS H;  1BE3 E;  3P32 A;  3H1H D;  1HGV A;  1L0N K;  2JP3 A;  2MJZ A;  1T2K D;  2H43 A;  1RF1 B;  2HR3 A;  1XTC C;  1K73 Q;  3V2P A;  2W27 A;  1KZU B;  3CI9 A;  1KMI Z;  2JEE A;  1OXZ A;  3MUD C;  1SQX E;  3FX0 A;  2CK3 H;  2RMZ A;  4DJG A;  2R5D A;  1OVU A;  2V4H A;  4GT1 A;  2OQQ A;  3RBX A;  5CCH D;  2LR2 A;  4D6T J;  4C7N B;  3AEG C;  4ASV A;  2XV5 A;  2ZT9 D;  5KLI C;  1LTS C;  1K05 A;  4UB8 E;  3MUD A;  1NGM B;  2B87 B;  5GTH E;  3V2N A;  1LT9 A;  3CCV P;  2ZFC A;  4IL6 X;  2L91 A;  2OGU A;  2KNC A;  2V7Q J;  1PPJ G;  1YBK A;  1SFC D;  2E74 B;  4R4M A;  1SQV E;  1EZV E;  2B9B A;  5AW9 B;  5TIS E;  4I2L C;  3F89 A;  1W2B O;  4JYC A;  1QL1 A;  4H44 C;  2Y9Y A;  4ZKU A;  1EDJ A;  4L73 A;  4GIF A;  4JYB A;  1X0T A;  3H1H J;  3BCC D;  1LTJ B;  1NHL A;  1H88 A;  4PD4 E;  3CWB G;  1M7L A;  1NTZ G;  3A0B H;  2E76 D;  2YO2 A;  5AVT B;  5AW2 B;  3S1K A;  5APS A;  3M91 A;  2K9Y A;  2XNX A;  1SQB D;  2Q3I A;  4N78 D;  4B86 A;  1OW6 A;  3KXD A;  2VRS A;  1S3J A;  1KYO D;  2KB7 P;  3L70 E;  3M0D A;  1KOR A;  4OWF A;  2FXO A;  5KAI H;  3HD7 D;  4YXD C;  2FYU D;  2Q3E A;  3NXS A;  4XA4 A;  1QEX A;  3BAT A;  3R4Y A;  2HG5 D;  2AEJ A;  3VMY A;  1LT1 A;  1M1J A;  1KIL B;  4XE5 B;  1GDT A;  1YTZ T;  2E75 D;  4OGQ B;  1NTK E;  1URQ B;  4D6T G;  3CME P;  1P84 E;  5CJ4 A;  3KHU A;  2N1T A;  2XKM A;  4AUW A;  2JDI H;  2POH A;  3H25 A;  1S9K D;  2QJY C;  3I56 P;  1J2J B;  1KFN A;  2PRR A;  1IJD B;  2B88 A;  2WQY C;  2M8R A;  1OW7 A;  2E5Y A;  1WMK A;  4R4L A;  4UB6 H;  3BCC J;  3CPW O;  2IPP A;  1EXI A;  3MHV A;  2M3E A;  5E79 H;  1FZB A;  1N7S D;  5M1B A;  1RHZ B;  3IR9 A;  1RQV A;  1ZRT E;  4JF7 A;  1BSH A;  3CCR P;  3NMD A;  3H1H G;  3L74 J;  2B89 A;  1JMB A;  1SQB J;  1Q90 D;  2FYN C;  4I7Z C;  1T2K C;  4WBA A;  3AE7 C;  3H1L J;  2K9J B;  5AVW B;  3HE5 A;  3GHG A;  3OA7 A;  1L0L K;  2BAS A;  4ZKP A;  2FYU J;  3TNU A;  3C8V A;  1HH0 A;  3U1C A;  2HYN A;  3JCU H;  1RH5 B;  1W5C E;  2ZYD A;  2UWJ E;  1Q81 Q;  5APV A;  2IBZ D;  5AW5 B;  2OYI C;  4WY4 D;  3EQ2 A;  2KZI A;  5CCH C;  4IL6 E;  2Z5I A;  2ZT9 C;  3L75 E;  2GA1 A;  5KLV D;  4O9B A;  2YMK A;  2P7J A;  2Q5U A;  2QRX A;  3GF3 A;  1SQB K;  5B5E E;  2OAR A;  1QGK B;  1GMJ A;  3G9R A;  3IAO A;  1GL2 B;  1FDM A;  4H13 D;  4A7P A;  2O01 N;  3CCJ P;  1PGJ A;  2WVR A;  1DX7 A;  3CX5 I;  1PP9 D;  1T8Z A;  1PV3 A;  1KB9 D;  1QLE D;  5B66 H;  1EQ7 A;  1L0L E;  2QSI A;  3L36 A;  1LTB C;  1YHQ P;  1LWU B;  3CC4 P;  4Y28 J;  3WUT A;  2WWW A;  2ZXE B;  1JY2 O;  1BE3 D;  1J1E C;  3BCC G;  1SFC A;  3LW5 J;  3Q5R A;  2A45 G;  5KKZ C;  3L71 E;  1VQM P;  1OVR A;  4BRY A;  3H32 A;  4N3Y B;  1X22 A;  2I1J A;  3NTN A;  2E76 C;  3TF5 A;  3B71 A;  3H1K E;  1X8Y A;  1J1D C;  1VF5 D;  1SQX D;  1SQB G;  4MN4 C;  4GKG A;  1ZXG A;  3H1L G;  1JB0 J;  2WSE H;  2OYH A;  2D2C D;  2FFD A;  1N86 A;  1BCC J;  5APW A;  3NFQ A;  3E1R A;  4PV1 D;  2FYU G;  4HH2 A;  2KLU A;  1QVF O;  1NO4 A;  1BGY E;  1JCC A;  4JBZ A;  1VQ7 P;  3USS A;  4KJM A;  3VMA A;  2E5T A;  2Z4E A;  1HJB A;  2E75 C;  4C7R A;  2KIK A;  1PIX A;  1QL2 A;  4HJG H;  2WT7 B;  3HD7 A;  1PGO A;  1JY2 N;  1OVV A;  3B8E B;  2KS1 A;  2H88 C;  3G4S P;  1VQ4 P;  3AED C;  2NRG A;  3IF4 A;  2W6B A;  4XFJ A;  2QJK C; 
#chains in the Genus database with same CATH homology
 5DJT B;  1BDC A;  5EFW B;  2JWD A;  2KZJ A;  4ASW A;  1EDJ A;  4ZNC A;  1X0T A;  4WWI A;  2RKL A;  1EC5 A;  4EYY Q;  4GOD A;  3MHV A;  5DJU B;  2KUB A;  4IOI H;  1SS1 A;  2B87 A;  3FXE A;  5CBO A;  2WMM A;  4ZMD A;  4NPE A;  3QWO C;  2LXC B;  1EDI A;  2HR3 A;  4HB1 A;  1DEE G;  1U7M A;  2OTK E;  1BDD A;  2B89 A;  3S1K A;  1JMB A;  1OVR A;  1Q2N A;  4NPD A;  4BXL A;  1H0T A;  2KI7 B;  4K3A A;  2M0B A;  1LP1 B;  1Y47 A;  1S3J A;  3ZDM A;  2Q1K A;  2I8D A;  4GOE A;  2KS1 B;  1OVU A;  4MN4 C;  2M5A B;  4GOF A;  5C39 A;  1NVO A;  1ZXG A;  2LR2 A;  4K35 A;  1ZW0 A;  4ASV A;  4NPF X;  2UWJ E;  1LT1 A;  4CPG A;  2B87 B;  1EDK A;  2KZI A;  2QVA A;  1JM0 A;  4HKZ H;  5CBN A;  4JBZ A;  2LXB A;  5K5G B;  4KJM A;  2SPZ A;  2ZAE B;  2P58 A;  3PH0 A;  1EDL A;  2QRX A;  3FXD A;  1LP1 A;  2KIK A;  3RGU A;  1H0T B;  1U7J A;  2R44 A;  4HJG H;  2K3R A;  3MZW B;  1OVV A;  2B88 A;  1FC2 C;  2M5A A;  1MFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...