1S5LH

Architecture of the photosynthetic oxygen evolving center
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
53
structure length
53
Chain Sequence
LNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Architecture of the Photosynthetic Oxygen-Evolving Center
pubmed doi rcsb
molecule tags Photosynthesis
total genus 9
structure length 53
sequence length 53
chains with identical sequence h
ec nomenclature
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 1s5lH00
4UB6H 2AXTH 5B66H 3KZIH 5B5EH 5H2FH 3A0BH 3A0HH 5GTIH 4PJ0H 4IL6H 1S5LH 5GTHH 5KAFH 3WU2H 3JCUH 5KAIH 5E79H 5TISH 4UB8H
chains in the Genus database with same CATH superfamily
1K8AQ 2B87A 1BGYG 1ZR4A 3KZIE 2O01N 3CL3D 4YPCA 3A0HE 3VMZA 3KPEA 4DT0A 5AVTB 4GT1A 1ZW0A 1RF0C 2OQQA 3H1IJ 2AEJA 3CC2P 1BGYE 1VF5D 3E1RA 3O8ZA 1PP9G 1VL2A 5APSA 1NU1G 1NOHA 1OWAA 3A2AA 2LXCB 1N8RQ 3TGUJ 2M0BA 1NYHA 3U59A 2WTYA 3H1KE 4UB6E 3Q5RA 5KTBA 4EIJA 1ZV8A 1T6AA 4HKZH 2GUSA 5KLVJ 4TT3H 1L4AC 4C46A 2LXBA 2Y0CA 2C9NY 2A45G 1NU1E 3GMAA 4LC1A 1LT1A 1JM0A 1ZP0C 3R4YA 1PV3A 3HRNA 1S4XA 2ZXXA 4EOTA 3H1HG 1SQBK 1EDJA 3H1LJ 4O9BA 4OGQC 1IFJA 1BE3J 3AE4C 3L74J 1FZBA 2QG4A 1YBKA 3H1HE 3PH0A 2W8ZA 1VQKP 3GG2A 3CD6P 3V2RA 1LP1B 2A45I 1H0TA 1VQLP 5APQA 1H8AA 2Y0DA 2WT7A 4I6MC 1T8ZA 3CCRP 3CCJP 2KXPB 3TK1A 3VOPA 4NPFX 4JPZB 1URQC 3FXEA 2HPCA 1HUCA 4IFDK 3L70E 5CJ0A 1BCCJ 3CCMP 3GHGC 2WPSA 4GDOA 1SQPJ 3AE3C 3NXSA 2AXTH 3BVHA 2Y9YA 2I8DA 2JWDA 4YTPC 1JTHA 1GL2B 1LTSC 4IFFA 3I55P 1KQGB 2MKVA 2QRXA 2KP8A 1JUNA 2WSCJ 2KI7B 2O01J 1T2KC 1BSNA 2KNCB 4DZOA 1NTKJ 4PV1B 3RL0C 2ZYGA 2BEQD 1YYCA 2OYHC 3A5TA 3G6EP 2FYNB 4D6TG 3CWBJ 2YKQA 1EZVG 4PJ0H 1L0LJ 2XKMA 1RE4A 1GL2D 1VDFA 1BGYD 5APXA 3B5NB 2ZAEB 2WVRA 1KORA 5B66E 3IR9A 4I7ZB 3H1IE 1NKNA 3G9RA 4AUWA 4D6TE 3HE4A 3L73G 1IFMA 2J58A 5KLVG 1G1JA 2IYOA 1DEBA 1WMKA 1NO4A 1PP9D 4I1LA 4IFMA 2Q9IA 2E76C 2JP3A 3TGUE 3RK3B 1YJWP 2OYIA 2K37A 2P58A 1NU1D 2KNCA 3B5ND 3TNUB 1OIPA 3II6A 2PRRA 1AJYA 2UWJE 5KLVE 3VMYA 1SQVJ 1FJKA 2RKLA 1FZCA 2ITAA 3EFFK 1H88A 4QMAA 2M5AA 1HGVA 2H89C 2QVAA 1QVGO 1KILE 3RK3D 2FYUJ 2XNXA 1FBMA 3H1LE 2K88A 1E79H 1PIXA 3T97B 2M8RA 1KYOI 3N7NA 1P84H 3GLMA 1LTBC 5AVWB 2J59M 3WUUA 3M0AA 4U3FJ 4TLFA 2W6BA 1RF0A 2H7HA 2P2UA 3GW6A 1VF5C 1YJ9P 1SFCB 1PPJG 2W27A 1VQ5P 2LR2A 1EXIA 2ZT9B 4CPGA 1FOSE 3CI9A 3M9HA 3AE1C 2QM7A 1AQTA 3PTZA 1BCCE 1SQXJ 5C39A 1PPJE 1IC2A 3T97A 1X22A 1SQPE 2ZXEB 1PGQA 4OVNF 1D7MA 3PRJA 3JCUE 1SFCD 2KLUA 3HUSB 1VQ4P 3S9OA 2ZT9D 2L91A 3KZIH 1MKMA 2V4HA 4AQRD 2W6JH 1W5CE 3FWLA 1FZGA 5EFWB 1R8EA 3CCUP 3CX5I 3CWBE 3O6QB 3SFEC 3A7OA 1JY3P 3L71G 3PP5A 1GD2E 1L0LE 4D6TD 4RESB 1EZVD 5CBOA 1OZHA 3MP7B 5AW8B 2K9YA 1KILB 2HODB 1QEXA 1NU1K 4ZNCA 1NH4A 1U7JA 5TISH 3TF5A 3AEDC 1M56D 3AE6C 2YMKA 1IZNB 4HYTB 2KK7A 2XDJA 3S1KA 3HD7B 1SQQG 1R5SA 3L73D 3CCVP 4Y28J 5KLVD 5AVYB 3L75J 3LW5H 1JCCA 2J5UA 2QJPB 3P8CD 5APYA 5APWA 5KAIE 1Q90D 1KYOD 1FZAA 4NPEA 1KILD 1SQVE 1GDTA 1SQQE 3M9BA 3P7KA 2G8YA 2B89A 2A45H 3OW2O 5AW3B 1XTGB 4H0LB 3EFGA 5AW9B 2IZ0A 2OARA 3BRVB 2R3SA 2WMMA 3I56P 3H32A 2XZRA 4BRYB 1IJDB 4N6JA 2HODA 2OYHA 1L0NJ 4RJTA 4LGDE 1HH0A 1BDCA 2W90A 3H1JJ 1J1DB 1JCDA 4H13B 3HD7A 3D70A 4N78D 1GL2C 3BCCG 2NZ2A 3KYQA 4H0LD 2WSEH 2R44A 2FFDB 1K04A 3V4WA 4PV1C 5KAFE 5KJ7A 2FYNC 3BCCE 3M91A 3L4FA 3CLQA 4H13D 1PPJD 1T3UA 1M1JB 3L72J 3B5NC 5CCGA 4BRYA 1SQXE 4L75A 2Z5HA 1S5LH 4I7ZC 1NTMJ 3CX5D 1YQ3C 1FOSF 4DJGA 4C7NB 1AV1A 1K9MQ 2Q7CA 2DW3A 3F5HA 2VRSA 3RK3C 1GK4A 1KZUB 2KS1B 2JWAA 1MFZA 5E79E 3WUVA 2FFDA 3UIAA 1KB9E 1OW8A 1OMIA 3H1KG 1RQVA 2MJZA 3QWOC 4L73A 1IFNA 1N7SB 4W7ZA 1LJ2A 3HE5B 1NAFA 2KIKA 1U57A 1M1JA 2K1AA 1IK9A 1NTZJ 3L71D 3AE8C 3V6IA 3MUDA 2KOGA 4WY4B 1UIXA 5KLVK 3L75G 2JO1A 1Q81Q 4PD4H 1FDIA 4HJGH 2K9JA 5DJTB 2YNYA 4C7NA 2PP6A 1N7SD 1WT6A 2ZYAA 2Z4EA 3D6YA 2QJYB 3MHVA 2FBWC 3AEFC 3L75E 4BWNA 1SQQD 5CCHD 1KYOH 1UIIA 1N2DC 4WY4D 3KQGA 2HG5D 2WSFH 1OVRA 1HBWA 5GTHH 1SFCC 2QEXP 3HE5A 3V2PA 2WSFJ 3EQ2A 4JYBA 1DEEG 2ZT9C 5B5EE 3CMEP 2KZJA 5KKZB 1SQBJ 2XNDH 3A0BE 2KSEA 4YXDC 1J1EB 4W7YA 2YXRB 1M7LA 1L0NE 3L70G 3SFDC 5AW4B 4ASWA 1HGZA 3H1JE 1EC5A 2PGDA 1RF1B 3HUSC 1JNMA 2LKMA 1RQUA 1VQ9P 2O1KA 3BCCD 3W68A 3CC7P 3SSUA 3NMDA 2W6AA 4UB8H 2GA1A 2N9BA 3P32A 1LT9B 3CXHE 3RBXA 3FXDA 3V2NA 1OFCX 5GTIE 3RK2B 2ZVNB 3F89A 2WPQA 5AVQB 4ASVA 1LP1A 2BCCJ 5BU8B 4NPDA 3MIWA 5AW2B 3CX5H 3IFMA 1ZRTE 1CSBA 1KILC 3CXHI 3H1IG 3IN6A 1AVYA 3K5BA 4L76A 1LTGC 1RF1A 2E43A 3HD7C 3W67A 1LTAC 1IFIA 2W83C 3RK2D 2N1TD 3S4RA 1LTIC 1ZR2A 3TGUG 2QJPC 1NTZG 2YMYA 1Y9BA 1X8YA 4LLHA 3PLNA 4XA4A 2CK3H 1FAVA 1AFOA 2POHA 5KJ7C 1Q2NA 1OXZA 3H1KD 3WU2H 2IBZE 1S9KE 1GL2A 3AE9C 4RKUJ 1NTZE 4H0LC 1KN7A 2O1JA 3ZDMA 5CJ4A 3L37A 1GTWA 1T3JA 5CCGC 1FZFA 4K35A 1SQQK 4IL6H 2IBZI 3H1LG 5KAIH 1N86A 3KHUA 2WZ7A 1BE3G 3C1LA 2IFMA 3A3YB 1J1DC 3L74G 2P7JA 4H13C 4WVZA 1QVFO 3U1AA 1RH5B 3NFQA 3B5NA 1QL1A 1G2CB 1LTJB 2OGUA 4H44B 3JSVC 3AEEC 3Q2YA 2FFDC 1ZN5A 2H43A 1BE3E 3H1HD 3USSA 5AVRB 3L74E 3SWKA 2FKWB 3FX0A 3V2QA 1GU4A 1RY3A 2KUBA 3MZWB 1SQBE 1QGKB 2B88A 2YO2A 1M1JC 2E75B 3MUDC 3MD0A 3TNUA 2GM4A 4H44D 1JY2O 1DH3A 1ZMEC 4EYYQ 1BCCG 2QM8A 2WSSH 3VTPC 1SQPG 3L70D 1IO4A 1QLED 1M57D 1G2CA 2D2CB 3CC4P 2E75D 2HFED 1L4AD 3TSIA 2WITA 1NTKG 2NPSB 3BRTB 1KFNA 4HH2A 2OTLP 1N7SC 1PGJA 3VYIA 1ZRTD 3JC22 2R5BA 3CWBG 2AXTE 1L0LG 2BCCE 5CCHC 4OGQD 3U1CA 1QX8A 2YO3A 4WY4C 1NTKE 2D2CD 1Y8AA 3A0HH 1Q86Q 3M9QA 1VQMP 1GU5A 1SFCA 1J2JB 3TYYA 2NPSD 3H1ID 3E7KA 1NVOA 1FU1A 1KD1Q 2A06G 2QJYC 4PJ0E 1E5WA 2M3BA 5AVUB 1BGYJ 2E74B 1S9KD 3L35A 1PGPA 2HYNA 3TGUD 1NTZD 4UB6H 1URQD 1VQOP 3HUSA 1SQVG 2A06E 3G4SP 1PP9J 5KKZC 1WRGA 3VN0A 2SPZA 1S2EA 3FGAD 1J1EC 1NU1J 3B8EB 2E74D 1JOCA 3LW5J 2FYUG 1K05A 3O6QA 1EDKA 3NTNA 1JY2N 2XV5A 3H1LD 2QJKB 1RF1C 3HTKB 1T2KD 1BE3D 3L74D 1L0NK 2H88C 3CCEP 2JDIH 2FYUE 1GK6A 4U3FG 1KILA 1VQ8P 3OA7A 1KMIZ 1IFDA 3A0BH 4BXLA 1KC8Q 1YTZT 2IYPA 1LT9C 2IPPA 2QIWA 3AECC 3E1IA 1LWUB 4Y99B 3G71P 1P84E 1DIPA 3RK2C 1JEKA 2IDBA 4U3FE 2BASA 1HVVA 1EDLA 4I2LC 1M1KQ 1W2EA 1DX7A 3L36A 4N3YB 2R3CA 1CZQA 2WSEJ 2Q3EA 1SQXG 1FZEA 1KTMA 1IFPA 1P84I 2E76D 1BCCD 1A02J 3HTKA 1NGMB 1SQPD 4OH8B 2JR8A 2OTJP 1NAYA 4R4LA 1GW4A 2FYZA 2KB7P 2YIUB 1VQPP 3D6ZA 2V7QH 1MV8A 5AW7B 3M0DA 2YKPA 1Z56A 1NTKD 2KYVA 4YXWH 4GOEA 3CWBD 3V5BA 1CI6B 1USEA 1L0LD 2QSIA 2ZJSE 5B66H 2Y0EA 2Q3IA 1NTZK 1RE3A 2IX7C 1H89A 1KB9I 3OJAB 1LNQA 4D6TJ 3LIEA 1LTJC 3FWNA 4H44C 1KQSO 2CPBA 3RL0g 1S72P 2RMZA 2A06D 1FS0E 3CMAP 1M8OB 5AVZB 1Y47A 1N73B 5TISE 1H0TB 1PP9E 3MGNA 1LGHB 1SQVD 3L73J 2WT7B 3R2PA 2I1KA 2KS1A 2KLVA 2QA4P 1KQFB 2E75C 1CI6A 1ZXGA 1X79B 2WPRA 5CMZA 2O3JA 1W2BO 1HWTC 4Z1MH 1OX3A 4MN4C 1OVVA 2HLOA 3AEBC 1L0NG 1S5LX 2BEZF 3D71A 1KQLA 2HPCB 1N7SA 2FYUD 2NRGA 3Q1MA 4GKGA 3H1JG 4RO0A 3KDPB 5CCHA 2WPVB 5H2FE 3B4SA 1AA0A 4WY4A 3RK3E 2D2CC 1X0TA 1HTLC 1BDDA 1P84D 1JTHB 3AEGC 4U3FD 4XFJA 3RBZA 2NPSC 3KXDA 2E5YA 2AEMA 1N73A 1KFMA 1PL5A 1S1CX 5AW1B 1S3JA 2Q5UA 2YKOA 3I5CA 1SQPK 4ZKUA 3L72G 4K3AA 5KLIB 1SP4A 5AW5B 1JB0J 3LIDA 3CCSP 4JBZA 1NTMG 3AEAC 2ZYDA 1SQXD 1LTTC 1N7LA 2N1TB 2JEEA 1PGOA 2RN0A 2E5TA 2P1JA 3L72E 1NTKK 3JCUH 2XU6A 3HE4B 2L5GB 5TJHA 2E74C 2N9YB 3VP8A 4IOIH 1NTME 2WSCH 1JMBA 2O01H 3EWKA 4EI2A 4L74A 1L0LK 5CHXA 1S5LE 3SWFA 2OYIB 1KB9D 2Q6QA 3AE2C 2IBZG 2I1JA 4M3LA 3H6PA 1HF9A 3WUTA 3QH9A 2QE7H 2KZIA 2ZVOB 5APTA 1FZCB 1NKZB 5AVVB 2M5AB 1LT9A 3SWYA 2IFNA 1XTCC 2N1TA 3C8VA 2QJKC 1AVOA 1USDA 2E42A 2G3AA 1EZVE 3L71J 4PV1D 5M1BA 1SQVK 2Y9ZA 2WWWA 1SS1A 1QL2A 4OWFA 3CPWO 2AXCA 3L75D 3M06A 3M0DC 1IK7A 4PD4E 2FXOA 4Y99C 1EZVI 1LWUC 2FYUK 3L73E 4EDFA 1FC2C 1SQQJ 1R5LA 1SQBG 3P8CE 4PD4I 1KYOE 1AQ5A 2OYOA 3P8MC 3Q3DA 1L0ND 1RE3C 5GTHE 3C9IA 1K73Q 3Q5SA 3AE5C 3H1JD 1L4AB 2PFXA 3PJSK 5BU5A 1FDMA 1G1IA 4ZMDA 1OW6A 2R32A 4KT0J 2YIUC 4U7JA 1FJPA 1L2PA 1VQ6P 1U7MA 1RHZB 1DD4A 1MUUA 1JY3O 1CW5A 5KAFH 1VPCA 4OGQB 1SQXK 4HB1A 4N78E 1SVFA 1LTJA 4XE5B 2C9LY 3ITKA 3CXHD 2BCCG 4GOFA 3BCCJ 1NWQA 3TDKA 1EXJA 2K3RA 3L72D 1YJNP 1FDOA 4IL6X 4UB8E 3WMM0 1NTMD 2FXPA 1PFIA 2GUVA 1L4AA 2B9BA 2P10A 5CBNA 1A02F 1JMMA 2ZFCA 4WBAA 1URQB 1YIJP 5BVZA 3CX5E 5E79H 1JO5A 3Q5PA 3AE7C 1KB9H 4JF7A 2FY8A 1OVUA 1N73C 2FXMA 4GODA 3GHGB 1JY2P 1Q82Q 4R4MA 2IZ1A 4WWIA 5L8RJ 2IBZD 2M3EA 2WQYC 1YI2P 2NPSA 1GZLA 4W80A 3PHLA 3H25A 1OW7A 3VMXA 3H1KJ 3H32B 4KJMA 1EDIA 1X9VA 1HJ0A 2C0XA 3RL0B 4DOJA 3WU2E 2OYHB 1GW3A 1HJBA 4JQ0D 3L71E 4PD4D 4B86A 3B71A 5DJUB 3VP9A 5APUA 1URQA 1MFTA 5K5GB 2RH0A 2AEFA 1DD3A 5APVA 4IL6E 2Z5IA 3OAKA 1SLQA 3ABVC 3GHGA 1MZ9A 1FE6A 2Q1KA 3RL0D 3GF7A 4A7PA 1JY3N 1NJIQ 5B5EH 1ZLLA 1TU3F 3N4XA 5H2FH 5KLIC 1EQ7A 2E76B 1SQBD 3H1HJ 3HD7D 1RE4C 1NHLA 2PAJA 2N1TC 1YITP 1BSHA 1YHQP 5AW6B 3IF4A 2YXQB 2P67A 4C7RA 1VQ7P 2B87B 5KJ7D 2CPSA 2R5DA 1GMJA 4DCKA 1YTZI 3CCQP 4WB4A 4AYCA 1PZQA 1M90Q 2HR3A 2OYIC 3V4QA 1ZOYC 3L70J 5CCGD 3CXHH 3MTUE 2KSJA 5GTIH 1NTMK 3CCLP 2H8PD 2JKVA 3BATA 3BASA 5AVSB 4GIFA 5AVXB 1FZCC 1KV4A 2BCCD 3RGUA 4JYCA 1Q7YQ 2V7QJ 1LWUA 5AW0B 3G3ZA 4KHXA 1VF5B 2OTKE 3GF3A 1YQ4C 3IAOA 1VQNP 4ZKPA 2C0WA 3VMAA 2K9JB 2JJLA
chains in the Genus database with same CATH topology
4UB6H 2AXTH 5B66H 3KZIH 5B5EH 5H2FH 3A0BH 3A0HH 5GTIH 4PJ0H 4IL6H 1S5LH 5GTHH 5KAFH 3WU2H 3JCUH 5KAIH 5E79H 5TISH 4UB8H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB6 H;  2AXT H;  5B66 H;  3KZI H;  5B5E H;  5H2F H;  3A0B H;  3A0H H;  5GTI H;  4PJ0 H;  4IL6 H;  1S5L H;  5GTH H;  5KAF H;  3WU2 H;  3JCU H;  5KAI H;  5E79 H;  5TIS H;  4UB8 H; 
#chains in the Genus database with same CATH topology
 1K8A Q;  2B87 A;  1BGY G;  1ZR4 A;  3KZI E;  2O01 N;  3CL3 D;  4YPC A;  3A0H E;  3VMZ A;  3KPE A;  4DT0 A;  5AVT B;  4GT1 A;  1ZW0 A;  1RF0 C;  2OQQ A;  3H1I J;  2AEJ A;  3CC2 P;  1BGY E;  1VF5 D;  3E1R A;  3O8Z A;  1PP9 G;  1VL2 A;  5APS A;  1NU1 G;  1NOH A;  1OWA A;  3A2A A;  2LXC B;  1N8R Q;  3TGU J;  2M0B A;  1NYH A;  3U59 A;  2WTY A;  3H1K E;  4UB6 E;  3Q5R A;  5KTB A;  4EIJ A;  1ZV8 A;  1T6A A;  4HKZ H;  2GUS A;  5KLV J;  4TT3 H;  1L4A C;  4C46 A;  2LXB A;  2Y0C A;  2C9N Y;  2A45 G;  1NU1 E;  3GMA A;  4LC1 A;  1LT1 A;  1JM0 A;  1ZP0 C;  3R4Y A;  1PV3 A;  3HRN A;  1S4X A;  2ZXX A;  4EOT A;  3H1H G;  1SQB K;  1EDJ A;  3H1L J;  4O9B A;  4OGQ C;  1IFJ A;  1BE3 J;  3AE4 C;  3L74 J;  1FZB A;  2QG4 A;  1YBK A;  3H1H E;  3PH0 A;  2W8Z A;  1VQK P;  3GG2 A;  3CD6 P;  3V2R A;  1LP1 B;  2A45 I;  1H0T A;  1VQL P;  5APQ A;  1H8A A;  2Y0D A;  2WT7 A;  4I6M C;  1T8Z A;  3CCR P;  3CCJ P;  2KXP B;  3TK1 A;  3VOP A;  4NPF X;  4JPZ B;  1URQ C;  3FXE A;  2HPC A;  1HUC A;  4IFD K;  3L70 E;  5CJ0 A;  1BCC J;  3CCM P;  3GHG C;  2WPS A;  4GDO A;  1SQP J;  3AE3 C;  3NXS A;  2AXT H;  3BVH A;  2Y9Y A;  2I8D A;  2JWD A;  4YTP C;  1JTH A;  1GL2 B;  1LTS C;  4IFF A;  3I55 P;  1KQG B;  2MKV A;  2QRX A;  2KP8 A;  1JUN A;  2WSC J;  2KI7 B;  2O01 J;  1T2K C;  1BSN A;  2KNC B;  4DZO A;  1NTK J;  4PV1 B;  3RL0 C;  2ZYG A;  2BEQ D;  1YYC A;  2OYH C;  3A5T A;  3G6E P;  2FYN B;  4D6T G;  3CWB J;  2YKQ A;  1EZV G;  4PJ0 H;  1L0L J;  2XKM A;  1RE4 A;  1GL2 D;  1VDF A;  1BGY D;  5APX A;  3B5N B;  2ZAE B;  2WVR A;  1KOR A;  5B66 E;  3IR9 A;  4I7Z B;  3H1I E;  1NKN A;  3G9R A;  4AUW A;  4D6T E;  3HE4 A;  3L73 G;  1IFM A;  2J58 A;  5KLV G;  1G1J A;  2IYO A;  1DEB A;  1WMK A;  1NO4 A;  1PP9 D;  4I1L A;  4IFM A;  2Q9I A;  2E76 C;  2JP3 A;  3TGU E;  3RK3 B;  1YJW P;  2OYI A;  2K37 A;  2P58 A;  1NU1 D;  2KNC A;  3B5N D;  3TNU B;  1OIP A;  3II6 A;  2PRR A;  1AJY A;  2UWJ E;  5KLV E;  3VMY A;  1SQV J;  1FJK A;  2RKL A;  1FZC A;  2ITA A;  3EFF K;  1H88 A;  4QMA A;  2M5A A;  1HGV A;  2H89 C;  2QVA A;  1QVG O;  1KIL E;  3RK3 D;  2FYU J;  2XNX A;  1FBM A;  3H1L E;  2K88 A;  1E79 H;  1PIX A;  3T97 B;  2M8R A;  1KYO I;  3N7N A;  1P84 H;  3GLM A;  1LTB C;  5AVW B;  2J59 M;  3WUU A;  3M0A A;  4U3F J;  4TLF A;  2W6B A;  1RF0 A;  2H7H A;  2P2U A;  3GW6 A;  1VF5 C;  1YJ9 P;  1SFC B;  1PPJ G;  2W27 A;  1VQ5 P;  2LR2 A;  1EXI A;  2ZT9 B;  4CPG A;  1FOS E;  3CI9 A;  3M9H A;  3AE1 C;  2QM7 A;  1AQT A;  3PTZ A;  1BCC E;  1SQX J;  5C39 A;  1PPJ E;  1IC2 A;  3T97 A;  1X22 A;  1SQP E;  2ZXE B;  1PGQ A;  4OVN F;  1D7M A;  3PRJ A;  3JCU E;  1SFC D;  2KLU A;  3HUS B;  1VQ4 P;  3S9O A;  2ZT9 D;  2L91 A;  3KZI H;  1MKM A;  2V4H A;  4AQR D;  2W6J H;  1W5C E;  3FWL A;  1FZG A;  5EFW B;  1R8E A;  3CCU P;  3CX5 I;  3CWB E;  3O6Q B;  3SFE C;  3A7O A;  1JY3 P;  3L71 G;  3PP5 A;  1GD2 E;  1L0L E;  4D6T D;  4RES B;  1EZV D;  5CBO A;  1OZH A;  3MP7 B;  5AW8 B;  2K9Y A;  1KIL B;  2HOD B;  1QEX A;  1NU1 K;  4ZNC A;  1NH4 A;  1U7J A;  5TIS H;  3TF5 A;  3AED C;  1M56 D;  3AE6 C;  2YMK A;  1IZN B;  4HYT B;  2KK7 A;  2XDJ A;  3S1K A;  3HD7 B;  1SQQ G;  1R5S A;  3L73 D;  3CCV P;  4Y28 J;  5KLV D;  5AVY B;  3L75 J;  3LW5 H;  1JCC A;  2J5U A;  2QJP B;  3P8C D;  5APY A;  5APW A;  5KAI E;  1Q90 D;  1KYO D;  1FZA A;  4NPE A;  1KIL D;  1SQV E;  1GDT A;  1SQQ E;  3M9B A;  3P7K A;  2G8Y A;  2B89 A;  2A45 H;  3OW2 O;  5AW3 B;  1XTG B;  4H0L B;  3EFG A;  5AW9 B;  2IZ0 A;  2OAR A;  3BRV B;  2R3S A;  2WMM A;  3I56 P;  3H32 A;  2XZR A;  4BRY B;  1IJD B;  4N6J A;  2HOD A;  2OYH A;  1L0N J;  4RJT A;  4LGD E;  1HH0 A;  1BDC A;  2W90 A;  3H1J J;  1J1D B;  1JCD A;  4H13 B;  3HD7 A;  3D70 A;  4N78 D;  1GL2 C;  3BCC G;  2NZ2 A;  3KYQ A;  4H0L D;  2WSE H;  2R44 A;  2FFD B;  1K04 A;  3V4W A;  4PV1 C;  5KAF E;  5KJ7 A;  2FYN C;  3BCC E;  3M91 A;  3L4F A;  3CLQ A;  4H13 D;  1PPJ D;  1T3U A;  1M1J B;  3L72 J;  3B5N C;  5CCG A;  4BRY A;  1SQX E;  4L75 A;  2Z5H A;  1S5L H;  4I7Z C;  1NTM J;  3CX5 D;  1YQ3 C;  1FOS F;  4DJG A;  4C7N B;  1AV1 A;  1K9M Q;  2Q7C A;  2DW3 A;  3F5H A;  2VRS A;  3RK3 C;  1GK4 A;  1KZU B;  2KS1 B;  2JWA A;  1MFZ A;  5E79 E;  3WUV A;  2FFD A;  3UIA A;  1KB9 E;  1OW8 A;  1OMI A;  3H1K G;  1RQV A;  2MJZ A;  3QWO C;  4L73 A;  1IFN A;  1N7S B;  4W7Z A;  1LJ2 A;  3HE5 B;  1NAF A;  2KIK A;  1U57 A;  1M1J A;  2K1A A;  1IK9 A;  1NTZ J;  3L71 D;  3AE8 C;  3V6I A;  3MUD A;  2KOG A;  4WY4 B;  1UIX A;  5KLV K;  3L75 G;  2JO1 A;  1Q81 Q;  4PD4 H;  1FDI A;  4HJG H;  2K9J A;  5DJT B;  2YNY A;  4C7N A;  2PP6 A;  1N7S D;  1WT6 A;  2ZYA A;  2Z4E A;  3D6Y A;  2QJY B;  3MHV A;  2FBW C;  3AEF C;  3L75 E;  4BWN A;  1SQQ D;  5CCH D;  1KYO H;  1UII A;  1N2D C;  4WY4 D;  3KQG A;  2HG5 D;  2WSF H;  1OVR A;  1HBW A;  5GTH H;  1SFC C;  2QEX P;  3HE5 A;  3V2P A;  2WSF J;  3EQ2 A;  4JYB A;  1DEE G;  2ZT9 C;  5B5E E;  3CME P;  2KZJ A;  5KKZ B;  1SQB J;  2XND H;  3A0B E;  2KSE A;  4YXD C;  1J1E B;  4W7Y A;  2YXR B;  1M7L A;  1L0N E;  3L70 G;  3SFD C;  5AW4 B;  4ASW A;  1HGZ A;  3H1J E;  1EC5 A;  2PGD A;  1RF1 B;  3HUS C;  1JNM A;  2LKM A;  1RQU A;  1VQ9 P;  2O1K A;  3BCC D;  3W68 A;  3CC7 P;  3SSU A;  3NMD A;  2W6A A;  4UB8 H;  2GA1 A;  2N9B A;  3P32 A;  1LT9 B;  3CXH E;  3RBX A;  3FXD A;  3V2N A;  1OFC X;  5GTI E;  3RK2 B;  2ZVN B;  3F89 A;  2WPQ A;  5AVQ B;  4ASV A;  1LP1 A;  2BCC J;  5BU8 B;  4NPD A;  3MIW A;  5AW2 B;  3CX5 H;  3IFM A;  1ZRT E;  1CSB A;  1KIL C;  3CXH I;  3H1I G;  3IN6 A;  1AVY A;  3K5B A;  4L76 A;  1LTG C;  1RF1 A;  2E43 A;  3HD7 C;  3W67 A;  1LTA C;  1IFI A;  2W83 C;  3RK2 D;  2N1T D;  3S4R A;  1LTI C;  1ZR2 A;  3TGU G;  2QJP C;  1NTZ G;  2YMY A;  1Y9B A;  1X8Y A;  4LLH A;  3PLN A;  4XA4 A;  2CK3 H;  1FAV A;  1AFO A;  2POH A;  5KJ7 C;  1Q2N A;  1OXZ A;  3H1K D;  3WU2 H;  2IBZ E;  1S9K E;  1GL2 A;  3AE9 C;  4RKU J;  1NTZ E;  4H0L C;  1KN7 A;  2O1J A;  3ZDM A;  5CJ4 A;  3L37 A;  1GTW A;  1T3J A;  5CCG C;  1FZF A;  4K35 A;  1SQQ K;  4IL6 H;  2IBZ I;  3H1L G;  5KAI H;  1N86 A;  3KHU A;  2WZ7 A;  1BE3 G;  3C1L A;  2IFM A;  3A3Y B;  1J1D C;  3L74 G;  2P7J A;  4H13 C;  4WVZ A;  1QVF O;  3U1A A;  1RH5 B;  3NFQ A;  3B5N A;  1QL1 A;  1G2C B;  1LTJ B;  2OGU A;  4H44 B;  3JSV C;  3AEE C;  3Q2Y A;  2FFD C;  1ZN5 A;  2H43 A;  1BE3 E;  3H1H D;  3USS A;  5AVR B;  3L74 E;  3SWK A;  2FKW B;  3FX0 A;  3V2Q A;  1GU4 A;  1RY3 A;  2KUB A;  3MZW B;  1SQB E;  1QGK B;  2B88 A;  2YO2 A;  1M1J C;  2E75 B;  3MUD C;  3MD0 A;  3TNU A;  2GM4 A;  4H44 D;  1JY2 O;  1DH3 A;  1ZME C;  4EYY Q;  1BCC G;  2QM8 A;  2WSS H;  3VTP C;  1SQP G;  3L70 D;  1IO4 A;  1QLE D;  1M57 D;  1G2C A;  2D2C B;  3CC4 P;  2E75 D;  2HFE D;  1L4A D;  3TSI A;  2WIT A;  1NTK G;  2NPS B;  3BRT B;  1KFN A;  4HH2 A;  2OTL P;  1N7S C;  1PGJ A;  3VYI A;  1ZRT D;  3JC2 2;  2R5B A;  3CWB G;  2AXT E;  1L0L G;  2BCC E;  5CCH C;  4OGQ D;  3U1C A;  1QX8 A;  2YO3 A;  4WY4 C;  1NTK E;  2D2C D;  1Y8A A;  3A0H H;  1Q86 Q;  3M9Q A;  1VQM P;  1GU5 A;  1SFC A;  1J2J B;  3TYY A;  2NPS D;  3H1I D;  3E7K A;  1NVO A;  1FU1 A;  1KD1 Q;  2A06 G;  2QJY C;  4PJ0 E;  1E5W A;  2M3B A;  5AVU B;  1BGY J;  2E74 B;  1S9K D;  3L35 A;  1PGP A;  2HYN A;  3TGU D;  1NTZ D;  4UB6 H;  1URQ D;  1VQO P;  3HUS A;  1SQV G;  2A06 E;  3G4S P;  1PP9 J;  5KKZ C;  1WRG A;  3VN0 A;  2SPZ A;  1S2E A;  3FGA D;  1J1E C;  1NU1 J;  3B8E B;  2E74 D;  1JOC A;  3LW5 J;  2FYU G;  1K05 A;  3O6Q A;  1EDK A;  3NTN A;  1JY2 N;  2XV5 A;  3H1L D;  2QJK B;  1RF1 C;  3HTK B;  1T2K D;  1BE3 D;  3L74 D;  1L0N K;  2H88 C;  3CCE P;  2JDI H;  2FYU E;  1GK6 A;  4U3F G;  1KIL A;  1VQ8 P;  3OA7 A;  1KMI Z;  1IFD A;  3A0B H;  4BXL A;  1KC8 Q;  1YTZ T;  2IYP A;  1LT9 C;  2IPP A;  2QIW A;  3AEC C;  3E1I A;  1LWU B;  4Y99 B;  3G71 P;  1P84 E;  1DIP A;  3RK2 C;  1JEK A;  2IDB A;  4U3F E;  2BAS A;  1HVV A;  1EDL A;  4I2L C;  1M1K Q;  1W2E A;  1DX7 A;  3L36 A;  4N3Y B;  2R3C A;  1CZQ A;  2WSE J;  2Q3E A;  1SQX G;  1FZE A;  1KTM A;  1IFP A;  1P84 I;  2E76 D;  1BCC D;  1A02 J;  3HTK A;  1NGM B;  1SQP D;  4OH8 B;  2JR8 A;  2OTJ P;  1NAY A;  4R4L A;  1GW4 A;  2FYZ A;  2KB7 P;  2YIU B;  1VQP P;  3D6Z A;  2V7Q H;  1MV8 A;  5AW7 B;  3M0D A;  2YKP A;  1Z56 A;  1NTK D;  2KYV A;  4YXW H;  4GOE A;  3CWB D;  3V5B A;  1CI6 B;  1USE A;  1L0L D;  2QSI A;  2ZJS E;  5B66 H;  2Y0E A;  2Q3I A;  1NTZ K;  1RE3 A;  2IX7 C;  1H89 A;  1KB9 I;  3OJA B;  1LNQ A;  4D6T J;  3LIE A;  1LTJ C;  3FWN A;  4H44 C;  1KQS O;  2CPB A;  3RL0 g;  1S72 P;  2RMZ A;  2A06 D;  1FS0 E;  3CMA P;  1M8O B;  5AVZ B;  1Y47 A;  1N73 B;  5TIS E;  1H0T B;  1PP9 E;  3MGN A;  1LGH B;  1SQV D;  3L73 J;  2WT7 B;  3R2P A;  2I1K A;  2KS1 A;  2KLV A;  2QA4 P;  1KQF B;  2E75 C;  1CI6 A;  1ZXG A;  1X79 B;  2WPR A;  5CMZ A;  2O3J A;  1W2B O;  1HWT C;  4Z1M H;  1OX3 A;  4MN4 C;  1OVV A;  2HLO A;  3AEB C;  1L0N G;  1S5L X;  2BEZ F;  3D71 A;  1KQL A;  2HPC B;  1N7S A;  2FYU D;  2NRG A;  3Q1M A;  4GKG A;  3H1J G;  4RO0 A;  3KDP B;  5CCH A;  2WPV B;  5H2F E;  3B4S A;  1AA0 A;  4WY4 A;  3RK3 E;  2D2C C;  1X0T A;  1HTL C;  1BDD A;  1P84 D;  1JTH B;  3AEG C;  4U3F D;  4XFJ A;  3RBZ A;  2NPS C;  3KXD A;  2E5Y A;  2AEM A;  1N73 A;  1KFM A;  1PL5 A;  1S1C X;  5AW1 B;  1S3J A;  2Q5U A;  2YKO A;  3I5C A;  1SQP K;  4ZKU A;  3L72 G;  4K3A A;  5KLI B;  1SP4 A;  5AW5 B;  1JB0 J;  3LID A;  3CCS P;  4JBZ A;  1NTM G;  3AEA C;  2ZYD A;  1SQX D;  1LTT C;  1N7L A;  2N1T B;  2JEE A;  1PGO A;  2RN0 A;  2E5T A;  2P1J A;  3L72 E;  1NTK K;  3JCU H;  2XU6 A;  3HE4 B;  2L5G B;  5TJH A;  2E74 C;  2N9Y B;  3VP8 A;  4IOI H;  1NTM E;  2WSC H;  1JMB A;  2O01 H;  3EWK A;  4EI2 A;  4L74 A;  1L0L K;  5CHX A;  1S5L E;  3SWF A;  2OYI B;  1KB9 D;  2Q6Q A;  3AE2 C;  2IBZ G;  2I1J A;  4M3L A;  3H6P A;  1HF9 A;  3WUT A;  3QH9 A;  2QE7 H;  2KZI A;  2ZVO B;  5APT A;  1FZC B;  1NKZ B;  5AVV B;  2M5A B;  1LT9 A;  3SWY A;  2IFN A;  1XTC C;  2N1T A;  3C8V A;  2QJK C;  1AVO A;  1USD A;  2E42 A;  2G3A A;  1EZV E;  3L71 J;  4PV1 D;  5M1B A;  1SQV K;  2Y9Z A;  2WWW A;  1SS1 A;  1QL2 A;  4OWF A;  3CPW O;  2AXC A;  3L75 D;  3M06 A;  3M0D C;  1IK7 A;  4PD4 E;  2FXO A;  4Y99 C;  1EZV I;  1LWU C;  2FYU K;  3L73 E;  4EDF A;  1FC2 C;  1SQQ J;  1R5L A;  1SQB G;  3P8C E;  4PD4 I;  1KYO E;  1AQ5 A;  2OYO A;  3P8M C;  3Q3D A;  1L0N D;  1RE3 C;  5GTH E;  3C9I A;  1K73 Q;  3Q5S A;  3AE5 C;  3H1J D;  1L4A B;  2PFX A;  3PJS K;  5BU5 A;  1FDM A;  1G1I A;  4ZMD A;  1OW6 A;  2R32 A;  4KT0 J;  2YIU C;  4U7J A;  1FJP A;  1L2P A;  1VQ6 P;  1U7M A;  1RHZ B;  1DD4 A;  1MUU A;  1JY3 O;  1CW5 A;  5KAF H;  1VPC A;  4OGQ B;  1SQX K;  4HB1 A;  4N78 E;  1SVF A;  1LTJ A;  4XE5 B;  2C9L Y;  3ITK A;  3CXH D;  2BCC G;  4GOF A;  3BCC J;  1NWQ A;  3TDK A;  1EXJ A;  2K3R A;  3L72 D;  1YJN P;  1FDO A;  4IL6 X;  4UB8 E;  3WMM 0;  1NTM D;  2FXP A;  1PFI A;  2GUV A;  1L4A A;  2B9B A;  2P10 A;  5CBN A;  1A02 F;  1JMM A;  2ZFC A;  4WBA A;  1URQ B;  1YIJ P;  5BVZ A;  3CX5 E;  5E79 H;  1JO5 A;  3Q5P A;  3AE7 C;  1KB9 H;  4JF7 A;  2FY8 A;  1OVU A;  1N73 C;  2FXM A;  4GOD A;  3GHG B;  1JY2 P;  1Q82 Q;  4R4M A;  2IZ1 A;  4WWI A;  5L8R J;  2IBZ D;  2M3E A;  2WQY C;  1YI2 P;  2NPS A;  1GZL A;  4W80 A;  3PHL A;  3H25 A;  1OW7 A;  3VMX A;  3H1K J;  3H32 B;  4KJM A;  1EDI A;  1X9V A;  1HJ0 A;  2C0X A;  3RL0 B;  4DOJ A;  3WU2 E;  2OYH B;  1GW3 A;  1HJB A;  4JQ0 D;  3L71 E;  4PD4 D;  4B86 A;  3B71 A;  5DJU B;  3VP9 A;  5APU A;  1URQ A;  1MFT A;  5K5G B;  2RH0 A;  2AEF A;  1DD3 A;  5APV A;  4IL6 E;  2Z5I A;  3OAK A;  1SLQ A;  3ABV C;  3GHG A;  1MZ9 A;  1FE6 A;  2Q1K A;  3RL0 D;  3GF7 A;  4A7P A;  1JY3 N;  1NJI Q;  5B5E H;  1ZLL A;  1TU3 F;  3N4X A;  5H2F H;  5KLI C;  1EQ7 A;  2E76 B;  1SQB D;  3H1H J;  3HD7 D;  1RE4 C;  1NHL A;  2PAJ A;  2N1T C;  1YIT P;  1BSH A;  1YHQ P;  5AW6 B;  3IF4 A;  2YXQ B;  2P67 A;  4C7R A;  1VQ7 P;  2B87 B;  5KJ7 D;  2CPS A;  2R5D A;  1GMJ A;  4DCK A;  1YTZ I;  3CCQ P;  4WB4 A;  4AYC A;  1PZQ A;  1M90 Q;  2HR3 A;  2OYI C;  3V4Q A;  1ZOY C;  3L70 J;  5CCG D;  3CXH H;  3MTU E;  2KSJ A;  5GTI H;  1NTM K;  3CCL P;  2H8P D;  2JKV A;  3BAT A;  3BAS A;  5AVS B;  4GIF A;  5AVX B;  1FZC C;  1KV4 A;  2BCC D;  3RGU A;  4JYC A;  1Q7Y Q;  2V7Q J;  1LWU A;  5AW0 B;  3G3Z A;  4KHX A;  1VF5 B;  2OTK E;  3GF3 A;  1YQ4 C;  3IAO A;  1VQN P;  4ZKP A;  2C0W A;  3VMA A;  2K9J B;  2JJL A; 
#chains in the Genus database with same CATH homology
 4UB6 H;  2AXT H;  5B66 H;  3KZI H;  5B5E H;  5H2F H;  3A0B H;  3A0H H;  5GTI H;  4PJ0 H;  4IL6 H;  1S5L H;  5GTH H;  5KAF H;  3WU2 H;  3JCU H;  5KAI H;  5E79 H;  5TIS H;  4UB8 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...