1S5LH

Architecture of the photosynthetic oxygen evolving center
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
53
structure length
53
Chain Sequence
LNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Architecture of the Photosynthetic Oxygen-Evolving Center
pubmed doi rcsb
molecule tags Photosynthesis
total genus 9
structure length 53
sequence length 53
chains with identical sequence h
ec nomenclature
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 1s5lH00
3A0BH 2AXTH 4UB6H 5B66H 3A0HH 4UB8H 5H2FH 5KAFH 4PJ0H 3WU2H 5TISH 5E79H 1S5LH 3JCUH 3KZIH 5GTHH 5GTIH 5B5EH 5KAIH 4IL6H
chains in the Genus database with same CATH superfamily
4TT3H 3BCCE 3HD7C 1KFNA 1N2DC 1NTMD 3TNUB 1BE3D 5AVZB 2M3EA 4PV1D 1MKMA 2XNDH 4BXLA 1T8ZA 5AVQB 3CLQA 3M06A 5KJ7D 2OTLP 3AE8C 1KB9H 3HE5A 4U3FD 1Z56A 3LIEA 3CC7P 1HBWA 1SP4A 3V5BA 4YXWH 5APTA 2ZYGA 2K9JA 4I2LC 1J1DC 2Q3IA 3RK3B 1RE3C 3V4QA 4ZKUA 4Y99C 1A02J 2HPCA 5KAFH 3NTNA 4LGDE 4DT0A 1NTZJ 1LT1A 1KMIZ 2FFDB 2ZXXA 3HTKA 1NTZG 1T6AA 3D70A 1NTKD 2W6BA 2OYHB 4WY4B 1NU1D 1SQXE 2VRSA 1AVYA 2OYIA 1PP9E 1ZOYC 2OYOA 1FAVA 1W5CE 4DCKA 3A5TA 1SS1A 3VP8A 1EDKA 2A45G 1Q82Q 1M57D 3D6ZA 1FBMA 1ZLLA 1ZXGA 3B71A 1EZVE 1NTZK 2IFNA 1KB9E 2ZYDA 1GZLA 1HUCA 1N7SB 3H1HD 2E74C 4R4LA 4JYCA 1SQBG 5AW2B 4HH2A 2B87B 1EZVI 1KB9I 4H44B 1ZR2A 2G3AA 2AEMA 3B8EB 1JO5A 3Q2YA 2ZJSE 2OYIC 2YMKA 3RK2C 4JF7A 2A06G 3L71D 1IFJA 3AEBC 3CXHD 5APSA 1JY3N 1JOCA 1NTME 3WU2E 1BE3E 1VQMP 1NH4A 2FFDA 4JPZB 4BWNA 3FGAD 1E79H 3QH9A 4KT0J 2E76C 2NRGA 1SQBK 2OTJP 2OYHA 5GTHH 1HF9A 4WY4A 3CPWO 4N3YB 1IFPA 2YNYA 4U3FE 1MFTA 2RKLA 1PPJD 4IFFA 2QE7H 1AJYA 2P2UA 3SWKA 3EFFK 1L4AB 3R2PA 4QMAA 2KZJA 1PIXA 2FYNB 5CHXA 2WT7B 2Z5HA 4KJMA 3B5ND 1Y8AA 3P32A 3VMYA 3M9HA 1PGOA 1S9KD 3HE4B 2CPBA 3KHUA 5CCHA 3A2AA 2BCCJ 1IFIA 1G1JA 4WY4C 1URQC 1WMKA 1GD2E 1NTKE 1MFZA 3KYQA 3CMAP 2BCCG 2KLVA 1NU1E 3KZIE 3CCMP 1H88A 1FJKA 3A0HH 2E75C 4ASWA 1ZN5A 2FYUG 1M1JB 4AUWA 2KB7P 5APVA 3RBZA 3GLMA 2W6JH 1SFCD 3EWKA 2JO1A 3AE5C 4O9BA 5CCHC 1K9MQ 1NHLA 4LLHA 1L0NK 3C1LA 2M5AB 4IFMA 1X79B 2Y0DA 3TGUD 3G6EP 3H1HE 1LT9B 1OX3A 2WPRA 2ITAA 2V7QJ 4PD4H 1OXZA 1X0TA 3A0BH 1N7SD 2FYUK 1LNQA 2BEZF 2NPSD 5K5GB 5KLVD 3L71E 2Q9IA 3CXHE 3HE4A 4H44D 1GU4A 2QJKB 1IK7A 2PP6A 2WMMA 1FZCB 1DD4A 3H1IJ 4OGQB 1YYCA 1K8AQ 1SQPD 3KDPB 4H0LB 3H1IG 2FBWC 2O1KA 1FE6A 4OH8B 1USDA 2H8PD 2WPQA 3A0HE 3LW5H 5CCGD 2E5TA 1KILC 2H7HA 1PPJE 4NPEA 2KNCB 4HB1A 1PL5A 2FYNC 3PTZA 3CC2P 4UB8H 3OAKA 3CCUP 2KZIA 1IC2A 4MN4C 1AQTA 1J1EC 2C0XA 5AVSB 1OZHA 1BCCG 1L4AD 2B88A 1S9KE 1SQQJ 4I7ZC 2QIWA 2R5DA 1FU1A 2IZ1A 4DOJA 1R8EA 2ZT9B 2FKWB 2KSJA 4AYCA 1QEXA 1SQQG 4PD4E 3N7NA 1LP1B 3A0BE 3HRNA 1Y47A 4PD4I 2GM4A 4YXDC 3O6QA 2YXRB 4D6TJ 2RMZA 1AV1A 3HD7B 1SQQK 5APWA 3P8MC 5E79E 4D6TG 3Q5SA 1NYHA 3TGUE 1RF1A 3C8VA 2K9YA 3CWBJ 1OMIA 1CI6B 2KNCA 1NJIQ 1LJ2A 2YKPA 3CWBG 1GU5A 4C7NB 1HVVA 2C9LY 2BASA 5KLVE 1BGYJ 1Q2NA 5AVXB 2WPVB 1Q81Q 1GL2A 1VF5B 2W27A 1BGYG 3PHLA 4WBAA 2G8YA 3P8CD 3GMAA 1YIJP 1RH5B 1SQPE 4Y99B 1LP1A 3H1KJ 4IL6X 1RF1C 1QX8A 1Q90D 2P58A 4Y28J 4OGQD 1LGHB 1BDCA 4RKUJ 3H1KG 1GDTA 2IYOA 4H0LD 3I56P 1L0LJ 3HE5B 1NKZB 1OWAA 2L5GB 1USEA 2PGDA 1LWUA 1L0LG 2K9JB 2GA1A 1FDOA 1GL2C 1GMJA 1PGJA 2OTKE 1DH3A 4ZNCA 1T2KC 1NTZD 3M9QA 1YITP 3FWNA 4DJGA 2HPCB 1CI6A 1AQ5A 2XZRA 4HJGH 3E1IA 5BU5A 3BCCJ 4EDFA 4GODA 2JKVA 3M0AA 2P1JA 2E74B 5AVVB 3L72D 3HTKB 3BCCG 3GW6A 3BVHA 1HTLC 1L0LK 4M3LA 4W80A 2R44A 1N7LA 2OYIB 1LWUC 2E42A 1RE3A 1FZEA 3RK2B 2CPSA 1JUNA 3VYIA 4C7RA 2GUVA 2IYPA 3RL0B 3IF4A 1SQBD 2Q3EA 1SQVK 3EFGA 2HLOA 1IZNB 3VMXA 5B5EE 1G2CB 3MHVA 2E76B 3HD7D 2FXOA 3L74E 4ZKPA 4WVZA 1E5WA 3L75D 1GTWA 1FJPA 1AVOA 1MUUA 3PJSK 5L8RJ 1MV8A 3L73D 3TDKA 1VF5C 2WWWA 1JMBA 2H88C 2SPZA 2RH0A 2K88A 3CI9A 1M1KQ 1SQXJ 3LIDA 4L73A 4RJTA 3P8CE 3G3ZA 3WU2H 1KQFB 2ZXEB 1PP9J 3AEAC 2YKOA 1SQXG 2N9YB 1PP9G 1GK4A 1URQB 3L70D 3Q5PA 1U7MA 3CL3D 2I8DA 4L74A 1QVGO 3IR9A 2ZFCA 3L36A 2XKMA 2OQQA 2E75B 1NGMB 1EZVG 2P10A 3SWFA 1FDMA 5H2FH 1L0ND 1SQXK 2KP8A 1G2CA 1NOHA 2IFMA 4EIJA 1IK9A 1XTGB 1VDFA 1W2BO 1P84D 1JY3O 1NTMJ 2AXTH 3CMEP 1BE3J 3AE3C 3CCSP 2FYUD 3L72E 3K5BA 1VQ8P 2JJLA 2HYNA 4PJ0H 1NTMG 1HJBA 1BE3G 1T3UA 5TISH 1VQ5P 3KZIH 4H13B 5GTIH 4LC1A 4CPGA 4TLFA 2E74D 3RL0C 2KK7A 3VOPA 4U3FJ 3S1KA 2JDIH 2Z5IA 1SQBE 1VQOP 4U3FG 3AE1C 2J5UA 3H1LD 2QJYC 1URQA 2RN0A 3NFQA 3M9BA 2KI7B 1NTMK 1P84H 3L75E 1PGQA 1X8YA 1VPCA 3BASA 2E76D 1KILB 3V2NA 3L73E 3AEDC 5AVWB 3AE7C 3AE4C 5CMZA 1JCCA 2KYVA 1GK6A 5H2FE 2OARA 2WZ7A 2FXPA 1NU1J 4W7ZA 3CXHH 1J1EB 2FYZA 3RK3D 1ZW0A 2P67A 2AXTE 1BSNA 4I7ZB 1EDLA 3EQ2A 4JYBA 1U57A 4K3AA 1FOSF 4PJ0E 1KQLA 2MJZA 3L70E 5TISE 2LKMA 5GTIE 1ZMEC 5AW1B 2Y0EA 1EXJA 1OIPA 1BCCD 2IBZD 3NMDA 5APQA 5APYA 3H1HJ 3GF7A 4WY4D 1ZRTD 1RHZB 2H43A 2YMYA 3WUTA 5BU8B 2WPSA 3F89A 3H1HG 1L0NE 4HKZH 3WUUA 3W68A 2PFXA 2E75D 3L71J 5AW9B 1P84E 3AE9C 3CCEP 2KSEA 1FC2C 2FYUE 4ZMDA 3SWYA 1MZ9A 4H13C 1KILA 2N1TB 1K04A 2AEJA 5CCHD 3S4RA 3L35A 3V2RA 3IFMA 1KORA 4XFJA 2AEFA 3O6QB 3CXHI 1RQVA 3H1LE 1VQKP 1PPJG 4BRYA 2LR2A 3CWBD 1BSHA 5E79H 1LTTC 1QGKB 1CSBA 1RF1B 1HH0A 2O1JA 2XNXA 5APUA 2WTYA 3BATA 3I5CA 5DJUB 2MKVA 2NZ2A 1CZQA 3D71A 3GG2A 1QLED 1LTIC 3ZDMA 3JSVC 4YPCA 1RF0A 3H6PA 1QVFO 3USSA 3VTPC 3V2PA 1KYOD 1FOSE 2QJPC 2WSFH 1DIPA 1XTCC 1GL2B 1VQ4P 3RK3E 3H1KD 4IOIH 1KN7A 1S3JA 2D2CB 2YIUB 4B86A 1Y9BA 2N1TA 3RGUA 3N4XA 1BCCE 2IBZE 1JTHA 1UIIA 2WSCH 2K1AA 1IFNA 1ZP0C 1OVRA 3LW5J 1ZRTE 1S4XA 2M8RA 3S9OA 1DEBA 5KTBA 1RF0C 2IBZI 3SSUA 1JCDA 5AW5B 2I1KA 3CCLP 1LWUB 1SQVD 2QM8A 2XU6A 4R4MA 1YQ4C 5KLVJ 2KLUA 2GUSA 2W90A 2I1JA 5KKZC 4N78D 2N1TC 3H1JD 1W2EA 4GOEA 2JWDA 5KLVG 3A7OA 4GDOA 1JY3P 1SQPJ 3QWOC 2BEQD 1NAYA 1YQ3C 1D7MA 2JP3A 3OA7A 1RQUA 2E5YA 2ZVOB 1JY2N 1H8AA 3SFEC 1M8OB 5AW6B 3D6YA 5KLVK 3T97A 1HGZA 1S1CX 4AQRD 1IJDB 1S5LH 2XV5A 5B5EH 5KAIH 4GIFA 2JWAA 1NKNA 2HFED 1LTSC 3UIAA 3TF5A 2KXPB 4U7JA 3MTUE 1KQGB 4OVNF 2LXCB 1SQXD 3SFDC 1Q7YQ 1KYOE 2D2CC 2YIUC 2KUBA 2C0WA 4WWIA 3H1KE 3VN0A 4L75A 5KJ7A 4Z1MH 4HYTB 1A02F 1K73Q 2QEXP 3U1AA 2ZT9D 1GL2D 2CK3H 2YO2A 1Q86Q 3ABVC 2QA4P 3RBXA 1BDDA 5KLIC 3PRJA 1AA0A 3CD6P 3L74J 3ITKA 4PV1C 2Y9YA 1ZV8A 3II6A 3L74G 1SQVE 2V4HA 2WSSH 5KJ7C 1GW3A 1LTJC 1S5LE 2N9BA 2C9NY 4N78E 1H89A 3IAOA 3H1JE 1FDIA 5KAIE 3U1CA 2A06D 3M91A 2QJYB 1NWQA 1DD3A 1S72P 2KOGA 1IO4A 3C9IA 2OGUA 2P7JA 2A45H 5C39A 3PH0A 2QRXA 1NAFA 2WQYC 3JC22 2M3BA 1YJNP 3B5NB 1KTMA 1K05A 1OVUA 1EDJA 1VF5D 2R3SA 3AE6C 3VMZA 2FXMA 1X9VA 3MUDA 1HJ0A 1LTAC 2B9BA 2IZ0A 3AEGC 2POHA 1H0TB 2HODB 1M7LA 1NO4A 5B66H 3IN6A 4WB4A 3L72J 5CJ4A 1KC8Q 1NTZE 1SFCB 1LTGC 1EQ7A 2BCCD 3TNUA 2WSEH 1YJ9P 3L72G 1HWTC 1HGVA 1JNMA 3V4WA 3E1RA 4UB6H 4JQ0D 4IFDK 2E43A 3MUDC 4N6JA 2W6AA 1OFCX 1SQBJ 3FX0A 5M1BA 1R5LA 1VQ6P 1FZGA 3I55P 3B5NA 1IFDA 2NPSB 5DJTB 3L37A 2Z4EA 3NXSA 2A45I 2QG4A 3L75J 3O8ZA 5APXA 2HG5D 1M56D 3L73J 4RESB 3RK2D 1QL1A 3FWLA 3L75G 3R4YA 1FZBA 2ZVNB 5KAFE 4ASVA 3RL0D 3OJAB 4GKGA 2A06E 3L73G 2WSEJ 1H0TA 2HODA 5CBOA 2O3JA 3G4SP 1PGPA 5B66E 5CJ0A 1JY2P 4NPDA 4RO0A 3VP9A 3B5NC 3CCRP 1NTKJ 1SFCA 2R32A 1AFOA 2M0BA 3L70J 3H1ID 4I1LA 3RK3C 2K37A 1NTKG 3RL0g 1N73B 4UB6E 3HUSB 1NU1G 3L70G 3Q1MA 2QJPB 3PP5A 3TYYA 1OW6A 2ZYAA 5AVUB 2FFDC 4BRYB 1VQLP 1J2JB 1N7SA 5AW4B 1L0NJ 2Y0CA 2V7QH 3V2QA 2NPSA 2OYHC 1PFIA 2B87A 2R5BA 3A3YB 1L0NG 4PD4D 1URQD 3Q3DA 1LTBC 2PAJA 1SFCC 3H25A 1N86A 1PZQA 3E7KA 3CX5D 1NTKK 2FYUJ 1OW8A 2JR8A 1SQQD 3CC4P 1NU1K 2J59M 3MZWB 4EI2A 2BCCE 1L2PA 3BRVB 1VQ7P 1JB0J 1FS0E 2IX7C 2AXCA 4DZOA 3AEEC 2QSIA 3GF3A 3TK1A 2KS1B 5CCGA 3BRTB 1N7SC 2Q6QA 3L71G 2WITA 5KKZB 2XDJA 1SVFA 5GTHE 2R3CA 3AEFC 1TU3F 5AW7B 1P84I 2NPSC 3GHGB 3H1LJ 4H44C 2J58A 2HR3A 1JTHB 4D6TD 1L4AA 3FXDA 2Q5UA 3H1LG 1PV3A 1N73A 3HUSA 4H13D 2WT7A 2IDBA 3CX5H 1S2EA 1YI2P 3KXDA 4L76A 3H32B 3KQGA 3G71P 3G9RA 4XA4A 5CCGC 2W83C 1X22A 5BVZA 1KFMA 2YO3A 3FXEA 3AECC 3MIWA 3KPEA 5TJHA 2W8ZA 1KQSO 3Q5RA 1OW7A 1BGYD 2Y9ZA 2ZAEB 1KV4A 1L4AC 3PLNA 3H1IE 1N73C 4KHXA 1YJWP 3HUSC 1M1JA 1KILD 2IPPA 2O01N 1BCCJ 3U59A 2KS1A 5AW3B 1QL2A 1JM0A 2IBZG 2M5AA 2LXBA 5AVYB 4C46A 5AVTB 4NPFX 3T97B 3GHGA 4YTPC 3TSIA 4OWFA 1LT9A 1L0LD 1JMMA 3L4FA 3TGUJ 1YHQP 3AE2C 4XE5B 5KLIB 1G1IA 3JCUH 1NVOA 2YKQA 3CX5E 3TGUG 1SQQE 1T3JA 1M1JC 3H32A 4W7YA 1GW4A 4PV1B 1UIXA 1KYOH 2Q1KA 3CX5I 1FZCA 2O01H 3BCCD 2L91A 4A7PA 2WSFJ 1YTZT 5CBNA 1LTJB 3GHGC 1JY2O 1LT9C 5AW0B 4EYYQ 4GT1A 4GOFA 2PRRA 3P7KA 1OVVA 3L74D 3V6IA 1SQPG 4JBZA 4D6TE 3CCJP 2N1TD 1SLQA 4UB8E 2WSCJ 1RY3A 3VMAA 4IL6H 2QJKC 5AW8B 2JEEA 1WT6A 1JEKA 1FZCC 1FZFA 4K35A 4OGQC 3WMM0 3CWBE 1WRGA 3OW2O 1YTZI 1J1DB 2QM7A 3M0DA 4H0LC 2O01J 1YBKA 1VQPP 1VQ9P 1SQPK 1IFMA 3CCQP 1BGYE 3JCUE 2UWJE 1R5SA 1M90Q 3B4SA 1KZUB 1DX7A 5EFWB 3CCVP 1RE4A 1CW5A 2B89A 1KILE 1S5LX 1ZR4A 3MD0A 1PP9D 4EOTA 1EC5A 1LTJA 3HD7A 1EXIA 2ZT9C 2FY8A 1KYOI 3M0DC 3WUVA 5AVRB 1VQNP 4I6MC 1N8RQ 2KIKA 1T2KD 2H89C 1L0LE 1SQVJ 2D2CD 3W67A 1EZVD 1EDIA 1KB9D 1KD1Q 3MP7B 2YXQB 1DEEG 1FZAA 2K3RA 1VL2A 1SQVG 2QVAA 3H1JJ 4C7NA 1U7JA 3MGNA 4IL6E 2DW3A 1RE4C 3F5HA 3H1JG 2WVRA 2Q7CA
chains in the Genus database with same CATH topology
3A0BH 2AXTH 4UB6H 5B66H 3A0HH 4UB8H 5H2FH 5KAFH 4PJ0H 3WU2H 5TISH 5E79H 1S5LH 3JCUH 3KZIH 5GTHH 5GTIH 5B5EH 5KAIH 4IL6H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0B H;  2AXT H;  4UB6 H;  5B66 H;  3A0H H;  4UB8 H;  5H2F H;  5KAF H;  4PJ0 H;  3WU2 H;  5TIS H;  5E79 H;  1S5L H;  3JCU H;  3KZI H;  5GTH H;  5GTI H;  5B5E H;  5KAI H;  4IL6 H; 
#chains in the Genus database with same CATH topology
 4TT3 H;  3BCC E;  3HD7 C;  1KFN A;  1N2D C;  1NTM D;  3TNU B;  1BE3 D;  5AVZ B;  2M3E A;  4PV1 D;  1MKM A;  2XND H;  4BXL A;  1T8Z A;  5AVQ B;  3CLQ A;  3M06 A;  5KJ7 D;  2OTL P;  3AE8 C;  1KB9 H;  3HE5 A;  4U3F D;  1Z56 A;  3LIE A;  3CC7 P;  1HBW A;  1SP4 A;  3V5B A;  4YXW H;  5APT A;  2ZYG A;  2K9J A;  4I2L C;  1J1D C;  2Q3I A;  3RK3 B;  1RE3 C;  3V4Q A;  4ZKU A;  4Y99 C;  1A02 J;  2HPC A;  5KAF H;  3NTN A;  4LGD E;  4DT0 A;  1NTZ J;  1LT1 A;  1KMI Z;  2FFD B;  2ZXX A;  3HTK A;  1NTZ G;  1T6A A;  3D70 A;  1NTK D;  2W6B A;  2OYH B;  4WY4 B;  1NU1 D;  1SQX E;  2VRS A;  1AVY A;  2OYI A;  1PP9 E;  1ZOY C;  2OYO A;  1FAV A;  1W5C E;  4DCK A;  3A5T A;  1SS1 A;  3VP8 A;  1EDK A;  2A45 G;  1Q82 Q;  1M57 D;  3D6Z A;  1FBM A;  1ZLL A;  1ZXG A;  3B71 A;  1EZV E;  1NTZ K;  2IFN A;  1KB9 E;  2ZYD A;  1GZL A;  1HUC A;  1N7S B;  3H1H D;  2E74 C;  4R4L A;  4JYC A;  1SQB G;  5AW2 B;  4HH2 A;  2B87 B;  1EZV I;  1KB9 I;  4H44 B;  1ZR2 A;  2G3A A;  2AEM A;  3B8E B;  1JO5 A;  3Q2Y A;  2ZJS E;  2OYI C;  2YMK A;  3RK2 C;  4JF7 A;  2A06 G;  3L71 D;  1IFJ A;  3AEB C;  3CXH D;  5APS A;  1JY3 N;  1JOC A;  1NTM E;  3WU2 E;  1BE3 E;  1VQM P;  1NH4 A;  2FFD A;  4JPZ B;  4BWN A;  3FGA D;  1E79 H;  3QH9 A;  4KT0 J;  2E76 C;  2NRG A;  1SQB K;  2OTJ P;  2OYH A;  5GTH H;  1HF9 A;  4WY4 A;  3CPW O;  4N3Y B;  1IFP A;  2YNY A;  4U3F E;  1MFT A;  2RKL A;  1PPJ D;  4IFF A;  2QE7 H;  1AJY A;  2P2U A;  3SWK A;  3EFF K;  1L4A B;  3R2P A;  4QMA A;  2KZJ A;  1PIX A;  2FYN B;  5CHX A;  2WT7 B;  2Z5H A;  4KJM A;  3B5N D;  1Y8A A;  3P32 A;  3VMY A;  3M9H A;  1PGO A;  1S9K D;  3HE4 B;  2CPB A;  3KHU A;  5CCH A;  3A2A A;  2BCC J;  1IFI A;  1G1J A;  4WY4 C;  1URQ C;  1WMK A;  1GD2 E;  1NTK E;  1MFZ A;  3KYQ A;  3CMA P;  2BCC G;  2KLV A;  1NU1 E;  3KZI E;  3CCM P;  1H88 A;  1FJK A;  3A0H H;  2E75 C;  4ASW A;  1ZN5 A;  2FYU G;  1M1J B;  4AUW A;  2KB7 P;  5APV A;  3RBZ A;  3GLM A;  2W6J H;  1SFC D;  3EWK A;  2JO1 A;  3AE5 C;  4O9B A;  5CCH C;  1K9M Q;  1NHL A;  4LLH A;  1L0N K;  3C1L A;  2M5A B;  4IFM A;  1X79 B;  2Y0D A;  3TGU D;  3G6E P;  3H1H E;  1LT9 B;  1OX3 A;  2WPR A;  2ITA A;  2V7Q J;  4PD4 H;  1OXZ A;  1X0T A;  3A0B H;  1N7S D;  2FYU K;  1LNQ A;  2BEZ F;  2NPS D;  5K5G B;  5KLV D;  3L71 E;  2Q9I A;  3CXH E;  3HE4 A;  4H44 D;  1GU4 A;  2QJK B;  1IK7 A;  2PP6 A;  2WMM A;  1FZC B;  1DD4 A;  3H1I J;  4OGQ B;  1YYC A;  1K8A Q;  1SQP D;  3KDP B;  4H0L B;  3H1I G;  2FBW C;  2O1K A;  1FE6 A;  4OH8 B;  1USD A;  2H8P D;  2WPQ A;  3A0H E;  3LW5 H;  5CCG D;  2E5T A;  1KIL C;  2H7H A;  1PPJ E;  4NPE A;  2KNC B;  4HB1 A;  1PL5 A;  2FYN C;  3PTZ A;  3CC2 P;  4UB8 H;  3OAK A;  3CCU P;  2KZI A;  1IC2 A;  4MN4 C;  1AQT A;  1J1E C;  2C0X A;  5AVS B;  1OZH A;  1BCC G;  1L4A D;  2B88 A;  1S9K E;  1SQQ J;  4I7Z C;  2QIW A;  2R5D A;  1FU1 A;  2IZ1 A;  4DOJ A;  1R8E A;  2ZT9 B;  2FKW B;  2KSJ A;  4AYC A;  1QEX A;  1SQQ G;  4PD4 E;  3N7N A;  1LP1 B;  3A0B E;  3HRN A;  1Y47 A;  4PD4 I;  2GM4 A;  4YXD C;  3O6Q A;  2YXR B;  4D6T J;  2RMZ A;  1AV1 A;  3HD7 B;  1SQQ K;  5APW A;  3P8M C;  5E79 E;  4D6T G;  3Q5S A;  1NYH A;  3TGU E;  1RF1 A;  3C8V A;  2K9Y A;  3CWB J;  1OMI A;  1CI6 B;  2KNC A;  1NJI Q;  1LJ2 A;  2YKP A;  3CWB G;  1GU5 A;  4C7N B;  1HVV A;  2C9L Y;  2BAS A;  5KLV E;  1BGY J;  1Q2N A;  5AVX B;  2WPV B;  1Q81 Q;  1GL2 A;  1VF5 B;  2W27 A;  1BGY G;  3PHL A;  4WBA A;  2G8Y A;  3P8C D;  3GMA A;  1YIJ P;  1RH5 B;  1SQP E;  4Y99 B;  1LP1 A;  3H1K J;  4IL6 X;  1RF1 C;  1QX8 A;  1Q90 D;  2P58 A;  4Y28 J;  4OGQ D;  1LGH B;  1BDC A;  4RKU J;  3H1K G;  1GDT A;  2IYO A;  4H0L D;  3I56 P;  1L0L J;  3HE5 B;  1NKZ B;  1OWA A;  2L5G B;  1USE A;  2PGD A;  1LWU A;  1L0L G;  2K9J B;  2GA1 A;  1FDO A;  1GL2 C;  1GMJ A;  1PGJ A;  2OTK E;  1DH3 A;  4ZNC A;  1T2K C;  1NTZ D;  3M9Q A;  1YIT P;  3FWN A;  4DJG A;  2HPC B;  1CI6 A;  1AQ5 A;  2XZR A;  4HJG H;  3E1I A;  5BU5 A;  3BCC J;  4EDF A;  4GOD A;  2JKV A;  3M0A A;  2P1J A;  2E74 B;  5AVV B;  3L72 D;  3HTK B;  3BCC G;  3GW6 A;  3BVH A;  1HTL C;  1L0L K;  4M3L A;  4W80 A;  2R44 A;  1N7L A;  2OYI B;  1LWU C;  2E42 A;  1RE3 A;  1FZE A;  3RK2 B;  2CPS A;  1JUN A;  3VYI A;  4C7R A;  2GUV A;  2IYP A;  3RL0 B;  3IF4 A;  1SQB D;  2Q3E A;  1SQV K;  3EFG A;  2HLO A;  1IZN B;  3VMX A;  5B5E E;  1G2C B;  3MHV A;  2E76 B;  3HD7 D;  2FXO A;  3L74 E;  4ZKP A;  4WVZ A;  1E5W A;  3L75 D;  1GTW A;  1FJP A;  1AVO A;  1MUU A;  3PJS K;  5L8R J;  1MV8 A;  3L73 D;  3TDK A;  1VF5 C;  2WWW A;  1JMB A;  2H88 C;  2SPZ A;  2RH0 A;  2K88 A;  3CI9 A;  1M1K Q;  1SQX J;  3LID A;  4L73 A;  4RJT A;  3P8C E;  3G3Z A;  3WU2 H;  1KQF B;  2ZXE B;  1PP9 J;  3AEA C;  2YKO A;  1SQX G;  2N9Y B;  1PP9 G;  1GK4 A;  1URQ B;  3L70 D;  3Q5P A;  1U7M A;  3CL3 D;  2I8D A;  4L74 A;  1QVG O;  3IR9 A;  2ZFC A;  3L36 A;  2XKM A;  2OQQ A;  2E75 B;  1NGM B;  1EZV G;  2P10 A;  3SWF A;  1FDM A;  5H2F H;  1L0N D;  1SQX K;  2KP8 A;  1G2C A;  1NOH A;  2IFM A;  4EIJ A;  1IK9 A;  1XTG B;  1VDF A;  1W2B O;  1P84 D;  1JY3 O;  1NTM J;  2AXT H;  3CME P;  1BE3 J;  3AE3 C;  3CCS P;  2FYU D;  3L72 E;  3K5B A;  1VQ8 P;  2JJL A;  2HYN A;  4PJ0 H;  1NTM G;  1HJB A;  1BE3 G;  1T3U A;  5TIS H;  1VQ5 P;  3KZI H;  4H13 B;  5GTI H;  4LC1 A;  4CPG A;  4TLF A;  2E74 D;  3RL0 C;  2KK7 A;  3VOP A;  4U3F J;  3S1K A;  2JDI H;  2Z5I A;  1SQB E;  1VQO P;  4U3F G;  3AE1 C;  2J5U A;  3H1L D;  2QJY C;  1URQ A;  2RN0 A;  3NFQ A;  3M9B A;  2KI7 B;  1NTM K;  1P84 H;  3L75 E;  1PGQ A;  1X8Y A;  1VPC A;  3BAS A;  2E76 D;  1KIL B;  3V2N A;  3L73 E;  3AED C;  5AVW B;  3AE7 C;  3AE4 C;  5CMZ A;  1JCC A;  2KYV A;  1GK6 A;  5H2F E;  2OAR A;  2WZ7 A;  2FXP A;  1NU1 J;  4W7Z A;  3CXH H;  1J1E B;  2FYZ A;  3RK3 D;  1ZW0 A;  2P67 A;  2AXT E;  1BSN A;  4I7Z B;  1EDL A;  3EQ2 A;  4JYB A;  1U57 A;  4K3A A;  1FOS F;  4PJ0 E;  1KQL A;  2MJZ A;  3L70 E;  5TIS E;  2LKM A;  5GTI E;  1ZME C;  5AW1 B;  2Y0E A;  1EXJ A;  1OIP A;  1BCC D;  2IBZ D;  3NMD A;  5APQ A;  5APY A;  3H1H J;  3GF7 A;  4WY4 D;  1ZRT D;  1RHZ B;  2H43 A;  2YMY A;  3WUT A;  5BU8 B;  2WPS A;  3F89 A;  3H1H G;  1L0N E;  4HKZ H;  3WUU A;  3W68 A;  2PFX A;  2E75 D;  3L71 J;  5AW9 B;  1P84 E;  3AE9 C;  3CCE P;  2KSE A;  1FC2 C;  2FYU E;  4ZMD A;  3SWY A;  1MZ9 A;  4H13 C;  1KIL A;  2N1T B;  1K04 A;  2AEJ A;  5CCH D;  3S4R A;  3L35 A;  3V2R A;  3IFM A;  1KOR A;  4XFJ A;  2AEF A;  3O6Q B;  3CXH I;  1RQV A;  3H1L E;  1VQK P;  1PPJ G;  4BRY A;  2LR2 A;  3CWB D;  1BSH A;  5E79 H;  1LTT C;  1QGK B;  1CSB A;  1RF1 B;  1HH0 A;  2O1J A;  2XNX A;  5APU A;  2WTY A;  3BAT A;  3I5C A;  5DJU B;  2MKV A;  2NZ2 A;  1CZQ A;  3D71 A;  3GG2 A;  1QLE D;  1LTI C;  3ZDM A;  3JSV C;  4YPC A;  1RF0 A;  3H6P A;  1QVF O;  3USS A;  3VTP C;  3V2P A;  1KYO D;  1FOS E;  2QJP C;  2WSF H;  1DIP A;  1XTC C;  1GL2 B;  1VQ4 P;  3RK3 E;  3H1K D;  4IOI H;  1KN7 A;  1S3J A;  2D2C B;  2YIU B;  4B86 A;  1Y9B A;  2N1T A;  3RGU A;  3N4X A;  1BCC E;  2IBZ E;  1JTH A;  1UII A;  2WSC H;  2K1A A;  1IFN A;  1ZP0 C;  1OVR A;  3LW5 J;  1ZRT E;  1S4X A;  2M8R A;  3S9O A;  1DEB A;  5KTB A;  1RF0 C;  2IBZ I;  3SSU A;  1JCD A;  5AW5 B;  2I1K A;  3CCL P;  1LWU B;  1SQV D;  2QM8 A;  2XU6 A;  4R4M A;  1YQ4 C;  5KLV J;  2KLU A;  2GUS A;  2W90 A;  2I1J A;  5KKZ C;  4N78 D;  2N1T C;  3H1J D;  1W2E A;  4GOE A;  2JWD A;  5KLV G;  3A7O A;  4GDO A;  1JY3 P;  1SQP J;  3QWO C;  2BEQ D;  1NAY A;  1YQ3 C;  1D7M A;  2JP3 A;  3OA7 A;  1RQU A;  2E5Y A;  2ZVO B;  1JY2 N;  1H8A A;  3SFE C;  1M8O B;  5AW6 B;  3D6Y A;  5KLV K;  3T97 A;  1HGZ A;  1S1C X;  4AQR D;  1IJD B;  1S5L H;  2XV5 A;  5B5E H;  5KAI H;  4GIF A;  2JWA A;  1NKN A;  2HFE D;  1LTS C;  3UIA A;  3TF5 A;  2KXP B;  4U7J A;  3MTU E;  1KQG B;  4OVN F;  2LXC B;  1SQX D;  3SFD C;  1Q7Y Q;  1KYO E;  2D2C C;  2YIU C;  2KUB A;  2C0W A;  4WWI A;  3H1K E;  3VN0 A;  4L75 A;  5KJ7 A;  4Z1M H;  4HYT B;  1A02 F;  1K73 Q;  2QEX P;  3U1A A;  2ZT9 D;  1GL2 D;  2CK3 H;  2YO2 A;  1Q86 Q;  3ABV C;  2QA4 P;  3RBX A;  1BDD A;  5KLI C;  3PRJ A;  1AA0 A;  3CD6 P;  3L74 J;  3ITK A;  4PV1 C;  2Y9Y A;  1ZV8 A;  3II6 A;  3L74 G;  1SQV E;  2V4H A;  2WSS H;  5KJ7 C;  1GW3 A;  1LTJ C;  1S5L E;  2N9B A;  2C9N Y;  4N78 E;  1H89 A;  3IAO A;  3H1J E;  1FDI A;  5KAI E;  3U1C A;  2A06 D;  3M91 A;  2QJY B;  1NWQ A;  1DD3 A;  1S72 P;  2KOG A;  1IO4 A;  3C9I A;  2OGU A;  2P7J A;  2A45 H;  5C39 A;  3PH0 A;  2QRX A;  1NAF A;  2WQY C;  3JC2 2;  2M3B A;  1YJN P;  3B5N B;  1KTM A;  1K05 A;  1OVU A;  1EDJ A;  1VF5 D;  2R3S A;  3AE6 C;  3VMZ A;  2FXM A;  1X9V A;  3MUD A;  1HJ0 A;  1LTA C;  2B9B A;  2IZ0 A;  3AEG C;  2POH A;  1H0T B;  2HOD B;  1M7L A;  1NO4 A;  5B66 H;  3IN6 A;  4WB4 A;  3L72 J;  5CJ4 A;  1KC8 Q;  1NTZ E;  1SFC B;  1LTG C;  1EQ7 A;  2BCC D;  3TNU A;  2WSE H;  1YJ9 P;  3L72 G;  1HWT C;  1HGV A;  1JNM A;  3V4W A;  3E1R A;  4UB6 H;  4JQ0 D;  4IFD K;  2E43 A;  3MUD C;  4N6J A;  2W6A A;  1OFC X;  1SQB J;  3FX0 A;  5M1B A;  1R5L A;  1VQ6 P;  1FZG A;  3I55 P;  3B5N A;  1IFD A;  2NPS B;  5DJT B;  3L37 A;  2Z4E A;  3NXS A;  2A45 I;  2QG4 A;  3L75 J;  3O8Z A;  5APX A;  2HG5 D;  1M56 D;  3L73 J;  4RES B;  3RK2 D;  1QL1 A;  3FWL A;  3L75 G;  3R4Y A;  1FZB A;  2ZVN B;  5KAF E;  4ASV A;  3RL0 D;  3OJA B;  4GKG A;  2A06 E;  3L73 G;  2WSE J;  1H0T A;  2HOD A;  5CBO A;  2O3J A;  3G4S P;  1PGP A;  5B66 E;  5CJ0 A;  1JY2 P;  4NPD A;  4RO0 A;  3VP9 A;  3B5N C;  3CCR P;  1NTK J;  1SFC A;  2R32 A;  1AFO A;  2M0B A;  3L70 J;  3H1I D;  4I1L A;  3RK3 C;  2K37 A;  1NTK G;  3RL0 g;  1N73 B;  4UB6 E;  3HUS B;  1NU1 G;  3L70 G;  3Q1M A;  2QJP B;  3PP5 A;  3TYY A;  1OW6 A;  2ZYA A;  5AVU B;  2FFD C;  4BRY B;  1VQL P;  1J2J B;  1N7S A;  5AW4 B;  1L0N J;  2Y0C A;  2V7Q H;  3V2Q A;  2NPS A;  2OYH C;  1PFI A;  2B87 A;  2R5B A;  3A3Y B;  1L0N G;  4PD4 D;  1URQ D;  3Q3D A;  1LTB C;  2PAJ A;  1SFC C;  3H25 A;  1N86 A;  1PZQ A;  3E7K A;  3CX5 D;  1NTK K;  2FYU J;  1OW8 A;  2JR8 A;  1SQQ D;  3CC4 P;  1NU1 K;  2J59 M;  3MZW B;  4EI2 A;  2BCC E;  1L2P A;  3BRV B;  1VQ7 P;  1JB0 J;  1FS0 E;  2IX7 C;  2AXC A;  4DZO A;  3AEE C;  2QSI A;  3GF3 A;  3TK1 A;  2KS1 B;  5CCG A;  3BRT B;  1N7S C;  2Q6Q A;  3L71 G;  2WIT A;  5KKZ B;  2XDJ A;  1SVF A;  5GTH E;  2R3C A;  3AEF C;  1TU3 F;  5AW7 B;  1P84 I;  2NPS C;  3GHG B;  3H1L J;  4H44 C;  2J58 A;  2HR3 A;  1JTH B;  4D6T D;  1L4A A;  3FXD A;  2Q5U A;  3H1L G;  1PV3 A;  1N73 A;  3HUS A;  4H13 D;  2WT7 A;  2IDB A;  3CX5 H;  1S2E A;  1YI2 P;  3KXD A;  4L76 A;  3H32 B;  3KQG A;  3G71 P;  3G9R A;  4XA4 A;  5CCG C;  2W83 C;  1X22 A;  5BVZ A;  1KFM A;  2YO3 A;  3FXE A;  3AEC C;  3MIW A;  3KPE A;  5TJH A;  2W8Z A;  1KQS O;  3Q5R A;  1OW7 A;  1BGY D;  2Y9Z A;  2ZAE B;  1KV4 A;  1L4A C;  3PLN A;  3H1I E;  1N73 C;  4KHX A;  1YJW P;  3HUS C;  1M1J A;  1KIL D;  2IPP A;  2O01 N;  1BCC J;  3U59 A;  2KS1 A;  5AW3 B;  1QL2 A;  1JM0 A;  2IBZ G;  2M5A A;  2LXB A;  5AVY B;  4C46 A;  5AVT B;  4NPF X;  3T97 B;  3GHG A;  4YTP C;  3TSI A;  4OWF A;  1LT9 A;  1L0L D;  1JMM A;  3L4F A;  3TGU J;  1YHQ P;  3AE2 C;  4XE5 B;  5KLI B;  1G1I A;  3JCU H;  1NVO A;  2YKQ A;  3CX5 E;  3TGU G;  1SQQ E;  1T3J A;  1M1J C;  3H32 A;  4W7Y A;  1GW4 A;  4PV1 B;  1UIX A;  1KYO H;  2Q1K A;  3CX5 I;  1FZC A;  2O01 H;  3BCC D;  2L91 A;  4A7P A;  2WSF J;  1YTZ T;  5CBN A;  1LTJ B;  3GHG C;  1JY2 O;  1LT9 C;  5AW0 B;  4EYY Q;  4GT1 A;  4GOF A;  2PRR A;  3P7K A;  1OVV A;  3L74 D;  3V6I A;  1SQP G;  4JBZ A;  4D6T E;  3CCJ P;  2N1T D;  1SLQ A;  4UB8 E;  2WSC J;  1RY3 A;  3VMA A;  4IL6 H;  2QJK C;  5AW8 B;  2JEE A;  1WT6 A;  1JEK A;  1FZC C;  1FZF A;  4K35 A;  4OGQ C;  3WMM 0;  3CWB E;  1WRG A;  3OW2 O;  1YTZ I;  1J1D B;  2QM7 A;  3M0D A;  4H0L C;  2O01 J;  1YBK A;  1VQP P;  1VQ9 P;  1SQP K;  1IFM A;  3CCQ P;  1BGY E;  3JCU E;  2UWJ E;  1R5S A;  1M90 Q;  3B4S A;  1KZU B;  1DX7 A;  5EFW B;  3CCV P;  1RE4 A;  1CW5 A;  2B89 A;  1KIL E;  1S5L X;  1ZR4 A;  3MD0 A;  1PP9 D;  4EOT A;  1EC5 A;  1LTJ A;  3HD7 A;  1EXI A;  2ZT9 C;  2FY8 A;  1KYO I;  3M0D C;  3WUV A;  5AVR B;  1VQN P;  4I6M C;  1N8R Q;  2KIK A;  1T2K D;  2H89 C;  1L0L E;  1SQV J;  2D2C D;  3W67 A;  1EZV D;  1EDI A;  1KB9 D;  1KD1 Q;  3MP7 B;  2YXQ B;  1DEE G;  1FZA A;  2K3R A;  1VL2 A;  1SQV G;  2QVA A;  3H1J J;  4C7N A;  1U7J A;  3MGN A;  4IL6 E;  2DW3 A;  1RE4 C;  3F5H A;  3H1J G;  2WVR A;  2Q7C A; 
#chains in the Genus database with same CATH homology
 3A0B H;  2AXT H;  4UB6 H;  5B66 H;  3A0H H;  4UB8 H;  5H2F H;  5KAF H;  4PJ0 H;  3WU2 H;  5TIS H;  5E79 H;  1S5L H;  3JCU H;  3KZI H;  5GTH H;  5GTI H;  5B5E H;  5KAI H;  4IL6 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...