4AQRD

Crystal structure of calmodulin in complex with the regulatory domain of a plasma-membrane ca2+-atpase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
57
structure length
57
Chain Sequence
SSIERLQQWRKAALVLNASRRFRYTLDLKKEQETREMRQKIRSHAHALLAANRFMDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ca-binding protein/hydrolase
molecule keywords CALMODULIN-7
publication title A Bimodular Mechanism of Calcium Control in Eukaryotes
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 27
structure length 57
sequence length 57
ec nomenclature ec 7.2.2.10: P-type Ca(2+) transporter.
pdb deposition date 2012-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4aqrD00
3P8MC 3B8EB 4LC1A 1X8YA 5AW6B 4C46A 4C7NA 3M0DA 2P67A 1J2JB 2YO3A 1NWQA 1SLQA 4AUWA 2WPRA 1HUCA 3L35A 5AW1B 1MFZA 5APQA 4M3LA 4AYCA 5AVZB 4GT1A 1FOSE 3M0AA 2WPQA 2WWWA 1HWTC 2YO2A 1GK6A 3L36A 3LIDA 1JNMA 1G2CB 1H89A 3UIAA 1NAFA 3M06A 1H8AA 4GKGA 1T2KD 3HE4B 5AVTB 5AW9B 1A02J 2C9LY 1OWAA 3TNUA 3A2AA 1HBWA 5AVVB 3HE4A 2Q7CA 3T97A 1GTWA 4AQRD 1FAVA 1GK4A 1CI6B 4RESB 4KHXA 3VN0A 3VMXA 1OXZA 2R5BA 5AVYB 5AVWB 1MV8A 2P7JA 2XV5A 2R32A 1CI6A 4B86A 3TK1A 4JYCA 1JUNA 1CZQA 4EOTA 3MD0A 2R3CA 3TYYA 1H88A 3A5TA 1S9KE 1T2KC 5APSA 5APXA 2P2UA 4JYBA 3KDPB 5AW2B 2W27A 1GZLA 3M9HA 3VTPC 1KQLA 3MGNA 3OAKA 1YYCA 3I5CA 2N9BA 2E43A 2KP8A 1MUUA 3NXSA 5AVQB 4I2LC 3VMYA 1FOSF 3L37A 2QM7A 1A02F 2ZXEB 2W6AA 2XZRA 2JJLA 5AW3B 3O8ZA 4DZOA 3A7OA 3LIEA 4HYTB 5APTA 2Z5HA 1SP4A 3V4QA 1DH3A 2IPPA 5AVSB 2C9NY 5APWA 3NFQA 2VRSA 1GU4A 2BASA 4XE5B 5APVA 3HE5B 3KQGA 1IO4A 2WPSA 2QM8A 2XU6A 3IR9A 2Q5UA 3P32A 5AVRB 3NTNA 3P7KA 1S9KD 2E42A 5CMZA 3NMDA 2Q3IA 1GU5A 2YNYA 3A3YB 3HE5A 3V5BA 5AVUB 3M9BA 1CSBA 3M91A 2WT7B 2WTYA 2H7HA 5AW0B 5APYA 3V4WA 5AW4B 5APUA 5AW5B 5AW8B 3TNUB 5AVXB 3HTKA 3VMZA 4C7NB 2R5DA 2ZFCA 2WT7A 5AW7B 4I6MC 3SWFA 2Z5IA 1GD2E 1HJBA 3VYIA
chains in the Genus database with same CATH superfamily
3AEFC 2KI7B 3L75D 4DCKA 3QH9A 1LWUC 3M0DA 2HODB 4NPDA 3L35A 5AW1B 1ZXGA 4ASWA 1AA0A 5AVZB 1KILA 1S5LH 3VP9A 3L70J 4Y99C 3M06A 1SQVG 4JBZA 1RE3C 2QSIA 1JY3N 1RF0A 2B89A 3VN0A 4KHXA 2H43A 1BCCE 1USDA 1NTZK 2E74B 2R3CA 4OGQB 5CJ0A 3PH0A 5KKZB 3AE9C 3RK3B 1G2CA 3G9RA 2QJPC 1JO5A 1EZVE 3NXSA 2OYHA 2IBZD 4R4LA 2XZRA 1Q86Q 5CJ4A 3HD7C 1BDDA 1LTSC 1NTKE 2WQYC 3H1JG 2HLOA 3L75G 1SQQD 1IO4A 2O3JA 5CCHA 1PGPA 3D70A 4H44C 3AECC 1T6AA 3VOPA 1E5WA 3CXHE 3CCUP 4IFMA 5CMZA 1LP1B 4L74A 4IFFA 1NU1G 3JSVC 3I56P 1KYOH 1NTMJ 5AW5B 3VMZA 1BDCA 3L73D 3P8MC 2H8PD 2QJYC 3CCEP 4RO0A 1RF1C 2WZ7A 2LR2A 2E76B 2QJPB 3H6PA 1GK6A 4PV1C 3H1HD 1VQ9P 1URQA 2QEXP 3H1IJ 2RKLA 5AVVB 1GTWA 2XKMA 2POHA 1NO4A 3L70D 4H44B 1GW4A 3MD0A 5KLIC 4WY4A 1VQ5P 1RE4C 1T3JA 2NRGA 1OW8A 5TJHA 3SWKA 2AEJA 2WSCH 3KDPB 1SQQG 1JY2O 1VQNP 1FZCA 2XNXA 2QJYB 3HRNA 1LJ2A 2Q3EA 3H1KG 1PGJA 1BGYE 4HB1A 2K37A 3BCCG 2FYUG 2PAJA 2I1JA 1KZUB 3A0HE 5CCGC 3L73G 5APWA 3L71G 1DX7A 1ZR4A 2Q5UA 3NTNA 3LW5J 3A3YB 1EC5A 3F5HA 2WT7B 5AW0B 1BE3D 3KXDA 3AEDC 3HTKA 3B5ND 2HR3A 3FXDA 5KLIB 5GTHH 1JB0J 3V2NA 3U1CA 1SLQA 2OQQA 1P84E 4PD4D 5APQA 1NTMD 3WUVA 3L36A 4EDFA 3MZWB 5KAFE 1KD1Q 5AVTB 1JY3O 2PGDA 1U57A 2ZYAA 1N73C 2KXPB 1KFNA 5TISE 3EWKA 2R3SA 2XV5A 2M3EA 1CI6A 2HPCB 2H88C 1BSNA 3TYYA 3QWOC 5AW2B 1KB9E 1R8EA 1FZAA 3MGNA 3OAKA 2FY8A 5H2FE 1YYCA 1NTZD 1GL2A 1N2DC 2JDIH 3WUUA 3L75E 1IK9A 3O8ZA 3BASA 5APTA 1JY2P 2BEZF 1VQMP 2HYNA 4D6TD 1X79B 2J5UA 1PIXA 1RQVA 3AE7C 4BRYA 2KB7P 4C7RA 2AXTE 2H89C 1SFCA 1JTHA 3B8EB 4H13D 1N7SA 5B5EH 4XFJA 1YTZI 3E1RA 3AEBC 2WWWA 2HODA 1LTIC 3H1IG 1H89A 3OW2O 3UIAA 1NAFA 1Q81Q 5AW9B 3WU2H 2QA4P 1OWAA 2O01H 4WVZA 2IBZE 3A2AA 1NJIQ 2K3RA 2IFNA 3D6YA 4PJ0E 3MUDA 4XA4A 1FZGA 3KPEA 3RK2D 2E5TA 1KTMA 1IFPA 4EOTA 1SQQE 2BCCD 1LTBC 1L0NJ 1ZN5A 2LXCB 3AEEC 1KV4A 1KQLA 4WWIA 1X0TA 2FYUE 3RBXA 1M1JC 3L73E 1FE6A 1BCCG 2ZYGA 1RQUA 4LGDE 2IPPA 3V2RA 1NOHA 3H1HE 4U3FJ 1SQBK 3H32B 4IL6X 3KYQA 1LP1A 5AW4B 3G3ZA 3L4FA 4I6MC 3L70E 2WPVB 1QX8A 3B5NB 2Q9IA 4N6JA 3JC22 3GG2A 3L72J 1NTKG 4M3LA 3ITKA 2O1JA 2M5AB 2V7QJ 3CX5D 2B87B 1FBMA 2YO2A 4I1LA 2RN0A 1J1DB 2B9BA 2Y9ZA 1IFIA 1L4AA 3SWYA 3OJAB 5GTIE 4YTPC 3CCRP 1E79H 2Y0DA 2R32A 5E79E 3BRTB 1U7JA 1QL1A 4JYCA 1N8RQ 3HD7D 1H88A 1NKNA 1KFMA 5KJ7A 3C8VA 5KTBA 4H13C 2KZJA 1BE3E 1ZRTD 1N7LA 4JF7A 1KC8Q 1FZEA 3HUSC 1NKZB 5AW3B 1ZOYC 4PD4E 2J58A 4YPCA 2KOGA 2XDJA 1NH4A 1GU4A 1NYHA 4XE5B 1NTME 1YTZT 4WBAA 3P32A 5DJTB 3A0BE 4DJGA 1CSBA 2UWJE 3AEGC 4PV1D 1Q7YQ 5APUA 3N4XA 2WT7A 2WSSH 3EQ2A 1KQGB 1X8YA 3C1LA 1LT9C 1HVVA 3H1LD 1HUCA 1KYOD 3H1IE 4H13B 4HH2A 3R4YA 3E7KA 2P58A 4H0LD 2HG5D 2RH0A 2K88A 3H1HJ 1A02J 4UB8E 2CK3H 3P8CD 4ZNCA 3L72D 2YXRB 1LGHB 5AVYB 1VPCA 1YJWP 2FFDC 2IX7C 2GUVA 3CX5I 1L0NG 4D6TE 5CCGD 1FC2C 2WVRA 3RK2B 3IF4A 5CBOA 1OW7A 1WT6A 1W2BO 5B66E 3AE4C 4W7YA 2OGUA 2NPSB 3EFFK 3N7NA 1LT9B 1HJ0A 2YKQA 1ZLLA 3H25A 1ZW0A 2CPSA 4L73A 4OVNF 2K9JB 5KLVJ 1JMBA 2KS1B 2W6JH 4U3FG 3TGUJ 3KHUA 4Y28J 1T3UA 5BU8B 2JWAA 1OX3A 2GM4A 1LWUB 1LT1A 2QRXA 1BE3J 4Y99B 2WSEH 1NVOA 2GA1A 3KZIE 1MFTA 3L72G 1HTLC 2A06D 1VQPP 2OTJP 5KAFH 1HWTC 3L74J 1JNMA 3Q5RA 2M0BA 3IFMA 3RL0g 1S72P 3PP5A 5TISH 1G1JA 4UB6E 3S1KA 3RK3E 1MV8A 1IFNA 2LKMA 1KYOI 5CCHD 3RL0D 2L91A 2I1KA 1KB9H 3ZDMA 5CBNA 5H2FH 3HD7B 1USEA 1M90Q 2V4HA 2PFXA 1S1CX 2N9BA 1SQPK 2J59M 2OTKE 1TU3F 3SFEC 1NTZJ 2IBZG 2YKPA 1KB9I 3V2PA 5K5GB 3RGUA 2JJLA 1XTCC 4H0LC 1ZR2A 2C9NY 1ZV8A 2YMYA 1OW6A 1AVOA 2A06G 4D6TJ 1VQ6P 2AEFA 1SQXK 1RF1B 5KLVD 3TNUB 1PZQA 3H32A 1NAYA 3TSIA 4PV1B 3M9QA 3TGUD 4IL6H 5AW6B 2KLVA 1IFDA 3B5NA 1JCCA 3M0DC 1HGVA 2PP6A 1BSHA 3SSUA 3H1HG 5L8RJ 2M5AA 1KILC 1H8AA 2B87A 4DT0A 4N78D 1ZRTE 1GK4A 2WSFH 1L0NE 1FZBA 3L74D 1RF0C 1KORA 3L70G 4K35A 1NGMB 2ZXXA 4ZKPA 1DEEG 3A5TA 2YIUC 2KNCB 1L0LK 2BCCJ 2JP3A 3AE5C 3U1AA 1M7LA 1PPJD 1QGKB 3GHGA 1SQPJ 2A45G 1EDKA 2OYOA 5KLVG 2SPZA 4U3FE 4OH8B 1EXIA 2OYHC 1AV1A 1DH3A 3IN6A 2BASA 1VF5D 1L2PA 1LTJC 2QJKC 1IFMA 4QMAA 5AVUB 4ZKUA 5CCHC 1FJPA 3P8CE 2Y0EA 3L72E 1BE3G 3RL0C 1DD3A 1SQVK 4L76A 1PGQA 1Q2NA 3USSA 1DD4A 1OZHA 2QE7H 3L74G 2W90A 1N73B 1NTMG 1G2CB 2IDBA 3HE4B 5GTIH 1SS1A 4OWFA 1HBWA 3O6QB 5E79H 2GUSA 2MJZA 1LTJB 2K9YA 1JUNA 2KSEA 5APSA 4YXWH 1Q90D 2E75D 4U7JA 3RL0B 2N1TD 1L0LJ 3GF3A 1QVGO 2YXQB 3I5CA 1NTZG 1N7SD 5AVQB 1WMKA 1AQTA 1NU1K 2IFMA 2BEQD 4PD4H 2NPSA 1AJYA 1FZCC 4GDOA 3EFGA 3FX0A 4L75A 2ZVNB 2ITAA 2A06E 2JWDA 1VQLP 3A0BH 2QM8A 2XU6A 4D6TG 4LLHA 5GTHE 2KS1A 3CCSP 1SQPD 3Q5SA 2Q3IA 3F89A 2WTYA 2FXOA 5BU5A 4KT0J 1LWUA 2NZ2A 3BATA 1IZNB 3PLNA 5KAIE 2W6BA 1YI2P 4IOIH 1K04A 1MFZA 1N86A 3H1LJ 1RE3A 2JEEA 1SQXD 4UB8H 3S9OA 3AE6C 3BRVB 3GW6A 1QEXA 1SQQK 4HKZH 1VF5C 3TF5A 5AVWB 3AE3C 3CPWO 2FYUK 2BCCG 1W5CE 1M1JB 1T2KC 5B66H 2ZT9C 3H1JJ 1M56D 1IK7A 2FYZA 3BVHA 1R5LA 3HD7A 5KLVE 2KP8A 3CMAP 3LW5H 2QM7A 3W67A 3TGUE 1W2EA 1NU1J 1Y8AA 1LTTC 2WSCJ 1GL2C 1L0LD 2KZIA 1FU1A 3V4QA 1BGYD 1S4XA 5APVA 3HE5B 3KQGA 3CWBJ 3AE2C 2E76D 1IFJA 1L4AD 4IFDK 1VF5B 5B5EE 2P1JA 4N78E 3V4WA 1VL2A 1JCDA 3E1IA 1QL2A 3KZIH 1EZVI 1DIPA 3G6EP 1GD2E 1HH0A 3VYIA 1RF1A 1HJBA 2E75C 3L74E 3CXHH 2N1TC 1OFCX 1SFCC 4AUWA 5KJ7D 2WPQA 1N7SC 1SQBJ 2P10A 3V2QA 1SQVD 2AEMA 1PPJE 3CXHI 1K8AQ 2W83C 4ZMDA 2Q7CA 2IZ0A 1Z56A 1FS0E 1OXZA 1AQ5A 1YHQP 1SVFA 1RE4A 2P7JA 1FJKA 3SFDC 2WITA 3U59A 3V6IA 1YJ9P 3D6ZA 3MUDC 2YMKA 2YKOA 3BCCJ 3I55P 1S3JA 5APXA 1NTZE 3HUSB 3CL3D 1YQ3C 3L71J 3B4SA 2KNCA 2OYIC 2E75B 1AVYA 1ZP0C 2N1TB 1HGZA 5M1BA 2E74C 1KB9D 5CCGA 4OGQC 5KKZC 1FZFA 2FXPA 1N7SB 2Z5HA 3MIWA 4GODA 2IYOA 2KYVA 3H1JD 2B88A 2N9YB 2HPCA 3CD6P 1VQ7P 1OIPA 2JO1A 4K3AA 1NU1D 2HFED 3A0HH 4MN4C 4JQ0D 4TT3H 1KILD 3SWFA 4GIFA 3CWBD 4BXLA 4LC1A 1H0TB 1IC2A 1KQSO 1J2JB 2YO3A 1NWQA 3W68A 3H1LG 3IAOA 4AYCA 1FOSE 2C0WA 2RMZA 2OYIB 1GW3A 2KSJA 2FFDB 1N73A 2WMMA 1U7MA 2C9LY 1P84H 1QLED 1AFOA 3HE4A 2E76C 2D2CD 2O1KA 2OTLP 2BCCE 3MP7B 1L4AC 1SQBD 3Q3DA 3O6QA 1YITP 5DJUB 1VQKP 1T8ZA 3CCLP 1OMIA 1LTJA 1FDMA 1P84I 3Q5PA 1PFIA 1YIJP 2Y9YA 1SQPE 2O01J 1GZLA 1PL5A 3VTPC 2K1AA 2E43A 5KJ7C 1KMIZ 3H1KD 3L37A 3JCUE 1A02F 2W6AA 3BCCD 1YBKA 2FYUD 4DZOA 3LIEA 1SP4A 3CWBG 3CCQP 3L71D 3NFQA 2L5GB 2M8RA 2WPSA 1PP9J 1PGOA 1SQXE 1JOCA 1NTKK 3CCMP 1L4AB 2V7QH 1K73Q 1K05A 4C7NB 5CHXA 2PRRA 4C46A 2G3AA 1URQD 3CX5E 2WPRA 3PTZA 1SQBG 3M0AA 2AXTH 1Y9BA 3LIDA 4EIJA 1S5LE 3T97B 4RKUJ 4AQRD 4WY4D 1FAVA 4RESB 3VMXA 2LXBA 2JR8A 3WUTA 1L0LE 1QVFO 2IZ1A 4B86A 2Q1KA 1D7MA 1BCCJ 1LNQA 2P2UA 3R2PA 4PJ0H 3VMAA 1M1JA 4H0LB 4I2LC 4DOJA 2FXMA 4NPFX 2IBZI 4W7ZA 3CC2P 1LTGC 2FBWC 2ZJSE 3AEAC 3A7OA 4HYTB 2MKVA 2JKVA 3C9IA 4EI2A 2VRSA 2W8ZA 3PJSK 3MTUE 3CCVP 1GMJA 3IR9A 1S9KD 2E42A 1SQVE 2D2CC 1GU5A 3HE5A 1WRGA 1NTKJ 1K9MQ 2H7HA 1VQ8P 1VQOP 2AXCA 2QIWA 5AW8B 5KAIH 2ZFCA 3H1LE 2KLUA 2E5YA 2Z5IA 1S5LX 1KYOE 1PP9D 3TGUG 2QVAA 1KILB 3B71A 1R5SA 4GOFA 4GT1A 3Q2YA 2C0XA 1YQ4C 4BWNA 3PRJA 1JEKA 3H1ID 1L0NK 1MZ9A 5BVZA 3D71A 4R4MA 1T2KD 1G1IA 1SQXJ 2R44A 2ZT9D 3AE8C 2YIUB 1FDOA 1EDJA 5C39A 1NHLA 3G71P 3H1JE 2FYNC 2D2CB 2ZAEB 1GL2D 2A45H 1NU1E 1M57D 2OYHB 1PPJG 1URQC 1S2EA 3HUSA 1UIXA 1KILE 3CI9A 1PV3A 1KQFB 2QJKB 1FOSF 1EXJA 3CWBE 2A45I 2N1TA 2FKWB 1BCCD 4NPEA 4WB4A 1HF9A 2Y0CA 1PP9G 4I7ZC 1JMMA 1SFCD 1BGYJ 3RBZA 4IL6E 4WY4C 5AVRB 1OVVA 2YNYA 3V5BA 4A7PA 2QG4A 3M9BA 3MHVA 3M91A 5APYA 1EZVD 2FYNB 1LT9A 2ZYDA 1SQBE 1Y47A 2M3BA 2K9JA 1NTKD 1H0TA 4PD4I 4GOEA 1URQB 2Q6QA 2G8YA 1JY3P 1OVUA 1X22A 3CXHD 2OYIA 1VDFA 4GKGA 2WSEJ 3B5NC 2NPSD 3OA7A 1SQVJ 2FFDA 1OVRA 3H1KE 3TDKA 3BCCE 4I7ZB 2E74D 2I8DA 2ZVOB 1J1DC 1IJDB 4OGQD 2KK7A 4WY4B 3L71E 1CZQA 3RK3D 1VQ4P 3WMM0 1YJNP 3G4SP 1FZCB 4JYBA 1GDTA 1J1EC 2KUBA 1Q82Q 3VMYA 3ABVC 4RJTA 1DEBA 1EZVG 3GHGC 3CLQA 3FGAD 1M1KQ 1MKMA 3L75J 3K5BA 4ASVA 3P7KA 4N3YB 1SQPG 3NMDA 4HJGH 3HTKB 3FWLA 1RY3A 3FXEA 4EYYQ 1KN7A 2R5DA 5AW7B 4KJMA 4C7NA 3GLMA 4JPZB 2P67A 1LTAC 2CPBA 1UIIA 1J1EB 3PHLA 3GMAA 1X9VA 3AE1C 1SQXG 1RH5B 2Z4EA 4TLFA 3GF7A 1EQ7A 3GHGB 4CPGA 3TNUA 4H44D 3T97A 3WU2E 3VP8A 1CI6B 4O9BA 2ZT9B 2R5BA 4Z1MH 1EDLA 3TK1A 1P84D 2O01N 1L0ND 5KLVK 1JM0A 2DW3A 1S9KE 4UB6H 2W27A 3M9HA 3Q1MA 1GL2B 1CW5A 2WSFJ 1JY2N 1SQQJ 3JCUH 1MUUA 4YXDC 2KIKA 3RK2C 1PP9E 2ZXEB 3CC7P 3H1KJ 1FDIA 5EFWB 2FYUJ 1L0LG 1EDIA 5AVSB 1BGYG 2NPSC 2XNDH 3II6A 4U3FD 3L73J 4BRYB 3S4RA 3CCJP 3CC4P 2OARA 1M8OB 3CMEP 1SFCB 1NTMK 1ZMEC 1JTHB 4W80A 5AVXB 3RK3C 1XTGB 1RHZB 3CX5H 2IYPA 3FWNA
chains in the Genus database with same CATH topology
4C46A 1LWUC 1URQD 3M0DA 2HODB 3B5NB 2Q9IA 2WPRA 3L35A 4N6JA 5AW1B 4M3LA 5AVZB 2O1JA 1KILA 3M0AA 3VP9A 1N73B 1FBMA 2YO2A 3LIDA 4I1LA 4Y99C 4EIJA 1G2CB 1J1DB 3M06A 3HE4B 1RE3C 1IFIA 1L4AA 1JY3N 1RF0A 1HBWA 3SWYA 3OJAB 4AQRD 4WY4D 1FAVA 4RESB 3VN0A 4KHXA 2H43A 2GUSA 3VMXA 1NTZK 2MJZA 1LTJB 2R32A 3BRTB 4B86A 1QL1A 4JYCA 1JUNA 3HD7D 2R3CA 1H88A 5CJ0A 5APSA 1NKNA 2P2UA 1KFMA 3R2PA 3RL0B 5KJ7A 2N1TD 3RK3B 1G2CA 1M1JA 5KTBA 3I5CA 1JO5A 3NXSA 1N7SD 5AVQB 4I2LC 2OYHA 1NU1K 4DOJA 2IFMA 2FXMA 2NPSA 4W7ZA 1N7LA 4JF7A 1FZCC 1FZEA 2XZRA 3HUSC 1LTGC 1NKZB 3HD7C 5AW3B 5CJ4A 3A7OA 4HYTB 3EFGA 1LTSC 2J58A 2KOGA 3C9IA 2XDJA 1NH4A 2HLOA 2VRSA 4XE5B 1GU4A 3MTUE 1IO4A 1YTZT 2QM8A 5CCHA 2XU6A 4LLHA 3IR9A 4WBAA 3P32A 3VOPA 1E5WA 1S9KD 2E42A 4IFMA 5CMZA 2Q3IA 1GU5A 3HE5A 1WRGA 4IFFA 1CSBA 2WTYA 2H7HA 5BU5A 5APUA 5AW5B 5AW8B 3N4XA 1LWUA 3VMZA 2WT7A 2ZFCA 3EQ2A 2Z5IA 3BATA 3P8MC 2W6BA 1X8YA 2H8PD 1KILB 1LT9C 1HVVA 1HUCA 1MFZA 1N86A 4GT1A 1RF1C 1RE3A 2C0XA 2WZ7A 2JEEA 3H6PA 1GK6A 4HH2A 3BRVB 1L0NK 1MZ9A 5BVZA 1URQA 2HG5D 1T2KD 1G1IA 1A02J 3P8CD 1SQQK 5AVVB 1GTWA 2XKMA 1LGHB 2POHA 1NO4A 5AVWB 5AVYB 1NHLA 1VPCA 2FFDC 2IX7C 1GW4A 2GUVA 2FYUK 3MD0A 1GL2D 4WY4A 5CCGD 1M1JB 1RE4C 2A45H 1T2KC 1T3JA 3RK2B 2WSCH 3KDPB 2OYHB 1WT6A 1JY2O 2FYZA 4W7YA 1URQC 1FZCA 3BVHA 3HUSA 2NPSB 2XNXA 3HD7A 2KP8A 3HRNA 3N7NA 1LT9B 3CI9A 3LW5H 2YKQA 1FOSF 2QM7A 1ZLLA 2A45I 1W2EA 2N1TA 2CPSA 2FKWB 1LTTC 2PAJA 2I1JA 1KZUB 1GL2C 4WB4A 5CCGC 1FU1A 3V4QA 5APWA 1DX7A 5APVA 3HE5B 1JMMA 1SFCD 3KQGA 1IFJA 1ZR4A 2Q5UA 1T3UA 4WY4C 3NTNA 1L4AD 5AVRB 5BU8B 4IFDK 2YNYA 3A3YB 3V5BA 2GM4A 1LWUB 2P1JA 3M9BA 3M91A 2WT7B 4N78E 5AW0B 5APYA 3V4WA 1JCDA 3E1IA 1QL2A 3HTKA 1LT9A 3B5ND 4Y99B 1GD2E 1HH0A 3VYIA 2WSEH 1HJBA 1RF1A 2N1TC 3V2NA 1HTLC 2M3BA 3U1CA 1SFCC 4AUWA 1SLQA 5KJ7D 5APQA 2WPQA 1N7SC 1URQB 1HWTC 1JY3P 3L36A 1JNMA 3V2QA 2OYIA 1VDFA 4GKGA 3IFMA 5AVTB 3B5NC 1JY3O 2NPSD 3OA7A 2FFDA 3PP5A 2Q7CA 1G1JA 1N73C 1KFNA 1Z56A 1OXZA 1AQ5A 1MV8A 1SVFA 1J1DC 1IFNA 1RE4A 2P7JA 1IJDB 1FJKA 2LKMA 2XV5A 1CI6A 5CCHD 4WY4B 2WITA 3U59A 3RL0D 2HPCB 1CZQA 3RK3D 2I1KA 3TYYA 2YKOA 3WMM0 5APXA 1FZCB 4JYBA 3HUSB 1GDTA 3HD7B 5AW2B 3CL3D 1J1EC 1FZAA 3MGNA 3OAKA 2OYIC 1YYCA 2N9BA 2N1TB 1HGZA 1SQPK 2J59M 1GL2A 1N2DC 5CCGA 3VMYA 2YKPA 3V2PA 1DEBA 1IK9A 2JJLA 1N7SB 3O8ZA 3BASA 1FZFA 3GHGC 3CLQA 5APTA 2Z5HA 1XTCC 3MIWA 2KYVA 1JY2P 1ZR2A 2HPCA 2C9NY 1ZV8A 2YMYA 2HYNA 1X79B 3P7KA 4N3YB 3NMDA 2HFED 3HTKB 2KB7P 4C7RA 1RY3A 1SQXK 1RF1B 3TNUB 1SFCA 1KILD 3H32A 2R5DA 5AW7B 3SWFA 4GIFA 3TSIA 1JTHA 3M9QA 3B8EB 4LC1A 1N7SA 5AW6B 1IC2A 4C7NA 2P67A 1J2JB 2YO3A 1NWQA 2KLVA 1YTZI 1LTAC 2CPBA 4AYCA 1J1EB 1FOSE 2C0WA 1X9VA 2OYIB 1IFDA 2WWWA 1GW3A 2HODA 3B5NA 1JCCA 3M0DC 1HGVA 2PP6A 2KSJA 2FFDB 1LTIC 1H89A 3UIAA 1NAFA 1N73A 1KILC 1H8AA 2Z4EA 5AW9B 1EQ7A 4N78D 2C9LY 3GHGB 1OWAA 2O01H 1AFOA 3TNUA 3A2AA 3HE4A 3T97A 2IFNA 3VP8A 1CI6B 1GK4A 3MUDA 2O1KA 4XA4A 4O9BA 2WSFH 2R5BA 1FZGA 1FZBA 1L4AC 1RF0C 3KPEA 3RK2D 1T8ZA 3TK1A 4EOTA 4ZKPA 5KLVK 1LTBC 1LTJA 1FDMA 1PFIA 3A5TA 1S9KE 1L0LK 3U1AA 1ZN5A 2W27A 1GZLA 1M7LA 3M9HA 3VTPC 1CW5A 1GL2B 1KQLA 1JY2N 2E43A 1MUUA 3GHGA 5KJ7C 2A45G 1M1JC 3L37A 1A02F 3RK2C 2ZXEB 2W6AA 4DZOA 4OH8B 3LIEA 2OYHC 1SP4A 4LGDE 1DH3A 2IPPA 5AVSB 2NPSC 3NFQA 2BASA 3II6A 2L5GB 2M8RA 2WPSA 3V2RA 1LTJC 1NOHA 2OARA 1IFMA 1JOCA 1NTKK 1SQBK 5AVUB 1SFCB 3H32B 4ZKUA 5CCHC 1NTMK 1FJPA 3KYQA 1L4AB 3P8CE 1JTHB 5AW4B 4W80A 3RL0C 5AVXB 3RK3C 3G3ZA 1SQVK 3L4FA 4C7NB 5CHXA 1XTGB 4I6MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P8M C;  3B8E B;  4LC1 A;  1X8Y A;  5AW6 B;  4C46 A;  4C7N A;  3M0D A;  2P67 A;  1J2J B;  2YO3 A;  1NWQ A;  1SLQ A;  4AUW A;  2WPR A;  1HUC A;  3L35 A;  5AW1 B;  1MFZ A;  5APQ A;  4M3L A;  4AYC A;  5AVZ B;  4GT1 A;  1FOS E;  3M0A A;  2WPQ A;  2WWW A;  1HWT C;  2YO2 A;  1GK6 A;  3L36 A;  3LID A;  1JNM A;  1G2C B;  1H89 A;  3UIA A;  1NAF A;  3M06 A;  1H8A A;  4GKG A;  1T2K D;  3HE4 B;  5AVT B;  5AW9 B;  1A02 J;  2C9L Y;  1OWA A;  3TNU A;  3A2A A;  1HBW A;  5AVV B;  3HE4 A;  2Q7C A;  3T97 A;  1GTW A;  4AQR D;  1FAV A;  1GK4 A;  1CI6 B;  4RES B;  4KHX A;  3VN0 A;  3VMX A;  1OXZ A;  2R5B A;  5AVY B;  5AVW B;  1MV8 A;  2P7J A;  2XV5 A;  2R32 A;  1CI6 A;  4B86 A;  3TK1 A;  4JYC A;  1JUN A;  1CZQ A;  4EOT A;  3MD0 A;  2R3C A;  3TYY A;  1H88 A;  3A5T A;  1S9K E;  1T2K C;  5APS A;  5APX A;  2P2U A;  4JYB A;  3KDP B;  5AW2 B;  2W27 A;  1GZL A;  3M9H A;  3VTP C;  1KQL A;  3MGN A;  3OAK A;  1YYC A;  3I5C A;  2N9B A;  2E43 A;  2KP8 A;  1MUU A;  3NXS A;  5AVQ B;  4I2L C;  3VMY A;  1FOS F;  3L37 A;  2QM7 A;  1A02 F;  2ZXE B;  2W6A A;  2XZR A;  2JJL A;  5AW3 B;  3O8Z A;  4DZO A;  3A7O A;  3LIE A;  4HYT B;  5APT A;  2Z5H A;  1SP4 A;  3V4Q A;  1DH3 A;  2IPP A;  5AVS B;  2C9N Y;  5APW A;  3NFQ A;  2VRS A;  1GU4 A;  2BAS A;  4XE5 B;  5APV A;  3HE5 B;  3KQG A;  1IO4 A;  2WPS A;  2QM8 A;  2XU6 A;  3IR9 A;  2Q5U A;  3P32 A;  5AVR B;  3NTN A;  3P7K A;  1S9K D;  2E42 A;  5CMZ A;  3NMD A;  2Q3I A;  1GU5 A;  2YNY A;  3A3Y B;  3HE5 A;  3V5B A;  5AVU B;  3M9B A;  1CSB A;  3M91 A;  2WT7 B;  2WTY A;  2H7H A;  5AW0 B;  5APY A;  3V4W A;  5AW4 B;  5APU A;  5AW5 B;  5AW8 B;  3TNU B;  5AVX B;  3HTK A;  3VMZ A;  4C7N B;  2R5D A;  2ZFC A;  2WT7 A;  5AW7 B;  4I6M C;  3SWF A;  2Z5I A;  1GD2 E;  1HJB A;  3VYI A; 
#chains in the Genus database with same CATH topology
 3AEF C;  2KI7 B;  3L75 D;  4DCK A;  3QH9 A;  1LWU C;  3M0D A;  2HOD B;  4NPD A;  3L35 A;  5AW1 B;  1ZXG A;  4ASW A;  1AA0 A;  5AVZ B;  1KIL A;  1S5L H;  3VP9 A;  3L70 J;  4Y99 C;  3M06 A;  1SQV G;  4JBZ A;  1RE3 C;  2QSI A;  1JY3 N;  1RF0 A;  2B89 A;  3VN0 A;  4KHX A;  2H43 A;  1BCC E;  1USD A;  1NTZ K;  2E74 B;  2R3C A;  4OGQ B;  5CJ0 A;  3PH0 A;  5KKZ B;  3AE9 C;  3RK3 B;  1G2C A;  3G9R A;  2QJP C;  1JO5 A;  1EZV E;  3NXS A;  2OYH A;  2IBZ D;  4R4L A;  2XZR A;  1Q86 Q;  5CJ4 A;  3HD7 C;  1BDD A;  1LTS C;  1NTK E;  2WQY C;  3H1J G;  2HLO A;  3L75 G;  1SQQ D;  1IO4 A;  2O3J A;  5CCH A;  1PGP A;  3D70 A;  4H44 C;  3AEC C;  1T6A A;  3VOP A;  1E5W A;  3CXH E;  3CCU P;  4IFM A;  5CMZ A;  1LP1 B;  4L74 A;  4IFF A;  1NU1 G;  3JSV C;  3I56 P;  1KYO H;  1NTM J;  5AW5 B;  3VMZ A;  1BDC A;  3L73 D;  3P8M C;  2H8P D;  2QJY C;  3CCE P;  4RO0 A;  1RF1 C;  2WZ7 A;  2LR2 A;  2E76 B;  2QJP B;  3H6P A;  1GK6 A;  4PV1 C;  3H1H D;  1VQ9 P;  1URQ A;  2QEX P;  3H1I J;  2RKL A;  5AVV B;  1GTW A;  2XKM A;  2POH A;  1NO4 A;  3L70 D;  4H44 B;  1GW4 A;  3MD0 A;  5KLI C;  4WY4 A;  1VQ5 P;  1RE4 C;  1T3J A;  2NRG A;  1OW8 A;  5TJH A;  3SWK A;  2AEJ A;  2WSC H;  3KDP B;  1SQQ G;  1JY2 O;  1VQN P;  1FZC A;  2XNX A;  2QJY B;  3HRN A;  1LJ2 A;  2Q3E A;  3H1K G;  1PGJ A;  1BGY E;  4HB1 A;  2K37 A;  3BCC G;  2FYU G;  2PAJ A;  2I1J A;  1KZU B;  3A0H E;  5CCG C;  3L73 G;  5APW A;  3L71 G;  1DX7 A;  1ZR4 A;  2Q5U A;  3NTN A;  3LW5 J;  3A3Y B;  1EC5 A;  3F5H A;  2WT7 B;  5AW0 B;  1BE3 D;  3KXD A;  3AED C;  3HTK A;  3B5N D;  2HR3 A;  3FXD A;  5KLI B;  5GTH H;  1JB0 J;  3V2N A;  3U1C A;  1SLQ A;  2OQQ A;  1P84 E;  4PD4 D;  5APQ A;  1NTM D;  3WUV A;  3L36 A;  4EDF A;  3MZW B;  5KAF E;  1KD1 Q;  5AVT B;  1JY3 O;  2PGD A;  1U57 A;  2ZYA A;  1N73 C;  2KXP B;  1KFN A;  5TIS E;  3EWK A;  2R3S A;  2XV5 A;  2M3E A;  1CI6 A;  2HPC B;  2H88 C;  1BSN A;  3TYY A;  3QWO C;  5AW2 B;  1KB9 E;  1R8E A;  1FZA A;  3MGN A;  3OAK A;  2FY8 A;  5H2F E;  1YYC A;  1NTZ D;  1GL2 A;  1N2D C;  2JDI H;  3WUU A;  3L75 E;  1IK9 A;  3O8Z A;  3BAS A;  5APT A;  1JY2 P;  2BEZ F;  1VQM P;  2HYN A;  4D6T D;  1X79 B;  2J5U A;  1PIX A;  1RQV A;  3AE7 C;  4BRY A;  2KB7 P;  4C7R A;  2AXT E;  2H89 C;  1SFC A;  1JTH A;  3B8E B;  4H13 D;  1N7S A;  5B5E H;  4XFJ A;  1YTZ I;  3E1R A;  3AEB C;  2WWW A;  2HOD A;  1LTI C;  3H1I G;  1H89 A;  3OW2 O;  3UIA A;  1NAF A;  1Q81 Q;  5AW9 B;  3WU2 H;  2QA4 P;  1OWA A;  2O01 H;  4WVZ A;  2IBZ E;  3A2A A;  1NJI Q;  2K3R A;  2IFN A;  3D6Y A;  4PJ0 E;  3MUD A;  4XA4 A;  1FZG A;  3KPE A;  3RK2 D;  2E5T A;  1KTM A;  1IFP A;  4EOT A;  1SQQ E;  2BCC D;  1LTB C;  1L0N J;  1ZN5 A;  2LXC B;  3AEE C;  1KV4 A;  1KQL A;  4WWI A;  1X0T A;  2FYU E;  3RBX A;  1M1J C;  3L73 E;  1FE6 A;  1BCC G;  2ZYG A;  1RQU A;  4LGD E;  2IPP A;  3V2R A;  1NOH A;  3H1H E;  4U3F J;  1SQB K;  3H32 B;  4IL6 X;  3KYQ A;  1LP1 A;  5AW4 B;  3G3Z A;  3L4F A;  4I6M C;  3L70 E;  2WPV B;  1QX8 A;  3B5N B;  2Q9I A;  4N6J A;  3JC2 2;  3GG2 A;  3L72 J;  1NTK G;  4M3L A;  3ITK A;  2O1J A;  2M5A B;  2V7Q J;  3CX5 D;  2B87 B;  1FBM A;  2YO2 A;  4I1L A;  2RN0 A;  1J1D B;  2B9B A;  2Y9Z A;  1IFI A;  1L4A A;  3SWY A;  3OJA B;  5GTI E;  4YTP C;  3CCR P;  1E79 H;  2Y0D A;  2R32 A;  5E79 E;  3BRT B;  1U7J A;  1QL1 A;  4JYC A;  1N8R Q;  3HD7 D;  1H88 A;  1NKN A;  1KFM A;  5KJ7 A;  3C8V A;  5KTB A;  4H13 C;  2KZJ A;  1BE3 E;  1ZRT D;  1N7L A;  4JF7 A;  1KC8 Q;  1FZE A;  3HUS C;  1NKZ B;  5AW3 B;  1ZOY C;  4PD4 E;  2J58 A;  4YPC A;  2KOG A;  2XDJ A;  1NH4 A;  1GU4 A;  1NYH A;  4XE5 B;  1NTM E;  1YTZ T;  4WBA A;  3P32 A;  5DJT B;  3A0B E;  4DJG A;  1CSB A;  2UWJ E;  3AEG C;  4PV1 D;  1Q7Y Q;  5APU A;  3N4X A;  2WT7 A;  2WSS H;  3EQ2 A;  1KQG B;  1X8Y A;  3C1L A;  1LT9 C;  1HVV A;  3H1L D;  1HUC A;  1KYO D;  3H1I E;  4H13 B;  4HH2 A;  3R4Y A;  3E7K A;  2P58 A;  4H0L D;  2HG5 D;  2RH0 A;  2K88 A;  3H1H J;  1A02 J;  4UB8 E;  2CK3 H;  3P8C D;  4ZNC A;  3L72 D;  2YXR B;  1LGH B;  5AVY B;  1VPC A;  1YJW P;  2FFD C;  2IX7 C;  2GUV A;  3CX5 I;  1L0N G;  4D6T E;  5CCG D;  1FC2 C;  2WVR A;  3RK2 B;  3IF4 A;  5CBO A;  1OW7 A;  1WT6 A;  1W2B O;  5B66 E;  3AE4 C;  4W7Y A;  2OGU A;  2NPS B;  3EFF K;  3N7N A;  1LT9 B;  1HJ0 A;  2YKQ A;  1ZLL A;  3H25 A;  1ZW0 A;  2CPS A;  4L73 A;  4OVN F;  2K9J B;  5KLV J;  1JMB A;  2KS1 B;  2W6J H;  4U3F G;  3TGU J;  3KHU A;  4Y28 J;  1T3U A;  5BU8 B;  2JWA A;  1OX3 A;  2GM4 A;  1LWU B;  1LT1 A;  2QRX A;  1BE3 J;  4Y99 B;  2WSE H;  1NVO A;  2GA1 A;  3KZI E;  1MFT A;  3L72 G;  1HTL C;  2A06 D;  1VQP P;  2OTJ P;  5KAF H;  1HWT C;  3L74 J;  1JNM A;  3Q5R A;  2M0B A;  3IFM A;  3RL0 g;  1S72 P;  3PP5 A;  5TIS H;  1G1J A;  4UB6 E;  3S1K A;  3RK3 E;  1MV8 A;  1IFN A;  2LKM A;  1KYO I;  5CCH D;  3RL0 D;  2L91 A;  2I1K A;  1KB9 H;  3ZDM A;  5CBN A;  5H2F H;  3HD7 B;  1USE A;  1M90 Q;  2V4H A;  2PFX A;  1S1C X;  2N9B A;  1SQP K;  2J59 M;  2OTK E;  1TU3 F;  3SFE C;  1NTZ J;  2IBZ G;  2YKP A;  1KB9 I;  3V2P A;  5K5G B;  3RGU A;  2JJL A;  1XTC C;  4H0L C;  1ZR2 A;  2C9N Y;  1ZV8 A;  2YMY A;  1OW6 A;  1AVO A;  2A06 G;  4D6T J;  1VQ6 P;  2AEF A;  1SQX K;  1RF1 B;  5KLV D;  3TNU B;  1PZQ A;  3H32 A;  1NAY A;  3TSI A;  4PV1 B;  3M9Q A;  3TGU D;  4IL6 H;  5AW6 B;  2KLV A;  1IFD A;  3B5N A;  1JCC A;  3M0D C;  1HGV A;  2PP6 A;  1BSH A;  3SSU A;  3H1H G;  5L8R J;  2M5A A;  1KIL C;  1H8A A;  2B87 A;  4DT0 A;  4N78 D;  1ZRT E;  1GK4 A;  2WSF H;  1L0N E;  1FZB A;  3L74 D;  1RF0 C;  1KOR A;  3L70 G;  4K35 A;  1NGM B;  2ZXX A;  4ZKP A;  1DEE G;  3A5T A;  2YIU C;  2KNC B;  1L0L K;  2BCC J;  2JP3 A;  3AE5 C;  3U1A A;  1M7L A;  1PPJ D;  1QGK B;  3GHG A;  1SQP J;  2A45 G;  1EDK A;  2OYO A;  5KLV G;  2SPZ A;  4U3F E;  4OH8 B;  1EXI A;  2OYH C;  1AV1 A;  1DH3 A;  3IN6 A;  2BAS A;  1VF5 D;  1L2P A;  1LTJ C;  2QJK C;  1IFM A;  4QMA A;  5AVU B;  4ZKU A;  5CCH C;  1FJP A;  3P8C E;  2Y0E A;  3L72 E;  1BE3 G;  3RL0 C;  1DD3 A;  1SQV K;  4L76 A;  1PGQ A;  1Q2N A;  3USS A;  1DD4 A;  1OZH A;  2QE7 H;  3L74 G;  2W90 A;  1N73 B;  1NTM G;  1G2C B;  2IDB A;  3HE4 B;  5GTI H;  1SS1 A;  4OWF A;  1HBW A;  3O6Q B;  5E79 H;  2GUS A;  2MJZ A;  1LTJ B;  2K9Y A;  1JUN A;  2KSE A;  5APS A;  4YXW H;  1Q90 D;  2E75 D;  4U7J A;  3RL0 B;  2N1T D;  1L0L J;  3GF3 A;  1QVG O;  2YXQ B;  3I5C A;  1NTZ G;  1N7S D;  5AVQ B;  1WMK A;  1AQT A;  1NU1 K;  2IFM A;  2BEQ D;  4PD4 H;  2NPS A;  1AJY A;  1FZC C;  4GDO A;  3EFG A;  3FX0 A;  4L75 A;  2ZVN B;  2ITA A;  2A06 E;  2JWD A;  1VQL P;  3A0B H;  2QM8 A;  2XU6 A;  4D6T G;  4LLH A;  5GTH E;  2KS1 A;  3CCS P;  1SQP D;  3Q5S A;  2Q3I A;  3F89 A;  2WTY A;  2FXO A;  5BU5 A;  4KT0 J;  1LWU A;  2NZ2 A;  3BAT A;  1IZN B;  3PLN A;  5KAI E;  2W6B A;  1YI2 P;  4IOI H;  1K04 A;  1MFZ A;  1N86 A;  3H1L J;  1RE3 A;  2JEE A;  1SQX D;  4UB8 H;  3S9O A;  3AE6 C;  3BRV B;  3GW6 A;  1QEX A;  1SQQ K;  4HKZ H;  1VF5 C;  3TF5 A;  5AVW B;  3AE3 C;  3CPW O;  2FYU K;  2BCC G;  1W5C E;  1M1J B;  1T2K C;  5B66 H;  2ZT9 C;  3H1J J;  1M56 D;  1IK7 A;  2FYZ A;  3BVH A;  1R5L A;  3HD7 A;  5KLV E;  2KP8 A;  3CMA P;  3LW5 H;  2QM7 A;  3W67 A;  3TGU E;  1W2E A;  1NU1 J;  1Y8A A;  1LTT C;  2WSC J;  1GL2 C;  1L0L D;  2KZI A;  1FU1 A;  3V4Q A;  1BGY D;  1S4X A;  5APV A;  3HE5 B;  3KQG A;  3CWB J;  3AE2 C;  2E76 D;  1IFJ A;  1L4A D;  4IFD K;  1VF5 B;  5B5E E;  2P1J A;  4N78 E;  3V4W A;  1VL2 A;  1JCD A;  3E1I A;  1QL2 A;  3KZI H;  1EZV I;  1DIP A;  3G6E P;  1GD2 E;  1HH0 A;  3VYI A;  1RF1 A;  1HJB A;  2E75 C;  3L74 E;  3CXH H;  2N1T C;  1OFC X;  1SFC C;  4AUW A;  5KJ7 D;  2WPQ A;  1N7S C;  1SQB J;  2P10 A;  3V2Q A;  1SQV D;  2AEM A;  1PPJ E;  3CXH I;  1K8A Q;  2W83 C;  4ZMD A;  2Q7C A;  2IZ0 A;  1Z56 A;  1FS0 E;  1OXZ A;  1AQ5 A;  1YHQ P;  1SVF A;  1RE4 A;  2P7J A;  1FJK A;  3SFD C;  2WIT A;  3U59 A;  3V6I A;  1YJ9 P;  3D6Z A;  3MUD C;  2YMK A;  2YKO A;  3BCC J;  3I55 P;  1S3J A;  5APX A;  1NTZ E;  3HUS B;  3CL3 D;  1YQ3 C;  3L71 J;  3B4S A;  2KNC A;  2OYI C;  2E75 B;  1AVY A;  1ZP0 C;  2N1T B;  1HGZ A;  5M1B A;  2E74 C;  1KB9 D;  5CCG A;  4OGQ C;  5KKZ C;  1FZF A;  2FXP A;  1N7S B;  2Z5H A;  3MIW A;  4GOD A;  2IYO A;  2KYV A;  3H1J D;  2B88 A;  2N9Y B;  2HPC A;  3CD6 P;  1VQ7 P;  1OIP A;  2JO1 A;  4K3A A;  1NU1 D;  2HFE D;  3A0H H;  4MN4 C;  4JQ0 D;  4TT3 H;  1KIL D;  3SWF A;  4GIF A;  3CWB D;  4BXL A;  4LC1 A;  1H0T B;  1IC2 A;  1KQS O;  1J2J B;  2YO3 A;  1NWQ A;  3W68 A;  3H1L G;  3IAO A;  4AYC A;  1FOS E;  2C0W A;  2RMZ A;  2OYI B;  1GW3 A;  2KSJ A;  2FFD B;  1N73 A;  2WMM A;  1U7M A;  2C9L Y;  1P84 H;  1QLE D;  1AFO A;  3HE4 A;  2E76 C;  2D2C D;  2O1K A;  2OTL P;  2BCC E;  3MP7 B;  1L4A C;  1SQB D;  3Q3D A;  3O6Q A;  1YIT P;  5DJU B;  1VQK P;  1T8Z A;  3CCL P;  1OMI A;  1LTJ A;  1FDM A;  1P84 I;  3Q5P A;  1PFI A;  1YIJ P;  2Y9Y A;  1SQP E;  2O01 J;  1GZL A;  1PL5 A;  3VTP C;  2K1A A;  2E43 A;  5KJ7 C;  1KMI Z;  3H1K D;  3L37 A;  3JCU E;  1A02 F;  2W6A A;  3BCC D;  1YBK A;  2FYU D;  4DZO A;  3LIE A;  1SP4 A;  3CWB G;  3CCQ P;  3L71 D;  3NFQ A;  2L5G B;  2M8R A;  2WPS A;  1PP9 J;  1PGO A;  1SQX E;  1JOC A;  1NTK K;  3CCM P;  1L4A B;  2V7Q H;  1K73 Q;  1K05 A;  4C7N B;  5CHX A;  2PRR A;  4C46 A;  2G3A A;  1URQ D;  3CX5 E;  2WPR A;  3PTZ A;  1SQB G;  3M0A A;  2AXT H;  1Y9B A;  3LID A;  4EIJ A;  1S5L E;  3T97 B;  4RKU J;  4AQR D;  4WY4 D;  1FAV A;  4RES B;  3VMX A;  2LXB A;  2JR8 A;  3WUT A;  1L0L E;  1QVF O;  2IZ1 A;  4B86 A;  2Q1K A;  1D7M A;  1BCC J;  1LNQ A;  2P2U A;  3R2P A;  4PJ0 H;  3VMA A;  1M1J A;  4H0L B;  4I2L C;  4DOJ A;  2FXM A;  4NPF X;  2IBZ I;  4W7Z A;  3CC2 P;  1LTG C;  2FBW C;  2ZJS E;  3AEA C;  3A7O A;  4HYT B;  2MKV A;  2JKV A;  3C9I A;  4EI2 A;  2VRS A;  2W8Z A;  3PJS K;  3MTU E;  3CCV P;  1GMJ A;  3IR9 A;  1S9K D;  2E42 A;  1SQV E;  2D2C C;  1GU5 A;  3HE5 A;  1WRG A;  1NTK J;  1K9M Q;  2H7H A;  1VQ8 P;  1VQO P;  2AXC A;  2QIW A;  5AW8 B;  5KAI H;  2ZFC A;  3H1L E;  2KLU A;  2E5Y A;  2Z5I A;  1S5L X;  1KYO E;  1PP9 D;  3TGU G;  2QVA A;  1KIL B;  3B71 A;  1R5S A;  4GOF A;  4GT1 A;  3Q2Y A;  2C0X A;  1YQ4 C;  4BWN A;  3PRJ A;  1JEK A;  3H1I D;  1L0N K;  1MZ9 A;  5BVZ A;  3D71 A;  4R4M A;  1T2K D;  1G1I A;  1SQX J;  2R44 A;  2ZT9 D;  3AE8 C;  2YIU B;  1FDO A;  1EDJ A;  5C39 A;  1NHL A;  3G71 P;  3H1J E;  2FYN C;  2D2C B;  2ZAE B;  1GL2 D;  2A45 H;  1NU1 E;  1M57 D;  2OYH B;  1PPJ G;  1URQ C;  1S2E A;  3HUS A;  1UIX A;  1KIL E;  3CI9 A;  1PV3 A;  1KQF B;  2QJK B;  1FOS F;  1EXJ A;  3CWB E;  2A45 I;  2N1T A;  2FKW B;  1BCC D;  4NPE A;  4WB4 A;  1HF9 A;  2Y0C A;  1PP9 G;  4I7Z C;  1JMM A;  1SFC D;  1BGY J;  3RBZ A;  4IL6 E;  4WY4 C;  5AVR B;  1OVV A;  2YNY A;  3V5B A;  4A7P A;  2QG4 A;  3M9B A;  3MHV A;  3M91 A;  5APY A;  1EZV D;  2FYN B;  1LT9 A;  2ZYD A;  1SQB E;  1Y47 A;  2M3B A;  2K9J A;  1NTK D;  1H0T A;  4PD4 I;  4GOE A;  1URQ B;  2Q6Q A;  2G8Y A;  1JY3 P;  1OVU A;  1X22 A;  3CXH D;  2OYI A;  1VDF A;  4GKG A;  2WSE J;  3B5N C;  2NPS D;  3OA7 A;  1SQV J;  2FFD A;  1OVR A;  3H1K E;  3TDK A;  3BCC E;  4I7Z B;  2E74 D;  2I8D A;  2ZVO B;  1J1D C;  1IJD B;  4OGQ D;  2KK7 A;  4WY4 B;  3L71 E;  1CZQ A;  3RK3 D;  1VQ4 P;  3WMM 0;  1YJN P;  3G4S P;  1FZC B;  4JYB A;  1GDT A;  1J1E C;  2KUB A;  1Q82 Q;  3VMY A;  3ABV C;  4RJT A;  1DEB A;  1EZV G;  3GHG C;  3CLQ A;  3FGA D;  1M1K Q;  1MKM A;  3L75 J;  3K5B A;  4ASV A;  3P7K A;  4N3Y B;  1SQP G;  3NMD A;  4HJG H;  3HTK B;  3FWL A;  1RY3 A;  3FXE A;  4EYY Q;  1KN7 A;  2R5D A;  5AW7 B;  4KJM A;  4C7N A;  3GLM A;  4JPZ B;  2P67 A;  1LTA C;  2CPB A;  1UII A;  1J1E B;  3PHL A;  3GMA A;  1X9V A;  3AE1 C;  1SQX G;  1RH5 B;  2Z4E A;  4TLF A;  3GF7 A;  1EQ7 A;  3GHG B;  4CPG A;  3TNU A;  4H44 D;  3T97 A;  3WU2 E;  3VP8 A;  1CI6 B;  4O9B A;  2ZT9 B;  2R5B A;  4Z1M H;  1EDL A;  3TK1 A;  1P84 D;  2O01 N;  1L0N D;  5KLV K;  1JM0 A;  2DW3 A;  1S9K E;  4UB6 H;  2W27 A;  3M9H A;  3Q1M A;  1GL2 B;  1CW5 A;  2WSF J;  1JY2 N;  1SQQ J;  3JCU H;  1MUU A;  4YXD C;  2KIK A;  3RK2 C;  1PP9 E;  2ZXE B;  3CC7 P;  3H1K J;  1FDI A;  5EFW B;  2FYU J;  1L0L G;  1EDI A;  5AVS B;  1BGY G;  2NPS C;  2XND H;  3II6 A;  4U3F D;  3L73 J;  4BRY B;  3S4R A;  3CCJ P;  3CC4 P;  2OAR A;  1M8O B;  3CME P;  1SFC B;  1NTM K;  1ZME C;  1JTH B;  4W80 A;  5AVX B;  3RK3 C;  1XTG B;  1RHZ B;  3CX5 H;  2IYP A;  3FWN A; 
#chains in the Genus database with same CATH homology
 4C46 A;  1LWU C;  1URQ D;  3M0D A;  2HOD B;  3B5N B;  2Q9I A;  2WPR A;  3L35 A;  4N6J A;  5AW1 B;  4M3L A;  5AVZ B;  2O1J A;  1KIL A;  3M0A A;  3VP9 A;  1N73 B;  1FBM A;  2YO2 A;  3LID A;  4I1L A;  4Y99 C;  4EIJ A;  1G2C B;  1J1D B;  3M06 A;  3HE4 B;  1RE3 C;  1IFI A;  1L4A A;  1JY3 N;  1RF0 A;  1HBW A;  3SWY A;  3OJA B;  4AQR D;  4WY4 D;  1FAV A;  4RES B;  3VN0 A;  4KHX A;  2H43 A;  2GUS A;  3VMX A;  1NTZ K;  2MJZ A;  1LTJ B;  2R32 A;  3BRT B;  4B86 A;  1QL1 A;  4JYC A;  1JUN A;  3HD7 D;  2R3C A;  1H88 A;  5CJ0 A;  5APS A;  1NKN A;  2P2U A;  1KFM A;  3R2P A;  3RL0 B;  5KJ7 A;  2N1T D;  3RK3 B;  1G2C A;  1M1J A;  5KTB A;  3I5C A;  1JO5 A;  3NXS A;  1N7S D;  5AVQ B;  4I2L C;  2OYH A;  1NU1 K;  4DOJ A;  2IFM A;  2FXM A;  2NPS A;  4W7Z A;  1N7L A;  4JF7 A;  1FZC C;  1FZE A;  2XZR A;  3HUS C;  1LTG C;  1NKZ B;  3HD7 C;  5AW3 B;  5CJ4 A;  3A7O A;  4HYT B;  3EFG A;  1LTS C;  2J58 A;  2KOG A;  3C9I A;  2XDJ A;  1NH4 A;  2HLO A;  2VRS A;  4XE5 B;  1GU4 A;  3MTU E;  1IO4 A;  1YTZ T;  2QM8 A;  5CCH A;  2XU6 A;  4LLH A;  3IR9 A;  4WBA A;  3P32 A;  3VOP A;  1E5W A;  1S9K D;  2E42 A;  4IFM A;  5CMZ A;  2Q3I A;  1GU5 A;  3HE5 A;  1WRG A;  4IFF A;  1CSB A;  2WTY A;  2H7H A;  5BU5 A;  5APU A;  5AW5 B;  5AW8 B;  3N4X A;  1LWU A;  3VMZ A;  2WT7 A;  2ZFC A;  3EQ2 A;  2Z5I A;  3BAT A;  3P8M C;  2W6B A;  1X8Y A;  2H8P D;  1KIL B;  1LT9 C;  1HVV A;  1HUC A;  1MFZ A;  1N86 A;  4GT1 A;  1RF1 C;  1RE3 A;  2C0X A;  2WZ7 A;  2JEE A;  3H6P A;  1GK6 A;  4HH2 A;  3BRV B;  1L0N K;  1MZ9 A;  5BVZ A;  1URQ A;  2HG5 D;  1T2K D;  1G1I A;  1A02 J;  3P8C D;  1SQQ K;  5AVV B;  1GTW A;  2XKM A;  1LGH B;  2POH A;  1NO4 A;  5AVW B;  5AVY B;  1NHL A;  1VPC A;  2FFD C;  2IX7 C;  1GW4 A;  2GUV A;  2FYU K;  3MD0 A;  1GL2 D;  4WY4 A;  5CCG D;  1M1J B;  1RE4 C;  2A45 H;  1T2K C;  1T3J A;  3RK2 B;  2WSC H;  3KDP B;  2OYH B;  1WT6 A;  1JY2 O;  2FYZ A;  4W7Y A;  1URQ C;  1FZC A;  3BVH A;  3HUS A;  2NPS B;  2XNX A;  3HD7 A;  2KP8 A;  3HRN A;  3N7N A;  1LT9 B;  3CI9 A;  3LW5 H;  2YKQ A;  1FOS F;  2QM7 A;  1ZLL A;  2A45 I;  1W2E A;  2N1T A;  2CPS A;  2FKW B;  1LTT C;  2PAJ A;  2I1J A;  1KZU B;  1GL2 C;  4WB4 A;  5CCG C;  1FU1 A;  3V4Q A;  5APW A;  1DX7 A;  5APV A;  3HE5 B;  1JMM A;  1SFC D;  3KQG A;  1IFJ A;  1ZR4 A;  2Q5U A;  1T3U A;  4WY4 C;  3NTN A;  1L4A D;  5AVR B;  5BU8 B;  4IFD K;  2YNY A;  3A3Y B;  3V5B A;  2GM4 A;  1LWU B;  2P1J A;  3M9B A;  3M91 A;  2WT7 B;  4N78 E;  5AW0 B;  5APY A;  3V4W A;  1JCD A;  3E1I A;  1QL2 A;  3HTK A;  1LT9 A;  3B5N D;  4Y99 B;  1GD2 E;  1HH0 A;  3VYI A;  2WSE H;  1HJB A;  1RF1 A;  2N1T C;  3V2N A;  1HTL C;  2M3B A;  3U1C A;  1SFC C;  4AUW A;  1SLQ A;  5KJ7 D;  5APQ A;  2WPQ A;  1N7S C;  1URQ B;  1HWT C;  1JY3 P;  3L36 A;  1JNM A;  3V2Q A;  2OYI A;  1VDF A;  4GKG A;  3IFM A;  5AVT B;  3B5N C;  1JY3 O;  2NPS D;  3OA7 A;  2FFD A;  3PP5 A;  2Q7C A;  1G1J A;  1N73 C;  1KFN A;  1Z56 A;  1OXZ A;  1AQ5 A;  1MV8 A;  1SVF A;  1J1D C;  1IFN A;  1RE4 A;  2P7J A;  1IJD B;  1FJK A;  2LKM A;  2XV5 A;  1CI6 A;  5CCH D;  4WY4 B;  2WIT A;  3U59 A;  3RL0 D;  2HPC B;  1CZQ A;  3RK3 D;  2I1K A;  3TYY A;  2YKO A;  3WMM 0;  5APX A;  1FZC B;  4JYB A;  3HUS B;  1GDT A;  3HD7 B;  5AW2 B;  3CL3 D;  1J1E C;  1FZA A;  3MGN A;  3OAK A;  2OYI C;  1YYC A;  2N9B A;  2N1T B;  1HGZ A;  1SQP K;  2J59 M;  1GL2 A;  1N2D C;  5CCG A;  3VMY A;  2YKP A;  3V2P A;  1DEB A;  1IK9 A;  2JJL A;  1N7S B;  3O8Z A;  3BAS A;  1FZF A;  3GHG C;  3CLQ A;  5APT A;  2Z5H A;  1XTC C;  3MIW A;  2KYV A;  1JY2 P;  1ZR2 A;  2HPC A;  2C9N Y;  1ZV8 A;  2YMY A;  2HYN A;  1X79 B;  3P7K A;  4N3Y B;  3NMD A;  2HFE D;  3HTK B;  2KB7 P;  4C7R A;  1RY3 A;  1SQX K;  1RF1 B;  3TNU B;  1SFC A;  1KIL D;  3H32 A;  2R5D A;  5AW7 B;  3SWF A;  4GIF A;  3TSI A;  1JTH A;  3M9Q A;  3B8E B;  4LC1 A;  1N7S A;  5AW6 B;  1IC2 A;  4C7N A;  2P67 A;  1J2J B;  2YO3 A;  1NWQ A;  2KLV A;  1YTZ I;  1LTA C;  2CPB A;  4AYC A;  1J1E B;  1FOS E;  2C0W A;  1X9V A;  2OYI B;  1IFD A;  2WWW A;  1GW3 A;  2HOD A;  3B5N A;  1JCC A;  3M0D C;  1HGV A;  2PP6 A;  2KSJ A;  2FFD B;  1LTI C;  1H89 A;  3UIA A;  1NAF A;  1N73 A;  1KIL C;  1H8A A;  2Z4E A;  5AW9 B;  1EQ7 A;  4N78 D;  2C9L Y;  3GHG B;  1OWA A;  2O01 H;  1AFO A;  3TNU A;  3A2A A;  3HE4 A;  3T97 A;  2IFN A;  3VP8 A;  1CI6 B;  1GK4 A;  3MUD A;  2O1K A;  4XA4 A;  4O9B A;  2WSF H;  2R5B A;  1FZG A;  1FZB A;  1L4A C;  1RF0 C;  3KPE A;  3RK2 D;  1T8Z A;  3TK1 A;  4EOT A;  4ZKP A;  5KLV K;  1LTB C;  1LTJ A;  1FDM A;  1PFI A;  3A5T A;  1S9K E;  1L0L K;  3U1A A;  1ZN5 A;  2W27 A;  1GZL A;  1M7L A;  3M9H A;  3VTP C;  1CW5 A;  1GL2 B;  1KQL A;  1JY2 N;  2E43 A;  1MUU A;  3GHG A;  5KJ7 C;  2A45 G;  1M1J C;  3L37 A;  1A02 F;  3RK2 C;  2ZXE B;  2W6A A;  4DZO A;  4OH8 B;  3LIE A;  2OYH C;  1SP4 A;  4LGD E;  1DH3 A;  2IPP A;  5AVS B;  2NPS C;  3NFQ A;  2BAS A;  3II6 A;  2L5G B;  2M8R A;  2WPS A;  3V2R A;  1LTJ C;  1NOH A;  2OAR A;  1IFM A;  1JOC A;  1NTK K;  1SQB K;  5AVU B;  1SFC B;  3H32 B;  4ZKU A;  5CCH C;  1NTM K;  1FJP A;  3KYQ A;  1L4A B;  3P8C E;  1JTH B;  5AW4 B;  4W80 A;  3RL0 C;  5AVX B;  3RK3 C;  3G3Z A;  1SQV K;  3L4F A;  4C7N B;  5CHX A;  1XTG B;  4I6M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...