4AQRD

Crystal structure of calmodulin in complex with the regulatory domain of a plasma-membrane ca2+-atpase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
57
structure length
57
Chain Sequence
SSIERLQQWRKAALVLNASRRFRYTLDLKKEQETREMRQKIRSHAHALLAANRFMDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN-7
publication title A Bimodular Mechanism of Calcium Control in Eukaryotes
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Ca-binding protein/hydrolase
total genus 27
structure length 57
sequence length 57
ec nomenclature ec 7.2.2.10: P-type Ca(2+) transporter.
pdb deposition date 2012-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4aqrD00
4C7NA 2E42A 2YNYA 2WPQA 1H88A 4I6MC 1A02F 1GTWA 3VMXA 3TNUA 3KDPB 2N9BA 3NMDA 3P7KA 1GK6A 3HE4B 5APWA 4B86A 5AVWB 2W27A 3HE5A 4GKGA 5APTA 1HWTC 2C9NY 4DZOA 2ZXEB 5AVTB 4XE5B 2BASA 4EOTA 2P7JA 2R5DA 4C46A 1GK4A 1MFZA 4RESB 1T2KD 3M9BA 1H89A 1NWQA 2Q7CA 4C7NB 5AVZB 2QM7A 5AVRB 1HUCA 3MD0A 2WPRA 1MV8A 3V4WA 4KHXA 5AW2B 5AW8B 3TNUB 2P2UA 1CZQA 3I5CA 2C9LY 1G2CB 3HTKA 2IPPA 2JJLA 1HBWA 4AUWA 1CI6A 3TYYA 2WWWA 2R3CA 1FAVA 1YYCA 3KQGA 5AW9B 2XV5A 1IO4A 5APSA 2VRSA 1NAFA 2Q3IA 5APQA 2WT7A 2WTYA 5AVSB 1A02J 1SP4A 5AW4B 1J2JB 1S9KE 1HJBA 1T2KC 2Z5HA 5AW3B 3LIDA 2ZFCA 5APYA 1CSBA 1JUNA 3L35A 4HYTB 3L36A 3L37A 3VTPC 4LC1A 3M06A 1X8YA 3T97A 3V4QA 1S9KD 1GD2E 3NXSA 5AW1B 3HE5B 4JYBA 5AW7B 3IR9A 4JYCA 2H7HA 3O8ZA 5AVVB 1FOSE 4AYCA 3SWFA 3M9HA 2Z5IA 3OAKA 2QM8A 1OWAA 3P32A 5AW5B 1OXZA 3LIEA 3VYIA 2WPSA 1GU4A 3NFQA 3MGNA 2WT7B 5AVYB 3VN0A 3P8MC 4GT1A 3M0AA 2KP8A 5CMZA 3M91A 3HE4A 5AW6B 3UIAA 3A7OA 3VMYA 3NTNA 1GU5A 4I2LC 2R5BA 5AVUB 5AVXB 3A5TA 1SLQA 3M0DA 5AVQB 2P67A 1DH3A 2W6AA 4AQRD 2XU6A 5APUA 3VMZA 2YO3A 5APVA 3TK1A 2YO2A 5AW0B 1CI6B 3A3YB 2R32A 3V5BA 4M3LA 1KQLA 2XZRA 2E43A 1H8AA 1MUUA 3A2AA 3B8EB 5APXA 1FOSF 1JNMA 2Q5UA 1GZLA
chains in the Genus database with same CATH superfamily
4C7NA 1KORA 1PZQA 2M5AA 3KDPB 3U1AA 2A45H 1HJ0A 1FZAA 4N78E 2QEXP 2OYHA 1FJPA 3FWNA 3WU2E 1VF5B 2A45G 2PP6A 1T2KD 1BGYD 3OW2O 3KPEA 3PP5A 2WVRA 1BCCD 3MIWA 2KOGA 2YIUB 2OYOA 1JB0J 3VMAA 1PFIA 4DJGA 3L74G 3GHGC 3CXHI 1RH5B 2QJKC 4TT3H 5L8RJ 1NAFA 1PIXA 2WT7A 1WT6A 1M1JA 1SS1A 5K5GB 1S9KE 4HYTB 1Q2NA 3HRNA 1GD2E 4ASWA 4K35A 3IF4A 1RF1C 4TLFA 1OWAA 4IFDK 2FYUJ 1S5LX 1GU4A 1H0TB 5AVYB 2J5UA 1MKMA 3H1KG 1KFNA 4RKUJ 1KQGB 1EDKA 5EFWB 1QX8A 1EDJA 1OVUA 2H88C 2FYUE 1PGJA 3D6YA 1FZEA 1YQ4C 2RH0A 2N1TA 1IFIA 1EDIA 3BRTB 1FZCC 3Q3DA 5APWA 4B86A 3GG2A 3RL0B 1ZR2A 1SQXE 2O1JA 1KTMA 1GW3A 2IBZD 2E75C 1GK4A 5KLIC 3AEFC 1NTMD 2FFDA 1OW7A 1L0LK 3RK3C 4IL6E 1G2CB 2PFXA 1U7JA 2JJLA 3HUSA 2BEQD 2L5GB 1IFDA 3PLNA 2POHA 2KS1B 4H13B 3CX5D 3S1KA 1L4AC 3WUUA 1KILD 1L0LD 3L72J 3IFMA 5DJTB 5AW7B 5AVVB 3H1JJ 2AXTH 1Q82Q 3P32A 5AW5B 1LTGC 3LIEA 3BASA 2K88A 1RF0A 2WPSA 2KLUA 3P8MC 1IFNA 3L72E 3D6ZA 3RK2B 3H1JE 2KB7P 2O01N 2KUBA 1YJWP 1J1DC 3V2RA 1QEXA 1YITP 4N78D 3CCJP 1SQPE 2YNYA 2WPQA 1H88A 4I6MC 2G8YA 2NPSC 4H0LB 2M3BA 2N9BA 2YXRB 1LNQA 1LP1A 1G1JA 2R44A 2RKLA 1URQC 2Z4EA 3AE5C 2P7JA 4UB8H 1S2EA 5AVZB 2K9YA 2QM7A 3K5BA 4PD4I 2IPPA 4U7JA 1L4AB 5CCGC 1LTBC 3N4XA 4I7ZC 3KYQA 1RE4C 1R8EA 3G6EP 1S1CX 3F89A 1Q7YQ 1NYHA 1PGQA 1SQQJ 4C7RA 1SQVG 2FYUK 5AW4B 2B87B 5CBNA 1LT1A 3OJAB 3H1LG 3S9OA 4LC1A 3PHLA 1ZV8A 3CXHH 2J59M 3TGUJ 1Z56A 4UB6H 3MGNA 1OIPA 1J1DB 2FYUD 5CMZA 3CCEP 5GTHE 2FXMA 2KNCA 4JQ0D 2QRXA 1YIJP 5CCHC 2E75D 2W6AA 3TGUE 1KILA 1FZBA 3VMZA 2YO2A 5AW0B 4PV1D 1CI6B 3A3YB 1VQKP 4XFJA 2I1KA 1FU1A 3A2AA 2IZ0A 4YTPC 3RGUA 3RK3D 1VQOP 2KK7A 1VQLP 3HE5A 4L73A 1VQ5P 2C9NY 1BGYG 4OGQC 3C8VA 2Q1KA 2QG4A 4XE5B 1SQBJ 1BCCG 2E74C 2WQYC 2FYNC 4HKZH 4C7NB 1KQSO 2M5AB 3CXHE 2W8ZA 2B88A 4AUWA 4OWFA 1SQBE 2JKVA 5KLVJ 2OGUA 2XV5A 4UB6E 2OYHB 3E1RA 3FXEA 3GHGA 1VQ8P 2GM4A 1VQ4P 1X22A 1AVOA 1N7SC 4ZMDA 2JEEA 1R5LA 3H1HJ 2V4HA 5APYA 2RMZA 2P10A 4JBZA 1OVRA 1X8YA 3L72D 5KLVE 3NXSA 3CL3D 1FOSE 3H1JD 1JCDA 2Z5IA 2QM8A 1FZGA 2ZVOB 1JY3P 1FDIA 1JY3N 3AE6C 1VQ7P 2MKVA 1SLQA 2QA4P 1URQD 1KZUB 1LT9C 4KJMA 3L71J 3CC7P 2AEMA 3AEDC 1DEBA 1OFCX 3N7NA 3W68A 2IBZG 5CCGD 3SSUA 5H2FH 3L71E 1BSNA 3BRVB 3PH0A 2OTJP 1JY2O 1NTMG 2QVAA 1K04A 2M3EA 1NWQA 2N1TB 1SQQK 4LGDE 1ZLLA 2A06E 1DD3A 1IK9A 1GL2B 1N7SB 1HBWA 4L75A 1ZW0A 1M1KQ 2YXQB 1SFCC 4JF7A 1P84E 1SVFA 3KQGA 1KB9I 2OYIB 5APQA 1L0LG 1E79H 1AFOA 1KFMA 3VP8A 2IFNA 4PD4H 1SQQD 2K9JB 1J2JB 2BEZF 2FFDB 1NU1J 3L35A 1PP9J 3L36A 3MUDC 1U7MA 3H32A 1ZP0C 5AW1B 3HUSB 3O8ZA 1VF5C 2ZYGA 3TGUD 4D6TE 2PAJA 1NU1E 2YIUC 4IOIH 4GT1A 4R4LA 1PP9E 3II6A 3WU2H 5H2FE 4WY4B 3CI9A 3HE4A 2LKMA 3HD7C 4OGQD 2WSCH 4H44D 1JTHA 2E74D 2R32A 3H1LD 1LTAC 1FOSF 2IZ1A 2IYPA 4NPDA 1DEEG 1HF9A 1ZMEC 1NTZJ 2AXCA 4W7YA 3TNUA 3Q2YA 2XKMA 2JR8A 3CXHD 2G3AA 2PRRA 3MTUE 1SQBD 1URQA 4DCKA 1KYOI 2E76B 1BE3J 4BXLA 2Q9IA 1D7MA 1AV1A 3HTKA 2WSCJ 2HG5D 4XA4A 3SFDC 2JDIH 2MJZA 1MFTA 1LP1B 3A0BE 5CCGA 5KLVD 3G9RA 2QJPB 3BCCE 1RE4A 1BE3E 1N73B 3B71A 1GW4A 3R4YA 4Y99B 1YTZT 3LIDA 3AEAC 3CWBJ 3RL0C 3H1HD 2D2CB 1L0NJ 3VTPC 3V2QA 3O6QB 2FYUG 3HD7B 1OXZA 3VYIA 3CWBE 4GODA 1L0NE 2ZXXA 2HODB 3AECC 1Y47A 5AVUB 3AE4C 1NVOA 4H13C 4IL6H 1DD4A 3L71D 1M57D 3V2NA 5E79H 4HH2A 3LW5H 3Q1MA 5KKZB 2W27A 1HWTC 1T6AA 1E5WA 1M90Q 1TU3F 2CK3H 1SQXJ 3RK2C 1MFZA 1NTMK 1HUCA 2WPRA 1ZRTE 2JO1A 1X0TA 2KZJA 3USSA 2I1JA 2V7QH 5APSA 2BCCD 4H0LC 3LW5J 2WSFH 3L72G 5M1BA 5KJ7C 1KQFB 4L76A 3L73J 3H1JG 5C39A 1NU1D 3L37A 3KZIE 1PP9D 1KB9H 4W7ZA 2OTKE 5E79E 1VDFA 1FS0E 1OVVA 3L73E 2JWAA 1P84I 1NTZK 1PPJD 2QSIA 3WUTA 3M0DA 2SPZA 3AE3C 4W80A 3GF7A 1MZ9A 2V7QJ 1ZOYC 1LT9A 4QMAA 3BVHA 2L91A 2WSFJ 4LLHA 4PD4D 1SQPJ 1NTZD 4EYYQ 2P58A 3FWLA 3MP7B 2YKPA 2W83C 2KSEA 3T97B 3AE7C 3AEBC 2QJYC 4HB1A 4O9BA 2KI7B 2QIWA 1NGMB 1OZHA 4YXDC 1VQNP 1KB9E 1BE3D 1L2PA 5TISH 1RE3C 2OTLP 5GTHH 3CCRP 1KMIZ 3TYYA 1SQQG 1ZR4A 1S72P 1KYOH 1LTJB 1LWUB 2O01H 2O3JA 4PV1B 4RJTA 1K05A 3CWBD 4H13D 1NTKJ 1S9KD 3TGUG 1FDMA 3MUDA 1YTZI 3P8CE 1EC5A 4RO0A 2FYZA 1FJKA 1NTKE 2M0BA 3M0AA 5DJUB 2OYHC 3H32B 5KAFH 5APVA 3TK1A 4U3FJ 2O01J 1SQXK 1PL5A 2QJYB 4IL6X 4WB4A 5TISE 1VPCA 3B5NB 1EZVI 3G71P 3HE4B 1SQBG 1AQTA 4U3FE 3W67A 1ZRTD 3GLMA 1KYOE 2OQQA 1IFPA 4H0LD 5BU8B 2BASA 3GMAA 5KJ7D 1H0TA 1SQXD 1YBKA 3M9BA 4KT0J 3TNUB 3I5CA 3A0HH 5KLVG 1T3UA 1LTSC 3CCMP 4MN4C 1VQ9P 3TSIA 3H1HG 1IZNB 4HJGH 4WWIA 1L4AD 1K73Q 2Y0CA 1OW8A 2FXOA 5AW3B 1J1EB 3L70J 3L73D 1AA0A 5KAFE 5KAIH 2A45I 1NO4A 2XDJA 2N1TC 1GL2C 3NFQA 3L70E 1NOHA 2GUVA 1G2CA 1SQPK 3UIAA 4NPEA 3L71G 2OYIC 1GU5A 4I2LC 1VQPP 4DOJA 2WMMA 1M7LA 3FGAD 5B66H 2LXBA 2E43A 4Z1MH 1P84H 2FFDC 1RF1A 2ZYAA 2NPSD 2WT7B 1JOCA 1ZXGA 1M1JB 2A06G 3A0HE 3HUSC 1SQPD 2N9YB 3RBZA 4OVNF 1IJDB 1KB9D 1N8RQ 1HTLC 2FY8A 1FBMA 4EOTA 4K3AA 4WY4C 2NZ2A 2ITAA 2Q7CA 3S4RA 2IYOA 2HYNA 3L75J 5AVRB 1QL2A 3V4WA 2M8RA 5KAIE 2YMYA 2C9LY 2BCCG 1QGKB 3H1IJ 2I8DA 1FZCA 1BDDA 3KXDA 3CCUP 2Q3IA 1S3JA 3L75E 1NU1G 4H44B 1A02J 1PP9G 3P8CD 4JPZB 3M9QA 3H1IE 5KJ7A 3EWKA 1GMJA 1KD1Q 2ZT9B 5B66E 1NH4A 1Q86Q 2FXPA 3M9HA 2E76C 5TJHA 1PPJG 2LR2A 1FC2C 4YXWH 3VN0A 3VOPA 4D6TJ 1N2DC 2YKOA 2CPSA 1USDA 5CCHD 1L4AA 2P67A 2QJPC 4N3YB 1IFJA 3WUVA 1ZN5A 4AQRD 5APUA 4U3FD 1N73C 3V5BA 1NTZG 1KQLA 4Y99C 1KYOD 2D2CC 1FZFA 1GZLA 2B87A 3A0BH 1GTWA 2DW3A 2AEJA 1LTIC 1S5LE 2HLOA 2IBZE 2H89C 3Q5PA 4GOFA 3FXDA 1DIPA 1BE3G 1SQBK 2E5YA 2R5DA 3PRJA 1VL2A 2JWDA 1BDCA 3CPWO 3ITKA 2P1JA 4CPGA 3CMAP 1AJYA 1WMKA 3TDKA 1IFMA 2NPSA 2YKQA 2N1TD 1CI6A 2WWWA 4I1LA 2VRSA 5KKZC 5KLVK 1GL2D 3CWBG 1KILE 1N7SD 2WTYA 3CLQA 5CJ0A 3E1IA 3BCCJ 2H43A 3JCUE 4GOEA 1YI2P 3L70D 1IK7A 1KILC 2K37A 2H7HA 1K8AQ 4AYCA 2KZIA 1T3JA 4A7PA 2KP8A 1NJIQ 2JP3A 2KIKA 4NPFX 1RQVA 2GA1A 3A5TA 5AVQB 5KTBA 1NHLA 3CC4P 4WY4D 1Y9BA 3F5HA 1EZVE 2B89A 1JNMA 2XNXA 2Q5UA 3NTNA 1X79B 1A02F 3I55P 1DX7A 3P7KA 4GKGA 2KLVA 5GTIE 1Q81Q 1SQXG 1K9MQ 3KZIH 2ZXEB 5CCHA 4BWNA 4WBAA 4RESB 2IX7C 1JCCA 3ZDMA 3L75D 3SWYA 2OARA 2P2UA 1JY3O 1SFCD 1YJNP 3H1ID 2KNCB 3KHUA 2ZJSE 2A06D 2GUSA 4ZNCA 1WRGA 2E76D 3G4SP 1IO4A 1KILB 3L74J 3L73G 2E5TA 1P84D 5AVSB 4IFFA 2WSSH 1SP4A 2UWJE 1HJBA 2Z5HA 2KSJA 1HGVA 1CSBA 1JUNA 2WZ7A 3H25A 1NU1K 1VF5D 3HE5B 4JYCA 3L74E 2CPBA 3WMM0 3AE2C 2D2CD 4L74A 3U59A 3Q5RA 3TF5A 2WPVB 1GL2A 4D6TD 1N7SA 3HD7D 2IFMA 5AW6B 3A7OA 1EXJA 3AE1C 3CCQP 3H1KJ 3V6IA 2OYIA 2XU6A 1LTJC 1LWUC 2Y9ZA 3QH9A 3RK3E 2Y9YA 4PV1C 1SQPG 2K9JA 3GHGB 2QJKB 1NKNA 3H1KE 2R3SA 2K1AA 1AVYA 1USEA 5APTA 2Q3EA 3V2PA 2KXPB 1EXIA 1JEKA 3CC2P 4DZOA 1OW6A 5CHXA 1X9VA 1W5CE 4C46A 1PGOA 3CMEP 1H89A 1RF1B 4WY4A 3MD0A 1LGHB 1FE6A 3JSVC 1OX3A 1QL1A 1YYCA 2IDBA 4GDOA 1XTCC 1YJ9P 5CBOA 2KYVA 2IBZI 3B5NC 2HPCA 1NTKG 3RL0D 3BCCD 2Q6QA 1JY2P 1IC2A 1JY2N 1L0NK 1FZCB 4JYBA 1QLED 3OAKA 1SFCA 1RHZB 4BRYA 3GF3A 2E75B 3BATA 3CX5I 1EZVD 1JMMA 1HH0A 2FBWC 3AEEC 5KLIB 3D71A 4U3FG 1L0ND 5AVXB 1S4XA 1EQ7A 3RK3B 3I56P 2YO3A 2C0XA 4M3LA 1H8AA 1MUUA 1N73A 1J1EC 1LJ2A 1OMIA 3EFFK 4PJ0H 1JO5A 3NMDA 2AXTE 4ZKPA 1PGPA 3E7KA 3O6QA 1UIXA 2ZVNB 4IFMA 3HD7A 2W90A 3ABVC 2K3RA 4YPCA 3RK2D 3CD6P 3CCVP 3AE9C 2HODA 1YHQP 3D70A 1MV8A 2H8PD 5AW8B 1U57A 4WVZA 1JTHB 1R5SA 3Q5SA 1QVGO 5AW9B 1SQQE 1CW5A 1N7LA 1M1JC 3L74D 2ZAEB 3L70G 2RN0A 2HR3A 2ZFCA 1M56D 2FKWB 1UIIA 1SQVJ 2NPSB 3V4QA 1KV4A 3H1LJ 4UB8E 4EIJA 1Y8AA 5BU5A 4PJ0E 1JMBA 1URQB 1EDLA 1SQVE 3JC22 2ZYDA 1HVVA 3H1LE 1G1IA 3HTKB 2Y0DA 2C0WA 1QVFO 3H1KD 2PGDA 3B4SA 4H44C 2W6BA 4ZKUA 2AEFA 3RL0g 4I7ZB 2E42A 4ASVA 2LXCB 5B5EH 2ZT9C 4EDFA 1AQ5A 4OH8B 1N86A 5AVTB 2KS1A 1M8OB 3B5ND 3L75G 1FDOA 4R4MA 1BGYJ 2NRGA 3MZWB 3H1IG 1BCCJ 4KHXA 1CZQA 1VQ6P 4GIFA 2R3CA 1BGYE 3IAOA 3EFGA 3PTZA 3H1HE 1BCCE 3SFEC 1T2KC 2J58A 3M0DC 3M06A 3T97A 1NTKK 3OA7A 3IR9A 1GDTA 3AE8C 3PJSK 1S5LH 1W2BO 1NAYA 1RF0C 4D6TG 3U1CA 4OGQB 5B5EE 2WSEH 1RQUA 3C9IA 2E74B 2HFED 3M91A 1PV3A 2FYNB 3VMYA 2R5BA 1NTKD 1XTGB 3L4FA 1DH3A 1T8ZA 3EQ2A 3RBXA 1LTJA 1LWUA 3CX5H 3B8EB 3VMXA 4N6JA 2XNDH 4Y28J 1GK6A 5AVWB 3JCUH 2O1KA 1BSHA 2QE7H 2BCCJ 3R2PA 3SWKA 2WSEJ 1NTMJ 1Q90D 3QWOC 3VP9A 5AW2B 2BCCE 1SQVK 3GW6A 1FAVA 5BVZA 3G3ZA 3BCCG 1NTME 3H6PA 3MHVA 1JM0A 1LT9B 4EI2A 1RY3A 3C1LA 1YQ3C 3B5NA 1L0LJ 1VQMP 2W6JH 1KN7A 1HGZA 1LTTC 1SQVD 1NKZB 3CX5E 1RE3A 3SWFA 1EZVG 3AEGC 5GTIH 2Y0EA 3CCSP 2B9BA 3FX0A 1W2EA 1L0LE 1PPJE 1L0NG 2ZT9D 2HPCB 5CJ4A 2YMKA 1KC8Q 2WITA 4PD4E 3CCLP 3IN6A 1SFCB 2XZRA 1NTZE 5APXA 4DT0A 4BRYB
chains in the Genus database with same CATH topology
4C7NA 4WB4A 1DEBA 1NKNA 3KDPB 1VPCA 3N7NA 3B5NB 3U1AA 2A45H 3HE4B 5CCGD 5APTA 1FZAA 3V2PA 3BRVB 4N78E 2OYHA 4DZOA 5BU8B 1JY2O 1FJPA 2BASA 5CHXA 1X9VA 5KJ7D 4C46A 2A45G 2PP6A 1T2KD 1H89A 3M9BA 1RF1B 1NWQA 2N1TB 1SQQK 4WY4A 3KPEA 4LGDE 3PP5A 3MD0A 1ZLLA 3TNUB 3MIWA 2KOGA 1LGHB 3I5CA 1IK9A 1GL2B 1T3UA 1N7SB 1PFIA 1HBWA 1SFCC 4JF7A 1LTSC 1QL1A 1SVFA 1YYCA 3KQGA 2OYIB 3GHGC 1XTCC 1NAFA 3TSIA 5APQA 2WT7A 2KYVA 1AFOA 1KFMA 1WT6A 3VP8A 1M1JA 3B5NC 2IFNA 2HPCA 1L4AD 3RL0D 1J2JB 1S9KE 5AW3B 2FFDB 1J1EB 3L35A 1JY2P 4HYTB 1IC2A 3HRNA 3L36A 1JY2N 1L0NK 1GD2E 2A45I 3H32A 1NO4A 5AW1B 3HUSB 1FZCB 4JYBA 2XDJA 3O8ZA 1RF1C 2N1TC 3OAKA 1SFCA 1OWAA 2PAJA 4IFDK 1GU4A 1GL2C 3NFQA 3BATA 1NOHA 5AVYB 4GT1A 3II6A 2GUVA 1JMMA 1HH0A 4WY4B 1KFNA 1G2CA 1SQPK 3CI9A 3HE4A 3UIAA 2OYIC 1GU5A 4I2LC 2LKMA 3HD7C 2WSCH 5AVXB 1JTHA 3RK3B 1EQ7A 4DOJA 2YO3A 1M7LA 2R32A 1LTAC 2C0XA 4M3LA 2E43A 1H8AA 2FFDC 1FZEA 1MUUA 1N73A 1RF1A 1FOSF 1J1EC 2N1TA 2NPSD 2WT7B 1IFIA 1JOCA 1M1JB 4W7YA 3TNUA 3BRTB 3HUSC 1FZCC 1JO5A 3NMDA 5APWA 2XKMA 4B86A 1IJDB 4ZKPA 3RL0B 1ZR2A 4IFMA 3HD7A 1HTLC 2O1JA 1GW3A 1FBMA 3MTUE 4EOTA 3RK2D 1URQA 4WY4C 1GK4A 2HODA 2Q7CA 2HYNA 2FFDA 5AVRB 1QL2A 3V4WA 2M8RA 1MV8A 2H8PD 5AW8B 2YMYA 1L0LK 3RK3C 2Q9IA 2C9LY 1G2CB 3HTKA 2JJLA 3HUSA 1FZCA 2HG5D 4XA4A 2L5GB 1IFDA 2MJZA 1JTHB 5AW9B 5CCGA 1CW5A 1N7LA 1M1JC 2POHA 2Q3IA 1RE4A 1A02J 1N73B 3P8CD 1GW4A 4Y99B 1YTZT 3M9QA 1L4AC 3LIDA 3RL0C 2ZFCA 1KILD 2FKWB 5KJ7A 3VTPC 2NPSB 3IFMA 3V4QA 1NH4A 5AW7B 5AVVB 3V2QA 3M9HA 4EIJA 3HD7B 5BU5A 3P32A 5AW5B 1LTGC 1OXZA 3LIEA 3BASA 3VYIA 1RF0A 2WPSA 1URQB 3VN0A 3P8MC 1IFNA 2HODB 3VOPA 3RK2B 1N2DC 2YKOA 2CPSA 5CCHD 1HVVA 1L4AA 5AVUB 1G1IA 3HTKB 2P67A 2C0WA 4N3YB 2KB7P 1IFJA 4AQRD 1ZN5A 5APUA 2W6BA 1J1DC 1N73C 3V2RA 3V5BA 3V2NA 1KQLA 4N78D 4HH2A 4Y99C 3LW5H 4ZKUA 1FZFA 1GZLA 2E42A 2YNYA 2WPQA 1H88A 4I6MC 1GTWA 2NPSC 2M3BA 1LTIC 2N9BA 2HLOA 2W27A 1HWTC 1AQ5A 4OH8B 1E5WA 1N86A 1G1JA 5AVTB 1URQC 2Z4EA 3B5ND 2P7JA 1SQBK 2R5DA 3RK2C 1MFZA 2P1JA 5AVZB 2QM7A 1NTMK 1HUCA 2WPRA 4KHXA 1IFMA 1CZQA 2NPSA 2IPPA 2YKQA 4GIFA 1L4AB 2N1TD 5CCGC 1LTBC 1CI6A 3N4XA 2WWWA 2R3CA 4I1LA 2I1JA 5APSA 3KYQA 2VRSA 1RE4C 5KLVK 1GL2D 3EFGA 1N7SD 2WTYA 3CLQA 2WSFH 5CJ0A 4C7RA 3E1IA 2FYUK 5AW4B 5KJ7C 1T2KC 2H43A 2J58A 3M0DC 3OJAB 3L37A 1KILC 4LC1A 3M06A 3T97A 1ZV8A 1NTKK 4W7ZA 3OA7A 2J59M 2H7HA 3IR9A 1GDTA 4AYCA 1RF0C 1VDFA 3U1CA 1Z56A 2WSEH 3C9IA 1T3JA 3MGNA 1J1DB 2KP8A 1NTZK 5CMZA 2HFED 3M91A 2FXMA 3VMYA 2R5BA 5CCHC 3A5TA 3M0DA 5AVQB 1XTGB 3L4FA 4W80A 5KTBA 1DH3A 2W6AA 1KILA 1NHLA 1FZBA 1MZ9A 3VMZA 2YO2A 5AW0B 1T8ZA 1CI6B 3A3YB 4WY4D 3EQ2A 1LT9A 2I1KA 1LTJA 1LWUA 1FU1A 3BVHA 3A2AA 3B8EB 1JNMA 4LLHA 2XNXA 2Q5UA 3NTNA 1X79B 1A02F 3RK3D 3VMXA 4N6JA 1DX7A 3P7KA 1GK6A 5AVWB 3HE5A 4GKGA 2KLVA 2O1KA 2YKPA 2C9NY 2ZXEB 5CCHA 4XE5B 4O9BA 3R2PA 4WBAA 4RESB 2IX7C 4C7NB 1JCCA 3VP9A 3SWYA 5AW2B 2OARA 2P2UA 1JY3O 1SFCD 1RE3C 1SQVK 4AUWA 3TYYA 2GUSA 1FAVA 1WRGA 5BVZA 3G3ZA 2XV5A 2OYHB 1KILB 1ZR4A 1IO4A 3H6PA 3GHGA 2GM4A 1LT9B 1LTJB 1LWUB 2O01H 5AVSB 1RY3A 4IFFA 1N7SC 1SP4A 1HJBA 2Z5HA 2KSJA 2JEEA 3B5NA 5APYA 1HGVA 1CSBA 1JUNA 1HGZA 2WZ7A 1LTTC 1NU1K 1X8YA 1S9KD 1NKZB 3NXSA 3HE5B 1FDMA 4JYCA 2CPBA 3WMM0 3CL3D 1FOSE 1RE3A 3MUDA 3SWFA 1JCDA 2Z5IA 1YTZI 2QM8A 3P8CE 3U59A 1W2EA 1FZGA 1JY3P 2FYZA 2HPCB 1JY3N 1FJKA 3M0AA 1GL2A 1N7SA 3HD7D 2IFMA 5AW6B 3A7OA 2OYHC 5CJ4A 1SLQA 2OYIA 1URQD 3H32B 1KZUB 1LT9C 2XU6A 1LTJC 1LWUC 2WITA 5APVA 3TK1A 1SFCB 2XZRA 5APXA 1SQXK 3GHGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C7N A;  2E42 A;  2YNY A;  2WPQ A;  1H88 A;  4I6M C;  1A02 F;  1GTW A;  3VMX A;  3TNU A;  3KDP B;  2N9B A;  3NMD A;  3P7K A;  1GK6 A;  3HE4 B;  5APW A;  4B86 A;  5AVW B;  2W27 A;  3HE5 A;  4GKG A;  5APT A;  1HWT C;  2C9N Y;  4DZO A;  2ZXE B;  5AVT B;  4XE5 B;  2BAS A;  4EOT A;  2P7J A;  2R5D A;  4C46 A;  1GK4 A;  1MFZ A;  4RES B;  1T2K D;  3M9B A;  1H89 A;  1NWQ A;  2Q7C A;  4C7N B;  5AVZ B;  2QM7 A;  5AVR B;  1HUC A;  3MD0 A;  2WPR A;  1MV8 A;  3V4W A;  4KHX A;  5AW2 B;  5AW8 B;  3TNU B;  2P2U A;  1CZQ A;  3I5C A;  2C9L Y;  1G2C B;  3HTK A;  2IPP A;  2JJL A;  1HBW A;  4AUW A;  1CI6 A;  3TYY A;  2WWW A;  2R3C A;  1FAV A;  1YYC A;  3KQG A;  5AW9 B;  2XV5 A;  1IO4 A;  5APS A;  2VRS A;  1NAF A;  2Q3I A;  5APQ A;  2WT7 A;  2WTY A;  5AVS B;  1A02 J;  1SP4 A;  5AW4 B;  1J2J B;  1S9K E;  1HJB A;  1T2K C;  2Z5H A;  5AW3 B;  3LID A;  2ZFC A;  5APY A;  1CSB A;  1JUN A;  3L35 A;  4HYT B;  3L36 A;  3L37 A;  3VTP C;  4LC1 A;  3M06 A;  1X8Y A;  3T97 A;  3V4Q A;  1S9K D;  1GD2 E;  3NXS A;  5AW1 B;  3HE5 B;  4JYB A;  5AW7 B;  3IR9 A;  4JYC A;  2H7H A;  3O8Z A;  5AVV B;  1FOS E;  4AYC A;  3SWF A;  3M9H A;  2Z5I A;  3OAK A;  2QM8 A;  1OWA A;  3P32 A;  5AW5 B;  1OXZ A;  3LIE A;  3VYI A;  2WPS A;  1GU4 A;  3NFQ A;  3MGN A;  2WT7 B;  5AVY B;  3VN0 A;  3P8M C;  4GT1 A;  3M0A A;  2KP8 A;  5CMZ A;  3M91 A;  3HE4 A;  5AW6 B;  3UIA A;  3A7O A;  3VMY A;  3NTN A;  1GU5 A;  4I2L C;  2R5B A;  5AVU B;  5AVX B;  3A5T A;  1SLQ A;  3M0D A;  5AVQ B;  2P67 A;  1DH3 A;  2W6A A;  4AQR D;  2XU6 A;  5APU A;  3VMZ A;  2YO3 A;  5APV A;  3TK1 A;  2YO2 A;  5AW0 B;  1CI6 B;  3A3Y B;  2R32 A;  3V5B A;  4M3L A;  1KQL A;  2XZR A;  2E43 A;  1H8A A;  1MUU A;  3A2A A;  3B8E B;  5APX A;  1FOS F;  1JNM A;  2Q5U A;  1GZL A; 
#chains in the Genus database with same CATH topology
 4C7N A;  1KOR A;  1PZQ A;  2M5A A;  3KDP B;  3U1A A;  2A45 H;  1HJ0 A;  1FZA A;  4N78 E;  2QEX P;  2OYH A;  1FJP A;  3FWN A;  3WU2 E;  1VF5 B;  2A45 G;  2PP6 A;  1T2K D;  1BGY D;  3OW2 O;  3KPE A;  3PP5 A;  2WVR A;  1BCC D;  3MIW A;  2KOG A;  2YIU B;  2OYO A;  1JB0 J;  3VMA A;  1PFI A;  4DJG A;  3L74 G;  3GHG C;  3CXH I;  1RH5 B;  2QJK C;  4TT3 H;  5L8R J;  1NAF A;  1PIX A;  2WT7 A;  1WT6 A;  1M1J A;  1SS1 A;  5K5G B;  1S9K E;  4HYT B;  1Q2N A;  3HRN A;  1GD2 E;  4ASW A;  4K35 A;  3IF4 A;  1RF1 C;  4TLF A;  1OWA A;  4IFD K;  2FYU J;  1S5L X;  1GU4 A;  1H0T B;  5AVY B;  2J5U A;  1MKM A;  3H1K G;  1KFN A;  4RKU J;  1KQG B;  1EDK A;  5EFW B;  1QX8 A;  1EDJ A;  1OVU A;  2H88 C;  2FYU E;  1PGJ A;  3D6Y A;  1FZE A;  1YQ4 C;  2RH0 A;  2N1T A;  1IFI A;  1EDI A;  3BRT B;  1FZC C;  3Q3D A;  5APW A;  4B86 A;  3GG2 A;  3RL0 B;  1ZR2 A;  1SQX E;  2O1J A;  1KTM A;  1GW3 A;  2IBZ D;  2E75 C;  1GK4 A;  5KLI C;  3AEF C;  1NTM D;  2FFD A;  1OW7 A;  1L0L K;  3RK3 C;  4IL6 E;  1G2C B;  2PFX A;  1U7J A;  2JJL A;  3HUS A;  2BEQ D;  2L5G B;  1IFD A;  3PLN A;  2POH A;  2KS1 B;  4H13 B;  3CX5 D;  3S1K A;  1L4A C;  3WUU A;  1KIL D;  1L0L D;  3L72 J;  3IFM A;  5DJT B;  5AW7 B;  5AVV B;  3H1J J;  2AXT H;  1Q82 Q;  3P32 A;  5AW5 B;  1LTG C;  3LIE A;  3BAS A;  2K88 A;  1RF0 A;  2WPS A;  2KLU A;  3P8M C;  1IFN A;  3L72 E;  3D6Z A;  3RK2 B;  3H1J E;  2KB7 P;  2O01 N;  2KUB A;  1YJW P;  1J1D C;  3V2R A;  1QEX A;  1YIT P;  4N78 D;  3CCJ P;  1SQP E;  2YNY A;  2WPQ A;  1H88 A;  4I6M C;  2G8Y A;  2NPS C;  4H0L B;  2M3B A;  2N9B A;  2YXR B;  1LNQ A;  1LP1 A;  1G1J A;  2R44 A;  2RKL A;  1URQ C;  2Z4E A;  3AE5 C;  2P7J A;  4UB8 H;  1S2E A;  5AVZ B;  2K9Y A;  2QM7 A;  3K5B A;  4PD4 I;  2IPP A;  4U7J A;  1L4A B;  5CCG C;  1LTB C;  3N4X A;  4I7Z C;  3KYQ A;  1RE4 C;  1R8E A;  3G6E P;  1S1C X;  3F89 A;  1Q7Y Q;  1NYH A;  1PGQ A;  1SQQ J;  4C7R A;  1SQV G;  2FYU K;  5AW4 B;  2B87 B;  5CBN A;  1LT1 A;  3OJA B;  3H1L G;  3S9O A;  4LC1 A;  3PHL A;  1ZV8 A;  3CXH H;  2J59 M;  3TGU J;  1Z56 A;  4UB6 H;  3MGN A;  1OIP A;  1J1D B;  2FYU D;  5CMZ A;  3CCE P;  5GTH E;  2FXM A;  2KNC A;  4JQ0 D;  2QRX A;  1YIJ P;  5CCH C;  2E75 D;  2W6A A;  3TGU E;  1KIL A;  1FZB A;  3VMZ A;  2YO2 A;  5AW0 B;  4PV1 D;  1CI6 B;  3A3Y B;  1VQK P;  4XFJ A;  2I1K A;  1FU1 A;  3A2A A;  2IZ0 A;  4YTP C;  3RGU A;  3RK3 D;  1VQO P;  2KK7 A;  1VQL P;  3HE5 A;  4L73 A;  1VQ5 P;  2C9N Y;  1BGY G;  4OGQ C;  3C8V A;  2Q1K A;  2QG4 A;  4XE5 B;  1SQB J;  1BCC G;  2E74 C;  2WQY C;  2FYN C;  4HKZ H;  4C7N B;  1KQS O;  2M5A B;  3CXH E;  2W8Z A;  2B88 A;  4AUW A;  4OWF A;  1SQB E;  2JKV A;  5KLV J;  2OGU A;  2XV5 A;  4UB6 E;  2OYH B;  3E1R A;  3FXE A;  3GHG A;  1VQ8 P;  2GM4 A;  1VQ4 P;  1X22 A;  1AVO A;  1N7S C;  4ZMD A;  2JEE A;  1R5L A;  3H1H J;  2V4H A;  5APY A;  2RMZ A;  2P10 A;  4JBZ A;  1OVR A;  1X8Y A;  3L72 D;  5KLV E;  3NXS A;  3CL3 D;  1FOS E;  3H1J D;  1JCD A;  2Z5I A;  2QM8 A;  1FZG A;  2ZVO B;  1JY3 P;  1FDI A;  1JY3 N;  3AE6 C;  1VQ7 P;  2MKV A;  1SLQ A;  2QA4 P;  1URQ D;  1KZU B;  1LT9 C;  4KJM A;  3L71 J;  3CC7 P;  2AEM A;  3AED C;  1DEB A;  1OFC X;  3N7N A;  3W68 A;  2IBZ G;  5CCG D;  3SSU A;  5H2F H;  3L71 E;  1BSN A;  3BRV B;  3PH0 A;  2OTJ P;  1JY2 O;  1NTM G;  2QVA A;  1K04 A;  2M3E A;  1NWQ A;  2N1T B;  1SQQ K;  4LGD E;  1ZLL A;  2A06 E;  1DD3 A;  1IK9 A;  1GL2 B;  1N7S B;  1HBW A;  4L75 A;  1ZW0 A;  1M1K Q;  2YXQ B;  1SFC C;  4JF7 A;  1P84 E;  1SVF A;  3KQG A;  1KB9 I;  2OYI B;  5APQ A;  1L0L G;  1E79 H;  1AFO A;  1KFM A;  3VP8 A;  2IFN A;  4PD4 H;  1SQQ D;  2K9J B;  1J2J B;  2BEZ F;  2FFD B;  1NU1 J;  3L35 A;  1PP9 J;  3L36 A;  3MUD C;  1U7M A;  3H32 A;  1ZP0 C;  5AW1 B;  3HUS B;  3O8Z A;  1VF5 C;  2ZYG A;  3TGU D;  4D6T E;  2PAJ A;  1NU1 E;  2YIU C;  4IOI H;  4GT1 A;  4R4L A;  1PP9 E;  3II6 A;  3WU2 H;  5H2F E;  4WY4 B;  3CI9 A;  3HE4 A;  2LKM A;  3HD7 C;  4OGQ D;  2WSC H;  4H44 D;  1JTH A;  2E74 D;  2R32 A;  3H1L D;  1LTA C;  1FOS F;  2IZ1 A;  2IYP A;  4NPD A;  1DEE G;  1HF9 A;  1ZME C;  1NTZ J;  2AXC A;  4W7Y A;  3TNU A;  3Q2Y A;  2XKM A;  2JR8 A;  3CXH D;  2G3A A;  2PRR A;  3MTU E;  1SQB D;  1URQ A;  4DCK A;  1KYO I;  2E76 B;  1BE3 J;  4BXL A;  2Q9I A;  1D7M A;  1AV1 A;  3HTK A;  2WSC J;  2HG5 D;  4XA4 A;  3SFD C;  2JDI H;  2MJZ A;  1MFT A;  1LP1 B;  3A0B E;  5CCG A;  5KLV D;  3G9R A;  2QJP B;  3BCC E;  1RE4 A;  1BE3 E;  1N73 B;  3B71 A;  1GW4 A;  3R4Y A;  4Y99 B;  1YTZ T;  3LID A;  3AEA C;  3CWB J;  3RL0 C;  3H1H D;  2D2C B;  1L0N J;  3VTP C;  3V2Q A;  3O6Q B;  2FYU G;  3HD7 B;  1OXZ A;  3VYI A;  3CWB E;  4GOD A;  1L0N E;  2ZXX A;  2HOD B;  3AEC C;  1Y47 A;  5AVU B;  3AE4 C;  1NVO A;  4H13 C;  4IL6 H;  1DD4 A;  3L71 D;  1M57 D;  3V2N A;  5E79 H;  4HH2 A;  3LW5 H;  3Q1M A;  5KKZ B;  2W27 A;  1HWT C;  1T6A A;  1E5W A;  1M90 Q;  1TU3 F;  2CK3 H;  1SQX J;  3RK2 C;  1MFZ A;  1NTM K;  1HUC A;  2WPR A;  1ZRT E;  2JO1 A;  1X0T A;  2KZJ A;  3USS A;  2I1J A;  2V7Q H;  5APS A;  2BCC D;  4H0L C;  3LW5 J;  2WSF H;  3L72 G;  5M1B A;  5KJ7 C;  1KQF B;  4L76 A;  3L73 J;  3H1J G;  5C39 A;  1NU1 D;  3L37 A;  3KZI E;  1PP9 D;  1KB9 H;  4W7Z A;  2OTK E;  5E79 E;  1VDF A;  1FS0 E;  1OVV A;  3L73 E;  2JWA A;  1P84 I;  1NTZ K;  1PPJ D;  2QSI A;  3WUT A;  3M0D A;  2SPZ A;  3AE3 C;  4W80 A;  3GF7 A;  1MZ9 A;  2V7Q J;  1ZOY C;  1LT9 A;  4QMA A;  3BVH A;  2L91 A;  2WSF J;  4LLH A;  4PD4 D;  1SQP J;  1NTZ D;  4EYY Q;  2P58 A;  3FWL A;  3MP7 B;  2YKP A;  2W83 C;  2KSE A;  3T97 B;  3AE7 C;  3AEB C;  2QJY C;  4HB1 A;  4O9B A;  2KI7 B;  2QIW A;  1NGM B;  1OZH A;  4YXD C;  1VQN P;  1KB9 E;  1BE3 D;  1L2P A;  5TIS H;  1RE3 C;  2OTL P;  5GTH H;  3CCR P;  1KMI Z;  3TYY A;  1SQQ G;  1ZR4 A;  1S72 P;  1KYO H;  1LTJ B;  1LWU B;  2O01 H;  2O3J A;  4PV1 B;  4RJT A;  1K05 A;  3CWB D;  4H13 D;  1NTK J;  1S9K D;  3TGU G;  1FDM A;  3MUD A;  1YTZ I;  3P8C E;  1EC5 A;  4RO0 A;  2FYZ A;  1FJK A;  1NTK E;  2M0B A;  3M0A A;  5DJU B;  2OYH C;  3H32 B;  5KAF H;  5APV A;  3TK1 A;  4U3F J;  2O01 J;  1SQX K;  1PL5 A;  2QJY B;  4IL6 X;  4WB4 A;  5TIS E;  1VPC A;  3B5N B;  1EZV I;  3G71 P;  3HE4 B;  1SQB G;  1AQT A;  4U3F E;  3W67 A;  1ZRT D;  3GLM A;  1KYO E;  2OQQ A;  1IFP A;  4H0L D;  5BU8 B;  2BAS A;  3GMA A;  5KJ7 D;  1H0T A;  1SQX D;  1YBK A;  3M9B A;  4KT0 J;  3TNU B;  3I5C A;  3A0H H;  5KLV G;  1T3U A;  1LTS C;  3CCM P;  4MN4 C;  1VQ9 P;  3TSI A;  3H1H G;  1IZN B;  4HJG H;  4WWI A;  1L4A D;  1K73 Q;  2Y0C A;  1OW8 A;  2FXO A;  5AW3 B;  1J1E B;  3L70 J;  3L73 D;  1AA0 A;  5KAF E;  5KAI H;  2A45 I;  1NO4 A;  2XDJ A;  2N1T C;  1GL2 C;  3NFQ A;  3L70 E;  1NOH A;  2GUV A;  1G2C A;  1SQP K;  3UIA A;  4NPE A;  3L71 G;  2OYI C;  1GU5 A;  4I2L C;  1VQP P;  4DOJ A;  2WMM A;  1M7L A;  3FGA D;  5B66 H;  2LXB A;  2E43 A;  4Z1M H;  1P84 H;  2FFD C;  1RF1 A;  2ZYA A;  2NPS D;  2WT7 B;  1JOC A;  1ZXG A;  1M1J B;  2A06 G;  3A0H E;  3HUS C;  1SQP D;  2N9Y B;  3RBZ A;  4OVN F;  1IJD B;  1KB9 D;  1N8R Q;  1HTL C;  2FY8 A;  1FBM A;  4EOT A;  4K3A A;  4WY4 C;  2NZ2 A;  2ITA A;  2Q7C A;  3S4R A;  2IYO A;  2HYN A;  3L75 J;  5AVR B;  1QL2 A;  3V4W A;  2M8R A;  5KAI E;  2YMY A;  2C9L Y;  2BCC G;  1QGK B;  3H1I J;  2I8D A;  1FZC A;  1BDD A;  3KXD A;  3CCU P;  2Q3I A;  1S3J A;  3L75 E;  1NU1 G;  4H44 B;  1A02 J;  1PP9 G;  3P8C D;  4JPZ B;  3M9Q A;  3H1I E;  5KJ7 A;  3EWK A;  1GMJ A;  1KD1 Q;  2ZT9 B;  5B66 E;  1NH4 A;  1Q86 Q;  2FXP A;  3M9H A;  2E76 C;  5TJH A;  1PPJ G;  2LR2 A;  1FC2 C;  4YXW H;  3VN0 A;  3VOP A;  4D6T J;  1N2D C;  2YKO A;  2CPS A;  1USD A;  5CCH D;  1L4A A;  2P67 A;  2QJP C;  4N3Y B;  1IFJ A;  3WUV A;  1ZN5 A;  4AQR D;  5APU A;  4U3F D;  1N73 C;  3V5B A;  1NTZ G;  1KQL A;  4Y99 C;  1KYO D;  2D2C C;  1FZF A;  1GZL A;  2B87 A;  3A0B H;  1GTW A;  2DW3 A;  2AEJ A;  1LTI C;  1S5L E;  2HLO A;  2IBZ E;  2H89 C;  3Q5P A;  4GOF A;  3FXD A;  1DIP A;  1BE3 G;  1SQB K;  2E5Y A;  2R5D A;  3PRJ A;  1VL2 A;  2JWD A;  1BDC A;  3CPW O;  3ITK A;  2P1J A;  4CPG A;  3CMA P;  1AJY A;  1WMK A;  3TDK A;  1IFM A;  2NPS A;  2YKQ A;  2N1T D;  1CI6 A;  2WWW A;  4I1L A;  2VRS A;  5KKZ C;  5KLV K;  1GL2 D;  3CWB G;  1KIL E;  1N7S D;  2WTY A;  3CLQ A;  5CJ0 A;  3E1I A;  3BCC J;  2H43 A;  3JCU E;  4GOE A;  1YI2 P;  3L70 D;  1IK7 A;  1KIL C;  2K37 A;  2H7H A;  1K8A Q;  4AYC A;  2KZI A;  1T3J A;  4A7P A;  2KP8 A;  1NJI Q;  2JP3 A;  2KIK A;  4NPF X;  1RQV A;  2GA1 A;  3A5T A;  5AVQ B;  5KTB A;  1NHL A;  3CC4 P;  4WY4 D;  1Y9B A;  3F5H A;  1EZV E;  2B89 A;  1JNM A;  2XNX A;  2Q5U A;  3NTN A;  1X79 B;  1A02 F;  3I55 P;  1DX7 A;  3P7K A;  4GKG A;  2KLV A;  5GTI E;  1Q81 Q;  1SQX G;  1K9M Q;  3KZI H;  2ZXE B;  5CCH A;  4BWN A;  4WBA A;  4RES B;  2IX7 C;  1JCC A;  3ZDM A;  3L75 D;  3SWY A;  2OAR A;  2P2U A;  1JY3 O;  1SFC D;  1YJN P;  3H1I D;  2KNC B;  3KHU A;  2ZJS E;  2A06 D;  2GUS A;  4ZNC A;  1WRG A;  2E76 D;  3G4S P;  1IO4 A;  1KIL B;  3L74 J;  3L73 G;  2E5T A;  1P84 D;  5AVS B;  4IFF A;  2WSS H;  1SP4 A;  2UWJ E;  1HJB A;  2Z5H A;  2KSJ A;  1HGV A;  1CSB A;  1JUN A;  2WZ7 A;  3H25 A;  1NU1 K;  1VF5 D;  3HE5 B;  4JYC A;  3L74 E;  2CPB A;  3WMM 0;  3AE2 C;  2D2C D;  4L74 A;  3U59 A;  3Q5R A;  3TF5 A;  2WPV B;  1GL2 A;  4D6T D;  1N7S A;  3HD7 D;  2IFM A;  5AW6 B;  3A7O A;  1EXJ A;  3AE1 C;  3CCQ P;  3H1K J;  3V6I A;  2OYI A;  2XU6 A;  1LTJ C;  1LWU C;  2Y9Z A;  3QH9 A;  3RK3 E;  2Y9Y A;  4PV1 C;  1SQP G;  2K9J A;  3GHG B;  2QJK B;  1NKN A;  3H1K E;  2R3S A;  2K1A A;  1AVY A;  1USE A;  5APT A;  2Q3E A;  3V2P A;  2KXP B;  1EXI A;  1JEK A;  3CC2 P;  4DZO A;  1OW6 A;  5CHX A;  1X9V A;  1W5C E;  4C46 A;  1PGO A;  3CME P;  1H89 A;  1RF1 B;  4WY4 A;  3MD0 A;  1LGH B;  1FE6 A;  3JSV C;  1OX3 A;  1QL1 A;  1YYC A;  2IDB A;  4GDO A;  1XTC C;  1YJ9 P;  5CBO A;  2KYV A;  2IBZ I;  3B5N C;  2HPC A;  1NTK G;  3RL0 D;  3BCC D;  2Q6Q A;  1JY2 P;  1IC2 A;  1JY2 N;  1L0N K;  1FZC B;  4JYB A;  1QLE D;  3OAK A;  1SFC A;  1RHZ B;  4BRY A;  3GF3 A;  2E75 B;  3BAT A;  3CX5 I;  1EZV D;  1JMM A;  1HH0 A;  2FBW C;  3AEE C;  5KLI B;  3D71 A;  4U3F G;  1L0N D;  5AVX B;  1S4X A;  1EQ7 A;  3RK3 B;  3I56 P;  2YO3 A;  2C0X A;  4M3L A;  1H8A A;  1MUU A;  1N73 A;  1J1E C;  1LJ2 A;  1OMI A;  3EFF K;  4PJ0 H;  1JO5 A;  3NMD A;  2AXT E;  4ZKP A;  1PGP A;  3E7K A;  3O6Q A;  1UIX A;  2ZVN B;  4IFM A;  3HD7 A;  2W90 A;  3ABV C;  2K3R A;  4YPC A;  3RK2 D;  3CD6 P;  3CCV P;  3AE9 C;  2HOD A;  1YHQ P;  3D70 A;  1MV8 A;  2H8P D;  5AW8 B;  1U57 A;  4WVZ A;  1JTH B;  1R5S A;  3Q5S A;  1QVG O;  5AW9 B;  1SQQ E;  1CW5 A;  1N7L A;  1M1J C;  3L74 D;  2ZAE B;  3L70 G;  2RN0 A;  2HR3 A;  2ZFC A;  1M56 D;  2FKW B;  1UII A;  1SQV J;  2NPS B;  3V4Q A;  1KV4 A;  3H1L J;  4UB8 E;  4EIJ A;  1Y8A A;  5BU5 A;  4PJ0 E;  1JMB A;  1URQ B;  1EDL A;  1SQV E;  3JC2 2;  2ZYD A;  1HVV A;  3H1L E;  1G1I A;  3HTK B;  2Y0D A;  2C0W A;  1QVF O;  3H1K D;  2PGD A;  3B4S A;  4H44 C;  2W6B A;  4ZKU A;  2AEF A;  3RL0 g;  4I7Z B;  2E42 A;  4ASV A;  2LXC B;  5B5E H;  2ZT9 C;  4EDF A;  1AQ5 A;  4OH8 B;  1N86 A;  5AVT B;  2KS1 A;  1M8O B;  3B5N D;  3L75 G;  1FDO A;  4R4M A;  1BGY J;  2NRG A;  3MZW B;  3H1I G;  1BCC J;  4KHX A;  1CZQ A;  1VQ6 P;  4GIF A;  2R3C A;  1BGY E;  3IAO A;  3EFG A;  3PTZ A;  3H1H E;  1BCC E;  3SFE C;  1T2K C;  2J58 A;  3M0D C;  3M06 A;  3T97 A;  1NTK K;  3OA7 A;  3IR9 A;  1GDT A;  3AE8 C;  3PJS K;  1S5L H;  1W2B O;  1NAY A;  1RF0 C;  4D6T G;  3U1C A;  4OGQ B;  5B5E E;  2WSE H;  1RQU A;  3C9I A;  2E74 B;  2HFE D;  3M91 A;  1PV3 A;  2FYN B;  3VMY A;  2R5B A;  1NTK D;  1XTG B;  3L4F A;  1DH3 A;  1T8Z A;  3EQ2 A;  3RBX A;  1LTJ A;  1LWU A;  3CX5 H;  3B8E B;  3VMX A;  4N6J A;  2XND H;  4Y28 J;  1GK6 A;  5AVW B;  3JCU H;  2O1K A;  1BSH A;  2QE7 H;  2BCC J;  3R2P A;  3SWK A;  2WSE J;  1NTM J;  1Q90 D;  3QWO C;  3VP9 A;  5AW2 B;  2BCC E;  1SQV K;  3GW6 A;  1FAV A;  5BVZ A;  3G3Z A;  3BCC G;  1NTM E;  3H6P A;  3MHV A;  1JM0 A;  1LT9 B;  4EI2 A;  1RY3 A;  3C1L A;  1YQ3 C;  3B5N A;  1L0L J;  1VQM P;  2W6J H;  1KN7 A;  1HGZ A;  1LTT C;  1SQV D;  1NKZ B;  3CX5 E;  1RE3 A;  3SWF A;  1EZV G;  3AEG C;  5GTI H;  2Y0E A;  3CCS P;  2B9B A;  3FX0 A;  1W2E A;  1L0L E;  1PPJ E;  1L0N G;  2ZT9 D;  2HPC B;  5CJ4 A;  2YMK A;  1KC8 Q;  2WIT A;  4PD4 E;  3CCL P;  3IN6 A;  1SFC B;  2XZR A;  1NTZ E;  5APX A;  4DT0 A;  4BRY B; 
#chains in the Genus database with same CATH homology
 4C7N A;  4WB4 A;  1DEB A;  1NKN A;  3KDP B;  1VPC A;  3N7N A;  3B5N B;  3U1A A;  2A45 H;  3HE4 B;  5CCG D;  5APT A;  1FZA A;  3V2P A;  3BRV B;  4N78 E;  2OYH A;  4DZO A;  5BU8 B;  1JY2 O;  1FJP A;  2BAS A;  5CHX A;  1X9V A;  5KJ7 D;  4C46 A;  2A45 G;  2PP6 A;  1T2K D;  1H89 A;  3M9B A;  1RF1 B;  1NWQ A;  2N1T B;  1SQQ K;  4WY4 A;  3KPE A;  4LGD E;  3PP5 A;  3MD0 A;  1ZLL A;  3TNU B;  3MIW A;  2KOG A;  1LGH B;  3I5C A;  1IK9 A;  1GL2 B;  1T3U A;  1N7S B;  1PFI A;  1HBW A;  1SFC C;  4JF7 A;  1LTS C;  1QL1 A;  1SVF A;  1YYC A;  3KQG A;  2OYI B;  3GHG C;  1XTC C;  1NAF A;  3TSI A;  5APQ A;  2WT7 A;  2KYV A;  1AFO A;  1KFM A;  1WT6 A;  3VP8 A;  1M1J A;  3B5N C;  2IFN A;  2HPC A;  1L4A D;  3RL0 D;  1J2J B;  1S9K E;  5AW3 B;  2FFD B;  1J1E B;  3L35 A;  1JY2 P;  4HYT B;  1IC2 A;  3HRN A;  3L36 A;  1JY2 N;  1L0N K;  1GD2 E;  2A45 I;  3H32 A;  1NO4 A;  5AW1 B;  3HUS B;  1FZC B;  4JYB A;  2XDJ A;  3O8Z A;  1RF1 C;  2N1T C;  3OAK A;  1SFC A;  1OWA A;  2PAJ A;  4IFD K;  1GU4 A;  1GL2 C;  3NFQ A;  3BAT A;  1NOH A;  5AVY B;  4GT1 A;  3II6 A;  2GUV A;  1JMM A;  1HH0 A;  4WY4 B;  1KFN A;  1G2C A;  1SQP K;  3CI9 A;  3HE4 A;  3UIA A;  2OYI C;  1GU5 A;  4I2L C;  2LKM A;  3HD7 C;  2WSC H;  5AVX B;  1JTH A;  3RK3 B;  1EQ7 A;  4DOJ A;  2YO3 A;  1M7L A;  2R32 A;  1LTA C;  2C0X A;  4M3L A;  2E43 A;  1H8A A;  2FFD C;  1FZE A;  1MUU A;  1N73 A;  1RF1 A;  1FOS F;  1J1E C;  2N1T A;  2NPS D;  2WT7 B;  1IFI A;  1JOC A;  1M1J B;  4W7Y A;  3TNU A;  3BRT B;  3HUS C;  1FZC C;  1JO5 A;  3NMD A;  5APW A;  2XKM A;  4B86 A;  1IJD B;  4ZKP A;  3RL0 B;  1ZR2 A;  4IFM A;  3HD7 A;  1HTL C;  2O1J A;  1GW3 A;  1FBM A;  3MTU E;  4EOT A;  3RK2 D;  1URQ A;  4WY4 C;  1GK4 A;  2HOD A;  2Q7C A;  2HYN A;  2FFD A;  5AVR B;  1QL2 A;  3V4W A;  2M8R A;  1MV8 A;  2H8P D;  5AW8 B;  2YMY A;  1L0L K;  3RK3 C;  2Q9I A;  2C9L Y;  1G2C B;  3HTK A;  2JJL A;  3HUS A;  1FZC A;  2HG5 D;  4XA4 A;  2L5G B;  1IFD A;  2MJZ A;  1JTH B;  5AW9 B;  5CCG A;  1CW5 A;  1N7L A;  1M1J C;  2POH A;  2Q3I A;  1RE4 A;  1A02 J;  1N73 B;  3P8C D;  1GW4 A;  4Y99 B;  1YTZ T;  3M9Q A;  1L4A C;  3LID A;  3RL0 C;  2ZFC A;  1KIL D;  2FKW B;  5KJ7 A;  3VTP C;  2NPS B;  3IFM A;  3V4Q A;  1NH4 A;  5AW7 B;  5AVV B;  3V2Q A;  3M9H A;  4EIJ A;  3HD7 B;  5BU5 A;  3P32 A;  5AW5 B;  1LTG C;  1OXZ A;  3LIE A;  3BAS A;  3VYI A;  1RF0 A;  2WPS A;  1URQ B;  3VN0 A;  3P8M C;  1IFN A;  2HOD B;  3VOP A;  3RK2 B;  1N2D C;  2YKO A;  2CPS A;  5CCH D;  1HVV A;  1L4A A;  5AVU B;  1G1I A;  3HTK B;  2P67 A;  2C0W A;  4N3Y B;  2KB7 P;  1IFJ A;  4AQR D;  1ZN5 A;  5APU A;  2W6B A;  1J1D C;  1N73 C;  3V2R A;  3V5B A;  3V2N A;  1KQL A;  4N78 D;  4HH2 A;  4Y99 C;  3LW5 H;  4ZKU A;  1FZF A;  1GZL A;  2E42 A;  2YNY A;  2WPQ A;  1H88 A;  4I6M C;  1GTW A;  2NPS C;  2M3B A;  1LTI C;  2N9B A;  2HLO A;  2W27 A;  1HWT C;  1AQ5 A;  4OH8 B;  1E5W A;  1N86 A;  1G1J A;  5AVT B;  1URQ C;  2Z4E A;  3B5N D;  2P7J A;  1SQB K;  2R5D A;  3RK2 C;  1MFZ A;  2P1J A;  5AVZ B;  2QM7 A;  1NTM K;  1HUC A;  2WPR A;  4KHX A;  1IFM A;  1CZQ A;  2NPS A;  2IPP A;  2YKQ A;  4GIF A;  1L4A B;  2N1T D;  5CCG C;  1LTB C;  1CI6 A;  3N4X A;  2WWW A;  2R3C A;  4I1L A;  2I1J A;  5APS A;  3KYQ A;  2VRS A;  1RE4 C;  5KLV K;  1GL2 D;  3EFG A;  1N7S D;  2WTY A;  3CLQ A;  2WSF H;  5CJ0 A;  4C7R A;  3E1I A;  2FYU K;  5AW4 B;  5KJ7 C;  1T2K C;  2H43 A;  2J58 A;  3M0D C;  3OJA B;  3L37 A;  1KIL C;  4LC1 A;  3M06 A;  3T97 A;  1ZV8 A;  1NTK K;  4W7Z A;  3OA7 A;  2J59 M;  2H7H A;  3IR9 A;  1GDT A;  4AYC A;  1RF0 C;  1VDF A;  3U1C A;  1Z56 A;  2WSE H;  3C9I A;  1T3J A;  3MGN A;  1J1D B;  2KP8 A;  1NTZ K;  5CMZ A;  2HFE D;  3M91 A;  2FXM A;  3VMY A;  2R5B A;  5CCH C;  3A5T A;  3M0D A;  5AVQ B;  1XTG B;  3L4F A;  4W80 A;  5KTB A;  1DH3 A;  2W6A A;  1KIL A;  1NHL A;  1FZB A;  1MZ9 A;  3VMZ A;  2YO2 A;  5AW0 B;  1T8Z A;  1CI6 B;  3A3Y B;  4WY4 D;  3EQ2 A;  1LT9 A;  2I1K A;  1LTJ A;  1LWU A;  1FU1 A;  3BVH A;  3A2A A;  3B8E B;  1JNM A;  4LLH A;  2XNX A;  2Q5U A;  3NTN A;  1X79 B;  1A02 F;  3RK3 D;  3VMX A;  4N6J A;  1DX7 A;  3P7K A;  1GK6 A;  5AVW B;  3HE5 A;  4GKG A;  2KLV A;  2O1K A;  2YKP A;  2C9N Y;  2ZXE B;  5CCH A;  4XE5 B;  4O9B A;  3R2P A;  4WBA A;  4RES B;  2IX7 C;  4C7N B;  1JCC A;  3VP9 A;  3SWY A;  5AW2 B;  2OAR A;  2P2U A;  1JY3 O;  1SFC D;  1RE3 C;  1SQV K;  4AUW A;  3TYY A;  2GUS A;  1FAV A;  1WRG A;  5BVZ A;  3G3Z A;  2XV5 A;  2OYH B;  1KIL B;  1ZR4 A;  1IO4 A;  3H6P A;  3GHG A;  2GM4 A;  1LT9 B;  1LTJ B;  1LWU B;  2O01 H;  5AVS B;  1RY3 A;  4IFF A;  1N7S C;  1SP4 A;  1HJB A;  2Z5H A;  2KSJ A;  2JEE A;  3B5N A;  5APY A;  1HGV A;  1CSB A;  1JUN A;  1HGZ A;  2WZ7 A;  1LTT C;  1NU1 K;  1X8Y A;  1S9K D;  1NKZ B;  3NXS A;  3HE5 B;  1FDM A;  4JYC A;  2CPB A;  3WMM 0;  3CL3 D;  1FOS E;  1RE3 A;  3MUD A;  3SWF A;  1JCD A;  2Z5I A;  1YTZ I;  2QM8 A;  3P8C E;  3U59 A;  1W2E A;  1FZG A;  1JY3 P;  2FYZ A;  2HPC B;  1JY3 N;  1FJK A;  3M0A A;  1GL2 A;  1N7S A;  3HD7 D;  2IFM A;  5AW6 B;  3A7O A;  2OYH C;  5CJ4 A;  1SLQ A;  2OYI A;  1URQ D;  3H32 B;  1KZU B;  1LT9 C;  2XU6 A;  1LTJ C;  1LWU C;  2WIT A;  5APV A;  3TK1 A;  1SFC B;  2XZR A;  5APX A;  1SQX K;  3GHG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...