4AQRD

Crystal structure of calmodulin in complex with the regulatory domain of a plasma-membrane ca2+-atpase
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
57
structure length
57
Chain Sequence
SSIERLQQWRKAALVLNASRRFRYTLDLKKEQETREMRQKIRSHAHALLAANRFMDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALMODULIN-7
publication title A Bimodular Mechanism of Calcium Control in Eukaryotes
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Ca-binding protein/hydrolase
total genus 27
structure length 57
sequence length 57
ec nomenclature ec 7.2.2.10: P-type Ca(2+) transporter.
pdb deposition date 2012-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4aqrD00
1JNMA 3I5CA 1HBWA 1GD2E 5AVRB 5AW5B 4B86A 2XV5A 4LC1A 3M91A 3HE5A 5APWA 1NWQA 5AW7B 3V4QA 1S9KD 1H89A 2R32A 2E42A 3UIAA 3HE5B 1GTWA 2N9BA 3M06A 5AW4B 3P32A 5APVA 1GK4A 4JYCA 5AW9B 1FOSF 5APUA 1CI6A 5AVQB 2QM8A 2R3CA 1CI6B 3V4WA 1T2KD 1OXZA 4I6MC 2YO3A 1CSBA 1SP4A 5AVTB 5AVWB 3V5BA 2KP8A 1A02F 3P8MC 2WT7A 3VYIA 4EOTA 3NFQA 3MGNA 3OAKA 2Z5IA 1OWAA 2WT7B 2BASA 2YNYA 4M3LA 2C9NY 3A7OA 5APTA 4AYCA 3L35A 5AVZB 5AW3B 3NTNA 1JUNA 1GU5A 4AUWA 2R5BA 1CZQA 2Z5HA 2ZFCA 4HYTB 5APSA 1HUCA 1X8YA 1HJBA 3NXSA 3KDPB 5CMZA 3VMZA 3A2AA 4C7NA 2P7JA 4XE5B 2R5DA 3L36A 1SLQA 2WWWA 3P7KA 4C7NB 3TNUA 2WPRA 1H88A 1GU4A 2IPPA 3TNUB 2XU6A 3VMXA 2H7HA 5AVVB 5AVXB 2YO2A 1J2JB 2Q5UA 1GZLA 3KQGA 2P67A 2WTYA 3A5TA 4AQRD 3VN0A 3IR9A 5APXA 1H8AA 1MFZA 3LIDA 3MD0A 1KQLA 1S9KE 1DH3A 1YYCA 2JJLA 2C9LY 3A3YB 5APYA 2QM7A 5AW1B 1GK6A 2W27A 2ZXEB 3HTKA 3M9HA 4GT1A 4JYBA 2WPQA 1IO4A 4C46A 4RESB 2Q7CA 5AVUB 5AW2B 3NMDA 5APQA 3TK1A 3M0DA 1A02J 1NAFA 2P2UA 3LIEA 4DZOA 2VRSA 3O8ZA 2XZRA 5AVSB 2W6AA 3HE4A 5AW8B 3VMYA 3VTPC 5AW6B 5AVYB 5AW0B 4GKGA 1FOSE 3HE4B 3TYYA 1FAVA 1T2KC 1MV8A 1HWTC 3B8EB 3M9BA 4KHXA 3T97A 2Q3IA 3L37A 3M0AA 2E43A 1G2CB 4I2LC 3SWFA 2WPSA 1MUUA
chains in the Genus database with same CATH superfamily
1LTIC 2ZYAA 4LC1A 1JY3N 3L70D 4LLHA 2RKLA 2HLOA 1GTWA 1NTZD 2K88A 3EQ2A 3U1AA 1VF5B 3RGUA 3L70G 3L75D 3TF5A 1NTKJ 4L76A 2IZ0A 2XNDH 3OAKA 1L0LK 2KB7P 3ABVC 1Y47A 2GUSA 5AVZB 5AW3B 3CXHH 1ZR4A 2FXPA 2QSIA 4KJMA 3CC4P 1P84H 4YXDC 1S4XA 2KSEA 2YIUC 1SFCD 3CD6P 1NTZJ 2XKMA 3L73E 3CCUP 5AVVB 2OQQA 4ZMDA 3OJAB 4OH8B 1QEXA 3L75J 3KHUA 1Q86Q 3P8CE 1RE3A 3VP8A 2HFED 3O8ZA 1SQBD 5AVSB 2YKOA 2B89A 1HVVA 5KJ7D 3H1HD 1VQNP 4WVZA 2AXTH 2AEJA 3T97A 3MTUE 1OW8A 1MZ9A 1GL2B 1G2CB 2J5UA 1SQBG 3H1JG 3II6A 1RF0C 2K3RA 3CCQP 3M91A 4WY4A 3P32A 1N2DC 4BRYB 1KYOH 4O9BA 2FYUD 1BGYD 2YO3A 2KP8A 1USEA 3AEBC 1SQQE 3H1HJ 1S1CX 2E76B 3L72G 1M56D 1NVOA 3RK3D 3H32A 2GUVA 1J1EC 1N73C 3C1LA 2ZT9C 2FYUG 1BGYG 2OTJP 1IZNB 1R5SA 2ZFCA 1M1JA 3F89A 2JKVA 4WWIA 2QJKC 3AE4C 4RKUJ 4OWFA 4L74A 5CCHC 5GTIH 3A5TA 5H2FE 3ZDMA 4ASVA 1OVUA 1AVYA 1FZBA 1NKNA 3M9QA 1FZAA 2QM7A 3V2NA 2IBZE 2ZVNB 3N7NA 3GW6A 3S4RA 4EIJA 5CBOA 4GT1A 4C46A 1YQ3C 1DEBA 5TISH 2LXCB 4PJ0H 5AVUB 2OYHA 3LIEA 3KZIH 1NOHA 5DJTB 1ZXGA 5KLIC 5M1BA 1SFCB 1BSNA 5KLVE 2M0BA 5E79H 2KS1A 2E74C 2D2CC 1AQ5A 1R8EA 2N1TA 3SFDC 1JTHA 2BCCE 4Y99B 4Z1MH 2NPSD 1AFOA 3RL0g 2OGUA 1U7MA 5AW4B 3RK2C 3B5NC 3L73G 3O6QB 2PP6A 5AVQB 1H0TA 1LT1A 1CSBA 1UIXA 1SQVK 2YXQB 4W7ZA 1OWAA 2HR3A 1SQXK 3GHGC 1M90Q 2BASA 2O1JA 3Q3DA 1YHQP 5APTA 1OFCX 1PZQA 1YITP 4UB6H 3K5BA 4N3YB 1HUCA 3CC2P 2JP3A 3BCCD 1PL5A 1S2EA 3CXHE 3AE5C 4GIFA 1VQ9P 1KB9D 4ZKUA 1IFIA 1JEKA 3KQGA 3V2PA 1FS0E 2E75D 2HODB 4L75A 3CMEP 1ZRTE 3C9IA 1NTKK 3RK3B 2M3BA 1AQTA 5B5EH 3RBXA 2K9YA 1NYHA 1KN7A 1AVOA 3RL0C 1A02J 2WPVB 3OA7A 1NTMJ 1KILA 1K9MQ 3KPEA 2QJYC 5AVYB 3BCCJ 3E7KA 2KNCA 1SQQG 1YI2P 4H0LC 1NTZK 2KOGA 5EFWB 4K3AA 3L71E 5AW7B 1VQPP 3MZWB 1BSHA 2IBZD 2K9JB 2WQYC 1FZCA 1PGJA 1Q7YQ 2LR2A 3H1KE 1NO4A 4TT3H 4PD4E 2WT7A 1KYOE 2IBZG 1RHZB 1KQFB 3JSVC 2C9NY 4W80A 2O01N 1KB9I 4AYCA 4OGQD 1BCCD 1QGKB 2NPSB 2B9BA 2O01J 1LGHB 4ASWA 2BCCD 4WY4C 5KLVG 1JB0J 3ITKA 2NZ2A 1RH5B 3HD7D 3MP7B 2WTYA 2Y9ZA 1RF1A 2YMYA 1S9KE 1DH3A 5GTIE 5CBNA 3A3YB 5KKZC 1LWUB 3H1IE 1ZR2A 1BCCJ 1M1JC 3BASA 3EWKA 3NMDA 3TK1A 1L4AA 3I55P 1LTGC 4IFFA 2BCCJ 3AE3C 4PJ0E 3E1RA 4TLFA 2IBZI 2A06D 3A0BH 3KZIE 2E75B 2L5GB 1GZLA 1JNMA 4YPCA 1HGVA 1IFDA 5E79E 1N7SD 3WMM0 1ZRTD 3PTZA 3H1LG 2BEZF 5APVA 2WSFH 4U3FE 2YKPA 3BVHA 2OYHC 3RK2D 1PIXA 2FFDA 5AVTB 4W7YA 2KLUA 3Q5RA 4JF7A 3B4SA 4JPZB 3CMAP 3MGNA 1URQD 1LT9B 1S3JA 2N1TC 3HRNA 2IYOA 2JWAA 2V4HA 1WT6A 1S72P 4XE5B 1FBMA 1NU1E 3TNUA 1RQUA 1JM0A 2QA4P 2QG4A 3N4XA 3AEFC 1EC5A 5B66H 4DCKA 2PAJA 1IFJA 1T3JA 4PV1D 3L74E 3L71G 3OW2O 4PD4D 2B87B 4OGQB 2FYNB 1XTGB 3G3ZA 3CX5D 2KXPB 3H1KG 3D71A 1XTCC 1QX8A 1FC2C 1T3UA 1SQPE 3HD7B 1DEEG 1HWTC 1FJPA 1QVFO 5C39A 3AE8C 1WRGA 1EDLA 1HBWA 5AW5B 4B86A 2KZJA 3G9RA 1BE3E 1S9KD 3HE5B 1PV3A 1NJIQ 2QIWA 1SQVJ 3TSIA 5AW9B 1KILC 1KMIZ 3PHLA 2E5YA 2ZYGA 4L73A 2OYIB 3AECC 3H1IG 1W5CE 3A0HH 1PGQA 5CCGA 2ZJSE 4D6TE 3AE1C 1IFMA 2QJPC 1EQ7A 4IL6H 4UB8H 1N7SB 3VMZA 1KC8Q 1SLQA 4PD4I 3I56P 1IK9A 2AEMA 1FZCC 3RK2B 4JBZA 3VMXA 3CX5I 4BWNA 2OARA 3MUDA 5APXA 3IN6A 1URQB 3L70J 2HYNA 1CW5A 4U3FG 1FDMA 5APQA 1KILE 2W6BA 2VRSA 2ZXXA 1J1DB 4I7ZC 3FWNA 3W67A 4H13D 1G2CA 1GL2A 1Y9BA 4KT0J 1L0NE 1RF1C 4PV1B 3A0BE 3FWLA 2M5AB 4GODA 1NU1G 4BRYA 3H1JD 5CJ0A 1L4AC 3JCUE 1N8RQ 3IFMA 1Q81Q 4Y28J 1JMBA 4HJGH 3V4WA 1PGPA 1T2KD 2HG5D 1A02F 3TDKA 3L74G 1BDDA 3AE9C 3CCEP 1LTSC 1AJYA 2P1JA 3CCRP 3NTNA 2N1TD 1HJBA 3L72D 1K05A 2P7JA 1SQPG 1SQBJ 2UWJE 3H1JJ 1PP9E 2AEFA 2H7HA 5AVXB 2YO2A 2FFDC 2FYZA 4NPDA 2MJZA 3WU2H 1IK7A 4WB4A 5CHXA 2JJLA 1BE3G 1GK6A 2GM4A 2W27A 3Q5PA 3Q1MA 1UIIA 2ZXEB 4H44C 1OW7A 3E1IA 1OVVA 4RESB 1ZV8A 1L0LE 2W8ZA 4D6TD 3L72J 1SFCA 2Y0DA 2HPCB 2FYUJ 1BGYJ 3PP5A 5BU5A 1VL2A 4D6TG 3SWFA 2WMMA 1ZW0A 3R4YA 5APWA 1E79H 4EI2A 3FXDA 1LP1A 5KAIH 1VQMP 3O6QA 4ZKPA 3SWKA 5APUA 4D6TJ 5KJ7A 1U57A 2JWDA 3W68A 3L73D 1LTJB 4EOTA 2C0WA 1OMIA 4H13B 1DIPA 1AV1A 1EZVE 1MFTA 3BATA 2A45G 3P8CD 4YXWH 2KLVA 3A2AA 3A0HE 2IYPA 2CPBA 2H43A 2JR8A 1SS1A 1VF5C 5CJ4A 2WSEJ 1L0NG 2HODA 1RE4A 3PJSK 5KAFH 2QEXP 3S9OA 3L73J 1JY2N 1FJKA 2RMZA 1JY3P 2I1JA 1GW3A 2WPQA 3CPWO 2RN0A 5CCGC 4XFJA 3H1LE 1P84E 3M0DA 3VMAA 1NAFA 3EFGA 3F5HA 2XZRA 2IZ1A 3GF3A 1WMKA 1FOSE 3HUSB 3TYYA 5KTBA 3CWBE 3M9BA 1PP9D 2JO1A 1L2PA 3MUDC 3R2PA 1MUUA 1SQQD 2A45I 2GA1A 1PP9G 2P10A 1VQ6P 1FZGA 1L0LD 1Q2NA 3VYIA 3NFQA 2AXTE 1GL2C 3SFEC 2NPSA 3L35A 2R5BA 1SQQJ 1L0LG 2B88A 2QVAA 1OZHA 3VP9A 2G3AA 3GLMA 3GF7A 1BDCA 2WWWA 2KK7A 3CL3D 1QL1A 2W83C 4CPGA 2XU6A 2P67A 5KLVD 3VN0A 1MFZA 1LWUA 2E76C 3CC7P 3CI9A 3G71P 1QL2A 5AW1B 2ZT9D 3U1CA 1S5LH 3AEDC 2WSSH 1E5WA 1Q90D 2SPZA 2POHA 1SQXE 4R4LA 3QWOC 3TGUE 5CCHD 3VMYA 1IJDB 2ZYDA 1HH0A 1SQBK 4R4MA 1VQ4P 1HTLC 2CK3H 3M0AA 1EZVG 5KLVJ 5AVRB 2O1KA 1IC2A 1FE6A 2WSEH 3G4SP 5TISE 2YIUB 1KORA 1T6AA 3SWYA 1SFCC 3CXHD 1KD1Q 3H1LD 2ZVOB 3AE6C 1SP4A 1P84D 4I1LA 3BRTB 2E74D 3P8MC 1LT9A 2D2CD 2FXMA 2FYUK 2P58A 3VOPA 3Q5SA 2RH0A 3CWBD 4Y99C 1FDIA 2Z5HA 1Y8AA 5APSA 1NTZE 3AEAC 3B5ND 2JEEA 1YJ9P 3L36A 2KSJA 2WPRA 3AE7C 3CWBG 1KV4A 5TJHA 3L75E 4IFMA 4DOJA 3CCSP 5KJ7C 3H1LJ 2QRXA 2B87A 1KB9H 3L71D 4UB6E 2Q7CA 5AW2B 2Z4EA 2L91A 3HD7A 1OW6A 3H1KD 4KHXA 1RE4C 2Q3EA 1KYOD 4I2LC 2YKQA 3CXHI 2J58A 3WUVA 3I5CA 3RK3C 1J1EB 1P84I 1N73B 3B71A 2ZT9B 3HE5A 1H89A 3FX0A 2E42A 3CCLP 3WUUA 5B5EE 3RL0D 2QJKB 1Z56A 3M06A 1D7MA 3L71J 3M0DC 2FBWC 1LTBC 2QM8A 2R3CA 3H1HE 1CI6B 2Y0CA 2O01H 3MHVA 4I6MC 5H2FH 3S1KA 1SQXD 3V5BA 2OYIA 1JCCA 3IAOA 4H0LD 3TGUD 3H1KJ 1S5LX 4RJTA 2YNYA 1PGOA 1YIJP 1YJWP 1N7SA 1CZQA 2KZIA 1SQXG 3H1ID 1K04A 2YXRB 3KDPB 1K73Q 3TGUG 3CCMP 2NRGA 2R5DA 3P7KA 4C7NB 5DJUB 5KLIB 2IDBA 1NAYA 1FZEA 3AE2C 1M7LA 4AQRD 4GDOA 1EDKA 1H8AA 1PFIA 1URQA 2E74B 1YBKA 2D2CB 1VQ7P 1IO4A 2NPSC 1NTKG 1KYOI 3HTKB 2LXBA 2W90A 2H88C 1ZN5A 3H1IJ 4WY4D 3B5NB 4DZOA 1SQQK 4GOFA 1S5LE 1PPJE 4IFDK 2XNXA 3PH0A 3VTPC 5AW6B 5AW0B 4U3FD 1DD3A 1M1KQ 3HE4B 1HJ0A 1FAVA 3IF4A 4LGDE 3B8EB 1IFPA 2J59M 3GHGB 1LWUC 1NTZG 2M5AA 3EFFK 2Y0EA 4HKZH 2N9BA 2Q6QA 3L75G 5BVZA 3CCVP 2ITAA 1NU1D 1X0TA 3KYQA 3H6PA 5AVWB 1NH4A 4U3FJ 1W2BO 2E75C 1ZMEC 4DJGA 2WZ7A 3L74D 5KLVK 1X8YA 2K1AA 4NPFX 3RL0B 1NKZB 1H88A 1LJ2A 2R3SA 2QJYB 2IPPA 5GTHH 1NU1J 1SQPD 3CLQA 1DX7A 4H0LB 1EXIA 1OVRA 1LT9C 1YYCA 1VQLP 2C0XA 1LTTC 1JY2O 4ZNCA 1VQOP 1NTME 2W6JH 1KQGB 5K5GB 3L74J 2Y9YA 3BCCE 1BE3D 3H1HG 2HPCA 4N78E 1KB9E 4PD4H 2FKWB 1MV8A 1RY3A 3L37A 3CCJP 3CX5H 5B66E 2E43A 1SQPJ 2WPSA 3T97B 1GW4A 1GD2E 3KXDA 4HH2A 2PGDA 3D6YA 4OGQC 2FYNC 4HB1A 1DD4A 1G1JA 4WY4B 1BE3J 2KIKA 3HD7C 1LTJA 1PPJD 4IL6X 2Z5IA 2O3JA 3WUTA 2Q1KA 5KKZB 3A7OA 5BU8B 3H32B 1GU5A 1KFMA 1MKMA 4HYTB 1VQ8P 1FDOA 3NXSA 1PPJG 1EDJA 1T8ZA 1HGZA 1M1JB 3RBZA 5L8RJ 1KILD 3PRJA 2DW3A 3L4FA 2Q5UA 2OYIC 1L0ND 1KZUB 2LKMA 1BCCE 1OIPA 4K35A 1VPCA 1N7SC 4DT0A 4IL6E 4UB8E 2KUBA 2P2UA 3HUSA 2OYHB 3U59A 1LP1B 2Q3IA 4QMAA 4A7PA 2KS1B 1URQC 2N1TB 2XV5A 1L0NJ 1JTHB 1NWQA 1GDTA 2R32A 3UIAA 4U7JA 1FOSF 1J1DC 1NTMD 3FXEA 2V7QJ 4IOIH 3MIWA 1OXZA 2A06E 1H0TB 4RO0A 1SVFA 4N78D 1ZOYC 2H8PD 1NTMG 4M3LA 4PV1C 1JO5A 2K9JA 2WSFJ 3BCCG 3C8VA 2FY8A 2IX7C 5CMZA 2ZAEB 1GMJA 1L4AD 4MN4C 1GU4A 2M8RA 1NHLA 2XDJA 1PP9J 2OTKE 1M8OB 2R44A 3LIDA 3MD0A 1KQLA 1LNQA 5GTHE 2E5TA 4NPEA 2C9LY 3QH9A 3Q2YA 2H89C 3M9HA 4JYBA 3USSA 2AXCA 2K37A 3FGAD 1KILB 1RE3C 1USDA 3AEEC 1YJNP 1L0LJ 2KNCB 1N86A 1VDFA 1W2EA 2WVRA 1U7JA 3WU2E 1NU1K 2QE7H 4OVNF 4H44D 1SQVE 1EZVD 4XA4A 3CX5E 2QJPB 3V4QA 4C7RA 2KI7B 1G1IA 3SSUA 1JOCA 3BRVB 1FZCB 2WSCJ 1BCCG 2WT7B 3LW5J 2BCCG 1JUNA 1SQPK 2A45H 1NTKE 2WITA 4WBAA 1KFNA 5KAIE 2N9YB 1VQKP 4I7ZB 3GMAA 1LTAC 1J2JB 1R5LA 1RQVA 3H25A 1LTJC 1IFNA 4H13C 3L70E 3PLNA 1RF1B 1RF0A 1YTZI 2V7QH 4JQ0D 2KYVA 1TU3F 2BEQD 4N6JA 2M3EA 3JCUH 1X9VA 4GOEA 1M57D 1OX3A 4BXLA 2A06G 1EZVI 1L4AB 1VF5D 1JY3O 1AA0A 4YTPC 1FU1A 1T2KC 1HF9A 2I8DA 3D6ZA 1N73A 3CWBJ 5KAFE 1EDIA 1YQ4C 3GG2A 1Q82Q 2OTLP 1YTZT 1NGMB 5CCGD 1FZFA 1KQSO 1QVGO 1GK4A 4JYCA 1KTMA 5CCHA 1CI6A 2PRRA 3HUSC 2JDIH 2CPSA 1K8AQ 2FFDB 2FXOA 2IFMA 2G8YA 1JY2P 4EYYQ 4AUWA 1SQBE 4H44B 3H1JE 4C7NA 1ZP0C 1SQVD 1L0NK 3V6IA 1JCDA 2MKVA 3TNUB 1EXJA 2Q9IA 3JC22 3IR9A 1GL2D 1JMMA 1SQVG 3D70A 5APYA 1ZLLA 1X79B 3AEGC 3L72E 3HTKA 3V2QA 2WSCH 3V2RA 3B5NA 2FYUE 1BGYE 2YMKA 1VQ5P 4EDFA 2OYOA 1X22A 2W6AA 3HE4A 5AW8B 1NTKD 2PFXA 3LW5H 1N7LA 4GKGA 1SQXJ 3RK3E 2IFNA 2I1KA 3TGUJ 1QLED 3GHGA 2E76D 3G6EP 1NTMK
chains in the Genus database with same CATH topology
1JNMA 1GW4A 1GD2E 2A45I 1HGVA 1IFDA 1LTIC 4HH2A 4LC1A 1JY3N 1N7SD 3WMM0 4LLHA 2HLOA 1GTWA 1G1JA 5APVA 3EQ2A 4WY4B 2WSFH 3BVHA 2YKPA 2OYHC 3RK2D 3U1AA 1FZGA 2FFDA 3HD7C 5AVTB 1LTJA 4W7YA 4JF7A 3VYIA 3NFQA 3MGNA 3OAKA 1URQD 1LT9B 2Z5IA 1GL2C 1L0LK 2KB7P 2N1TC 3HRNA 2GUSA 3A7OA 5BU8B 2NPSA 3L35A 5AVZB 3H32B 5AW3B 1GU5A 1KFMA 1ZR4A 2R5BA 4HYTB 3NXSA 1T8ZA 1HGZA 3VP9A 1WT6A 1M1JB 4XE5B 1FBMA 2WWWA 3TNUA 3CL3D 1KILD 1SFCD 1QL1A 2XKMA 3N4XA 2XU6A 3L4FA 5AVVB 2Q5UA 2P67A 3OJAB 4OH8B 3VN0A 2OYIC 2PAJA 1MFZA 1IFJA 1T3JA 1LWUA 3CI9A 1QL2A 1KZUB 2LKMA 5AW1B 3U1CA 3P8CE 1E5WA 1XTGB 1VPCA 1N7SC 2POHA 1RE3A 3G3ZA 3VP8A 2HFED 2P2UA 3O8ZA 1XTCC 5AVSB 5CCHD 3HUSA 1IJDB 3VMYA 2OYHB 2YKOA 3U59A 1HH0A 1T3UA 3HD7B 1HVVA 5KJ7D 1SQBK 1HTLC 1HWTC 3T97A 2Q3IA 3M0AA 3MTUE 1MZ9A 1FJPA 1GL2B 1G2CB 1URQC 1WRGA 1HBWA 2N1TB 3II6A 5AVRB 1RF0C 5AW5B 4B86A 2XV5A 1JTHB 3M91A 1NWQA 2O1KA 1IC2A 1S9KD 1GDTA 2R32A 2WSEH 3UIAA 3HE5B 4WY4A 3P32A 1N2DC 3TSIA 5AW9B 1FOSF 1J1DC 4O9BA 3SWYA 1KILC 1SFCC 3MIWA 1OXZA 2YO3A 1SP4A 2KP8A 4I1LA 1SVFA 3BRTB 3P8MC 1LT9A 2OYIB 4N78D 2FXMA 2FYUK 3VOPA 2H8PD 3RK3D 4M3LA 3H32A 1JO5A 2GUVA 1J1EC 1N73C 4Y99C 5CCGA 2Z5HA 2ZFCA 1IFMA 5APSA 1M1JA 1EQ7A 2IX7C 1N7SB 5CMZA 3VMZA 3B5ND 2JEEA 1SLQA 3L36A 1L4AD 2KSJA 2WPRA 1IK9A 1GU4A 1FZCC 5CCHC 2M8RA 3RK2B 3VMXA 4IFMA 4DOJA 1NHLA 2XDJA 1GZLA 5KJ7C 3A5TA 2OARA 3MUDA 5APXA 1FZBA 3LIDA 3MD0A 1KQLA 1NKNA 3M9QA 1URQB 1FZAA 2C9LY 2QM7A 3V2NA 3N7NA 4EIJA 3M9HA 4JYBA 4GT1A 4C46A 2HYNA 1DEBA 1CW5A 1FDMA 2Q7CA 5AVUB 5AW2B 5APQA 2W6BA 2OYHA 3LIEA 2Z4EA 2VRSA 1J1DB 1NOHA 3HD7A 1KILB 1SFCB 1RE3C 1N86A 1VDFA 1W2EA 1G2CA 1GL2A 4KHXA 1RE4C 1AQ5A 2N1TA 4I2LC 1RF1C 2YKQA 2J58A 1NU1K 3I5CA 3RK3C 1J1EB 1JTHA 1N73B 4Y99B 2NPSD 4XA4A 3HE5A 3V4QA 4C7RA 1H89A 1AFOA 2E42A 3RL0D 1Z56A 3M06A 5AW4B 3RK2C 3B5NC 1G1IA 5CJ0A 3M0DC 1JOCA 1L4AC 3IFMA 2PP6A 5AVQB 1LTBC 3BRVB 1FZCB 2QM8A 2R3CA 1CI6B 3V4WA 2O01H 1T2KD 4I6MC 1CSBA 2HG5D 2OYIA 3V5BA 1JCCA 1A02F 1SQVK 4W7ZA 1OWAA 2WT7B 1SQXK 3GHGC 2BASA 2O1JA 2YNYA 1LTSC 5APTA 2P1JA 1JUNA 3NTNA 2N1TD 1N7SA 1CZQA 1SQPK 4N3YB 2A45H 1HJBA 1HUCA 2WITA 3KDPB 4WBAA 1KFNA 2P7JA 2R5DA 3P7KA 4C7NB 1FZEA 1LTAC 4GIFA 2H7HA 5AVXB 2YO2A 4ZKUA 1J2JB 1M7LA 1IFIA 2FFDC 3KQGA 2FYZA 3V2PA 2MJZA 4AQRD 2HODB 1LTJC 1H8AA 1IFNA 1PFIA 1URQA 4WB4A 5CHXA 2JJLA 1RF1B 1RF0A 3C9IA 1NTKK 1GK6A 2GM4A 2W27A 3RK3B 2M3BA 1YTZI 2ZXEB 1IO4A 2NPSC 3E1IA 4RESB 2KYVA 3HTKB 4N6JA 1ZN5A 4WY4D 1ZV8A 3RL0C 1A02J 1X9VA 3B5NB 4DZOA 1SQQK 3OA7A 1KILA 1SFCA 4IFDK 2XNXA 3KPEA 1L4AB 3VTPC 1JY3O 5AW6B 5AVYB 5AW0B 2HPCB 1FU1A 3HE4B 3PP5A 1FAVA 1T2KC 4LGDE 3B8EB 5BU5A 1NTZK 2J59M 2KOGA 3SWFA 3GHGB 1N73A 1LWUC 1YTZT 5CCGD 5APWA 5AW7B 1FZFA 2N9BA 4ZKPA 5BVZA 1GK4A 4JYCA 1FZCA 5CCHA 5APUA 1CI6A 3KYQA 3H6PA 3HUSC 5KJ7A 2CPSA 5AVWB 1NH4A 1NO4A 2FFDB 2IFMA 2WT7A 1LTJB 4EOTA 2C0WA 1JY2P 2WZ7A 2C9NY 4W80A 4AYCA 3BATA 2A45G 4AUWA 3P8CD 5KLVK 2NPSB 1X8YA 1LGHB 2KLVA 3A2AA 4C7NA 3RL0B 1L0NK 4WY4C 1NKZB 2CPBA 1JCDA 2H43A 1H88A 2IPPA 3HD7D 3TNUB 5CJ4A 2HODA 3CLQA 2WTYA 1RE4A 1DX7A 2Q9IA 3IR9A 1GL2D 1RF1A 1LT9C 2YMYA 1JMMA 1JY2N 1S9KE 1DH3A 1YYCA 1FJKA 3A3YB 5APYA 2C0XA 1ZLLA 1LWUB 1X79B 1LTTC 1JY3P 2I1JA 1JY2O 1GW3A 3HTKA 1ZR2A 2WPQA 5CCGC 3V2QA 2WSCH 3V2RA 3B5NA 1M1JC 3BASA 3NMDA 3TK1A 3M0DA 1L4AA 1NAFA 3EFGA 2HPCA 1LTGC 2XZRA 2W6AA 3HE4A 4N78E 5AW8B 4IFFA 3LW5H 1N7LA 4GKGA 1FOSE 3HUSB 3TYYA 2FKWB 5KTBA 1MV8A 2IFNA 2I1KA 3M9BA 3GHGA 1RY3A 3L37A 2E43A 2L5GB 1NTMK 2WPSA 3R2PA 1MUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JNM A;  3I5C A;  1HBW A;  1GD2 E;  5AVR B;  5AW5 B;  4B86 A;  2XV5 A;  4LC1 A;  3M91 A;  3HE5 A;  5APW A;  1NWQ A;  5AW7 B;  3V4Q A;  1S9K D;  1H89 A;  2R32 A;  2E42 A;  3UIA A;  3HE5 B;  1GTW A;  2N9B A;  3M06 A;  5AW4 B;  3P32 A;  5APV A;  1GK4 A;  4JYC A;  5AW9 B;  1FOS F;  5APU A;  1CI6 A;  5AVQ B;  2QM8 A;  2R3C A;  1CI6 B;  3V4W A;  1T2K D;  1OXZ A;  4I6M C;  2YO3 A;  1CSB A;  1SP4 A;  5AVT B;  5AVW B;  3V5B A;  2KP8 A;  1A02 F;  3P8M C;  2WT7 A;  3VYI A;  4EOT A;  3NFQ A;  3MGN A;  3OAK A;  2Z5I A;  1OWA A;  2WT7 B;  2BAS A;  2YNY A;  4M3L A;  2C9N Y;  3A7O A;  5APT A;  4AYC A;  3L35 A;  5AVZ B;  5AW3 B;  3NTN A;  1JUN A;  1GU5 A;  4AUW A;  2R5B A;  1CZQ A;  2Z5H A;  2ZFC A;  4HYT B;  5APS A;  1HUC A;  1X8Y A;  1HJB A;  3NXS A;  3KDP B;  5CMZ A;  3VMZ A;  3A2A A;  4C7N A;  2P7J A;  4XE5 B;  2R5D A;  3L36 A;  1SLQ A;  2WWW A;  3P7K A;  4C7N B;  3TNU A;  2WPR A;  1H88 A;  1GU4 A;  2IPP A;  3TNU B;  2XU6 A;  3VMX A;  2H7H A;  5AVV B;  5AVX B;  2YO2 A;  1J2J B;  2Q5U A;  1GZL A;  3KQG A;  2P67 A;  2WTY A;  3A5T A;  4AQR D;  3VN0 A;  3IR9 A;  5APX A;  1H8A A;  1MFZ A;  3LID A;  3MD0 A;  1KQL A;  1S9K E;  1DH3 A;  1YYC A;  2JJL A;  2C9L Y;  3A3Y B;  5APY A;  2QM7 A;  5AW1 B;  1GK6 A;  2W27 A;  2ZXE B;  3HTK A;  3M9H A;  4GT1 A;  4JYB A;  2WPQ A;  1IO4 A;  4C46 A;  4RES B;  2Q7C A;  5AVU B;  5AW2 B;  3NMD A;  5APQ A;  3TK1 A;  3M0D A;  1A02 J;  1NAF A;  2P2U A;  3LIE A;  4DZO A;  2VRS A;  3O8Z A;  2XZR A;  5AVS B;  2W6A A;  3HE4 A;  5AW8 B;  3VMY A;  3VTP C;  5AW6 B;  5AVY B;  5AW0 B;  4GKG A;  1FOS E;  3HE4 B;  3TYY A;  1FAV A;  1T2K C;  1MV8 A;  1HWT C;  3B8E B;  3M9B A;  4KHX A;  3T97 A;  2Q3I A;  3L37 A;  3M0A A;  2E43 A;  1G2C B;  4I2L C;  3SWF A;  2WPS A;  1MUU A; 
#chains in the Genus database with same CATH topology
 1LTI C;  2ZYA A;  4LC1 A;  1JY3 N;  3L70 D;  4LLH A;  2RKL A;  2HLO A;  1GTW A;  1NTZ D;  2K88 A;  3EQ2 A;  3U1A A;  1VF5 B;  3RGU A;  3L70 G;  3L75 D;  3TF5 A;  1NTK J;  4L76 A;  2IZ0 A;  2XND H;  3OAK A;  1L0L K;  2KB7 P;  3ABV C;  1Y47 A;  2GUS A;  5AVZ B;  5AW3 B;  3CXH H;  1ZR4 A;  2FXP A;  2QSI A;  4KJM A;  3CC4 P;  1P84 H;  4YXD C;  1S4X A;  2KSE A;  2YIU C;  1SFC D;  3CD6 P;  1NTZ J;  2XKM A;  3L73 E;  3CCU P;  5AVV B;  2OQQ A;  4ZMD A;  3OJA B;  4OH8 B;  1QEX A;  3L75 J;  3KHU A;  1Q86 Q;  3P8C E;  1RE3 A;  3VP8 A;  2HFE D;  3O8Z A;  1SQB D;  5AVS B;  2YKO A;  2B89 A;  1HVV A;  5KJ7 D;  3H1H D;  1VQN P;  4WVZ A;  2AXT H;  2AEJ A;  3T97 A;  3MTU E;  1OW8 A;  1MZ9 A;  1GL2 B;  1G2C B;  2J5U A;  1SQB G;  3H1J G;  3II6 A;  1RF0 C;  2K3R A;  3CCQ P;  3M91 A;  4WY4 A;  3P32 A;  1N2D C;  4BRY B;  1KYO H;  4O9B A;  2FYU D;  1BGY D;  2YO3 A;  2KP8 A;  1USE A;  3AEB C;  1SQQ E;  3H1H J;  1S1C X;  2E76 B;  3L72 G;  1M56 D;  1NVO A;  3RK3 D;  3H32 A;  2GUV A;  1J1E C;  1N73 C;  3C1L A;  2ZT9 C;  2FYU G;  1BGY G;  2OTJ P;  1IZN B;  1R5S A;  2ZFC A;  1M1J A;  3F89 A;  2JKV A;  4WWI A;  2QJK C;  3AE4 C;  4RKU J;  4OWF A;  4L74 A;  5CCH C;  5GTI H;  3A5T A;  5H2F E;  3ZDM A;  4ASV A;  1OVU A;  1AVY A;  1FZB A;  1NKN A;  3M9Q A;  1FZA A;  2QM7 A;  3V2N A;  2IBZ E;  2ZVN B;  3N7N A;  3GW6 A;  3S4R A;  4EIJ A;  5CBO A;  4GT1 A;  4C46 A;  1YQ3 C;  1DEB A;  5TIS H;  2LXC B;  4PJ0 H;  5AVU B;  2OYH A;  3LIE A;  3KZI H;  1NOH A;  5DJT B;  1ZXG A;  5KLI C;  5M1B A;  1SFC B;  1BSN A;  5KLV E;  2M0B A;  5E79 H;  2KS1 A;  2E74 C;  2D2C C;  1AQ5 A;  1R8E A;  2N1T A;  3SFD C;  1JTH A;  2BCC E;  4Y99 B;  4Z1M H;  2NPS D;  1AFO A;  3RL0 g;  2OGU A;  1U7M A;  5AW4 B;  3RK2 C;  3B5N C;  3L73 G;  3O6Q B;  2PP6 A;  5AVQ B;  1H0T A;  1LT1 A;  1CSB A;  1UIX A;  1SQV K;  2YXQ B;  4W7Z A;  1OWA A;  2HR3 A;  1SQX K;  3GHG C;  1M90 Q;  2BAS A;  2O1J A;  3Q3D A;  1YHQ P;  5APT A;  1OFC X;  1PZQ A;  1YIT P;  4UB6 H;  3K5B A;  4N3Y B;  1HUC A;  3CC2 P;  2JP3 A;  3BCC D;  1PL5 A;  1S2E A;  3CXH E;  3AE5 C;  4GIF A;  1VQ9 P;  1KB9 D;  4ZKU A;  1IFI A;  1JEK A;  3KQG A;  3V2P A;  1FS0 E;  2E75 D;  2HOD B;  4L75 A;  3CME P;  1ZRT E;  3C9I A;  1NTK K;  3RK3 B;  2M3B A;  1AQT A;  5B5E H;  3RBX A;  2K9Y A;  1NYH A;  1KN7 A;  1AVO A;  3RL0 C;  1A02 J;  2WPV B;  3OA7 A;  1NTM J;  1KIL A;  1K9M Q;  3KPE A;  2QJY C;  5AVY B;  3BCC J;  3E7K A;  2KNC A;  1SQQ G;  1YI2 P;  4H0L C;  1NTZ K;  2KOG A;  5EFW B;  4K3A A;  3L71 E;  5AW7 B;  1VQP P;  3MZW B;  1BSH A;  2IBZ D;  2K9J B;  2WQY C;  1FZC A;  1PGJ A;  1Q7Y Q;  2LR2 A;  3H1K E;  1NO4 A;  4TT3 H;  4PD4 E;  2WT7 A;  1KYO E;  2IBZ G;  1RHZ B;  1KQF B;  3JSV C;  2C9N Y;  4W80 A;  2O01 N;  1KB9 I;  4AYC A;  4OGQ D;  1BCC D;  1QGK B;  2NPS B;  2B9B A;  2O01 J;  1LGH B;  4ASW A;  2BCC D;  4WY4 C;  5KLV G;  1JB0 J;  3ITK A;  2NZ2 A;  1RH5 B;  3HD7 D;  3MP7 B;  2WTY A;  2Y9Z A;  1RF1 A;  2YMY A;  1S9K E;  1DH3 A;  5GTI E;  5CBN A;  3A3Y B;  5KKZ C;  1LWU B;  3H1I E;  1ZR2 A;  1BCC J;  1M1J C;  3BAS A;  3EWK A;  3NMD A;  3TK1 A;  1L4A A;  3I55 P;  1LTG C;  4IFF A;  2BCC J;  3AE3 C;  4PJ0 E;  3E1R A;  4TLF A;  2IBZ I;  2A06 D;  3A0B H;  3KZI E;  2E75 B;  2L5G B;  1GZL A;  1JNM A;  4YPC A;  1HGV A;  1IFD A;  5E79 E;  1N7S D;  3WMM 0;  1ZRT D;  3PTZ A;  3H1L G;  2BEZ F;  5APV A;  2WSF H;  4U3F E;  2YKP A;  3BVH A;  2OYH C;  3RK2 D;  1PIX A;  2FFD A;  5AVT B;  4W7Y A;  2KLU A;  3Q5R A;  4JF7 A;  3B4S A;  4JPZ B;  3CMA P;  3MGN A;  1URQ D;  1LT9 B;  1S3J A;  2N1T C;  3HRN A;  2IYO A;  2JWA A;  2V4H A;  1WT6 A;  1S72 P;  4XE5 B;  1FBM A;  1NU1 E;  3TNU A;  1RQU A;  1JM0 A;  2QA4 P;  2QG4 A;  3N4X A;  3AEF C;  1EC5 A;  5B66 H;  4DCK A;  2PAJ A;  1IFJ A;  1T3J A;  4PV1 D;  3L74 E;  3L71 G;  3OW2 O;  4PD4 D;  2B87 B;  4OGQ B;  2FYN B;  1XTG B;  3G3Z A;  3CX5 D;  2KXP B;  3H1K G;  3D71 A;  1XTC C;  1QX8 A;  1FC2 C;  1T3U A;  1SQP E;  3HD7 B;  1DEE G;  1HWT C;  1FJP A;  1QVF O;  5C39 A;  3AE8 C;  1WRG A;  1EDL A;  1HBW A;  5AW5 B;  4B86 A;  2KZJ A;  3G9R A;  1BE3 E;  1S9K D;  3HE5 B;  1PV3 A;  1NJI Q;  2QIW A;  1SQV J;  3TSI A;  5AW9 B;  1KIL C;  1KMI Z;  3PHL A;  2E5Y A;  2ZYG A;  4L73 A;  2OYI B;  3AEC C;  3H1I G;  1W5C E;  3A0H H;  1PGQ A;  5CCG A;  2ZJS E;  4D6T E;  3AE1 C;  1IFM A;  2QJP C;  1EQ7 A;  4IL6 H;  4UB8 H;  1N7S B;  3VMZ A;  1KC8 Q;  1SLQ A;  4PD4 I;  3I56 P;  1IK9 A;  2AEM A;  1FZC C;  3RK2 B;  4JBZ A;  3VMX A;  3CX5 I;  4BWN A;  2OAR A;  3MUD A;  5APX A;  3IN6 A;  1URQ B;  3L70 J;  2HYN A;  1CW5 A;  4U3F G;  1FDM A;  5APQ A;  1KIL E;  2W6B A;  2VRS A;  2ZXX A;  1J1D B;  4I7Z C;  3FWN A;  3W67 A;  4H13 D;  1G2C A;  1GL2 A;  1Y9B A;  4KT0 J;  1L0N E;  1RF1 C;  4PV1 B;  3A0B E;  3FWL A;  2M5A B;  4GOD A;  1NU1 G;  4BRY A;  3H1J D;  5CJ0 A;  1L4A C;  3JCU E;  1N8R Q;  3IFM A;  1Q81 Q;  4Y28 J;  1JMB A;  4HJG H;  3V4W A;  1PGP A;  1T2K D;  2HG5 D;  1A02 F;  3TDK A;  3L74 G;  1BDD A;  3AE9 C;  3CCE P;  1LTS C;  1AJY A;  2P1J A;  3CCR P;  3NTN A;  2N1T D;  1HJB A;  3L72 D;  1K05 A;  2P7J A;  1SQP G;  1SQB J;  2UWJ E;  3H1J J;  1PP9 E;  2AEF A;  2H7H A;  5AVX B;  2YO2 A;  2FFD C;  2FYZ A;  4NPD A;  2MJZ A;  3WU2 H;  1IK7 A;  4WB4 A;  5CHX A;  2JJL A;  1BE3 G;  1GK6 A;  2GM4 A;  2W27 A;  3Q5P A;  3Q1M A;  1UII A;  2ZXE B;  4H44 C;  1OW7 A;  3E1I A;  1OVV A;  4RES B;  1ZV8 A;  1L0L E;  2W8Z A;  4D6T D;  3L72 J;  1SFC A;  2Y0D A;  2HPC B;  2FYU J;  1BGY J;  3PP5 A;  5BU5 A;  1VL2 A;  4D6T G;  3SWF A;  2WMM A;  1ZW0 A;  3R4Y A;  5APW A;  1E79 H;  4EI2 A;  3FXD A;  1LP1 A;  5KAI H;  1VQM P;  3O6Q A;  4ZKP A;  3SWK A;  5APU A;  4D6T J;  5KJ7 A;  1U57 A;  2JWD A;  3W68 A;  3L73 D;  1LTJ B;  4EOT A;  2C0W A;  1OMI A;  4H13 B;  1DIP A;  1AV1 A;  1EZV E;  1MFT A;  3BAT A;  2A45 G;  3P8C D;  4YXW H;  2KLV A;  3A2A A;  3A0H E;  2IYP A;  2CPB A;  2H43 A;  2JR8 A;  1SS1 A;  1VF5 C;  5CJ4 A;  2WSE J;  1L0N G;  2HOD A;  1RE4 A;  3PJS K;  5KAF H;  2QEX P;  3S9O A;  3L73 J;  1JY2 N;  1FJK A;  2RMZ A;  1JY3 P;  2I1J A;  1GW3 A;  2WPQ A;  3CPW O;  2RN0 A;  5CCG C;  4XFJ A;  3H1L E;  1P84 E;  3M0D A;  3VMA A;  1NAF A;  3EFG A;  3F5H A;  2XZR A;  2IZ1 A;  3GF3 A;  1WMK A;  1FOS E;  3HUS B;  3TYY A;  5KTB A;  3CWB E;  3M9B A;  1PP9 D;  2JO1 A;  1L2P A;  3MUD C;  3R2P A;  1MUU A;  1SQQ D;  2A45 I;  2GA1 A;  1PP9 G;  2P10 A;  1VQ6 P;  1FZG A;  1L0L D;  1Q2N A;  3VYI A;  3NFQ A;  2AXT E;  1GL2 C;  3SFE C;  2NPS A;  3L35 A;  2R5B A;  1SQQ J;  1L0L G;  2B88 A;  2QVA A;  1OZH A;  3VP9 A;  2G3A A;  3GLM A;  3GF7 A;  1BDC A;  2WWW A;  2KK7 A;  3CL3 D;  1QL1 A;  2W83 C;  4CPG A;  2XU6 A;  2P67 A;  5KLV D;  3VN0 A;  1MFZ A;  1LWU A;  2E76 C;  3CC7 P;  3CI9 A;  3G71 P;  1QL2 A;  5AW1 B;  2ZT9 D;  3U1C A;  1S5L H;  3AED C;  2WSS H;  1E5W A;  1Q90 D;  2SPZ A;  2POH A;  1SQX E;  4R4L A;  3QWO C;  3TGU E;  5CCH D;  3VMY A;  1IJD B;  2ZYD A;  1HH0 A;  1SQB K;  4R4M A;  1VQ4 P;  1HTL C;  2CK3 H;  3M0A A;  1EZV G;  5KLV J;  5AVR B;  2O1K A;  1IC2 A;  1FE6 A;  2WSE H;  3G4S P;  5TIS E;  2YIU B;  1KOR A;  1T6A A;  3SWY A;  1SFC C;  3CXH D;  1KD1 Q;  3H1L D;  2ZVO B;  3AE6 C;  1SP4 A;  1P84 D;  4I1L A;  3BRT B;  2E74 D;  3P8M C;  1LT9 A;  2D2C D;  2FXM A;  2FYU K;  2P58 A;  3VOP A;  3Q5S A;  2RH0 A;  3CWB D;  4Y99 C;  1FDI A;  2Z5H A;  1Y8A A;  5APS A;  1NTZ E;  3AEA C;  3B5N D;  2JEE A;  1YJ9 P;  3L36 A;  2KSJ A;  2WPR A;  3AE7 C;  3CWB G;  1KV4 A;  5TJH A;  3L75 E;  4IFM A;  4DOJ A;  3CCS P;  5KJ7 C;  3H1L J;  2QRX A;  2B87 A;  1KB9 H;  3L71 D;  4UB6 E;  2Q7C A;  5AW2 B;  2Z4E A;  2L91 A;  3HD7 A;  1OW6 A;  3H1K D;  4KHX A;  1RE4 C;  2Q3E A;  1KYO D;  4I2L C;  2YKQ A;  3CXH I;  2J58 A;  3WUV A;  3I5C A;  3RK3 C;  1J1E B;  1P84 I;  1N73 B;  3B71 A;  2ZT9 B;  3HE5 A;  1H89 A;  3FX0 A;  2E42 A;  3CCL P;  3WUU A;  5B5E E;  3RL0 D;  2QJK B;  1Z56 A;  3M06 A;  1D7M A;  3L71 J;  3M0D C;  2FBW C;  1LTB C;  2QM8 A;  2R3C A;  3H1H E;  1CI6 B;  2Y0C A;  2O01 H;  3MHV A;  4I6M C;  5H2F H;  3S1K A;  1SQX D;  3V5B A;  2OYI A;  1JCC A;  3IAO A;  4H0L D;  3TGU D;  3H1K J;  1S5L X;  4RJT A;  2YNY A;  1PGO A;  1YIJ P;  1YJW P;  1N7S A;  1CZQ A;  2KZI A;  1SQX G;  3H1I D;  1K04 A;  2YXR B;  3KDP B;  1K73 Q;  3TGU G;  3CCM P;  2NRG A;  2R5D A;  3P7K A;  4C7N B;  5DJU B;  5KLI B;  2IDB A;  1NAY A;  1FZE A;  3AE2 C;  1M7L A;  4AQR D;  4GDO A;  1EDK A;  1H8A A;  1PFI A;  1URQ A;  2E74 B;  1YBK A;  2D2C B;  1VQ7 P;  1IO4 A;  2NPS C;  1NTK G;  1KYO I;  3HTK B;  2LXB A;  2W90 A;  2H88 C;  1ZN5 A;  3H1I J;  4WY4 D;  3B5N B;  4DZO A;  1SQQ K;  4GOF A;  1S5L E;  1PPJ E;  4IFD K;  2XNX A;  3PH0 A;  3VTP C;  5AW6 B;  5AW0 B;  4U3F D;  1DD3 A;  1M1K Q;  3HE4 B;  1HJ0 A;  1FAV A;  3IF4 A;  4LGD E;  3B8E B;  1IFP A;  2J59 M;  3GHG B;  1LWU C;  1NTZ G;  2M5A A;  3EFF K;  2Y0E A;  4HKZ H;  2N9B A;  2Q6Q A;  3L75 G;  5BVZ A;  3CCV P;  2ITA A;  1NU1 D;  1X0T A;  3KYQ A;  3H6P A;  5AVW B;  1NH4 A;  4U3F J;  1W2B O;  2E75 C;  1ZME C;  4DJG A;  2WZ7 A;  3L74 D;  5KLV K;  1X8Y A;  2K1A A;  4NPF X;  3RL0 B;  1NKZ B;  1H88 A;  1LJ2 A;  2R3S A;  2QJY B;  2IPP A;  5GTH H;  1NU1 J;  1SQP D;  3CLQ A;  1DX7 A;  4H0L B;  1EXI A;  1OVR A;  1LT9 C;  1YYC A;  1VQL P;  2C0X A;  1LTT C;  1JY2 O;  4ZNC A;  1VQO P;  1NTM E;  2W6J H;  1KQG B;  5K5G B;  3L74 J;  2Y9Y A;  3BCC E;  1BE3 D;  3H1H G;  2HPC A;  4N78 E;  1KB9 E;  4PD4 H;  2FKW B;  1MV8 A;  1RY3 A;  3L37 A;  3CCJ P;  3CX5 H;  5B66 E;  2E43 A;  1SQP J;  2WPS A;  3T97 B;  1GW4 A;  1GD2 E;  3KXD A;  4HH2 A;  2PGD A;  3D6Y A;  4OGQ C;  2FYN C;  4HB1 A;  1DD4 A;  1G1J A;  4WY4 B;  1BE3 J;  2KIK A;  3HD7 C;  1LTJ A;  1PPJ D;  4IL6 X;  2Z5I A;  2O3J A;  3WUT A;  2Q1K A;  5KKZ B;  3A7O A;  5BU8 B;  3H32 B;  1GU5 A;  1KFM A;  1MKM A;  4HYT B;  1VQ8 P;  1FDO A;  3NXS A;  1PPJ G;  1EDJ A;  1T8Z A;  1HGZ A;  1M1J B;  3RBZ A;  5L8R J;  1KIL D;  3PRJ A;  2DW3 A;  3L4F A;  2Q5U A;  2OYI C;  1L0N D;  1KZU B;  2LKM A;  1BCC E;  1OIP A;  4K35 A;  1VPC A;  1N7S C;  4DT0 A;  4IL6 E;  4UB8 E;  2KUB A;  2P2U A;  3HUS A;  2OYH B;  3U59 A;  1LP1 B;  2Q3I A;  4QMA A;  4A7P A;  2KS1 B;  1URQ C;  2N1T B;  2XV5 A;  1L0N J;  1JTH B;  1NWQ A;  1GDT A;  2R32 A;  3UIA A;  4U7J A;  1FOS F;  1J1D C;  1NTM D;  3FXE A;  2V7Q J;  4IOI H;  3MIW A;  1OXZ A;  2A06 E;  1H0T B;  4RO0 A;  1SVF A;  4N78 D;  1ZOY C;  2H8P D;  1NTM G;  4M3L A;  4PV1 C;  1JO5 A;  2K9J A;  2WSF J;  3BCC G;  3C8V A;  2FY8 A;  2IX7 C;  5CMZ A;  2ZAE B;  1GMJ A;  1L4A D;  4MN4 C;  1GU4 A;  2M8R A;  1NHL A;  2XDJ A;  1PP9 J;  2OTK E;  1M8O B;  2R44 A;  3LID A;  3MD0 A;  1KQL A;  1LNQ A;  5GTH E;  2E5T A;  4NPE A;  2C9L Y;  3QH9 A;  3Q2Y A;  2H89 C;  3M9H A;  4JYB A;  3USS A;  2AXC A;  2K37 A;  3FGA D;  1KIL B;  1RE3 C;  1USD A;  3AEE C;  1YJN P;  1L0L J;  2KNC B;  1N86 A;  1VDF A;  1W2E A;  2WVR A;  1U7J A;  3WU2 E;  1NU1 K;  2QE7 H;  4OVN F;  4H44 D;  1SQV E;  1EZV D;  4XA4 A;  3CX5 E;  2QJP B;  3V4Q A;  4C7R A;  2KI7 B;  1G1I A;  3SSU A;  1JOC A;  3BRV B;  1FZC B;  2WSC J;  1BCC G;  2WT7 B;  3LW5 J;  2BCC G;  1JUN A;  1SQP K;  2A45 H;  1NTK E;  2WIT A;  4WBA A;  1KFN A;  5KAI E;  2N9Y B;  1VQK P;  4I7Z B;  3GMA A;  1LTA C;  1J2J B;  1R5L A;  1RQV A;  3H25 A;  1LTJ C;  1IFN A;  4H13 C;  3L70 E;  3PLN A;  1RF1 B;  1RF0 A;  1YTZ I;  2V7Q H;  4JQ0 D;  2KYV A;  1TU3 F;  2BEQ D;  4N6J A;  2M3E A;  3JCU H;  1X9V A;  4GOE A;  1M57 D;  1OX3 A;  4BXL A;  2A06 G;  1EZV I;  1L4A B;  1VF5 D;  1JY3 O;  1AA0 A;  4YTP C;  1FU1 A;  1T2K C;  1HF9 A;  2I8D A;  3D6Z A;  1N73 A;  3CWB J;  5KAF E;  1EDI A;  1YQ4 C;  3GG2 A;  1Q82 Q;  2OTL P;  1YTZ T;  1NGM B;  5CCG D;  1FZF A;  1KQS O;  1QVG O;  1GK4 A;  4JYC A;  1KTM A;  5CCH A;  1CI6 A;  2PRR A;  3HUS C;  2JDI H;  2CPS A;  1K8A Q;  2FFD B;  2FXO A;  2IFM A;  2G8Y A;  1JY2 P;  4EYY Q;  4AUW A;  1SQB E;  4H44 B;  3H1J E;  4C7N A;  1ZP0 C;  1SQV D;  1L0N K;  3V6I A;  1JCD A;  2MKV A;  3TNU B;  1EXJ A;  2Q9I A;  3JC2 2;  3IR9 A;  1GL2 D;  1JMM A;  1SQV G;  3D70 A;  5APY A;  1ZLL A;  1X79 B;  3AEG C;  3L72 E;  3HTK A;  3V2Q A;  2WSC H;  3V2R A;  3B5N A;  2FYU E;  1BGY E;  2YMK A;  1VQ5 P;  4EDF A;  2OYO A;  1X22 A;  2W6A A;  3HE4 A;  5AW8 B;  1NTK D;  2PFX A;  3LW5 H;  1N7L A;  4GKG A;  1SQX J;  3RK3 E;  2IFN A;  2I1K A;  3TGU J;  1QLE D;  3GHG A;  2E76 D;  3G6E P;  1NTM K; 
#chains in the Genus database with same CATH homology
 1JNM A;  1GW4 A;  1GD2 E;  2A45 I;  1HGV A;  1IFD A;  1LTI C;  4HH2 A;  4LC1 A;  1JY3 N;  1N7S D;  3WMM 0;  4LLH A;  2HLO A;  1GTW A;  1G1J A;  5APV A;  3EQ2 A;  4WY4 B;  2WSF H;  3BVH A;  2YKP A;  2OYH C;  3RK2 D;  3U1A A;  1FZG A;  2FFD A;  3HD7 C;  5AVT B;  1LTJ A;  4W7Y A;  4JF7 A;  3VYI A;  3NFQ A;  3MGN A;  3OAK A;  1URQ D;  1LT9 B;  2Z5I A;  1GL2 C;  1L0L K;  2KB7 P;  2N1T C;  3HRN A;  2GUS A;  3A7O A;  5BU8 B;  2NPS A;  3L35 A;  5AVZ B;  3H32 B;  5AW3 B;  1GU5 A;  1KFM A;  1ZR4 A;  2R5B A;  4HYT B;  3NXS A;  1T8Z A;  1HGZ A;  3VP9 A;  1WT6 A;  1M1J B;  4XE5 B;  1FBM A;  2WWW A;  3TNU A;  3CL3 D;  1KIL D;  1SFC D;  1QL1 A;  2XKM A;  3N4X A;  2XU6 A;  3L4F A;  5AVV B;  2Q5U A;  2P67 A;  3OJA B;  4OH8 B;  3VN0 A;  2OYI C;  2PAJ A;  1MFZ A;  1IFJ A;  1T3J A;  1LWU A;  3CI9 A;  1QL2 A;  1KZU B;  2LKM A;  5AW1 B;  3U1C A;  3P8C E;  1E5W A;  1XTG B;  1VPC A;  1N7S C;  2POH A;  1RE3 A;  3G3Z A;  3VP8 A;  2HFE D;  2P2U A;  3O8Z A;  1XTC C;  5AVS B;  5CCH D;  3HUS A;  1IJD B;  3VMY A;  2OYH B;  2YKO A;  3U59 A;  1HH0 A;  1T3U A;  3HD7 B;  1HVV A;  5KJ7 D;  1SQB K;  1HTL C;  1HWT C;  3T97 A;  2Q3I A;  3M0A A;  3MTU E;  1MZ9 A;  1FJP A;  1GL2 B;  1G2C B;  1URQ C;  1WRG A;  1HBW A;  2N1T B;  3II6 A;  5AVR B;  1RF0 C;  5AW5 B;  4B86 A;  2XV5 A;  1JTH B;  3M91 A;  1NWQ A;  2O1K A;  1IC2 A;  1S9K D;  1GDT A;  2R32 A;  2WSE H;  3UIA A;  3HE5 B;  4WY4 A;  3P32 A;  1N2D C;  3TSI A;  5AW9 B;  1FOS F;  1J1D C;  4O9B A;  3SWY A;  1KIL C;  1SFC C;  3MIW A;  1OXZ A;  2YO3 A;  1SP4 A;  2KP8 A;  4I1L A;  1SVF A;  3BRT B;  3P8M C;  1LT9 A;  2OYI B;  4N78 D;  2FXM A;  2FYU K;  3VOP A;  2H8P D;  3RK3 D;  4M3L A;  3H32 A;  1JO5 A;  2GUV A;  1J1E C;  1N73 C;  4Y99 C;  5CCG A;  2Z5H A;  2ZFC A;  1IFM A;  5APS A;  1M1J A;  1EQ7 A;  2IX7 C;  1N7S B;  5CMZ A;  3VMZ A;  3B5N D;  2JEE A;  1SLQ A;  3L36 A;  1L4A D;  2KSJ A;  2WPR A;  1IK9 A;  1GU4 A;  1FZC C;  5CCH C;  2M8R A;  3RK2 B;  3VMX A;  4IFM A;  4DOJ A;  1NHL A;  2XDJ A;  1GZL A;  5KJ7 C;  3A5T A;  2OAR A;  3MUD A;  5APX A;  1FZB A;  3LID A;  3MD0 A;  1KQL A;  1NKN A;  3M9Q A;  1URQ B;  1FZA A;  2C9L Y;  2QM7 A;  3V2N A;  3N7N A;  4EIJ A;  3M9H A;  4JYB A;  4GT1 A;  4C46 A;  2HYN A;  1DEB A;  1CW5 A;  1FDM A;  2Q7C A;  5AVU B;  5AW2 B;  5APQ A;  2W6B A;  2OYH A;  3LIE A;  2Z4E A;  2VRS A;  1J1D B;  1NOH A;  3HD7 A;  1KIL B;  1SFC B;  1RE3 C;  1N86 A;  1VDF A;  1W2E A;  1G2C A;  1GL2 A;  4KHX A;  1RE4 C;  1AQ5 A;  2N1T A;  4I2L C;  1RF1 C;  2YKQ A;  2J58 A;  1NU1 K;  3I5C A;  3RK3 C;  1J1E B;  1JTH A;  1N73 B;  4Y99 B;  2NPS D;  4XA4 A;  3HE5 A;  3V4Q A;  4C7R A;  1H89 A;  1AFO A;  2E42 A;  3RL0 D;  1Z56 A;  3M06 A;  5AW4 B;  3RK2 C;  3B5N C;  1G1I A;  5CJ0 A;  3M0D C;  1JOC A;  1L4A C;  3IFM A;  2PP6 A;  5AVQ B;  1LTB C;  3BRV B;  1FZC B;  2QM8 A;  2R3C A;  1CI6 B;  3V4W A;  2O01 H;  1T2K D;  4I6M C;  1CSB A;  2HG5 D;  2OYI A;  3V5B A;  1JCC A;  1A02 F;  1SQV K;  4W7Z A;  1OWA A;  2WT7 B;  1SQX K;  3GHG C;  2BAS A;  2O1J A;  2YNY A;  1LTS C;  5APT A;  2P1J A;  1JUN A;  3NTN A;  2N1T D;  1N7S A;  1CZQ A;  1SQP K;  4N3Y B;  2A45 H;  1HJB A;  1HUC A;  2WIT A;  3KDP B;  4WBA A;  1KFN A;  2P7J A;  2R5D A;  3P7K A;  4C7N B;  1FZE A;  1LTA C;  4GIF A;  2H7H A;  5AVX B;  2YO2 A;  4ZKU A;  1J2J B;  1M7L A;  1IFI A;  2FFD C;  3KQG A;  2FYZ A;  3V2P A;  2MJZ A;  4AQR D;  2HOD B;  1LTJ C;  1H8A A;  1IFN A;  1PFI A;  1URQ A;  4WB4 A;  5CHX A;  2JJL A;  1RF1 B;  1RF0 A;  3C9I A;  1NTK K;  1GK6 A;  2GM4 A;  2W27 A;  3RK3 B;  2M3B A;  1YTZ I;  2ZXE B;  1IO4 A;  2NPS C;  3E1I A;  4RES B;  2KYV A;  3HTK B;  4N6J A;  1ZN5 A;  4WY4 D;  1ZV8 A;  3RL0 C;  1A02 J;  1X9V A;  3B5N B;  4DZO A;  1SQQ K;  3OA7 A;  1KIL A;  1SFC A;  4IFD K;  2XNX A;  3KPE A;  1L4A B;  3VTP C;  1JY3 O;  5AW6 B;  5AVY B;  5AW0 B;  2HPC B;  1FU1 A;  3HE4 B;  3PP5 A;  1FAV A;  1T2K C;  4LGD E;  3B8E B;  5BU5 A;  1NTZ K;  2J59 M;  2KOG A;  3SWF A;  3GHG B;  1N73 A;  1LWU C;  1YTZ T;  5CCG D;  5APW A;  5AW7 B;  1FZF A;  2N9B A;  4ZKP A;  5BVZ A;  1GK4 A;  4JYC A;  1FZC A;  5CCH A;  5APU A;  1CI6 A;  3KYQ A;  3H6P A;  3HUS C;  5KJ7 A;  2CPS A;  5AVW B;  1NH4 A;  1NO4 A;  2FFD B;  2IFM A;  2WT7 A;  1LTJ B;  4EOT A;  2C0W A;  1JY2 P;  2WZ7 A;  2C9N Y;  4W80 A;  4AYC A;  3BAT A;  2A45 G;  4AUW A;  3P8C D;  5KLV K;  2NPS B;  1X8Y A;  1LGH B;  2KLV A;  3A2A A;  4C7N A;  3RL0 B;  1L0N K;  4WY4 C;  1NKZ B;  2CPB A;  1JCD A;  2H43 A;  1H88 A;  2IPP A;  3HD7 D;  3TNU B;  5CJ4 A;  2HOD A;  3CLQ A;  2WTY A;  1RE4 A;  1DX7 A;  2Q9I A;  3IR9 A;  1GL2 D;  1RF1 A;  1LT9 C;  2YMY A;  1JMM A;  1JY2 N;  1S9K E;  1DH3 A;  1YYC A;  1FJK A;  3A3Y B;  5APY A;  2C0X A;  1ZLL A;  1LWU B;  1X79 B;  1LTT C;  1JY3 P;  2I1J A;  1JY2 O;  1GW3 A;  3HTK A;  1ZR2 A;  2WPQ A;  5CCG C;  3V2Q A;  2WSC H;  3V2R A;  3B5N A;  1M1J C;  3BAS A;  3NMD A;  3TK1 A;  3M0D A;  1L4A A;  1NAF A;  3EFG A;  2HPC A;  1LTG C;  2XZR A;  2W6A A;  3HE4 A;  4N78 E;  5AW8 B;  4IFF A;  3LW5 H;  1N7L A;  4GKG A;  1FOS E;  3HUS B;  3TYY A;  2FKW B;  5KTB A;  1MV8 A;  2IFN A;  2I1K A;  3M9B A;  3GHG A;  1RY3 A;  3L37 A;  2E43 A;  2L5G B;  1NTM K;  2WPS A;  3R2P A;  1MUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...