4I7ZB

Crystal structure of cytochrome b6f in dopg, with disordered rieske iron-sulfur protein soluble domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
159
structure length
159
Chain Sequence
ATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Lipid-induced conformational changes within the cytochrome b6f complex of oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 38
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4i7zB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4i7zB01
2WPVB 2YIUC 4H13B 2ZT9B 5KKZC 4KT0J 4H44B 4I7ZB 3C8VA 4PV1B 2QSIA 4OGQB 1VF5B 5L8RJ 1Q90D 2E76B 2O01J 2FYNC 2E75B 2D2CB 2QJYC 4RKUJ 5KLIC 1S5LX 4Y28J 3LW5J 1ZRTE 2QJKC 2WSFJ 4IL6X 2QJPC 2WSCJ 1JB0J 2K9YA 2QIWA 2E74B 4H0LB 2WSEJ
chains in the Genus database with same CATH superfamily
1VQ9V 3V4WA 4FFBA 2Y0PA 1MFTA 2VQEO 1Q6HA 2KZIA 4B7EA 4J9ZB 1QX8A 5KJ7C 3L37A 4WFAV 5AVXB 1YCIA 4HYTB 3OT7A 1N73C 3PRJA 1GL2B 2IZ0A 3H1HG 1GZLA 2PTMA 4D6TH 2OYHA 1N32B 2FYUE 4ASVA 2DWEC 1P84H 2V7QH 3A0HZ 3TGUD 1QL1A 1JUNA 3O8ZA 4EI2A 4GX0A 3I5DA 4LFAB 1SQXE 5APTA 2ARHA 2KK7A 1L8DA 2QDOA 1LTIC 2HG5D 3CB2A 4PV1C 1SQPK 5LMNO 2L6LA 1N0JA 5KHIA 1S9KD 4U7NA 2XNDG 2YO3A 2FL4A 1FAFA 2BE3A 3AG2C 1FS0G 2IYOA 2Y0CA 3E8GA 5AW0B 1J1DC 2P4VA 3ABMB 3L74G 4RESB 2EULA 5CHXA 3FYEB 1PL4A 2RQ6A 1OHHG 1NU1K 1R5SA 4BXLA 3K5BA 4TV8B 2OYIA 5EBWC 3S4RA 2FXMA 3KZIE 1KILE 3FXEA 3L73H 3X2QC 4MVSA 4X65O 2BCCH 3CX5D 2IBZG 1Y47A 2JWAA 1WLEA 4TWKA 4TUYA 1T3UA 1D7MA 4I2LC 1XNRO 1V54B 2E75B 3B5ND 1N8RW 2W6JG 2K1EA 1A02F 1WPBA 3CWBH 1QCEA 1PPJD 3Q2YA 2ZFCA 3APQA 4X1KB 4BIOA 1T3JA 2KS1B 2IW5A 3Q4HA 3FGAD 2P7TC 1AI5A 3I5CA 1VF6C 3JAWB 5LHHA 1OVUA 3E7KA 3FKSG 1G1IA 1OIPA 4PDLA 1JCHA 2H94A 4B08A 1B6QA 3BEHA 2IX7C 2HJFC 3GF7A 3WU2E 1S4XA 4U3FJ 1SS3A 1GKFA 1LTTC 1OCRB 1JX9A 3TK1A 1EZVE 2F93B 1GN4A 2OTJV 2OARA 1BE3D 1ZWIC 3E8HA 4BW9A 2DW3A 2PI5A 1ZXGA 1M4UA 1VQ5P 2KSDA 2PF4E 4ZMDA 3HD7B 2E74B 1SVFA 4LF5O 2WSCH 3DXRB 4WBAA 1JTHA 5LOVB 1L0NK 3JAKB 2ZYDA 2LJ2A 3GG2A 1USDA 3HKCA 5L3GA 3J81N 3RK3C 3VOPA 2H89C 4G2KA 1FZCA 4IOIH 3ZHVA 4JI6B 3E2EA 2KSJA 1VQMP 1XHXA 4R4MA 4DR4B 2Q0OC 1KC8W 2ZJSE 2WPQA 3H1KE 1R8EA 1X4TA 1K8AW 2N9BA 3ZHUA 5LGNA 2IM9A 3U1AA 3LW5H 1FKAO 4E4EA 1SZTA 2LFSA 1NU1J 2YKOA 2WLLA 1BHAA 2YIUB 3CRAA 4I7ZC 1BT8A 3G6BA 4FK5C 1AV1A 1K5SA 5LXTB 3AG1C 2VWKA 3ZMUA 2E5TA 3LIEA 3CCLV 3H1LG 3GLMA 4TV9A 3L70H 4IGGA 1LTJC 3CLQA 1VQ9P 4PDRA 2H88C 4OGQD 2D2CB 1SESA 2VS0A 3N27A 2OIEA 5B1AC 1NBMG 2YUAA 4JYBA 3CRRA 1BZKA 4IL6X 4LBEC 2R72A 2KB7P 4JQ0D 2A06H 5J9PC 2P06A 1VP7A 2Q73A 2VRSA 3H1HJ 1FAVA 1V9PA 2HEPA 1Y67A 1N86A 3BA9A 4HNAA 1BCCD 4JI1O 4JTDB 1XILA 1FE6A 1G2CA 3GF3A 4MVQA 2X6BA 4DV5B 4H44C 2PP6A 2ZXXA 2LW1A 3P3PA 4MTOA 3TGUG 4LR3A 3CXHH 1O9HA 2QA4V 1GO3F 2GUZA 3RVZA 2WSEH 2QGNA 4HAMA 4MVMA 2WPDG 2E76C 2WMMA 1LUWA 4GOFA 3IN6A 1UJWB 3ASNC 4U3FE 2AEJA 3PTZA 4WWIA 2WLIB 5EIBC 3W7WA 1K04A 2QTSA 3FXDA 3BA8A 3T1YB 3S3WA 1ZLLA 5CB4A 1KFNA 3JC22 1KQLA 3TCUA 1H2SB 2Q7HA 2WSFH 3PHLA 2WZ7A 2DWDC 4JTAB 2OCCB 4LF8O 3MIWA 4X64B 2F1MA 4UB6Z 1LTBC 1U97A 4DV2B 1QGKB 2P90A 2XT9A 4L74A 1LTSC 3TNUA 3MUDA 2E3CA 1XI1A 1USEA 5JQGA 2V4HA 5LHGA 1HNWB 1N73B 4PDVA 5JVDB 1J95A 4IFFA 1JY3N 1I5YA 3C3SA 5AW7B 1DD4A 5BMVA 1M8OB 1Y76B 4GIFA 5B1OA 1SQBD 1PPJG 3A7OA 1Q6IA 4ZBMA 1KILC 4AUWA 3SYOA 5HFLA 3JCUZ 1L2PA 4ICGA 1VQ8V 3P8MC 5AW6B 4K3AA 3B5NB 4I6MC 4UXNA 3D70A 3T1HO 3L9DA 4CH3A 2H8PD 4MTGA 5AVRB 1AB3A 3L75H 1AP5A 2NN4A 1L4AA 3AG2B 5B1BC 3RK2D 2PZSA 1UIXA 2Y0EA 1J1DB 5IJ0B 5IYZA 3H1HE 4DXWA 3B8MA 1J1EC 2WPSA 2OTJP 4IFDK 1BL8A 1SQQH 2WSSG 2UU9O 4H13D 2ZXWB 5L3EA 2P10A 3HKEB 2IJIA 1EDIA 4B3TB 5LL6Y 1KUQA 1URQA 3ABKC 5IWAO 4N23A 3JD0A 2B9BA 2ZDIA 4GOEA 4FPPA 1K33A 2NPSC 5FNVA 1OCOB 3CCMV 3B8NA 3S9OA 1KYOH 4JYAO 4B3SB 3M91A 2UWJE 2BSKB 1MMMA 2FXOA 3Q1MA 3IGAC 1FS0E 2Q8VA 4QPJA 4OX9O 4JPRA 4DR7B 4TT3H 3L74E 3DC5A 1M5IA 2UUAO 2O3JA 1TUBB 2XZRA 3GW6A 3AG4B 1BSHA 3JARB 2Q4PA 1HNXB 3PLNA 5AW8B 4MN4C 2IBZE 5CCHD 1KV4A 3GB7C 5AVWB 3VQWA 4DR6B 3H1LJ 1DEEG 5EFWB 1H8AA 3H1JD 4UB8E 4LWSB 3SYAA 2XTAA 5H6QA 3CL3D 1M57C 2FYUH 1KB9I 3V6IA 3CCUP 3ML0A 5B66E 2C9LY 3E83A 1BMFG 4LFCB 1OCZB 2Q7CA 1SQXH 2WLJA 4JV5O 4UVCA 1BCCG 4OGQB 1KQSU 3P30A 3SJAC 3TGUJ 2LQTA 5EYPB 3BAAA 3LUTB 3STLC 3V4QA 1LT9C 1GK6A 3CMEP 4HH2A 3V2RA 2YI8A 4DR2O 2QA4P 1FXVA 1W0JG 4X66O 3A3YB 4DRXB 4B86A 3CEIA 1M1JB 1Q5OA 3FAVB 1SA0A 4JI8B 4UFZA 4FMTA 3O6QA 1SFCD 4QNHB 2E42A 3AG3B 4XE5B 2FFDB 3NMDA 1MFZA 4I1LA 1SQFA 3SPIA 4KP4A 2FB5A 1VQKV 3L4FA 4AILC 4I7ZB 5IDJA 1VQ6P 4YY3O 3KZIH 1NZ6A 4OXSA 3AG1B 3G4SV 1Z5VA 4GDOA 1LWUC 1XTGB 1RP3B 3OUSA 5KAFE 4DV7B 4X62B 5L8RJ 4ASWA 3K57A 1LR1A 4NXNO 5D5QA 1QU7A 1XHZA 5B1AB 4G28B 4MTFA 1GMGA 1PP9D 1HWYA 2RDCA 4F6EA 1JFFB 4Z1VA 1HGVA 2LFRA 1VPCA 1S72P 4JI5B 3K58A 3HPLC 1JJOA 1PNMA 3QWOC 3UIAA 3H01A 3RL0D 1NTKD 2R44A 4AQYB 1HWTC 4JGSA 3L70J 2A7WA 4IIJA 1MZ9A 4H44B 5LXTA 1W59A 4MVZA 3ASOB 2EIKB 2RJZA 3AEIA 2GHYA 2CTPA 1NT2B 1NVPD 2XAHA 2I1KA 3V2PA 2IDBA 3ASNB 3V2QA 2UXDO 3O9OA 1FDMA 3WU2H 3H1LE 1SQQK 1VQ8P 4IT5A 3IFXA 1EZVH 4X1IA 4YJ3A 2HVJC 4A7PA 1KBHA 4GX1A 2AHZA 1NI8A 3FB5C 5F2VO 1M1KQ 5GW7A 1Q3EA 1OMIA 4O4IA 2ZIMA 3IC9A 1N36B 1FZAA 1YVWA 1E5WA 5CCGA 1LJ2A 3JD1A 4DW1A 1FXKB 3TGUE 3MD0A 1N7LA 1IDSA 1S5LZ 2LP7A 2FMLA 1GL2C 3ZIAG 1N7SC 4KJMA 2Z5IA 4N6JA 2DQ0A 2BTQA 2QWOB 2WSFJ 1X9VA 3BVOA 4FLXA 2K9YA 2C9NY 4YJ2A 2O57A 1ORQC 4XDJA 3I55V 4I55B 1X79B 3H1KH 1FD9A 4CBCA 2HFED 1S9KE 2I1JA 2ZXEB 1K4CC 3P7KA 1M7LA 2WLMA 3HKBB 1GM9A 3CCMP 1LT1A 4UB6E 2ZT9D 3AK1A 5K1XA 2POHA 3H9VA 3HTKB 1ZTEA 2H3OA 2UUCB 3CCQP 2O01J 4HBNA 3CS5A 2JDIH 4JI4O 5LYJA 1R3JC 2FYUK 3W68A 3IC7A 5E79Z 3ABUA 4ZIBA 4IHJB 3CCEV 1N73A 3OEEG 4XFJA 4PJ0Z 1M90W 5TJHA 4W7ZA 1SQXK 3CX5E 5B1BB 1T2KC 1T5EA 2HODB 4X20B 3QNEA 4PHZA 5KMGA 2A45H 3SPCA 3U10A 3AE2C 1Q86W 3H1JG 2ZAEB 1US6A 3AE6C 2LXCB 3KXDA 3SGIA 1JNMA 1COWG 1N8RQ 5LBQA 2ZE8A 2GA1A 3G67A 4W4LA 1RE3C 1XNQO 1PPJE 5KAIE 2Q9LA 3CCSV 3ABLB 3L75J 4QJFB 3F89A 1S76D 3ABKB 3KPEA 1BCCJ 1OZHA 2OWOA 3H25A 3RYFB 1PKXA 1HNZO 4U3FH 1P7BA 3L36A 1SQQJ 2NPSB 3T4ZA 2YXRB 4HJGH 2P22C 3RGBA 2Q9IA 3H1ID 3BRVB 1WT6A 2N1TC 4DR3O 5IYBO 2Q6QA 3OGCC 5C93A 1DGSA 2A79B 5L3DA 3M99B 1BE3E 3HKEA 3SPJA 1KORA 4ABMA 2W6AA 2PYLA 1W2EA 3AEDC 1URQD 3H1KG 1XL6A 2HR3A 2HKOA 1LNQA 4PA7A 5AVYB 1DF5A 1VQKP 3QG5A 3SDLA 5CJ0A 4PI0A 5IE9A 1ZX3A 2P67A 5ITZB 2E74C 2IJHA 3OA7A 2JDIG 2M0BA 3OAKA 2DN9A 1IFNA 4I0XB 3TJTA 4FLUA 1PP9G 2P1JA 1M57B 2O01N 2WQYC 3VP9A 1Q8IA 2JGDB 1VF6A 2XOKG 4JI0O 4FLVA 4LC1A 2KNCA 3W67A 1AP6A 3RYCB 3D36C 3CP1A 4IYIA 1NTKG 1RF1C 2QKAA 2XUMA 3T97A 4LF9O 1K8AQ 1IURA 3ZMSA 1NR1A 1AQTA 4Y28J 1AR1B 1I94B 1YHQP 1K7DA 2YDEA 4TSFG 4X65B 4D7SA 3GHGB 4LWSA 1CW5A 5IYDO 3RL0B 1ZLZA 2HPCA 3F5WC 5H2FZ 2QG4A 1BSMA 2JR8A 4NPEA 1FU1A 3UO3A 2YIUC 4JAUA 1XNRB 3VP8A 5JWPA 1RY3A 1ZR2A 1M93A 3H1HH 4ZI7A 2JEEA 4NPFX 3NXSA 3W7SA 4JI3O 4ZOLA 2ZQMA 4LFBO 3QF7A 1VQ5V 3HE4B 4ZKUA 3B2EE 1BCCE 4JF3A 2E5LO 2XASA 3OTFA 3CD6P 2E5YA 5KX5B 1ZL8A 3FAVA 4WFHA 1W5CE 2YO2A 3G71V 1CXZB 1FFTB 2B5UA 4O2AB 1S77D 3LSUA 1F4NA 1WMKA 3EFFK 1PL0A 2XNDH 3U0ZA 3HE5A 2WT7A 1H8HG 1QVFO 1LTAC 3I55P 2CPBA 3VOUA 4PA3A 1FJKA 3L74H 4ZHQB 3N2KB 1R6TA 3ICXA 4B3MO 1Z56A 1LTJA 2AXTZ 4FZ0A 1OW6A 3OR6C 2OYOA 2R5BA 3K79A 2PFXA 4LF5B 4I9QA 4RUFA 4OPHA 4X8AA 2IBZH 1ROPA 4U7OA 2VRZA 2AZ0A 2OCCC 2HG5C 1YSCA 2ZVOB 4UB8H 3CCEP 4J80A 2W6JH 3QO5A 2GTSA 3ZMZA 2HP8A 4L87A 1IZ3A 5B66H 3AE1C 3H1JJ 4I9WA 1M1KW 3B8EB 1TUEB 2UUBO 1JEKA 1FZGA 2HVKC 3BCCD 3THOA 1YJNV 3CWBD 1G1XB 3IF4A 1N7SB 1H2KA 1FFXB 3DTUB 4X1YB 2ZIOA 1TVKB 2PYJA 2AEMA 4O4LA 3CCSP 1IZNB 2R3SA 3AEFC 5CMZA 5DM6V 3CXHI 3FWLA 3FB6C 2CK3H 4I50A 2WLKA 1KU9A 3Q5SA 1N4CA 1U57A 3B5NC 3H1IG 2B9ZA 5CCGD 5JH7B 2MKVA 3P8CD 3KCYA 1SF9A 3HUSA 4NYKA 1ENVA 2EINC 5EZYA 3LIDA 1S5LE 3MDSA 1HVVA 2L35A 1GAXA 5KAFH 4JI1B 3K5MA 3H1KJ 1H0TA 3M0DC 3AE3C 3T2MA 1BS3A 4EB6A 2QKCA 3RYIB 3KQGA 3K5NA 1GRJA 2ZVNB 2RN9A 3Q3DA 2ZXWC 4EIJA 4KHXA 2XAJA 5KKZB 2PRRA 1FZFA 1KILA 1EDLA 1PP9J 3L35A 5AW4B 1QQCA 3V2NA 1KECA 3OD4A 4AQRD 3HKDB 3HB3B 3ZMTA 2K88A 2ZD9A 3UQ8A 4DR5O 3HR0A 5C8YB 1NTKJ 1QR8A 1QVFU 2A3QA 1MZFA 2F4VO 1OCOC 4K8ZA 2QJPC 4LF8B 1DD3A 1A32A 4EFEA 1WRGA 1R3LC 3H1LH 1ZR4A 2EIJC 1JY2P 5GTHE 5CJ4A 2IU3A 4C7RA 2WPVB 3LNMB 4JAVA 2N1TB 4IYHA 2KB1A 1N33O 2YKPA 1BGYD 3AG4C 1DLBA 3H1JE 3JATB 2CH7A 3E1RA 2PUSA 4UVBA 3J80N 2IU0A 2W8ZA 2CK3G 5GONB 4NXMO 2ILMA 3IJ4A 4F6RA 4XBFA 3SYCA 2N9YB 4C7UA 3TGUH 4JTCB 3N4XA 3AEEC 5DJUB 3A0BZ 3RGUA 1Y74A 1K3EA 3N2GA 5DEDA 2K1AA 1XL4A 3CCRP 4MT8A 4X9QA 1TGOA 2XDJA 1PGPA 1OCZC 2QE7H 2R9RB 2YIBA 1KKDA 2NNUA 3G71P 1ZP0C 1LP1B 4OGQC 1G6UA 1JCCA 2QKSA 3QTCA 4UB6H 1FPOA 1RF1B 2ZM6O 1KYOI 2ITDC 1VF5D 4BW5A 4C46A 1PV3A 1DH3A 1H2MA 1M1JC 1AI7A 2K3RA 2UU9B 4K0KO 1NTZD 3AG3C 3L72D 3SWYA 2FFDC 2K9JB 5BR8O 1L1FA 5APSA 2M5AB 3CX5H 2JGDA 1YTFD 2WA4A 5IWAB 1H2GA 4O2BA 2KSEA 3L71D 2CPSA 5APVA 1PP9E 3RYCA 2B87A 2FBWC 3VQYA 1MA1A 3S1KA 1SQVD 2E43A 4LH7A 4CPGA 4Q20A 4JYAB 2Y9ZA 1JO5A 1RHZB 1LT9A 3JD3A 1RM1C 1TAEA 2C2AA 5IJ9B 1PPJH 4DUZO 5KAIH 3CCUV 3IR9A 4EFBA 1NTKE 4OX9B 3UT5B 5KLVD 3BCCG 2ZYGA 2RMZA 4O4HB 3V5BA 2X0LA 1GU4A 5KA5A 5EC1C 1YJNP 3EXAA 2EILC 3QO7A 5KHKA 1W2BO 3CMEV 3TDKA 3BY6A 1FZEA 1OVRA 1U7JA 3ASOC 2EIKC 2YMKA 3ZRSA 1LWUA 1GK9A 4OPAA 2XHBA 2G8YA 1BE3H 3G3ZA 5AVTB 2QE7G 1NHLA 4WY4D 4UV9A 3MGNA 2WSSH 2XAQA 3E22A 1HH0A 1YZBA 3ITKA 2XU6A 2LR2A 4HKZH 2DMXA 2DQ3A 1VQ6V 4NTWA 2P5OA 4JV5B 3O65A 2K9PA 1W0KG 4FFKA 3PP5A 3VN0A 4WFBV 1VQ7V 1QR9A 3L74J 1SETA 2D3OW 2ADPA 2J59M 3JALA 3WUVA 4X66B 2YEVA 1FXKC 2H8PC 1EQ7A 1S72V 1Q6UA 4YHHO 2OYHC 1RF0C 1BQ0A 2KG7B 1HJ0A 3F7VC 2AXTE 3CSXA 3P32A 1S0VA 3RK2C 2KXPB 4JI7B 2QWRB 4IL6Z 2O01H 3AE7C 4YXDC 4PA4A 5LP6A 2DOSA 2KKWA 1Y4MA 4KHPO 4OWFA 4YY3B 2CTRA 4H13C 3D3QA 1CPYA 3OTOO 4WB4A 2ODMA 2JK5C 2N74A 4NXNB 4Z1MH 1H2LA 2WPRA 2QJ1A 3TYYA 5AVUB 2RN0A 3ABTA 3BHPA 2P4KA 3BABA 4JYYA 1K9MQ 1EZVI 1M90Q 1IO4A 2EINB 2WVRA 2G38A 3ZX6A 1BGYG 1GL2A 5EIBD 1NYHA 1N7SA 1KQFB 1FFXA 2MW2B 2FXPA 2YXQB 2OYIC 2QSAA 4DR1O 1AJNA 1TVKA 5TISZ 4DV3B 1Q86Q 1KQGB 3A0HE 1BCCH 3ETGA 3AEBC 1YI2P 1JCDA 4IFMA 2HYNA 2OGUA 3A8TA 1BE3G 2JS5A 3ZRVA 1IXBA 1ZUQA 1OV9A 1N34O 1Y8AA 3LDCA 3WB0A 2UXDB 2IPPA 5LA6B 2CE4A 1AJQA 5CCHC 3CE2A 3ABLC 4WBNB 2QR4A 2LO1A 2ZE7A 1HDJA 4RO0A 5CBGA 5AW3B 1RE4C 3CRQA 4RQEA 1W2BU 2P6JA 3H1IE 4E2LA 1YIJP 4JI6O 1CI6B 1X22A 1IBKO 2QJPB 5AVVB 4W7YA 4XDLA 3RYIA 4TV8A 2EIJB 3CCQV 1DEBA 3SYPA 3CC7V 1NTZG 1M56D 3L72G 2ADQB 4R8CA 2QWNB 2KZJA 1KB9F 4PELA 1VF5B 3WG7B 4DV1O 1Q90D 1RE3A 2F23A 1S2EA 1SQGA 2LXBA 2QM8A 3RYHB 4Z1MG 5C8YA 1AR5A 2R9IA 1RH5B 1SFCC 1RSOB 3FD9A 1GN2A 4I5SA 2Y69B 1QLED 2Q7GA 1SQVG 3E1IA 3K5LA 4X1KA 1JMBA 1IFJA 3USSA 3E8FA 2KS1A 4OH8B 2DYSB 2N1TA 3JAWA 3PN1A 4CC5A 1DTOA 4JI4B 3C8VA 2F95B 4FLZA 1GH6A 5KLVG 1KP2A 1NTMD 2X6CA 4UV8A 1GD2E 4BIUA 1YYCA 1Y6XA 1DK1A 5KHJA 5LMUB 1IJDB 2PGDA 1NJIQ 1OXZA 1URFA 5LGTA 3CC2V 3CC4V 3OMIB 4J11A 1IBMO 1NQTA 4MTXA 5JCOC 3GHGC 3H32B 3TF5A 2C0WA 4N21A 3A0BE 2WA3A 1S5LH 3RL0C 1EC5A 5CA0B 3AEGC 4QPKA 3HD7A 3M0AA 1XREA 1XNQB 3SR2C 4DT0A 2IFNA 3ZRWB 2HHHO 3DXRA 2IJKA 5LOVA 1LP1A 2B1IA 3JAKA 2YIAA 1Q81W 4X64O 2JIZG 1B04A 2HLDG 1HNZB 4O4JB 3D36A 4WY4B 3WFVA 1VQ7P 4C7NB 1SERA 2BASA 3KDPB 4FLTA 1AROP 1X8YA 1DF4A 4QMAA 1RM1B 5L3BA 4RAIA 4XA4A 5C39A 4LGDE 1IK9A 1HGZA 3LSSA 3K9SA 4GKJO 3ZRXA 1SC5B 2X7RB 5IYCO 4UCRA 5FLXN 3AECC 2QWQB 3B40A 4WF9V 2W83C 3Q5PA 2YIDA 2EILB 3OAAG 3F7YC 4M3LA 4L8JA 5GTHH 3ZHSA 1YHQV 4LNUB 1RQVA 3R4YA 4F4LA 1SQBG 1X59A 3CRCA 4RKUJ 2Q68A 2IH1C 4U3JB 4D7TA 3JASB 2ZCEA 1EN4A 4DV6O 3H1JH 2X6AA 2J5UA 1L0LD 1KTMA 4JI2O 2HFEC 1PIXA 1MSDA 4GCZA 1RPOA 3D6YA 1RQUA 1BGYJ 2O1JA 1F7YA 4FFBB 2ZT9C 4LF4O 5IY5C 3SPGA 4LF9B 2KYVA 1P4RA 3BCCE 1VQNP 1WPXA 5CMUA 1PFIA 4HYOA 1BE3J 3MUDC 4LF7O 3CD6V 1OJHA 1KB9D 3MTUE 4WFEA 4BAYA 2N04A 1MZEA 3OUFA 5H6RA 5KUMA 4NTYA 1XTCC 3ZEDA 2OYHB 1WAZA 2WLIA 4U7JA 4JZGA 1N0NA 3RK2B 2R9AA 2IJJA 1AI6A 2CTQA 4PD4F 2GTAA 2FY8A 2ZKOA 2KUBA 1MKMA 3ZS8C 2C0XA 4DW0A 1BQZA 3P8CE 4JI3B 4H13B 4CS4A 2EBOA 4LFBB 1KFMA 3M8AA 3AEAC 4TLFA 3SWKA 4KL1A 3FX0A 2ZE6A 2E5LB 3U1CA 1ZSPA 3K0GA 2Z5UA 4Y99C 2AHYA 4PD4I 3L72J 5KJ7A 2IBZI 3CC7P 2KG7A 2GUSA 2PGGA 1PP9H 4MW3A 4GKKO 2YXYA 4IL6E 4DZOA 4MW8A 1SQPD 1SRYA 5JVDA 1K9MW 1FJPA 1HF9A 2OYIB 1WA8B 1MOFA 1P84F 3AE5C 1B3QA 4JASA 1JA8A 1WP8A 3AG7A 1NTKH 3R2PA 1Y76A 1FOSF 1FJGO 3EHBB 1XMOO 4H0LD 2CDYA 4B3MB 5KKZC 4KT0J 1Y66A 3DC6A 1AVOA 5AG2A 2W90A 1IFIA 1H8EG 4TUYB 1FDOA 3JCUE 2EIMC 1R73A 1NU1D 2YI9A 1TU3F 4RJTA 5CBNA 3B5NA 1UPGA 1QBZA 5KLVJ 1ZV8A 1F23A 1P84I 3FWNA 1K73Q 1NTMG 1QLEB 2LKMA 3QO8A 5B3SB 1N2DC 4FM0A 5APWA 5APXA 1L4AD 3U59A 5TISE 2VQEB 2GBOA 3Q4HB 3N7NA 5IJ0A 1VQPV 1BGYE 3CC2P 1GN6A 3CC4P 2UUBB 5FPOA 1AFOA 4QE9A 1A02J 3CMAV 1IBLO 1NKDA 1JY2O 4DJGA 2Y0IA 3VTPC 2OQQA 4WBNA 4LH6A 5AVSB 3OEHG 5DN6G 2QJYC 3C9IA 4H33A 3OR7C 2Y0DA 4UCUA 2HLOA 1SFCB 2GM4A 1JOYA 2AXTH 5BY1A 1VF7A 2BSKA 1YEWA 1QL2A 4QIWF 1ZOYC 1KD1Q 5LMNB 3UCSC 2YKQA 1JTHB 2V4DA 2CGOA 5CA3A 1K5QA 1PV0A 4CH4A 3M9QA 3G9RA 2Q6AA 3EFGA 1TUBA 1XQ8A 3HKCB 3M7MX 2QEXV 1GW3A 1P49A 1NAFA 2UXCO 2EZPA 4RWUA 2EX3A 1SP4A 2I8DA 1FZCB 1EDJA 1HBWA 3CI9A 1WB7A 3JARA 3SSUA 2JVDA 4LF6O 2R70A 1VIBA 1NTZE 2KP8A 3L72E 1NWQA 2E75D 3JSLA 3CJHB 4Z2WA 1L0ND 1SQBJ 1OCCC 4PD4D 1VQLV 1NJIW 4GT1A 2NR5A 3L71E 3FYIB 2XAGA 4L76A 1GTWA 2WLLB 2AW9A 3K08A 4LP8A 3RWRD 2PAJA 1G8MA 2KLUA 4TQDA 1SQVE 1L0LG 3A0HH 2RH0A 5LHIA 1YJWV 4DR5B 3DGEA 4TV9B 3OGIB 3JYCA 1NVPB 2F4VB 4WFFA 4DV4O 1S5HC 5EYPA 1Y9BA 5APYA 3KKYA 5KLVE 3CCRV 3WB2A 2YNYA 2UXBO 3BPZA 4D6TD 5EBMC 3VBBA 1JMMA 4DRXA 5B5EZ 3H32A 1TA8A 1M1JA 4DK1A 1P84D 3B4SA 2QWPB 4HNAB 3H1IH 5CA0A 1E79G 1N33B 3HD7D 1QNMA 4YXWG 4K35A 3GMAA 2KIKA 2FFDA 3OMAB 1PNLA 2GUZB 4NXMB 2L91A 2DJVA 1AVYA 2QM4A 1GU5A 5JJEB 1MG1A 4HB1A 4G27B 3K0DA 1DIPA 1XMQO 2FKWB 1CEZA 5J2TB 3OFNG 3K04A 1NTKK 5H5NA 2F66C 5CB4B 3WB1A 1NO4A 2VQFO 3IFMA 1AI4A 3OMNB 3U11A 1JFFA 1BHBA 3CX5I 1UFIA 3J7AU 1MUUA 1D5AA 1SQPG 3L73D 2ZT9B 3CYOA 1SZXA 2BCCD 5CCGC 5IY5B 2ZM6B 1MV8A 4TQFA 5CBFA 3CXHF 1XOUA 5KHHA 3ZHTA 5CN0A 5JJNB 3IAYA 1Q82Q 5JQGB 3BRCA 4K0KB 4U3JA 1HR0O 2WTYA 2D2CD 4P9OA 2ZR2A 5BR8B 2JJ1G 4MSWC 1SQBE 4EDFA 2B1GA 3VQXA 1I5XA 4H0LB 2W6IG 3CCVV 3JSVC 3CXCU 4YTPC 2ETNA 3A0BH 3A0RA 4FM1A 1OVVA 3PH0A 5AW1B 4DUZB 4I4TB 4JZ2A 1H38A 1VQPP 3OJAB 5EK0A 3OM3B 1IK7A 4DUYO 1FXKA 4Y99B 4DK0A 1GMJA 2OT5A 2BEQD 4FLYA 2K37A 4QE7A 2W0XA 1RF0A 1AQ5A 1EN6A 2HJDA 3CMAP 1L4AB 2QJKB 3BATA 1BDCA 5IYZB 4FVMA 5A2QN 4N78D 4NB5A 4I55A 4P30A 2Q1KA 4B3RO 3RL0g 1AR4A 3MP7B 3HKBA 2R3CA 1KKCA 4BR6A 3SPHA 1YJ9V 3STZC 3CCJV 1URQB 3AE8C 3HTKA 2EIMB 3UKMA 1MABG 2Q7EA 5KJ7D 5AVQB 5KLIC 3D71A 1PM9A 5M1BA 4DV0O 5FNVB 4UCTA 5E79E 2QEXP 4IHJA 3QVNA 1J5EO 2IZ1A 1GW4A 1WA8A 3UM7A 1K73W 3PJSK 4PJ0E 1I94O 2BOCC 2HODA 4X20A 4J9YB 3RT3C 1L0NG 5IT9N 1JM0A 5AW2B 3VMAA 3C3TA 2XV5A 4YHHB 1VQLP 5EBLC 1S5JA 2G3AA 3A2FA 3WG7C 1AILA 1L0LJ 1VF5C 3QH9A 3H6PA 4PV1D 5CCHA 3BCCH 2Y4TA 5GTIZ 3L70D 1OZ0A 1YI2V 1ZN5A 2QJYB 4KHPB 1YJWP 1RE4A 2MJZA 1LTGC 4UB8Z 1EN5A 1GTOA 2Y69C 3OTOB 3RYFA 2PI4A 3EWKA 1Q2NA 2A06D 2NPSA 1KYOF 3G6EV 1NTME 5B66Z 5EC2C 1SKVA 2DYSC 4Q6GA 2JJLA 2KI7B 3II6A 3K3WA 2YMYA 4D6TG 3T1HB 2V7QG 2QM7A 2M7WA 3SJQC 3SJCC 2DE0X 3CXHD 3FB7C 3VQVA 1KD1W 1S3JA 5AVZB 4NKGB 1YIJV 1NH4A 1Q7YQ 1EXJA 4DR1B 1CSBA 2FYNC 4J41A 3HRNA 3AK2A 5APUA 1YTZI 4GYCB 1PD3A 2WLNA 3M9HA 4R6ZA 3ABVC 2JP3A 1SA0B 3MHVA 3O6QB 4FLWA 1OCCB 1SFCA 3W7TA 3K9AA 1IFDA 2M6YA 2WLHA 1N34B 2QRXA 5ITZA 4IL6H 3P3NA 2JS3A 3EQ2A 1ZRTD 4XDKA 4I0XA 1Q81Q 2ZE5A 4BIZA 4NVPA 5KAFZ 2B88A 3ZCCA 1SQPJ 1UIIA 1AJPA 1D5NA 3ZHQA 3L73G 4WY4C 1IBKB 2BCCG 3R66A 1R6KA 3RN4A 3JCUH 3CJHA 1JY3O 2WITA 2ZINA 1NKZB 3KHUA 1R3IC 5CA1B 3GHGA 2CGNA 5JCOA 2UUAB 3CPWO 3KYQA 4BWNA 5H2FE 1N32O 2NZ2A 4DV1B 3JSNA 4IIJB 3CWBG 5TISH 1QVGO 3W7XA 4FZ1A 3ETEA 3RW0A 1BGYH 1LUVA 4LFAO 1KZUB 2RCVA 2N05A 3F5TA 3CCVP 1RPRA 1L0LE 1YQ3C 3GWOA 4J10A 4WCEV 3FX7A 1K34A 3RK3D 4WFGA 3HE4A 3H1IJ 2Q5UA 4RO2A 3LDEA 2JJ2G 4X1IB 4YJ3B 3L75D 5B5EE 2JEUA 1EXIA 5KX5A 4O9BA 2ZNIA 4O2AA 2DYRC 1KB9E 4O4IB 1S1CX 1E1QG 4HZ3A 1SQQD 2IH3C 2R5DA 4ASUG 4MVRA 5KA6A 1AA0A 4UCSA 4DR2B 3SYQA 1FDIA 1IBMB 2AZ2A 4ZHQA 1F4MA 3N2KA 5J2TA 1SS1A 5BZBA 2BTQB 4EEQA 4YJ2B 2J58A 1YJ9P 1NTZH 3CCJP 1NGMB 2HHHB 1ZMEC 3L72H 1Q82W 4CC6A 3A5TA 4ZNCA 1KYOD 2L5GB 4J7KA 1GM7A 1ZAUA 1H2NA 3T4DA 2GUVA 1YXBA 3L71H 1EBOA 3C1LA 5J2UB 3RBZA 3LNNA 3HUSC 3MHHC 1L0NJ 2QSIA 4H44D 4P9PA 4PA9A 1SQVH 1SQPE 1FYJA 4RQFA 1EDKA 1SLQA 2CTWA 2Y48A 4KUMA 4KXRA 5LYJB 4DCKA 4R50A 1R3KC 4GZRB 2JKVA 2ATKC 2E76D 4GKJB 2ITCC 5BU5A 1GN3A 4K8XA 4NTXA 2GV9A 1YBKA 5KLVH 4X1YA 1KQSO 4J7JA 3L70G 1MNGA 5FPRA 5KMGB 1VQNV 5LGUA 3WUUA 2OTKE 3K5OA 1NU1E 4GODA 1M56C 2FYUD 4GX5A 3TXSA 5L3CA 1BDDA 1KP3A 2NLJC 1OW7A 2A06G 4PV1B 5KAIZ 1SQXD 4ZKIA 3G6EP 3CPWU 4DV6B 4D6TJ 2RNBA 4I4TA 1H89A 1Z5WA 2YXLA 5JH7A 3TSIA 2V7QJ 1JMKC 4JI2B 1FC2C 1QLEC 3T1CA 1QVGU 4L73A 5KLIB 5B3SC 3G80A 5FL7G 4QGPA 1NAYA 4LF4B 2OTLV 1CP9A 4X89A 4OVNF 1XDCA 5E1AC 1IXMA 4DR4O 3F5HA 1GM8A 1WP7A 4EYYQ 2OIGA 4LF7B 1VEWA 1NVOA 3K06A 3X2QB 1NS1A 4MS2A 3ZMVA 1I0HA 1FXHA 1KILD 2XNXA 2P7JA 5K1PA 3M06A 1D2DA 4H37A 4PA6A 3HKDA 2BEZF 3W7UA 3MZWB 3L71G 1NH2D 4ZKPA 1K97A 3L73J 4PI2A 3A2AA 2BCCJ 2A45I 5A9GA 3NFQA 4YPCA 5BU8B 1SQBH 3JCZA 1RFYA 1YTFB 1T6AA 2KNCB 3BCCJ 5HFMA 3RFRA 3ZBHA 1I7FA 4GKKB 4GX2A 1L0NE 3CWBJ 1FZCC 1R6NA 5H9CA 3T97B 4PD4E 4DV5O 1NR7A 3JATA 5GTIE 1JOCA 4GUNA 2FYNB 5DJTB 5GONA 1U7MA 2O1KA 3CCLP 1Q7YW 3LDDA 4YIOA 1FJGB 4PDMA 1XMOB 5CBOA 2Z5HA 2HPCB 1EZVD 3M9BA 3APOA 3ZHRA 4KFMA 2NPSD 2R32A 1V55C 4UUJC 1YTZT 3T1YO 4R4LA 3L75G 4ZI7B 5KUKA 3NTNA 4FJCC 1KN7A 3D3IA 2YIBD 1QLNA 4ZOLB 2JEXA 3I56V 4FM2A 3E86A 1JY3P 1NTZK 4D6TE 5KTBA 1R1BA 2H7HA 3RK3B 4L75A 2OCHA 4GLXA 2EJRA 1P84E 1PNKA 1SQQG 2AGAA 2W0FC 3B09A 1RF1A 4BRYB 4DV2O 1PGOA 4UVAA 1FOSE 2WSCJ 2AEFA 1ZL8B 1JQ0A 1FBMA 4J7ZA 4DR3B 5KHGA 4JI7O 1IBLB 1HNWO 5E79H 2JRIA 1SQVK 4JYCA 2K9JA 3H1KD 1VQ4V 3HE5B 2WT7B 3Q5RA 4PJ0H 4LLHA 1M57D 2M5AA 2FTKA 5APQA 4CZZA 2B89A 5KLVK 1YITV 1LTJB 1EFRG 1LGHB 1F51A 4TT3G 1VMGA 1S5LX 4DYLA 4DOJA 3LW5J 5IJ9A 1B06A 3L73E 1NKNA 2A9HA 1GDTA 2BCCE 4NPDA 5CA1A 3ZJZA 2XKMA 3UT5A 4JI0B 3WMM0 3AE9C 2UXCB 4W80A 4O4HA 3TXQA 1QEXA 3C90A 2DYRB 4DV3O 2W6BA 1AJYA 3E35A 1YF2A 2Q67A 4LF6B 1NTMH 3NR7A 3ETDA 3DSQA 3CWBE 2Q0AA 2FYUG 2E76B 1EZJA 4R7CA 2WAMA 1U96A 3CRMA 2P58A 4LCUC 2AXCA 1PZQA 4B3TO 1SQXG 1XBLA 5LP6C 4O4LB 1XUQA 2Z3YA 2JGUA 1HTLC 2RKLA 4U3FD 4MVOA 4YIPA 4H0LC 2WSEJ 4I50B 4DO2A 3OE7G 2Z4EA 4DV4B 4A5UB 4B3SO 1K05A 2OTLP 2Q3IA 3JD4A 2UXNA 2YXHA 3HUSB 3VMZA 1WJZA 2UXBB 4DR7O 4AI8A 2ZNJA 5EZYB 3VMXA 3ZN1A 1NTZJ 1X0TA 1M9NA 4N78E 5K5GB 1SQBK 1L4AC 2YS8A 2QJKC 1WN7A 1H0TB 1HNXO 4EB6B 2QIWA 3L71J 2EJ7A 4DR6O 3K59A 3FB8C 1K4DC 3KZIZ 1VQOV 3SFEC 1OFCX 3AK3A 3ETQA 1SQVJ 1M56B 3KCXA 1XMQB 4AYCA 4CS2A 4W4KA 2YICA 1KILB 5J2UA 2M3EA 3BASA 1J2JB 4J42A 5H2FH 3MHSC 2LW7A 2WWWA 1URQC 4LFCO 2VQFB 1PGQA 2QTOA 1IFMA 2KQXA 3VYIA 2ZDIC 1NH2B 1YQ4C 1MSWD 1QHTA 1HW7A 3SFDC 3TETA 5B1NA 3MAQA 1L0LH 1JVMA 3ABMC 2PY5A 1GL2D 5LMUO 5DECA 1N7SD 2DW4A 2OYQA 3ZDMA 5GTHZ 2H43A 3GVMA 3M0DA 1J1EB 4NR1A 5B5EH 4JI8O 3CHXA 3L70E 1R5LA 1GK4A 2IFMA 3E8BA 1EZVG 2VWJA 1HR0B 4RUEA 3H1HD 3R65A 2LGWA 5L3FA 1KB9H 3UO2A 1V54C 2CH7B 5LA6A 3WU2Z 4CH5A 4EKWA 2E75C 1PL5A 3B77A 4F6RB 1E79H 2A06E 4YXWH 1YDXA 2GSMB 3OW2O 2A0LA 5JJJB 4DV7O 4X62O 3I56P 1OX3A 1Y74B 4CH6A 2JWDA 3N2GB 1CI6A 4B7KA 1CZQA 3ZN0A 3CXHE 2CAZC 2Q69A 2KOGA 5D5PA 2GDSA 1T2KD 1WB8A 3GWKC 4DUYB 4JI5O 2IYPA 2UXXA 2EZOA 2W27A 1IX9A 1H88A 4WVZA 2M3BA 1EM1A 1OCRC 1Z2GA 4AQYO 4GKGA 3VMYA 5AW5B 3L74D 1VQ4P 3EVKA 1G1JA 3G4SP 1SQPH 2ZR3A 4TOIA 3RYHA 1ZRTE 2KLVA 2M8RA 4B3RB 4MVUA 2ZYAA 1RSOA 4UCOA 1NTMK 3HD7C 4N3YB 2QVAA 1YITP 1HJBA 2IBZD 1BSNA 4JAAA 1V55B 1OWAA 2RMKB 4O2BB 1PGJA 3KG2A 2N1TD 2XAFA 1Q43A 2B87B 1AVMA 1NU1H 1HP8A 2LGQA 4DV0B 1FZBA 1KC8Q 3K03A 1VDFA 2MK3A 4FIPC 3LSQA 4BWAA 2A45G 3JD2A 1J5EB 1LT9B 1O9GA 1N36O 2Y4UA 1KMIZ 1I08A 2YSUB 2FYUJ 2YC0A 2FYZA 2JO1A 4AHCA 3RVYA 1JB0J 3BRTB 2Q3EA 1SQXJ 1IFPA 3S3XA 1G2CB 2Z0AA 2CUGA 2E74D 1OW8A 3ZRWA 2FKXA 1K92A 4U3FG 3CX5F 3RK3E 2P2UA 4UCVA 1LWUB 1JY2N 4JF7A 5CBHA 2D2CC 1IVSA 3L75E 1T8ZA 5BXZA 1VARA 3RBXA 2BOBC 4O4JA 4WY4A 3BFRA 4BRYA 4C7NA 3E22B 2SPZA 1G4YB 2UUCO 2F43G 2ITAA 1E1RG 1SQQE 2BTOA 3D6ZA 2NRGA 5AW9B 4JBZA 3AE4C 1THZA 2V1DA 3OW2U 5BVZA 1VQMV 1HUCA 1JJ2U 3BVHA 1ZW0A 3JAMN 3JALB 1WNSA 4X88A 2YEVB 1L0LK 2Q5ZA 1VQOP 1JR9A 1VL2A 4LNUA 3TNUB 4CS3A 4EOTA 4JPZB 1KYOE 1JPXA 1L0NH 1DX7A 1P7GA 3FFQA 1IC2A 4PD4H 3SWFA 3JASA 3E89A 3B71A 3IAOA 5GTIH 1NU1G 3D8CA 2Y9YA 5LP6B 5BMVB 1NOHA 1NTMJ 1XEQA 4P2ZA 3SJBC 3WUTA 3H1LD
chains in the Genus database with same CATH topology
2WPVB 4H13B 3AE2C 3RL0g 1AJYA 3AE6C 4I7ZB 3AEAC 3C8VA 4GDOA 3AE8C 5L8RJ 2H89C 2E76B 3D70A 1Y9BA 1YQ3C 1HJ0A 2BEZF 5KLIC 1OW6A 4R4MA 3D71A 5M1BA 3H25A 1ZRTE 1R8EA 3AEEC 3AE7C 4YXDC 1UIXA 1HF9A 1EXIA 3AE5C 3AEGC 4H0LC 2WSEJ 4H13C 3GMAA 4H0LD 4I7ZC 4Z1MH 1K05A 1S1CX 5KKZC 4KT0J 4H44B 4H13D 4PV1C 2P10A 1ZP0C 4OGQC 1FDOA 2G3AA 3AE1C 1VF5C 1FDIA 1TU3F 1KORA 3GLMA 4PV1D 3T97B 1DIPA 3AEDC 4OGQD 2H88C 2D2CB 2IDBA 1VF5D 1KMIZ 1PV3A 2QJKC 4IL6X 1NYHA 2JO1A 1KQFB 1JB0J 2FXPA 1ZMEC 1NGMB 3S9OA 3EWKA 2QIWA 1KQGB 3Q1MA 2E74C 3AEFC 3AEBC 3SFEC 1KILE 2WQYC 2E74D 3AECC 3GF3A 4R4LA 4TT3H 4H44C 2ZT9B 3Q5PA 1OW8A 1OMIA 3Q5SA 3RK3E 1U57A 4H44D 2QSIA 2FBWC 2MKVA 1RQVA 3R4YA 2E76C 1EXJA 2D2CC 2OQQA 3IN6A 2E75B 2FYNC 2QJYC 1YQ4C 4RKUJ 2E76D 2D2CD 4Y28J 1K04A 3SFDC 2WSFJ 3ABVC 2JP3A 2WSCJ 3Q2YA 2J5UA 2K9YA 1KTMA 3AE3C 1PIXA 3D6ZA 3D6YA 1RQUA 4H0LB 3FGAD 3AE4C 1ZOYC 2ZT9C 4YTPC 2YIUC 3Q3DA 3Q5RA 2ZT9D 3G9RA 1OW7A 4PV1B 2YMKA 4OGQB 3GF7A 2E75C 1VF5B 1VL2A 1Q90D 1PL5A 1IK7A 2O01J 2V7QJ 2G8YA 1GMJA 2BEQD 2E75D 1S5LX 4U7JA 3LW5J 3B71A 3IAOA 4XFJA 2QJPC 1DD3A 3O6QA 1MKMA 1DD4A 2E74B 3AE9C 1WMKA 2NZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPV B;  2YIU C;  4H13 B;  2ZT9 B;  5KKZ C;  4KT0 J;  4H44 B;  4I7Z B;  3C8V A;  4PV1 B;  2QSI A;  4OGQ B;  1VF5 B;  5L8R J;  1Q90 D;  2E76 B;  2O01 J;  2FYN C;  2E75 B;  2D2C B;  2QJY C;  4RKU J;  5KLI C;  1S5L X;  4Y28 J;  3LW5 J;  1ZRT E;  2QJK C;  2WSF J;  4IL6 X;  2QJP C;  2WSC J;  1JB0 J;  2K9Y A;  2QIW A;  2E74 B;  4H0L B;  2WSE J; 
#chains in the Genus database with same CATH topology
 1VQ9 V;  3V4W A;  4FFB A;  2Y0P A;  1MFT A;  2VQE O;  1Q6H A;  2KZI A;  4B7E A;  4J9Z B;  1QX8 A;  5KJ7 C;  3L37 A;  4WFA V;  5AVX B;  1YCI A;  4HYT B;  3OT7 A;  1N73 C;  3PRJ A;  1GL2 B;  2IZ0 A;  3H1H G;  1GZL A;  2PTM A;  4D6T H;  2OYH A;  1N32 B;  2FYU E;  4ASV A;  2DWE C;  1P84 H;  2V7Q H;  3A0H Z;  3TGU D;  1QL1 A;  1JUN A;  3O8Z A;  4EI2 A;  4GX0 A;  3I5D A;  4LFA B;  1SQX E;  5APT A;  2ARH A;  2KK7 A;  1L8D A;  2QDO A;  1LTI C;  2HG5 D;  3CB2 A;  4PV1 C;  1SQP K;  5LMN O;  2L6L A;  1N0J A;  5KHI A;  1S9K D;  4U7N A;  2XND G;  2YO3 A;  2FL4 A;  1FAF A;  2BE3 A;  3AG2 C;  1FS0 G;  2IYO A;  2Y0C A;  3E8G A;  5AW0 B;  1J1D C;  2P4V A;  3ABM B;  3L74 G;  4RES B;  2EUL A;  5CHX A;  3FYE B;  1PL4 A;  2RQ6 A;  1OHH G;  1NU1 K;  1R5S A;  4BXL A;  3K5B A;  4TV8 B;  2OYI A;  5EBW C;  3S4R A;  2FXM A;  3KZI E;  1KIL E;  3FXE A;  3L73 H;  3X2Q C;  4MVS A;  4X65 O;  2BCC H;  3CX5 D;  2IBZ G;  1Y47 A;  2JWA A;  1WLE A;  4TWK A;  4TUY A;  1T3U A;  1D7M A;  4I2L C;  1XNR O;  1V54 B;  2E75 B;  3B5N D;  1N8R W;  2W6J G;  2K1E A;  1A02 F;  1WPB A;  3CWB H;  1QCE A;  1PPJ D;  3Q2Y A;  2ZFC A;  3APQ A;  4X1K B;  4BIO A;  1T3J A;  2KS1 B;  2IW5 A;  3Q4H A;  3FGA D;  2P7T C;  1AI5 A;  3I5C A;  1VF6 C;  3JAW B;  5LHH A;  1OVU A;  3E7K A;  3FKS G;  1G1I A;  1OIP A;  4PDL A;  1JCH A;  2H94 A;  4B08 A;  1B6Q A;  3BEH A;  2IX7 C;  2HJF C;  3GF7 A;  3WU2 E;  1S4X A;  4U3F J;  1SS3 A;  1GKF A;  1LTT C;  1OCR B;  1JX9 A;  3TK1 A;  1EZV E;  2F93 B;  1GN4 A;  2OTJ V;  2OAR A;  1BE3 D;  1ZWI C;  3E8H A;  4BW9 A;  2DW3 A;  2PI5 A;  1ZXG A;  1M4U A;  1VQ5 P;  2KSD A;  2PF4 E;  4ZMD A;  3HD7 B;  2E74 B;  1SVF A;  4LF5 O;  2WSC H;  3DXR B;  4WBA A;  1JTH A;  5LOV B;  1L0N K;  3JAK B;  2ZYD A;  2LJ2 A;  3GG2 A;  1USD A;  3HKC A;  5L3G A;  3J81 N;  3RK3 C;  3VOP A;  2H89 C;  4G2K A;  1FZC A;  4IOI H;  3ZHV A;  4JI6 B;  3E2E A;  2KSJ A;  1VQM P;  1XHX A;  4R4M A;  4DR4 B;  2Q0O C;  1KC8 W;  2ZJS E;  2WPQ A;  3H1K E;  1R8E A;  1X4T A;  1K8A W;  2N9B A;  3ZHU A;  5LGN A;  2IM9 A;  3U1A A;  3LW5 H;  1FKA O;  4E4E A;  1SZT A;  2LFS A;  1NU1 J;  2YKO A;  2WLL A;  1BHA A;  2YIU B;  3CRA A;  4I7Z C;  1BT8 A;  3G6B A;  4FK5 C;  1AV1 A;  1K5S A;  5LXT B;  3AG1 C;  2VWK A;  3ZMU A;  2E5T A;  3LIE A;  3CCL V;  3H1L G;  3GLM A;  4TV9 A;  3L70 H;  4IGG A;  1LTJ C;  3CLQ A;  1VQ9 P;  4PDR A;  2H88 C;  4OGQ D;  2D2C B;  1SES A;  2VS0 A;  3N27 A;  2OIE A;  5B1A C;  1NBM G;  2YUA A;  4JYB A;  3CRR A;  1BZK A;  4IL6 X;  4LBE C;  2R72 A;  2KB7 P;  4JQ0 D;  2A06 H;  5J9P C;  2P06 A;  1VP7 A;  2Q73 A;  2VRS A;  3H1H J;  1FAV A;  1V9P A;  2HEP A;  1Y67 A;  1N86 A;  3BA9 A;  4HNA A;  1BCC D;  4JI1 O;  4JTD B;  1XIL A;  1FE6 A;  1G2C A;  3GF3 A;  4MVQ A;  2X6B A;  4DV5 B;  4H44 C;  2PP6 A;  2ZXX A;  2LW1 A;  3P3P A;  4MTO A;  3TGU G;  4LR3 A;  3CXH H;  1O9H A;  2QA4 V;  1GO3 F;  2GUZ A;  3RVZ A;  2WSE H;  2QGN A;  4HAM A;  4MVM A;  2WPD G;  2E76 C;  2WMM A;  1LUW A;  4GOF A;  3IN6 A;  1UJW B;  3ASN C;  4U3F E;  2AEJ A;  3PTZ A;  4WWI A;  2WLI B;  5EIB C;  3W7W A;  1K04 A;  2QTS A;  3FXD A;  3BA8 A;  3T1Y B;  3S3W A;  1ZLL A;  5CB4 A;  1KFN A;  3JC2 2;  1KQL A;  3TCU A;  1H2S B;  2Q7H A;  2WSF H;  3PHL A;  2WZ7 A;  2DWD C;  4JTA B;  2OCC B;  4LF8 O;  3MIW A;  4X64 B;  2F1M A;  4UB6 Z;  1LTB C;  1U97 A;  4DV2 B;  1QGK B;  2P90 A;  2XT9 A;  4L74 A;  1LTS C;  3TNU A;  3MUD A;  2E3C A;  1XI1 A;  1USE A;  5JQG A;  2V4H A;  5LHG A;  1HNW B;  1N73 B;  4PDV A;  5JVD B;  1J95 A;  4IFF A;  1JY3 N;  1I5Y A;  3C3S A;  5AW7 B;  1DD4 A;  5BMV A;  1M8O B;  1Y76 B;  4GIF A;  5B1O A;  1SQB D;  1PPJ G;  3A7O A;  1Q6I A;  4ZBM A;  1KIL C;  4AUW A;  3SYO A;  5HFL A;  3JCU Z;  1L2P A;  4ICG A;  1VQ8 V;  3P8M C;  5AW6 B;  4K3A A;  3B5N B;  4I6M C;  4UXN A;  3D70 A;  3T1H O;  3L9D A;  4CH3 A;  2H8P D;  4MTG A;  5AVR B;  1AB3 A;  3L75 H;  1AP5 A;  2NN4 A;  1L4A A;  3AG2 B;  5B1B C;  3RK2 D;  2PZS A;  1UIX A;  2Y0E A;  1J1D B;  5IJ0 B;  5IYZ A;  3H1H E;  4DXW A;  3B8M A;  1J1E C;  2WPS A;  2OTJ P;  4IFD K;  1BL8 A;  1SQQ H;  2WSS G;  2UU9 O;  4H13 D;  2ZXW B;  5L3E A;  2P10 A;  3HKE B;  2IJI A;  1EDI A;  4B3T B;  5LL6 Y;  1KUQ A;  1URQ A;  3ABK C;  5IWA O;  4N23 A;  3JD0 A;  2B9B A;  2ZDI A;  4GOE A;  4FPP A;  1K33 A;  2NPS C;  5FNV A;  1OCO B;  3CCM V;  3B8N A;  3S9O A;  1KYO H;  4JYA O;  4B3S B;  3M91 A;  2UWJ E;  2BSK B;  1MMM A;  2FXO A;  3Q1M A;  3IGA C;  1FS0 E;  2Q8V A;  4QPJ A;  4OX9 O;  4JPR A;  4DR7 B;  4TT3 H;  3L74 E;  3DC5 A;  1M5I A;  2UUA O;  2O3J A;  1TUB B;  2XZR A;  3GW6 A;  3AG4 B;  1BSH A;  3JAR B;  2Q4P A;  1HNX B;  3PLN A;  5AW8 B;  4MN4 C;  2IBZ E;  5CCH D;  1KV4 A;  3GB7 C;  5AVW B;  3VQW A;  4DR6 B;  3H1L J;  1DEE G;  5EFW B;  1H8A A;  3H1J D;  4UB8 E;  4LWS B;  3SYA A;  2XTA A;  5H6Q A;  3CL3 D;  1M57 C;  2FYU H;  1KB9 I;  3V6I A;  3CCU P;  3ML0 A;  5B66 E;  2C9L Y;  3E83 A;  1BMF G;  4LFC B;  1OCZ B;  2Q7C A;  1SQX H;  2WLJ A;  4JV5 O;  4UVC A;  1BCC G;  4OGQ B;  1KQS U;  3P30 A;  3SJA C;  3TGU J;  2LQT A;  5EYP B;  3BAA A;  3LUT B;  3STL C;  3V4Q A;  1LT9 C;  1GK6 A;  3CME P;  4HH2 A;  3V2R A;  2YI8 A;  4DR2 O;  2QA4 P;  1FXV A;  1W0J G;  4X66 O;  3A3Y B;  4DRX B;  4B86 A;  3CEI A;  1M1J B;  1Q5O A;  3FAV B;  1SA0 A;  4JI8 B;  4UFZ A;  4FMT A;  3O6Q A;  1SFC D;  4QNH B;  2E42 A;  3AG3 B;  4XE5 B;  2FFD B;  3NMD A;  1MFZ A;  4I1L A;  1SQF A;  3SPI A;  4KP4 A;  2FB5 A;  1VQK V;  3L4F A;  4AIL C;  4I7Z B;  5IDJ A;  1VQ6 P;  4YY3 O;  3KZI H;  1NZ6 A;  4OXS A;  3AG1 B;  3G4S V;  1Z5V A;  4GDO A;  1LWU C;  1XTG B;  1RP3 B;  3OUS A;  5KAF E;  4DV7 B;  4X62 B;  5L8R J;  4ASW A;  3K57 A;  1LR1 A;  4NXN O;  5D5Q A;  1QU7 A;  1XHZ A;  5B1A B;  4G28 B;  4MTF A;  1GMG A;  1PP9 D;  1HWY A;  2RDC A;  4F6E A;  1JFF B;  4Z1V A;  1HGV A;  2LFR A;  1VPC A;  1S72 P;  4JI5 B;  3K58 A;  3HPL C;  1JJO A;  1PNM A;  3QWO C;  3UIA A;  3H01 A;  3RL0 D;  1NTK D;  2R44 A;  4AQY B;  1HWT C;  4JGS A;  3L70 J;  2A7W A;  4IIJ A;  1MZ9 A;  4H44 B;  5LXT A;  1W59 A;  4MVZ A;  3ASO B;  2EIK B;  2RJZ A;  3AEI A;  2GHY A;  2CTP A;  1NT2 B;  1NVP D;  2XAH A;  2I1K A;  3V2P A;  2IDB A;  3ASN B;  3V2Q A;  2UXD O;  3O9O A;  1FDM A;  3WU2 H;  3H1L E;  1SQQ K;  1VQ8 P;  4IT5 A;  3IFX A;  1EZV H;  4X1I A;  4YJ3 A;  2HVJ C;  4A7P A;  1KBH A;  4GX1 A;  2AHZ A;  1NI8 A;  3FB5 C;  5F2V O;  1M1K Q;  5GW7 A;  1Q3E A;  1OMI A;  4O4I A;  2ZIM A;  3IC9 A;  1N36 B;  1FZA A;  1YVW A;  1E5W A;  5CCG A;  1LJ2 A;  3JD1 A;  4DW1 A;  1FXK B;  3TGU E;  3MD0 A;  1N7L A;  1IDS A;  1S5L Z;  2LP7 A;  2FML A;  1GL2 C;  3ZIA G;  1N7S C;  4KJM A;  2Z5I A;  4N6J A;  2DQ0 A;  2BTQ A;  2QWO B;  2WSF J;  1X9V A;  3BVO A;  4FLX A;  2K9Y A;  2C9N Y;  4YJ2 A;  2O57 A;  1ORQ C;  4XDJ A;  3I55 V;  4I55 B;  1X79 B;  3H1K H;  1FD9 A;  4CBC A;  2HFE D;  1S9K E;  2I1J A;  2ZXE B;  1K4C C;  3P7K A;  1M7L A;  2WLM A;  3HKB B;  1GM9 A;  3CCM P;  1LT1 A;  4UB6 E;  2ZT9 D;  3AK1 A;  5K1X A;  2POH A;  3H9V A;  3HTK B;  1ZTE A;  2H3O A;  2UUC B;  3CCQ P;  2O01 J;  4HBN A;  3CS5 A;  2JDI H;  4JI4 O;  5LYJ A;  1R3J C;  2FYU K;  3W68 A;  3IC7 A;  5E79 Z;  3ABU A;  4ZIB A;  4IHJ B;  3CCE V;  1N73 A;  3OEE G;  4XFJ A;  4PJ0 Z;  1M90 W;  5TJH A;  4W7Z A;  1SQX K;  3CX5 E;  5B1B B;  1T2K C;  1T5E A;  2HOD B;  4X20 B;  3QNE A;  4PHZ A;  5KMG A;  2A45 H;  3SPC A;  3U10 A;  3AE2 C;  1Q86 W;  3H1J G;  2ZAE B;  1US6 A;  3AE6 C;  2LXC B;  3KXD A;  3SGI A;  1JNM A;  1COW G;  1N8R Q;  5LBQ A;  2ZE8 A;  2GA1 A;  3G67 A;  4W4L A;  1RE3 C;  1XNQ O;  1PPJ E;  5KAI E;  2Q9L A;  3CCS V;  3ABL B;  3L75 J;  4QJF B;  3F89 A;  1S76 D;  3ABK B;  3KPE A;  1BCC J;  1OZH A;  2OWO A;  3H25 A;  3RYF B;  1PKX A;  1HNZ O;  4U3F H;  1P7B A;  3L36 A;  1SQQ J;  2NPS B;  3T4Z A;  2YXR B;  4HJG H;  2P22 C;  3RGB A;  2Q9I A;  3H1I D;  3BRV B;  1WT6 A;  2N1T C;  4DR3 O;  5IYB O;  2Q6Q A;  3OGC C;  5C93 A;  1DGS A;  2A79 B;  5L3D A;  3M99 B;  1BE3 E;  3HKE A;  3SPJ A;  1KOR A;  4ABM A;  2W6A A;  2PYL A;  1W2E A;  3AED C;  1URQ D;  3H1K G;  1XL6 A;  2HR3 A;  2HKO A;  1LNQ A;  4PA7 A;  5AVY B;  1DF5 A;  1VQK P;  3QG5 A;  3SDL A;  5CJ0 A;  4PI0 A;  5IE9 A;  1ZX3 A;  2P67 A;  5ITZ B;  2E74 C;  2IJH A;  3OA7 A;  2JDI G;  2M0B A;  3OAK A;  2DN9 A;  1IFN A;  4I0X B;  3TJT A;  4FLU A;  1PP9 G;  2P1J A;  1M57 B;  2O01 N;  2WQY C;  3VP9 A;  1Q8I A;  2JGD B;  1VF6 A;  2XOK G;  4JI0 O;  4FLV A;  4LC1 A;  2KNC A;  3W67 A;  1AP6 A;  3RYC B;  3D36 C;  3CP1 A;  4IYI A;  1NTK G;  1RF1 C;  2QKA A;  2XUM A;  3T97 A;  4LF9 O;  1K8A Q;  1IUR A;  3ZMS A;  1NR1 A;  1AQT A;  4Y28 J;  1AR1 B;  1I94 B;  1YHQ P;  1K7D A;  2YDE A;  4TSF G;  4X65 B;  4D7S A;  3GHG B;  4LWS A;  1CW5 A;  5IYD O;  3RL0 B;  1ZLZ A;  2HPC A;  3F5W C;  5H2F Z;  2QG4 A;  1BSM A;  2JR8 A;  4NPE A;  1FU1 A;  3UO3 A;  2YIU C;  4JAU A;  1XNR B;  3VP8 A;  5JWP A;  1RY3 A;  1ZR2 A;  1M93 A;  3H1H H;  4ZI7 A;  2JEE A;  4NPF X;  3NXS A;  3W7S A;  4JI3 O;  4ZOL A;  2ZQM A;  4LFB O;  3QF7 A;  1VQ5 V;  3HE4 B;  4ZKU A;  3B2E E;  1BCC E;  4JF3 A;  2E5L O;  2XAS A;  3OTF A;  3CD6 P;  2E5Y A;  5KX5 B;  1ZL8 A;  3FAV A;  4WFH A;  1W5C E;  2YO2 A;  3G71 V;  1CXZ B;  1FFT B;  2B5U A;  4O2A B;  1S77 D;  3LSU A;  1F4N A;  1WMK A;  3EFF K;  1PL0 A;  2XND H;  3U0Z A;  3HE5 A;  2WT7 A;  1H8H G;  1QVF O;  1LTA C;  3I55 P;  2CPB A;  3VOU A;  4PA3 A;  1FJK A;  3L74 H;  4ZHQ B;  3N2K B;  1R6T A;  3ICX A;  4B3M O;  1Z56 A;  1LTJ A;  2AXT Z;  4FZ0 A;  1OW6 A;  3OR6 C;  2OYO A;  2R5B A;  3K79 A;  2PFX A;  4LF5 B;  4I9Q A;  4RUF A;  4OPH A;  4X8A A;  2IBZ H;  1ROP A;  4U7O A;  2VRZ A;  2AZ0 A;  2OCC C;  2HG5 C;  1YSC A;  2ZVO B;  4UB8 H;  3CCE P;  4J80 A;  2W6J H;  3QO5 A;  2GTS A;  3ZMZ A;  2HP8 A;  4L87 A;  1IZ3 A;  5B66 H;  3AE1 C;  3H1J J;  4I9W A;  1M1K W;  3B8E B;  1TUE B;  2UUB O;  1JEK A;  1FZG A;  2HVK C;  3BCC D;  3THO A;  1YJN V;  3CWB D;  1G1X B;  3IF4 A;  1N7S B;  1H2K A;  1FFX B;  3DTU B;  4X1Y B;  2ZIO A;  1TVK B;  2PYJ A;  2AEM A;  4O4L A;  3CCS P;  1IZN B;  2R3S A;  3AEF C;  5CMZ A;  5DM6 V;  3CXH I;  3FWL A;  3FB6 C;  2CK3 H;  4I50 A;  2WLK A;  1KU9 A;  3Q5S A;  1N4C A;  1U57 A;  3B5N C;  3H1I G;  2B9Z A;  5CCG D;  5JH7 B;  2MKV A;  3P8C D;  3KCY A;  1SF9 A;  3HUS A;  4NYK A;  1ENV A;  2EIN C;  5EZY A;  3LID A;  1S5L E;  3MDS A;  1HVV A;  2L35 A;  1GAX A;  5KAF H;  4JI1 B;  3K5M A;  3H1K J;  1H0T A;  3M0D C;  3AE3 C;  3T2M A;  1BS3 A;  4EB6 A;  2QKC A;  3RYI B;  3KQG A;  3K5N A;  1GRJ A;  2ZVN B;  2RN9 A;  3Q3D A;  2ZXW C;  4EIJ A;  4KHX A;  2XAJ A;  5KKZ B;  2PRR A;  1FZF A;  1KIL A;  1EDL A;  1PP9 J;  3L35 A;  5AW4 B;  1QQC A;  3V2N A;  1KEC A;  3OD4 A;  4AQR D;  3HKD B;  3HB3 B;  3ZMT A;  2K88 A;  2ZD9 A;  3UQ8 A;  4DR5 O;  3HR0 A;  5C8Y B;  1NTK J;  1QR8 A;  1QVF U;  2A3Q A;  1MZF A;  2F4V O;  1OCO C;  4K8Z A;  2QJP C;  4LF8 B;  1DD3 A;  1A32 A;  4EFE A;  1WRG A;  1R3L C;  3H1L H;  1ZR4 A;  2EIJ C;  1JY2 P;  5GTH E;  5CJ4 A;  2IU3 A;  4C7R A;  2WPV B;  3LNM B;  4JAV A;  2N1T B;  4IYH A;  2KB1 A;  1N33 O;  2YKP A;  1BGY D;  3AG4 C;  1DLB A;  3H1J E;  3JAT B;  2CH7 A;  3E1R A;  2PUS A;  4UVB A;  3J80 N;  2IU0 A;  2W8Z A;  2CK3 G;  5GON B;  4NXM O;  2ILM A;  3IJ4 A;  4F6R A;  4XBF A;  3SYC A;  2N9Y B;  4C7U A;  3TGU H;  4JTC B;  3N4X A;  3AEE C;  5DJU B;  3A0B Z;  3RGU A;  1Y74 A;  1K3E A;  3N2G A;  5DED A;  2K1A A;  1XL4 A;  3CCR P;  4MT8 A;  4X9Q A;  1TGO A;  2XDJ A;  1PGP A;  1OCZ C;  2QE7 H;  2R9R B;  2YIB A;  1KKD A;  2NNU A;  3G71 P;  1ZP0 C;  1LP1 B;  4OGQ C;  1G6U A;  1JCC A;  2QKS A;  3QTC A;  4UB6 H;  1FPO A;  1RF1 B;  2ZM6 O;  1KYO I;  2ITD C;  1VF5 D;  4BW5 A;  4C46 A;  1PV3 A;  1DH3 A;  1H2M A;  1M1J C;  1AI7 A;  2K3R A;  2UU9 B;  4K0K O;  1NTZ D;  3AG3 C;  3L72 D;  3SWY A;  2FFD C;  2K9J B;  5BR8 O;  1L1F A;  5APS A;  2M5A B;  3CX5 H;  2JGD A;  1YTF D;  2WA4 A;  5IWA B;  1H2G A;  4O2B A;  2KSE A;  3L71 D;  2CPS A;  5APV A;  1PP9 E;  3RYC A;  2B87 A;  2FBW C;  3VQY A;  1MA1 A;  3S1K A;  1SQV D;  2E43 A;  4LH7 A;  4CPG A;  4Q20 A;  4JYA B;  2Y9Z A;  1JO5 A;  1RHZ B;  1LT9 A;  3JD3 A;  1RM1 C;  1TAE A;  2C2A A;  5IJ9 B;  1PPJ H;  4DUZ O;  5KAI H;  3CCU V;  3IR9 A;  4EFB A;  1NTK E;  4OX9 B;  3UT5 B;  5KLV D;  3BCC G;  2ZYG A;  2RMZ A;  4O4H B;  3V5B A;  2X0L A;  1GU4 A;  5KA5 A;  5EC1 C;  1YJN P;  3EXA A;  2EIL C;  3QO7 A;  5KHK A;  1W2B O;  3CME V;  3TDK A;  3BY6 A;  1FZE A;  1OVR A;  1U7J A;  3ASO C;  2EIK C;  2YMK A;  3ZRS A;  1LWU A;  1GK9 A;  4OPA A;  2XHB A;  2G8Y A;  1BE3 H;  3G3Z A;  5AVT B;  2QE7 G;  1NHL A;  4WY4 D;  4UV9 A;  3MGN A;  2WSS H;  2XAQ A;  3E22 A;  1HH0 A;  1YZB A;  3ITK A;  2XU6 A;  2LR2 A;  4HKZ H;  2DMX A;  2DQ3 A;  1VQ6 V;  4NTW A;  2P5O A;  4JV5 B;  3O65 A;  2K9P A;  1W0K G;  4FFK A;  3PP5 A;  3VN0 A;  4WFB V;  1VQ7 V;  1QR9 A;  3L74 J;  1SET A;  2D3O W;  2ADP A;  2J59 M;  3JAL A;  3WUV A;  4X66 B;  2YEV A;  1FXK C;  2H8P C;  1EQ7 A;  1S72 V;  1Q6U A;  4YHH O;  2OYH C;  1RF0 C;  1BQ0 A;  2KG7 B;  1HJ0 A;  3F7V C;  2AXT E;  3CSX A;  3P32 A;  1S0V A;  3RK2 C;  2KXP B;  4JI7 B;  2QWR B;  4IL6 Z;  2O01 H;  3AE7 C;  4YXD C;  4PA4 A;  5LP6 A;  2DOS A;  2KKW A;  1Y4M A;  4KHP O;  4OWF A;  4YY3 B;  2CTR A;  4H13 C;  3D3Q A;  1CPY A;  3OTO O;  4WB4 A;  2ODM A;  2JK5 C;  2N74 A;  4NXN B;  4Z1M H;  1H2L A;  2WPR A;  2QJ1 A;  3TYY A;  5AVU B;  2RN0 A;  3ABT A;  3BHP A;  2P4K A;  3BAB A;  4JYY A;  1K9M Q;  1EZV I;  1M90 Q;  1IO4 A;  2EIN B;  2WVR A;  2G38 A;  3ZX6 A;  1BGY G;  1GL2 A;  5EIB D;  1NYH A;  1N7S A;  1KQF B;  1FFX A;  2MW2 B;  2FXP A;  2YXQ B;  2OYI C;  2QSA A;  4DR1 O;  1AJN A;  1TVK A;  5TIS Z;  4DV3 B;  1Q86 Q;  1KQG B;  3A0H E;  1BCC H;  3ETG A;  3AEB C;  1YI2 P;  1JCD A;  4IFM A;  2HYN A;  2OGU A;  3A8T A;  1BE3 G;  2JS5 A;  3ZRV A;  1IXB A;  1ZUQ A;  1OV9 A;  1N34 O;  1Y8A A;  3LDC A;  3WB0 A;  2UXD B;  2IPP A;  5LA6 B;  2CE4 A;  1AJQ A;  5CCH C;  3CE2 A;  3ABL C;  4WBN B;  2QR4 A;  2LO1 A;  2ZE7 A;  1HDJ A;  4RO0 A;  5CBG A;  5AW3 B;  1RE4 C;  3CRQ A;  4RQE A;  1W2B U;  2P6J A;  3H1I E;  4E2L A;  1YIJ P;  4JI6 O;  1CI6 B;  1X22 A;  1IBK O;  2QJP B;  5AVV B;  4W7Y A;  4XDL A;  3RYI A;  4TV8 A;  2EIJ B;  3CCQ V;  1DEB A;  3SYP A;  3CC7 V;  1NTZ G;  1M56 D;  3L72 G;  2ADQ B;  4R8C A;  2QWN B;  2KZJ A;  1KB9 F;  4PEL A;  1VF5 B;  3WG7 B;  4DV1 O;  1Q90 D;  1RE3 A;  2F23 A;  1S2E A;  1SQG A;  2LXB A;  2QM8 A;  3RYH B;  4Z1M G;  5C8Y A;  1AR5 A;  2R9I A;  1RH5 B;  1SFC C;  1RSO B;  3FD9 A;  1GN2 A;  4I5S A;  2Y69 B;  1QLE D;  2Q7G A;  1SQV G;  3E1I A;  3K5L A;  4X1K A;  1JMB A;  1IFJ A;  3USS A;  3E8F A;  2KS1 A;  4OH8 B;  2DYS B;  2N1T A;  3JAW A;  3PN1 A;  4CC5 A;  1DTO A;  4JI4 B;  3C8V A;  2F95 B;  4FLZ A;  1GH6 A;  5KLV G;  1KP2 A;  1NTM D;  2X6C A;  4UV8 A;  1GD2 E;  4BIU A;  1YYC A;  1Y6X A;  1DK1 A;  5KHJ A;  5LMU B;  1IJD B;  2PGD A;  1NJI Q;  1OXZ A;  1URF A;  5LGT A;  3CC2 V;  3CC4 V;  3OMI B;  4J11 A;  1IBM O;  1NQT A;  4MTX A;  5JCO C;  3GHG C;  3H32 B;  3TF5 A;  2C0W A;  4N21 A;  3A0B E;  2WA3 A;  1S5L H;  3RL0 C;  1EC5 A;  5CA0 B;  3AEG C;  4QPK A;  3HD7 A;  3M0A A;  1XRE A;  1XNQ B;  3SR2 C;  4DT0 A;  2IFN A;  3ZRW B;  2HHH O;  3DXR A;  2IJK A;  5LOV A;  1LP1 A;  2B1I A;  3JAK A;  2YIA A;  1Q81 W;  4X64 O;  2JIZ G;  1B04 A;  2HLD G;  1HNZ B;  4O4J B;  3D36 A;  4WY4 B;  3WFV A;  1VQ7 P;  4C7N B;  1SER A;  2BAS A;  3KDP B;  4FLT A;  1ARO P;  1X8Y A;  1DF4 A;  4QMA A;  1RM1 B;  5L3B A;  4RAI A;  4XA4 A;  5C39 A;  4LGD E;  1IK9 A;  1HGZ A;  3LSS A;  3K9S A;  4GKJ O;  3ZRX A;  1SC5 B;  2X7R B;  5IYC O;  4UCR A;  5FLX N;  3AEC C;  2QWQ B;  3B40 A;  4WF9 V;  2W83 C;  3Q5P A;  2YID A;  2EIL B;  3OAA G;  3F7Y C;  4M3L A;  4L8J A;  5GTH H;  3ZHS A;  1YHQ V;  4LNU B;  1RQV A;  3R4Y A;  4F4L A;  1SQB G;  1X59 A;  3CRC A;  4RKU J;  2Q68 A;  2IH1 C;  4U3J B;  4D7T A;  3JAS B;  2ZCE A;  1EN4 A;  4DV6 O;  3H1J H;  2X6A A;  2J5U A;  1L0L D;  1KTM A;  4JI2 O;  2HFE C;  1PIX A;  1MSD A;  4GCZ A;  1RPO A;  3D6Y A;  1RQU A;  1BGY J;  2O1J A;  1F7Y A;  4FFB B;  2ZT9 C;  4LF4 O;  5IY5 C;  3SPG A;  4LF9 B;  2KYV A;  1P4R A;  3BCC E;  1VQN P;  1WPX A;  5CMU A;  1PFI A;  4HYO A;  1BE3 J;  3MUD C;  4LF7 O;  3CD6 V;  1OJH A;  1KB9 D;  3MTU E;  4WFE A;  4BAY A;  2N04 A;  1MZE A;  3OUF A;  5H6R A;  5KUM A;  4NTY A;  1XTC C;  3ZED A;  2OYH B;  1WAZ A;  2WLI A;  4U7J A;  4JZG A;  1N0N A;  3RK2 B;  2R9A A;  2IJJ A;  1AI6 A;  2CTQ A;  4PD4 F;  2GTA A;  2FY8 A;  2ZKO A;  2KUB A;  1MKM A;  3ZS8 C;  2C0X A;  4DW0 A;  1BQZ A;  3P8C E;  4JI3 B;  4H13 B;  4CS4 A;  2EBO A;  4LFB B;  1KFM A;  3M8A A;  3AEA C;  4TLF A;  3SWK A;  4KL1 A;  3FX0 A;  2ZE6 A;  2E5L B;  3U1C A;  1ZSP A;  3K0G A;  2Z5U A;  4Y99 C;  2AHY A;  4PD4 I;  3L72 J;  5KJ7 A;  2IBZ I;  3CC7 P;  2KG7 A;  2GUS A;  2PGG A;  1PP9 H;  4MW3 A;  4GKK O;  2YXY A;  4IL6 E;  4DZO A;  4MW8 A;  1SQP D;  1SRY A;  5JVD A;  1K9M W;  1FJP A;  1HF9 A;  2OYI B;  1WA8 B;  1MOF A;  1P84 F;  3AE5 C;  1B3Q A;  4JAS A;  1JA8 A;  1WP8 A;  3AG7 A;  1NTK H;  3R2P A;  1Y76 A;  1FOS F;  1FJG O;  3EHB B;  1XMO O;  4H0L D;  2CDY A;  4B3M B;  5KKZ C;  4KT0 J;  1Y66 A;  3DC6 A;  1AVO A;  5AG2 A;  2W90 A;  1IFI A;  1H8E G;  4TUY B;  1FDO A;  3JCU E;  2EIM C;  1R73 A;  1NU1 D;  2YI9 A;  1TU3 F;  4RJT A;  5CBN A;  3B5N A;  1UPG A;  1QBZ A;  5KLV J;  1ZV8 A;  1F23 A;  1P84 I;  3FWN A;  1K73 Q;  1NTM G;  1QLE B;  2LKM A;  3QO8 A;  5B3S B;  1N2D C;  4FM0 A;  5APW A;  5APX A;  1L4A D;  3U59 A;  5TIS E;  2VQE B;  2GBO A;  3Q4H B;  3N7N A;  5IJ0 A;  1VQP V;  1BGY E;  3CC2 P;  1GN6 A;  3CC4 P;  2UUB B;  5FPO A;  1AFO A;  4QE9 A;  1A02 J;  3CMA V;  1IBL O;  1NKD A;  1JY2 O;  4DJG A;  2Y0I A;  3VTP C;  2OQQ A;  4WBN A;  4LH6 A;  5AVS B;  3OEH G;  5DN6 G;  2QJY C;  3C9I A;  4H33 A;  3OR7 C;  2Y0D A;  4UCU A;  2HLO A;  1SFC B;  2GM4 A;  1JOY A;  2AXT H;  5BY1 A;  1VF7 A;  2BSK A;  1YEW A;  1QL2 A;  4QIW F;  1ZOY C;  1KD1 Q;  5LMN B;  3UCS C;  2YKQ A;  1JTH B;  2V4D A;  2CGO A;  5CA3 A;  1K5Q A;  1PV0 A;  4CH4 A;  3M9Q A;  3G9R A;  2Q6A A;  3EFG A;  1TUB A;  1XQ8 A;  3HKC B;  3M7M X;  2QEX V;  1GW3 A;  1P49 A;  1NAF A;  2UXC O;  2EZP A;  4RWU A;  2EX3 A;  1SP4 A;  2I8D A;  1FZC B;  1EDJ A;  1HBW A;  3CI9 A;  1WB7 A;  3JAR A;  3SSU A;  2JVD A;  4LF6 O;  2R70 A;  1VIB A;  1NTZ E;  2KP8 A;  3L72 E;  1NWQ A;  2E75 D;  3JSL A;  3CJH B;  4Z2W A;  1L0N D;  1SQB J;  1OCC C;  4PD4 D;  1VQL V;  1NJI W;  4GT1 A;  2NR5 A;  3L71 E;  3FYI B;  2XAG A;  4L76 A;  1GTW A;  2WLL B;  2AW9 A;  3K08 A;  4LP8 A;  3RWR D;  2PAJ A;  1G8M A;  2KLU A;  4TQD A;  1SQV E;  1L0L G;  3A0H H;  2RH0 A;  5LHI A;  1YJW V;  4DR5 B;  3DGE A;  4TV9 B;  3OGI B;  3JYC A;  1NVP B;  2F4V B;  4WFF A;  4DV4 O;  1S5H C;  5EYP A;  1Y9B A;  5APY A;  3KKY A;  5KLV E;  3CCR V;  3WB2 A;  2YNY A;  2UXB O;  3BPZ A;  4D6T D;  5EBM C;  3VBB A;  1JMM A;  4DRX A;  5B5E Z;  3H32 A;  1TA8 A;  1M1J A;  4DK1 A;  1P84 D;  3B4S A;  2QWP B;  4HNA B;  3H1I H;  5CA0 A;  1E79 G;  1N33 B;  3HD7 D;  1QNM A;  4YXW G;  4K35 A;  3GMA A;  2KIK A;  2FFD A;  3OMA B;  1PNL A;  2GUZ B;  4NXM B;  2L91 A;  2DJV A;  1AVY A;  2QM4 A;  1GU5 A;  5JJE B;  1MG1 A;  4HB1 A;  4G27 B;  3K0D A;  1DIP A;  1XMQ O;  2FKW B;  1CEZ A;  5J2T B;  3OFN G;  3K04 A;  1NTK K;  5H5N A;  2F66 C;  5CB4 B;  3WB1 A;  1NO4 A;  2VQF O;  3IFM A;  1AI4 A;  3OMN B;  3U11 A;  1JFF A;  1BHB A;  3CX5 I;  1UFI A;  3J7A U;  1MUU A;  1D5A A;  1SQP G;  3L73 D;  2ZT9 B;  3CYO A;  1SZX A;  2BCC D;  5CCG C;  5IY5 B;  2ZM6 B;  1MV8 A;  4TQF A;  5CBF A;  3CXH F;  1XOU A;  5KHH A;  3ZHT A;  5CN0 A;  5JJN B;  3IAY A;  1Q82 Q;  5JQG B;  3BRC A;  4K0K B;  4U3J A;  1HR0 O;  2WTY A;  2D2C D;  4P9O A;  2ZR2 A;  5BR8 B;  2JJ1 G;  4MSW C;  1SQB E;  4EDF A;  2B1G A;  3VQX A;  1I5X A;  4H0L B;  2W6I G;  3CCV V;  3JSV C;  3CXC U;  4YTP C;  2ETN A;  3A0B H;  3A0R A;  4FM1 A;  1OVV A;  3PH0 A;  5AW1 B;  4DUZ B;  4I4T B;  4JZ2 A;  1H38 A;  1VQP P;  3OJA B;  5EK0 A;  3OM3 B;  1IK7 A;  4DUY O;  1FXK A;  4Y99 B;  4DK0 A;  1GMJ A;  2OT5 A;  2BEQ D;  4FLY A;  2K37 A;  4QE7 A;  2W0X A;  1RF0 A;  1AQ5 A;  1EN6 A;  2HJD A;  3CMA P;  1L4A B;  2QJK B;  3BAT A;  1BDC A;  5IYZ B;  4FVM A;  5A2Q N;  4N78 D;  4NB5 A;  4I55 A;  4P30 A;  2Q1K A;  4B3R O;  3RL0 g;  1AR4 A;  3MP7 B;  3HKB A;  2R3C A;  1KKC A;  4BR6 A;  3SPH A;  1YJ9 V;  3STZ C;  3CCJ V;  1URQ B;  3AE8 C;  3HTK A;  2EIM B;  3UKM A;  1MAB G;  2Q7E A;  5KJ7 D;  5AVQ B;  5KLI C;  3D71 A;  1PM9 A;  5M1B A;  4DV0 O;  5FNV B;  4UCT A;  5E79 E;  2QEX P;  4IHJ A;  3QVN A;  1J5E O;  2IZ1 A;  1GW4 A;  1WA8 A;  3UM7 A;  1K73 W;  3PJS K;  4PJ0 E;  1I94 O;  2BOC C;  2HOD A;  4X20 A;  4J9Y B;  3RT3 C;  1L0N G;  5IT9 N;  1JM0 A;  5AW2 B;  3VMA A;  3C3T A;  2XV5 A;  4YHH B;  1VQL P;  5EBL C;  1S5J A;  2G3A A;  3A2F A;  3WG7 C;  1AIL A;  1L0L J;  1VF5 C;  3QH9 A;  3H6P A;  4PV1 D;  5CCH A;  3BCC H;  2Y4T A;  5GTI Z;  3L70 D;  1OZ0 A;  1YI2 V;  1ZN5 A;  2QJY B;  4KHP B;  1YJW P;  1RE4 A;  2MJZ A;  1LTG C;  4UB8 Z;  1EN5 A;  1GTO A;  2Y69 C;  3OTO B;  3RYF A;  2PI4 A;  3EWK A;  1Q2N A;  2A06 D;  2NPS A;  1KYO F;  3G6E V;  1NTM E;  5B66 Z;  5EC2 C;  1SKV A;  2DYS C;  4Q6G A;  2JJL A;  2KI7 B;  3II6 A;  3K3W A;  2YMY A;  4D6T G;  3T1H B;  2V7Q G;  2QM7 A;  2M7W A;  3SJQ C;  3SJC C;  2DE0 X;  3CXH D;  3FB7 C;  3VQV A;  1KD1 W;  1S3J A;  5AVZ B;  4NKG B;  1YIJ V;  1NH4 A;  1Q7Y Q;  1EXJ A;  4DR1 B;  1CSB A;  2FYN C;  4J41 A;  3HRN A;  3AK2 A;  5APU A;  1YTZ I;  4GYC B;  1PD3 A;  2WLN A;  3M9H A;  4R6Z A;  3ABV C;  2JP3 A;  1SA0 B;  3MHV A;  3O6Q B;  4FLW A;  1OCC B;  1SFC A;  3W7T A;  3K9A A;  1IFD A;  2M6Y A;  2WLH A;  1N34 B;  2QRX A;  5ITZ A;  4IL6 H;  3P3N A;  2JS3 A;  3EQ2 A;  1ZRT D;  4XDK A;  4I0X A;  1Q81 Q;  2ZE5 A;  4BIZ A;  4NVP A;  5KAF Z;  2B88 A;  3ZCC A;  1SQP J;  1UII A;  1AJP A;  1D5N A;  3ZHQ A;  3L73 G;  4WY4 C;  1IBK B;  2BCC G;  3R66 A;  1R6K A;  3RN4 A;  3JCU H;  3CJH A;  1JY3 O;  2WIT A;  2ZIN A;  1NKZ B;  3KHU A;  1R3I C;  5CA1 B;  3GHG A;  2CGN A;  5JCO A;  2UUA B;  3CPW O;  3KYQ A;  4BWN A;  5H2F E;  1N32 O;  2NZ2 A;  4DV1 B;  3JSN A;  4IIJ B;  3CWB G;  5TIS H;  1QVG O;  3W7X A;  4FZ1 A;  3ETE A;  3RW0 A;  1BGY H;  1LUV A;  4LFA O;  1KZU B;  2RCV A;  2N05 A;  3F5T A;  3CCV P;  1RPR A;  1L0L E;  1YQ3 C;  3GWO A;  4J10 A;  4WCE V;  3FX7 A;  1K34 A;  3RK3 D;  4WFG A;  3HE4 A;  3H1I J;  2Q5U A;  4RO2 A;  3LDE A;  2JJ2 G;  4X1I B;  4YJ3 B;  3L75 D;  5B5E E;  2JEU A;  1EXI A;  5KX5 A;  4O9B A;  2ZNI A;  4O2A A;  2DYR C;  1KB9 E;  4O4I B;  1S1C X;  1E1Q G;  4HZ3 A;  1SQQ D;  2IH3 C;  2R5D A;  4ASU G;  4MVR A;  5KA6 A;  1AA0 A;  4UCS A;  4DR2 B;  3SYQ A;  1FDI A;  1IBM B;  2AZ2 A;  4ZHQ A;  1F4M A;  3N2K A;  5J2T A;  1SS1 A;  5BZB A;  2BTQ B;  4EEQ A;  4YJ2 B;  2J58 A;  1YJ9 P;  1NTZ H;  3CCJ P;  1NGM B;  2HHH B;  1ZME C;  3L72 H;  1Q82 W;  4CC6 A;  3A5T A;  4ZNC A;  1KYO D;  2L5G B;  4J7K A;  1GM7 A;  1ZAU A;  1H2N A;  3T4D A;  2GUV A;  1YXB A;  3L71 H;  1EBO A;  3C1L A;  5J2U B;  3RBZ A;  3LNN A;  3HUS C;  3MHH C;  1L0N J;  2QSI A;  4H44 D;  4P9P A;  4PA9 A;  1SQV H;  1SQP E;  1FYJ A;  4RQF A;  1EDK A;  1SLQ A;  2CTW A;  2Y48 A;  4KUM A;  4KXR A;  5LYJ B;  4DCK A;  4R50 A;  1R3K C;  4GZR B;  2JKV A;  2ATK C;  2E76 D;  4GKJ B;  2ITC C;  5BU5 A;  1GN3 A;  4K8X A;  4NTX A;  2GV9 A;  1YBK A;  5KLV H;  4X1Y A;  1KQS O;  4J7J A;  3L70 G;  1MNG A;  5FPR A;  5KMG B;  1VQN V;  5LGU A;  3WUU A;  2OTK E;  3K5O A;  1NU1 E;  4GOD A;  1M56 C;  2FYU D;  4GX5 A;  3TXS A;  5L3C A;  1BDD A;  1KP3 A;  2NLJ C;  1OW7 A;  2A06 G;  4PV1 B;  5KAI Z;  1SQX D;  4ZKI A;  3G6E P;  3CPW U;  4DV6 B;  4D6T J;  2RNB A;  4I4T A;  1H89 A;  1Z5W A;  2YXL A;  5JH7 A;  3TSI A;  2V7Q J;  1JMK C;  4JI2 B;  1FC2 C;  1QLE C;  3T1C A;  1QVG U;  4L73 A;  5KLI B;  5B3S C;  3G80 A;  5FL7 G;  4QGP A;  1NAY A;  4LF4 B;  2OTL V;  1CP9 A;  4X89 A;  4OVN F;  1XDC A;  5E1A C;  1IXM A;  4DR4 O;  3F5H A;  1GM8 A;  1WP7 A;  4EYY Q;  2OIG A;  4LF7 B;  1VEW A;  1NVO A;  3K06 A;  3X2Q B;  1NS1 A;  4MS2 A;  3ZMV A;  1I0H A;  1FXH A;  1KIL D;  2XNX A;  2P7J A;  5K1P A;  3M06 A;  1D2D A;  4H37 A;  4PA6 A;  3HKD A;  2BEZ F;  3W7U A;  3MZW B;  3L71 G;  1NH2 D;  4ZKP A;  1K97 A;  3L73 J;  4PI2 A;  3A2A A;  2BCC J;  2A45 I;  5A9G A;  3NFQ A;  4YPC A;  5BU8 B;  1SQB H;  3JCZ A;  1RFY A;  1YTF B;  1T6A A;  2KNC B;  3BCC J;  5HFM A;  3RFR A;  3ZBH A;  1I7F A;  4GKK B;  4GX2 A;  1L0N E;  3CWB J;  1FZC C;  1R6N A;  5H9C A;  3T97 B;  4PD4 E;  4DV5 O;  1NR7 A;  3JAT A;  5GTI E;  1JOC A;  4GUN A;  2FYN B;  5DJT B;  5GON A;  1U7M A;  2O1K A;  3CCL P;  1Q7Y W;  3LDD A;  4YIO A;  1FJG B;  4PDM A;  1XMO B;  5CBO A;  2Z5H A;  2HPC B;  1EZV D;  3M9B A;  3APO A;  3ZHR A;  4KFM A;  2NPS D;  2R32 A;  1V55 C;  4UUJ C;  1YTZ T;  3T1Y O;  4R4L A;  3L75 G;  4ZI7 B;  5KUK A;  3NTN A;  4FJC C;  1KN7 A;  3D3I A;  2YIB D;  1QLN A;  4ZOL B;  2JEX A;  3I56 V;  4FM2 A;  3E86 A;  1JY3 P;  1NTZ K;  4D6T E;  5KTB A;  1R1B A;  2H7H A;  3RK3 B;  4L75 A;  2OCH A;  4GLX A;  2EJR A;  1P84 E;  1PNK A;  1SQQ G;  2AGA A;  2W0F C;  3B09 A;  1RF1 A;  4BRY B;  4DV2 O;  1PGO A;  4UVA A;  1FOS E;  2WSC J;  2AEF A;  1ZL8 B;  1JQ0 A;  1FBM A;  4J7Z A;  4DR3 B;  5KHG A;  4JI7 O;  1IBL B;  1HNW O;  5E79 H;  2JRI A;  1SQV K;  4JYC A;  2K9J A;  3H1K D;  1VQ4 V;  3HE5 B;  2WT7 B;  3Q5R A;  4PJ0 H;  4LLH A;  1M57 D;  2M5A A;  2FTK A;  5APQ A;  4CZZ A;  2B89 A;  5KLV K;  1YIT V;  1LTJ B;  1EFR G;  1LGH B;  1F51 A;  4TT3 G;  1VMG A;  1S5L X;  4DYL A;  4DOJ A;  3LW5 J;  5IJ9 A;  1B06 A;  3L73 E;  1NKN A;  2A9H A;  1GDT A;  2BCC E;  4NPD A;  5CA1 A;  3ZJZ A;  2XKM A;  3UT5 A;  4JI0 B;  3WMM 0;  3AE9 C;  2UXC B;  4W80 A;  4O4H A;  3TXQ A;  1QEX A;  3C90 A;  2DYR B;  4DV3 O;  2W6B A;  1AJY A;  3E35 A;  1YF2 A;  2Q67 A;  4LF6 B;  1NTM H;  3NR7 A;  3ETD A;  3DSQ A;  3CWB E;  2Q0A A;  2FYU G;  2E76 B;  1EZJ A;  4R7C A;  2WAM A;  1U96 A;  3CRM A;  2P58 A;  4LCU C;  2AXC A;  1PZQ A;  4B3T O;  1SQX G;  1XBL A;  5LP6 C;  4O4L B;  1XUQ A;  2Z3Y A;  2JGU A;  1HTL C;  2RKL A;  4U3F D;  4MVO A;  4YIP A;  4H0L C;  2WSE J;  4I50 B;  4DO2 A;  3OE7 G;  2Z4E A;  4DV4 B;  4A5U B;  4B3S O;  1K05 A;  2OTL P;  2Q3I A;  3JD4 A;  2UXN A;  2YXH A;  3HUS B;  3VMZ A;  1WJZ A;  2UXB B;  4DR7 O;  4AI8 A;  2ZNJ A;  5EZY B;  3VMX A;  3ZN1 A;  1NTZ J;  1X0T A;  1M9N A;  4N78 E;  5K5G B;  1SQB K;  1L4A C;  2YS8 A;  2QJK C;  1WN7 A;  1H0T B;  1HNX O;  4EB6 B;  2QIW A;  3L71 J;  2EJ7 A;  4DR6 O;  3K59 A;  3FB8 C;  1K4D C;  3KZI Z;  1VQO V;  3SFE C;  1OFC X;  3AK3 A;  3ETQ A;  1SQV J;  1M56 B;  3KCX A;  1XMQ B;  4AYC A;  4CS2 A;  4W4K A;  2YIC A;  1KIL B;  5J2U A;  2M3E A;  3BAS A;  1J2J B;  4J42 A;  5H2F H;  3MHS C;  2LW7 A;  2WWW A;  1URQ C;  4LFC O;  2VQF B;  1PGQ A;  2QTO A;  1IFM A;  2KQX A;  3VYI A;  2ZDI C;  1NH2 B;  1YQ4 C;  1MSW D;  1QHT A;  1HW7 A;  3SFD C;  3TET A;  5B1N A;  3MAQ A;  1L0L H;  1JVM A;  3ABM C;  2PY5 A;  1GL2 D;  5LMU O;  5DEC A;  1N7S D;  2DW4 A;  2OYQ A;  3ZDM A;  5GTH Z;  2H43 A;  3GVM A;  3M0D A;  1J1E B;  4NR1 A;  5B5E H;  4JI8 O;  3CHX A;  3L70 E;  1R5L A;  1GK4 A;  2IFM A;  3E8B A;  1EZV G;  2VWJ A;  1HR0 B;  4RUE A;  3H1H D;  3R65 A;  2LGW A;  5L3F A;  1KB9 H;  3UO2 A;  1V54 C;  2CH7 B;  5LA6 A;  3WU2 Z;  4CH5 A;  4EKW A;  2E75 C;  1PL5 A;  3B77 A;  4F6R B;  1E79 H;  2A06 E;  4YXW H;  1YDX A;  2GSM B;  3OW2 O;  2A0L A;  5JJJ B;  4DV7 O;  4X62 O;  3I56 P;  1OX3 A;  1Y74 B;  4CH6 A;  2JWD A;  3N2G B;  1CI6 A;  4B7K A;  1CZQ A;  3ZN0 A;  3CXH E;  2CAZ C;  2Q69 A;  2KOG A;  5D5P A;  2GDS A;  1T2K D;  1WB8 A;  3GWK C;  4DUY B;  4JI5 O;  2IYP A;  2UXX A;  2EZO A;  2W27 A;  1IX9 A;  1H88 A;  4WVZ A;  2M3B A;  1EM1 A;  1OCR C;  1Z2G A;  4AQY O;  4GKG A;  3VMY A;  5AW5 B;  3L74 D;  1VQ4 P;  3EVK A;  1G1J A;  3G4S P;  1SQP H;  2ZR3 A;  4TOI A;  3RYH A;  1ZRT E;  2KLV A;  2M8R A;  4B3R B;  4MVU A;  2ZYA A;  1RSO A;  4UCO A;  1NTM K;  3HD7 C;  4N3Y B;  2QVA A;  1YIT P;  1HJB A;  2IBZ D;  1BSN A;  4JAA A;  1V55 B;  1OWA A;  2RMK B;  4O2B B;  1PGJ A;  3KG2 A;  2N1T D;  2XAF A;  1Q43 A;  2B87 B;  1AVM A;  1NU1 H;  1HP8 A;  2LGQ A;  4DV0 B;  1FZB A;  1KC8 Q;  3K03 A;  1VDF A;  2MK3 A;  4FIP C;  3LSQ A;  4BWA A;  2A45 G;  3JD2 A;  1J5E B;  1LT9 B;  1O9G A;  1N36 O;  2Y4U A;  1KMI Z;  1I08 A;  2YSU B;  2FYU J;  2YC0 A;  2FYZ A;  2JO1 A;  4AHC A;  3RVY A;  1JB0 J;  3BRT B;  2Q3E A;  1SQX J;  1IFP A;  3S3X A;  1G2C B;  2Z0A A;  2CUG A;  2E74 D;  1OW8 A;  3ZRW A;  2FKX A;  1K92 A;  4U3F G;  3CX5 F;  3RK3 E;  2P2U A;  4UCV A;  1LWU B;  1JY2 N;  4JF7 A;  5CBH A;  2D2C C;  1IVS A;  3L75 E;  1T8Z A;  5BXZ A;  1VAR A;  3RBX A;  2BOB C;  4O4J A;  4WY4 A;  3BFR A;  4BRY A;  4C7N A;  3E22 B;  2SPZ A;  1G4Y B;  2UUC O;  2F43 G;  2ITA A;  1E1R G;  1SQQ E;  2BTO A;  3D6Z A;  2NRG A;  5AW9 B;  4JBZ A;  3AE4 C;  1THZ A;  2V1D A;  3OW2 U;  5BVZ A;  1VQM V;  1HUC A;  1JJ2 U;  3BVH A;  1ZW0 A;  3JAM N;  3JAL B;  1WNS A;  4X88 A;  2YEV B;  1L0L K;  2Q5Z A;  1VQO P;  1JR9 A;  1VL2 A;  4LNU A;  3TNU B;  4CS3 A;  4EOT A;  4JPZ B;  1KYO E;  1JPX A;  1L0N H;  1DX7 A;  1P7G A;  3FFQ A;  1IC2 A;  4PD4 H;  3SWF A;  3JAS A;  3E89 A;  3B71 A;  3IAO A;  5GTI H;  1NU1 G;  3D8C A;  2Y9Y A;  5LP6 B;  5BMV B;  1NOH A;  1NTM J;  1XEQ A;  4P2Z A;  3SJB C;  3WUT A;  3H1L D; 
#chains in the Genus database with same CATH homology
 2WPV B;  4H13 B;  3AE2 C;  3RL0 g;  1AJY A;  3AE6 C;  4I7Z B;  3AEA C;  3C8V A;  4GDO A;  3AE8 C;  5L8R J;  2H89 C;  2E76 B;  3D70 A;  1Y9B A;  1YQ3 C;  1HJ0 A;  2BEZ F;  5KLI C;  1OW6 A;  4R4M A;  3D71 A;  5M1B A;  3H25 A;  1ZRT E;  1R8E A;  3AEE C;  3AE7 C;  4YXD C;  1UIX A;  1HF9 A;  1EXI A;  3AE5 C;  3AEG C;  4H0L C;  2WSE J;  4H13 C;  3GMA A;  4H0L D;  4I7Z C;  4Z1M H;  1K05 A;  1S1C X;  5KKZ C;  4KT0 J;  4H44 B;  4H13 D;  4PV1 C;  2P10 A;  1ZP0 C;  4OGQ C;  1FDO A;  2G3A A;  3AE1 C;  1VF5 C;  1FDI A;  1TU3 F;  1KOR A;  3GLM A;  4PV1 D;  3T97 B;  1DIP A;  3AED C;  4OGQ D;  2H88 C;  2D2C B;  2IDB A;  1VF5 D;  1KMI Z;  1PV3 A;  2QJK C;  4IL6 X;  1NYH A;  2JO1 A;  1KQF B;  1JB0 J;  2FXP A;  1ZME C;  1NGM B;  3S9O A;  3EWK A;  2QIW A;  1KQG B;  3Q1M A;  2E74 C;  3AEF C;  3AEB C;  3SFE C;  1KIL E;  2WQY C;  2E74 D;  3AEC C;  3GF3 A;  4R4L A;  4TT3 H;  4H44 C;  2ZT9 B;  3Q5P A;  1OW8 A;  1OMI A;  3Q5S A;  3RK3 E;  1U57 A;  4H44 D;  2QSI A;  2FBW C;  2MKV A;  1RQV A;  3R4Y A;  2E76 C;  1EXJ A;  2D2C C;  2OQQ A;  3IN6 A;  2E75 B;  2FYN C;  2QJY C;  1YQ4 C;  4RKU J;  2E76 D;  2D2C D;  4Y28 J;  1K04 A;  3SFD C;  2WSF J;  3ABV C;  2JP3 A;  2WSC J;  3Q2Y A;  2J5U A;  2K9Y A;  1KTM A;  3AE3 C;  1PIX A;  3D6Z A;  3D6Y A;  1RQU A;  4H0L B;  3FGA D;  3AE4 C;  1ZOY C;  2ZT9 C;  4YTP C;  2YIU C;  3Q3D A;  3Q5R A;  2ZT9 D;  3G9R A;  1OW7 A;  4PV1 B;  2YMK A;  4OGQ B;  3GF7 A;  2E75 C;  1VF5 B;  1VL2 A;  1Q90 D;  1PL5 A;  1IK7 A;  2O01 J;  2V7Q J;  2G8Y A;  1GMJ A;  2BEQ D;  2E75 D;  1S5L X;  4U7J A;  3LW5 J;  3B71 A;  3IAO A;  4XFJ A;  2QJP C;  1DD3 A;  3O6Q A;  1MKM A;  1DD4 A;  2E74 B;  3AE9 C;  1WMK A;  2NZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...