4I7ZB

Crystal structure of cytochrome b6f in dopg, with disordered rieske iron-sulfur protein soluble domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
159
structure length
159
Chain Sequence
ATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lipid-induced conformational changes within the cytochrome b6f complex of oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 38
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4i7zB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4i7zB01
2QJKC 2WSCJ 4IL6X 5KLIC 2K9YA 5L8RJ 1VF5B 4Y28J 4H13B 4I7ZB 1ZRTE 4PV1B 4H0LB 3LW5J 2QJYC 2QIWA 3C8VA 2FYNC 2YIUC 1S5LX 2E74B 2QSIA 4H44B 4OGQB 2WPVB 1JB0J 1Q90D 2ZT9B 4RKUJ 2E75B 2QJPC 2D2CB 4KT0J 2O01J 2E76B 2WSEJ 2WSFJ 5KKZC
chains in the Genus database with same CATH superfamily
1ZL8A 2ZNJA 2HFED 3OW2U 1NR1A 3SPIA 4LFCO 3TGUG 2OWOA 2M8RA 3BVOA 4AQRD 4UVCA 5JJJB 3JC22 4W7YA 1S9KD 2P22C 4JI8B 3CC7V 4X8AA 5IWAB 1JY3N 2A79B 2KUBA 1QX8A 3IF4A 1RF1C 1XMOB 2BEZF 1SVFA 5AVUB 1NKDA 1SA0B 4B08A 2WPVB 2JIZG 3M0AA 2WQYC 5APYA 3PLNA 3U1AA 4O4LB 2KOGA 4IOIH 3AEIA 4IYHA 4KFMA 1EDKA 2Q7GA 4FFBB 3K5LA 2Z3YA 1YYCA 1JY3P 5AW7B 5B5EZ 1OVRA 1FAFA 3CLQA 1Z5WA 2GUSA 3CXHD 1LP1B 1KV4A 1H8AA 2GUVA 3CWBE 2Z4EA 3DTUB 4NKGB 3FYIB 4W4LA 2XHBA 2PY5A 1SKVA 2CDYA 2OYIA 2Q67A 3JCUZ 1JY3O 3H1IG 1JY2P 1A32A 2HODA 3OEEG 1L0LJ 1S5LX 2Y0PA 1DF4A 1RPOA 1GM9A 4Z1MH 5CCHC 2WLNA 5AVWB 1XHXA 3KCXA 2E75B 1KD1Q 3SR2C 2A45I 5LYJB 1VQLV 2HPCB 4LFCB 1KC8W 3G6BA 1RE3A 3I5CA 1R3KC 1K8AQ 3QG5A 2GUZB 3HKCB 3QTCA 1AR1B 4U3FH 1VQ9V 1FZAA 5AG2A 5DN6G 2JP3A 4H0LB 1P4RA 1WT6A 3FWLA 1DK1A 2FYUE 2WPSA 2WSEH 5D5QA 5LA6B 4DV6B 2FFDB 3D6YA 2AEJA 2JWAA 4JYBA 3RL0B 2N1TD 2ZVNB 3ZX6A 1NU1J 1AJNA 1WB8A 1QNMA 4ZHQB 2PUSA 2MK3A 1IBMB 1RF0A 3BCCJ 3T4ZA 3AE4C 3AEFC 1FJPA 4H44D 3HD7A 5B66H 3RK2B 3N2KA 3THOA 4DV0O 1T3UA 1P84I 1LT9A 3ZRSA 2WLJA 2ZDIA 4H0LD 4WBAA 3FB8C 4FZ0A 4EYYQ 5CJ4A 3T1HB 4JI3B 2JEEA 5CCGC 2ATKC 3ZDMA 2VQFB 1L0NJ 5E1AC 3RL0D 4YPCA 5JVDB 4X66O 2YXHA 4J7KA 1OWAA 2H43A 1KILB 1M56C 2ZDIC 5LP6C 2UUAB 5AVSB 5KAFH 1EZVD 4UB6Z 3ETEA 3WU2H 1USDA 1VF6C 2H94A 1SQBG 2B89A 3RK2D 1NHLA 4BW9A 3ABMC 5JCOC 4I50A 2WLHA 2LW7A 3HKEB 4HAMA 3G71P 2QTSA 1FZFA 4FM2A 4X1KB 3T1CA 2JDIH 3GHGC 4YJ2B 3SJAC 3VP8A 4PD4E 4BIOA 2KZJA 2RMKB 4U7JA 1KTMA 2FYZA 4DK1A 2F23A 4OWFA 3L74E 2PGDA 5JCOA 2LP7A 2YICA 3G4SV 3FXEA 2SPZA 2M5AB 3L75J 1AQTA 3V5BA 1M5IA 4MVMA 4DV0B 1VQ5V 4ZIBA 2L91A 1LT1A 5AW3B 2CTQA 2R5DA 3UM7A 2IYOA 2Q9IA 2F4VO 2KB1A 3WMM0 1WPXA 2EIJC 1HF9A 3CCJP 4N21A 2DWDC 1EQ7A 1IC2A 5EZYA 5APXA 3H9VA 2WSCH 1KB9I 4DT0A 4I6MC 1IVSA 1URQD 2V4HA 1H2SB 1IBKO 1MFTA 3G80A 3QO5A 1D5AA 3KCYA 4LWSA 3RVYA 3FXDA 4YHHB 5KAIE 1D5NA 5LHHA 2W83C 3ZRWB 3D3QA 4N3YB 2A0LA 1B6QA 4UCVA 1NTKG 4BXLA 1MZ9A 1LR1A 5H2FZ 1SQXG 2CPBA 1RP3B 5FNVB 3RYHA 3CXHE 3B2EE 2R32A 3M91A 2BSKA 1NO4A 3H1JE 3FGAD 3CC4P 4UB8H 1GU4A 1K9MQ 1S5HC 4DR7O 2XNXA 1YJWP 4OPHA 1V55B 4IIJA 1IFNA 5CBGA 3KKYA 3TETA 2XOKG 4JI4O 5EBLC 2BCCE 2RNBA 1SQVE 3MUDA 3VMXA 3OTFA 3JCZA 3RBZA 3L4FA 1KECA 1L0LK 1MOFA 1LTJA 2IZ1A 2IH1C 2Y4TA 5AVXB 4JYCA 4FLYA 2WAMA 2OTJP 3RT3C 2LXBA 2QRXA 4I1LA 5JJNB 1MMMA 4UB8Z 1L4AB 4MSWC 3O65A 1EXJA 4UV9A 2XKMA 2JS5A 2OCCC 4MW8A 2CK3H 5LOVA 1Y66A 2KKWA 4JF7A 1H89A 2IU0A 2KYVA 2E42A 3L74D 1LGHB 1CP9A 1YJWV 3L35A 3IC9A 1JX9A 2BCCH 3K3WA 2AW9A 3AG2C 3W7UA 1N34B 2Q4PA 4Q6GA 1NU1K 3IJ4A 1R3IC 2YO3A 3K5BA 5DJUB 1NTMK 4J10A 5CMUA 1VIBA 4AQYO 4KUMA 1YTZI 4DUYB 1K73W 2C0XA 1ZW0A 4DV3B 1TU3F 2AXCA 1SQVH 3H1LH 4LF4B 1EZVE 1VQNV 1LTBC 2VRSA 1NTMJ 4O4JB 3MDSA 3TGUD 1YTZT 4OVNF 4UVBA 1N7SD 1AQ5A 4DUZB 1EFRG 5KLIC 4CS2A 1GL2A 5AW6B 4R8CA 1BL8A 1YIJV 1WRGA 2P10A 3HE5A 5L8RJ 2K1AA 1M1JC 2K3RA 3V2PA 5KAIH 1GW4A 3CCMP 1HP8A 4NPDA 5BMVA 1BGYD 2X0LA 4OPAA 3CSXA 5CCHD 1S3JA 2A45H 1KFNA 5KAFZ 4HKZH 4X64O 1HH0A 4IHJA 2IW5A 3CJHA 1YJNP 4ICGA 4Z1MG 2RN9A 1D7MA 1SQXE 5AW1B 2ODMA 2HYNA 2WA4A 3E22B 3EHBB 4WFBV 3GF3A 4BAYA 3KZIH 2UUBO 3ABUA 4TT3G 1R6NA 2QE7G 3L70H 5JH7B 5D5PA 4JYAO 1NTZE 3BPZA 4JI5O 4PA6A 4WY4C 3RK3D 1FZGA 1FPOA 2QWRB 3L73G 5KLVD 2ZE6A 4DV5O 1KP2A 5CA0A 4PDMA 1J5EO 2OTLP 3RYIA 2BCCJ 2QWQB 3H1HE 1K92A 3EVKA 1YI2P 3II6A 5GTIH 1Q43A 4TOIA 4WY4D 1K04A 3ZMSA 4NXNB 3LDCA 3H1LG 2ADPA 3LUTB 2WZ7A 1AJYA 4AUWA 4XDJA 3PRJA 1JFFB 3PJSK 4FLTA 1Q82W 2ZR2A 1IK9A 3JD0A 1NTMD 3TXQA 3OGIB 4JAUA 3MD0A 4AHCA 2IJJA 3B8EB 4PI0A 2WLIB 4I7ZB 2HJDA 1SQBJ 3P8CD 2Q69A 2GBOA 3SDLA 2OYHA 2BCCG 5LBQA 2W27A 2WLIA 1J1EB 1VQ7P 1PPJH 2YI8A 3ZHUA 5BZBA 3OTOB 3M0DA 5KLVG 3OR6C 1GK6A 4PJ0H 2B1IA 3MHVA 2ZM6B 4R6ZA 3A2AA 2FYUH 4WBNA 3B8MA 4GKKB 1AA0A 4NTWA 3HKBA 1F51A 2QJKC 2R3SA 4L87A 1BQ0A 3NMDA 3ABKB 2B9BA 3RYIB 2CGOA 3GWKC 4WFGA 2RDCA 5DEDA 2XTAA 3E89A 2YKPA 2BOBC 1DLBA 2ZT9D 3N2GA 3T1YO 1HJBA 2P1JA 1DEEG 5GTHE 1GN2A 3VMZA 2KZIA 2Y48A 1FDOA 3CCVP 1S77D 3D36A 2EIJB 1IX9A 1M1KQ 2UXDO 4GZRB 3RFRA 4PHZA 2K88A 3RK2C 1EBOA 3H1ID 1YITV 2Q68A 2QWPB 2AGAA 2LXCB 4JV5B 2LJ2A 3FAVA 4GKJB 4ABMA 5KX5A 2YDEA 3OGCC 2OQQA 2AEFA 3L70J 2E74B 2P5OA 1GL2C 2N1TA 4MVUA 2Q7EA 1TAEA 1YTFB 1KB9E 4KHXA 1Q90D 3B5NA 3CD6V 2B5UA 3BATA 4IGGA 1M56B 5LP6B 3OUFA 1T2KD 2OTLV 3WB0A 1WPBA 2UUCO 5B5EH 3VQVA 4B3RO 4FM1A 2X6CA 5GTIE 1Q8IA 2XAFA 1FJKA 1Y9BA 5BVZA 5EC1C 1G1JA 2ZQMA 3ABTA 1MSDA 4LF5B 3E35A 1K05A 1R3JC 3KPEA 5AVQB 2VQEB 1K3EA 3HE4A 4MTGA 1QL1A 2WSFH 5JQGA 1L0NE 4H33A 2H89C 3CHXA 1VQLP 4QJFB 1OCZC 1PPJG 3A3YB 2P4VA 4NB5A 2E5LO 1FFXA 5AVVB 4GUNA 3DXRB 1Z5VA 5CA1B 1O9HA 1SP4A 3HTKA 1K73Q 3CCUV 3P3PA 4D6TD 1VP7A 2QDOA 3FX7A 5KX5B 3CWBG 2P6JA 1IFMA 3F7VC 4ZI7B 2P4KA 4BRYB 1R8EA 4F6RA 1RM1B 5BU8B 1JNMA 2JEUA 5L3BA 4R4MA 1QCEA 1GL2D 1EXIA 3WG7C 1Q6UA 1IDSA 1XEQA 1ZV8A 2GSMB 1E79G 3AG7A 3S1KA 3L75E 1KKDA 1M93A 3MHSC 4I2LC 1AROP 1EM1A 1X9VA 3FX0A 2V7QH 1NT2B 3JD2A 1EZVH 4LF5O 2V4DA 4DV7O 4PV1B 1N4CA 3I56V 3BRCA 5FNVA 3M8AA 3J80N 1CW5A 5CBFA 2QIWA 1YBKA 3H1JG 4BIUA 4QE7A 4RUFA 4GIFA 2YIDA 1AB3A 2C0WA 2GTSA 3A2FA 1QU7A 4LC1A 2NPSD 4PELA 2YIUC 5KUMA 3ZBHA 4NYKA 1B04A 2P67A 4DV6O 2PRRA 3FFQA 3ZRXA 2BASA 4E4EA 3CCSV 3K9SA 1HUCA 1X8YA 3AEAC 4WBNB 2WPRA 2ZFCA 1AJPA 4DR3B 1RHZB 2KNCB 1YTFD 3AG1C 1VF5B 5ITZA 1RE4C 2K9PA 1MG1A 3KDPB 1S72P 4YY3O 1M56D 1Q3EA 1FXVA 4UCSA 4UCUA 3CXHH 4GLXA 3IR9A 3E1IA 1ZR4A 2DW4A 2YC0A 3H1KH 3L71J 2NNUA 1PNLA 2W8ZA 4F6EA 1URQC 3RYFB 2KS1A 2Y9ZA 4JTDB 1URFA 2Q7HA 4PD4I 2WSFJ 1FYJA 2PGGA 4EI2A 2QJKB 1JJOA 2UUAO 2G3AA 4TSFG 3T97B 1VQKV 3HE4B 1M90W 3P7KA 3IAYA 1W0KG 3KG2A 5AVYB 3V2NA 4LNUB 2L6LA 2PF4E 4YIPA 5J2TB 2Q9LA 1VQ6P 2N1TC 4A5UB 3I5DA 4XDKA 3GVMA 4X1YB 2JKVA 4EIJA 2QSIA 2W90A 3EQ2A 3FB6C 2DN9A 5LP6A 1BHAA 4MVZA 1YEWA 1FKAO 2FYUK 1BGYH 1GW3A 1P7BA 4WFHA 1PNMA 1KN7A 3W7TA 2Z5IA 2JWDA 1GZLA 1E1QG 3SYAA 1F7YA 1HNZO 5KLIB 4RQEA 3JSLA 2YMYA 1H88A 4JPRA 3E2EA 1Q7YW 2FKXA 1HR0O 4N78E 4TT3H 1VQ4P 4I55B 1KD1W 1UJWB 3P30A 5K5GB 1R73A 1JA8A 3AK2A 1GM8A 1S5LZ 1YHQP 1CPYA 5A9GA 3OA7A 1N73B 4MN4C 1MA1A 1OCOB 2CH7B 1LTJC 1GL2B 4JI6B 3TGUE 2A45G 2AZ0A 3L70D 4L75A 1PM9A 1JEKA 2JVDA 4GX2A 4YHHO 4CPGA 1AVYA 1YCIA 2ZNIA 2YKQA 1AFOA 3GB7C 4X1YA 5CB4A 3K79A 1IURA 2EILB 4QPJA 1IK7A 4I4TB 4HH2A 5J2TA 3NTNA 4LFBB 4DCKA 1BGYJ 3QO7A 2E43A 4O2BB 4RWUA 5CBHA 3SFEC 3T97A 1KMIZ 4J7JA 1URQA 2O01N 3STZC 2KXPB 1JY2N 4U3FJ 1YQ4C 2QJ1A 2ILMA 5B3SC 3MHHC 4MVRA 3JD3A 2AXTZ 3H1KJ 4RESB 1HR0B 3AE5C 3ZHVA 3HPLC 5LGTA 5LOVB 1MABG 2ZYAA 1P84E 1VQ8P 1F23A 4K35A 1ZUQA 3ZRVA 1ZXGA 3L71E 3B4SA 2YSUB 1BGYG 4TWKA 3N7NA 1QR8A 2D3OW 2QEXP 3CC2P 4TUYA 3A8TA 2OIGA 4UCOA 5EYPA 1LP1A 2LR2A 1NBMG 1JMBA 2AHZA 3WG7B 3CCQV 1R5SA 4R4LA 3H25A 2CPSA 2Y0CA 1A02J 4RKUJ 3CMAV 3IFXA 1DF5A 2WLKA 4EB6A 1RE4A 3K0GA 4J9YB 5GTHH 2BTQB 5LHGA 1T3JA 2LO1A 1BCCD 3ZJZA 1DGSA 4W4KA 5H6RA 1AVOA 4UUJC 1SQBE 1FZCA 1OCRB 3L72H 3V6IA 3EFGA 2LGWA 4K8XA 3ASNB 4RUEA 1TUBB 3CWBJ 5DJTB 2OGUA 1OIPA 5LMNB 1W2BO 1H2KA 1OW8A 3LDEA 1USEA 5GONB 3RL0g 4DUYO 1ZL8B 4WY4A 4DV3O 2IX7C 3JD4A 3TXSA 4LF4O 1S5LE 1RM1C 5B1AC 4MTFA 4C46A 3ZIAG 1JPXA 3DSQA 1NR7A 3AG1B 3K9AA 1J1DC 1S9KE 2FKWB 4H13B 1I5YA 4WFFA 5EZYB 4O9BA 3NFQA 1VQ6V 1NH2B 3CCRV 1HBWA 1LT9C 2UXCB 2Z5UA 3EXAA 5CA1A 1WP7A 1WNSA 4MW3A 3WU2E 5LGUA 5H9CA 1GU5A 1NTKD 1MNGA 2E76C 1ZTEA 4P30A 4DR1O 1N7SC 3CX5D 4XA4A 5GONA 1AI4A 1XMQO 2A06E 3CRMA 4MVQA 3ICXA 2WT7B 1GTWA 1B06A 4AILC 2UUBB 3ZHQA 2PZSA 4U3FE 2AXTE 1SQPD 1RE3C 4G28B 4XFJA 3H1KE 1FZCB 2IBZI 4YJ3B 2HEPA 4N23A 3TK1A 3L71G 1DEBA 3R2PA 5KJ7D 5K1PA 3J7AU 1G8MA 2LGQA 4PA4A 4KJMA 1SQPJ 4JI2B 3ETDA 1OHHG 2YI9A 3M99B 3ZHTA 1K5SA 1L4AA 4QGPA 4D7SA 4FJCC 4UCTA 3ZEDA 4G27B 1Q81W 1PP9H 2F95B 5EYPB 3L74G 2HVKC 1N33B 3SJBC 3SWYA 3PP5A 2VWJA 2Q6QA 1N36B 3CC4V 4LF9O 4LF7O 4IL6H 3T4DA 2Z5HA 2YXYA 1EN5A 3SYPA 3DGEA 5BXZA 3WUUA 2QM8A 1XL4A 2OTKE 4X9QA 4ZNCA 1LUWA 1SQPG 2QKCA 3VOUA 2UXBB 5CCGD 1Q5OA 3B77A 4DR1B 4IIJB 2P2UA 4H0LC 1W0JG 2YXLA 4FLZA 1G6UA 1S0VA 5KKZC 1ROPA 4EOTA 2QA4P 5LL6Y 3NXSA 2JS3A 1IJDB 4XE5B 3K57A 1NU1H 1S76D 1URQB 3ETGA 3U11A 2FYUD 1Y76B 2M0BA 1NTZH 1CSBA 2IBZG 2OARA 5AW8B 4X62B 2IJKA 4DV1O 3OEHG 4I4TA 1X22A 5AVTB 1XL6A 1VDFA 5B1OA 4JI2O 2YO2A 4UVAA 1PL0A 3JATB 2C9LY 1V9PA 2HFEC 4D6TE 3G4SP 1NU1D 4I9QA 2FXPA 5LMUB 2OYHB 1Q86Q 2GDSA 1L0LG 2HG5C 1XNQO 4A7PA 1P84D 4FMTA 4X20B 1T8ZA 1FOSE 1Y8AA 1HNWB 1I5XA 2IDBA 4B7KA 3HD7C 4I55A 4JTCB 3L72G 4GKJO 1QEXA 3S3WA 1GTOA 3RWRD 4JGSA 3ABMB 2LFRA 3JCUH 4EDFA 4FFBA 3VYIA 3L73J 2FXOA 4WFEA 1WMKA 1NTKE 1SQVJ 2PYJA 5CA0B 1Q6IA 1NTZG 2K9JA 3SJQC 3W7SA 4DV5B 5A2QN 3IFMA 1XNRB 1ZRTE 5KAIZ 2YUAA 1R1BA 1KILC 1NU1G 5JH7A 3LNMB 4LNUA 3WB1A 2WT7A 3E22A 3H32A 1KU9A 2VQEO 2W6BA 2IZ0A 1VQPV 1IFJA 3F5TA 1EZJA 4DV4O 1NVPB 3IGAC 4KXRA 1FS0E 1PKXA 3K5OA 4C7UA 4R7CA 2ZXEB 3CCVV 5IDJA 2KS1B 4J41A 2OYIC 4JAAA 3TGUH 1DH3A 4QNHB 2Q1KA 3Q2YA 1EZVG 1SQXH 5KLVJ 3PH0A 4B7EA 5DM6V 4FLVA 3A7OA 3K5NA 3QWOC 1A02F 2WPDG 2XNDG 2XDJA 3LSQA 4JZ2A 3E83A 4K8ZA 3C8VA 1I94O 1N73C 4EEQA 2R9RB 3CCLP 5ITZB 4O4JA 2ZM6O 3OMAB 5TISZ 3L72E 3JATA 1GK4A 2QSAA 2IJIA 1RQVA 3D71A 4UXNA 2E5TA 4ZHQA 1Y47A 3CCQP 2E75D 1SQQH 1GN4A 2HKOA 1KP3A 4K3AA 3C3SA 1PZQA 4JASA 5B1BB 1VQ7V 3ZN0A 2PAJA 2O1KA 1N32B 1U97A 2WWWA 3HKDA 5C39A 3RVZA 4YTPC 1VQOP 3T1YB 1N8RW 1QLNA 1SQPK 3L70G 3OMIB 3BCCD 4DR4B 3CX5I 2V7QJ 2HPCA 5L3EA 3IAOA 5IWAO 4CS3A 4Q20A 2BTQA 3ZMTA 2UXDB 3OJAB 1Y4MA 1DTOA 1RSOA 1XMOO 1EC5A 2IBZE 3TF5A 5EIBC 3ML0A 2WLMA 2BEQD 2Q6AA 3CWBH 5L3GA 1TVKA 2IPPA 1NI8A 3AE3C 3SYQA 2MJZA 3ETQA 1SFCD 5JJEB 2HHHO 3JSVC 2GM4A 4DR3O 1VPCA 1IO4A 3MUDC 2W6IG 3IC7A 3ZS8C 2QJYB 3LW5J 1FZEA 4ASUG 2XT9A 2X6AA 1FE6A 3HUSA 1FDMA 1NTKJ 4O4LA 3CCLV 2UUCB 5H2FE 2Q0OC 2O3JA 3RGUA 2QJPC 3L71D 1ZOYC 1BCCG 4B3RB 5M1BA 1TGOA 1MSWD 1RY3A 1YDXA 3R65A 4KL1A 1N32O 2A3QA 1M1KW 1NTKK 1S2EA 1HDJA 3HKDB 3VMAA 4U3JA 3D6ZA 1VQ4V 1GDTA 2D2CC 1BT8A 2IU3A 1JMMA 4PI2A 1H2NA 1CI6B 4RQFA 4HJGH 1ZAUA 1X59A 1V55C 3M7MX 2HJFC 2ZXWC 2A06H 1H0TA 3JD1A 2PTMA 1NWQA 5LXTA 3AEDC 3CP1A 3L37A 2GV9A 2ZE5A 1HJ0A 4IT5A 2HHHB 1DX7A 4LLHA 3WUTA 1PNKA 2CH7A 2ZE8A 2PI4A 1ZLZA 5H5NA 4Y99C 3K03A 1KC8Q 3TCUA 2NN4A 1VF5D 3KZIZ 2RN0A 1ZSPA 4NXMO 1YJ9P 3A0HZ 3F7YC 1FFTB 3E7KA 1N86A 3AE6C 4L74A 3JAMN 5L3FA 5APSA 1XILA 4OH8B 1JB0J 4B3MO 1J95A 5LGNA 1BDDA 1NOHA 4WY4B 2LW1A 2KK7A 3U59A 3AEEC 2QKSA 3VQXA 4LF8B 1YHQV 2VRZA 4IL6Z 2KSDA 2MKVA 2YMKA 1AR4A 1E5WA 5J9PC 5AVRB 4JI8O 3GWOA 4I50B 3K0DA 1X79B 1DD4A 1R6KA 5IY5C 5F2VO 1SQBD 1AR5A 4DW0A 3OM3B 1KB9F 1AI6A 1UFIA 2WLLA 2QR4A 3FWNA 3ZHRA 4LCUC 5FPRA 5KLVK 3C9IA 4GX0A 4J11A 3ZHSA 1SQBK 2AEMA 3LW5H 4DW1A 2QA4V 3AEGC 3K08A 3L71H 4AYCA 1HNXO 4B3TB 2ITCC 2DQ0A 1K97A 3QF7A 2EIMB 1LJ2A 2NPSA 5CJ0A 1I0HA 4HBNA 4JI7B 5E79E 5APUA 1PGQA 2H88C 4CC6A 3I56P 4CZZA 3MIWA 4OX9B 2ZE7A 1BE3E 2ADQB 2QWNB 5IT9N 3RYCA 2F4VB 2R72A 3OW2O 1PP9G 2RJZA 3UO3A 3CCRP 3FD9A 2IBZD 1L4AD 3NR7A 3ABKC 2NPSC 2FYNC 2UWJE 2OYHC 2E74C 5FLXN 4I7ZC 2W6AA 1PL5A 1RPRA 2EX3A 3ZCCA 3K58A 1IBKB 2WMMA 1GM7A 3SGIA 5AVZB 4K0KB 4JI0O 3D3IA 2WSEJ 3VN0A 3CCEP 3BRTB 3RK3C 2R9AA 2WSCJ 4WF9V 5B66Z 3TNUA 4W7ZA 1X0TA 4WFAV 4O2BA 2X7RB 1K8AW 1S72V 3ABLB 2Q0AA 4BWAA 2NZ2A 1VMGA 1AVMA 1ORQC 1PPJD 3S4RA 1GO3F 2C2AA 2V1DA 2GUZA 2MW2B 4XDLA 2BTOA 5IE9A 5IYCO 4OGQD 1SETA 1BSNA 5IYDO 2Y0IA 4L73A 5AW9B 2DE0X 1JUNA 3C3TA 4B3TO 2Y69B 3OFNG 4PV1D 1N73A 1SS1A 1EN4A 1H2GA 1K34A 3UIAA 4RO2A 1L0LH 5TJHA 3U10A 3CMAP 4PA7A 1V54C 1NTME 3P32A 3T1HO 1BE3G 2KSEA 2YS8A 1S1CX 2IYPA 3ASOC 2QJYC 1SQQJ 1BS3A 4J7ZA 3BY6A 3P8MC 4JI6O 1OZHA 4GODA 4XBFA 1W2EA 3HE5B 2KB7P 5C8YB 3W68A 4JI0B 3CL3D 1I08A 4TQDA 2QEXV 3CC2V 4B3SO 4JQ0D 2NR5A 3L9DA 2Q73A 2E5YA 2YXRB 3A0BE 1FXKC 1L0LD 2AZ2A 4QPKA 1FFXB 4N6JA 4RJTA 2CTRA 4YJ3A 2RMZA 1KILE 2O57A 4CH5A 2ZYGA 5AW4B 3AG4B 5KAFE 1Z56A 3SWKA 2E76D 1LWUC 3Q4HA 4PV1C 3H1LE 1NGMB 3LDDA 2EJRA 4EFEA 3LSSA 2UU9O 2LQTA 1M57D 3H1KG 2BE3A 1SQVK 1VF6A 3H1JH 2EINB 5B1BC 1QLEB 1XUQA 2ZXWB 1E79H 3AEBC 3LIEA 1QVFO 4FLUA 1MKMA 1EDIA 2UXNA 2N9BA 1BE3J 3F89A 3B5NB 3H1HJ 1PP9E 1SQQG 5IJ9A 4CC5A 1ZLLA 1KKCA 1SESA 1NTKH 4J9ZB 3FAVB 5IYZB 3RBXA 2QJPB 1SLQA 1XQ8A 1HVVA 1M8OB 2R3CA 3Q1MA 5EC2C 2IBZH 4B86A 4UB6E 2VWKA 5H6QA 3OAAG 1KYOF 2XAHA 4LF9B 2WSSH 4B3SB 2OIEA 4GCZA 4GYCB 4TV9B 3N27A 5EBWC 2ZKOA 2I8DA 1KILD 3PHLA 4IYIA 4YXWG 1HWYA 3A0RA 2FL4A 1JQ0A 1RH5B 3KHUA 2DJVA 4LP8A 4GDOA 3KZIE 1FJGB 3BA9A 3BHPA 2KIKA 4I9WA 1OW6A 1LUVA 1H8EG 2JGUA 1TUBA 1BZKA 4P9PA 2BSKB 2P58A 3AE9C 3RYHB 5AW5B 3D36C 4PJ0Z 4ZOLA 4C7RA 2RKLA 1NJIW 1OCZB 1HGZA 3E1RA 1Q7YQ 1AI5A 4CH6A 4EB6B 4D7TA 1VF5C 4ASVA 1BSMA 4OGQB 1J5EB 2IFMA 4JI4B 1VEWA 2OCHA 2H7HA 2ZINA 3RN4A 2LKMA 1IFPA 4RAIA 5EK0A 1SQQE 5KUKA 3ZN1A 5GTHZ 4HYTB 1L2PA 3P3NA 2ETNA 4TUYB 5CMZA 4F6RB 4F4LA 1P7GA 4O2AB 4FPPA 3CMEV 3BCCG 4MVOA 4ZKPA 4Z2WA 3CEIA 2N04A 2HLDG 4GT1A 1LNQA 3R66A 5KHGA 1XNQB 4IFFA 1NKZB 4UV8A 3HTKB 2F1MA 3N4XA 1OW7A 5KMGB 2AHYA 4GX5A 1FAVA 4Y99B 1HNWO 3VBBA 3DXRA 3JAKB 1JFFA 1FJGO 4BIZA 1AILA 1KFMA 3VMYA 1XMQB 4I0XB 4JPZB 1OCCB 3SSUA 4IL6X 2FBWC 1KQSU 2OYOA 3H1JJ 1JCCA 1NAFA 3BEHA 4WVZA 4QE9A 1U7JA 2KLVA 4NPFX 2A06D 3U0ZA 3H1HD 3H1IJ 4HB1A 2HR3A 4JI1B 2JGDA 3H1HH 5CB4B 1H8HG 1PD3A 5BR8B 1S5LH 1RF1B 3OT7A 4L8JA 4LF6B 1PP9J 2H8PD 1JOCA 2ZR3A 3E86A 3X2QB 4AI8A 2E3CA 4TV8B 2N1TB 3HB3B 1FDIA 2I1JA 2RCVA 4DV4B 1QVFU 3A0BH 1W59A 1X4TA 4IHJB 5GW7A 3EFFK 2K9YA 1XHZA 4PD4H 1OCOC 1FU1A 1P84H 3M9BA 1VQKP 4DV2B 4LF7B 1KORA 5CCGA 5BMVB 1G1IA 3L75G 5L3DA 3JALA 2W6JH 3SPCA 3MAQA 4GKGA 3O9OA 3GW6A 2KG7A 3AK1A 4QMAA 3B71A 4X1IA 1GN3A 3CX5F 3CXHI 3W7WA 1NQTA 3ABLC 3H1IH 2RH0A 3V2RA 3CX5E 3MP7B 1JOYA 3AE8C 1ZX3A 4E2LA 4PJ0E 4U3FG 2XAQA 3CRCA 4JYAB 4MS2A 4D6TH 3K59A 1ZP0C 1SFCC 3AE7C 1L0NH 1L8DA 2FFDA 4WWIA 4DV1B 3ASNC 1LTAC 1TA8A 2Y69C 2QWOB 3A0BZ 5B3SB 1O9GA 4M3LA 3RW0A 4LF6O 1Y74B 3H1LD 4X65O 1KZUB 3HKBB 2WA3A 1U57A 3Q5SA 1OMIA 3UT5B 1V54B 2KP8A 1DIPA 2EBOA 3RYFA 5HFLA 4FM0A 1FOSF 2R5BA 4Y28J 2E5LB 3CX5H 2CTWA 4KHPB 1FBMA 3HR0A 4JZGA 3AG3C 2W0XA 3JAKA 4O4HA 1HWTC 1YXBA 1E1RG 1OFCX 1Q81Q 1QGKB 1VARA 2ZYDA 3CD6P 1UPGA 5IJ0A 1Q2NA 2A7WA 1NTZK 1T5EA 2PI5A 2FYUJ 1ZR2A 3MZWB 4Z1VA 1YSCA 4DR6O 4JAVA 2KNCA 3G3ZA 3CRAA 3D70A 3CWBD 2UXXA 1K7DA 1M1JA 5EFWB 1AP5A 1ENVA 2B9ZA 1LTJB 2FYNB 2DYSB 1XTCC 3SYOA 3BCCE 3WB2A 2XNDH 3BRVB 1NTZJ 3KXDA 3E8HA 2QE7H 4NTYA 5KHIA 3AK3A 2EZOA 2YEVB 2R70A 3H1HG 2QGNA 3CPWU 1T6AA 3CCUP 4FLXA 1IFDA 4DR2B 3QVNA 4ZOLB 4LFAO 1WB7A 3CS5A 4FZ1A 3I55P 1FXKB 5CBOA 5KHJA 1N7SA 3AG4C 1FZCC 2AXTH 3PN1A 1M9NA 3CE2A 1QVGO 2ITAA 4H13C 2W6JG 4WB4A 1JMKC 3ZRWA 5K1XA 1OVVA 1K5QA 5CN0A 1SC5B 1BCCH 4R50A 1NH4A 2Y0EA 1WLEA 1US6A 1NJIQ 1OXZA 4U3FD 3Q5PA 1SQXK 1M1JB 1EDJA 3G71V 4BRYA 4ZI7A 3LSUA 4DR6B 1M7LA 1WA8A 1BHBA 4ZKIA 2FTKA 2M6YA 5IJ0B 1JR9A 3OE7G 1R5LA 4GOEA 4NPEA 4BR6A 1J2JB 3L74J 3QH9A 4TQFA 3MGNA 3SFDC 4LH7A 2VS0A 3AECC 1SRYA 1BQZA 3U1CA 1NKNA 4OXSA 1SQQK 1VL2A 2I1KA 2JK5C 3ZMUA 1NTZD 1ZRTD 5JQGB 4DYLA 4DR2O 2JR8A 4LFAB 1YITP 1Y74A 3V4WA 4O4IB 3GHGA 1FS0G 2N05A 4X1KA 1SQPH 5CA3A 1JJ2U 4DR4O 3MTUE 1KQFB 3VOPA 1XI1A 1M90Q 3Q4HB 2B1GA 4LBEC 2Q3EA 2EINC 3AG2B 2F66C 4JYYA 2B87B 3SPGA 3VP9A 3E8GA 5B1AB 1IBMO 2DWEC 3CYOA 1ZWIC 1WA8B 3BABA 3H1LJ 4CBCA 5KA6A 4UFZA 2ZJSE 1Y6XA 1WN7A 1LT9B 1QL2A 1GD2E 2DQ3A 4OX9O 1BCCJ 1SS3A 3APOA 3I55V 1L4AC 1JVMA 3M9HA 4JI3O 1VQ8V 1BMFG 1ZMEC 3OAKA 2G38A 1VQMV 2VQFO 3M06A 2JJLA 3CB2A 3VQYA 2O01J 4YXWH 1VQPP 1KYOI 4MVSA 3ZMZA 1N7SB 3N2GB 3Q5RA 1PPJE 4J80A 2XV5A 1FXKA 1VQOV 3DC6A 5LA6A 3A5TA 1THZA 4CH4A 2DYRB 4MTXA 2YEVA 4LFBO 1LWUA 4TLFA 1QR9A 1SQVG 3V2QA 3HKCA 1UIXA 3L75D 4OGQC 3E8FA 3L72J 3V4QA 4I0XA 2EIKB 1Z2GA 2ITDC 3PTZA 3E8BA 4YY3B 2DW3A 3CC7P 3ZMVA 2P90A 2Z0AA 4CH3A 2CAZC 2BCCD 1VQ9P 2CTPA 3T2MA 4DJGA 1GMJA 1HGVA 3VQWA 3RYCB 2O01H 3UO2A 2CK3G 3B8NA 3GF7A 4O4HB 3L75H 1QBZA 1K33A 1N0JA 4G2KA 4B3MB 1YJNV 2PFXA 2DYSC 2EULA 5KJ7A 4LF8O 1UIIA 1SQBH 1TUEB 5APTA 4DXWA 5KKZB 1NVOA 1OCCC 2QM4A 1SA0A 3CCEV 1SF9A 3C1LA 4LH6A 2P7JA 1YIJP 2EJ7A 3HKEA 3R4YA 4YIOA 1RQUA 1BE3H 3KQGA 1IZ3A 3FB7C 4N78D 2FYUG 1NVPD 3HRNA 3RK3E 4ZMDA 1VQNP 5B5EE 3A0HH 5LMNO 1OJHA 4JF3A 1SQXJ 5KLVH 2UU9B 1KILA 1YZBA 2D2CD 3ABVC 3UQ8A 2ZT9B 3CRRA 1NZ6A 3X2QC 3L72D 1HNXB 3CJHB 1HNZB 1YQ3C 2N74A 4DRXA 1MV8A 1I7FA 2ARHA 4X88A 4JI7O 2V7QG 1EDLA 3M0DC 1M4UA 3J81N 2CE4A 3O8ZA 2JEXA 3JALB 5APVA 1SQPE 2ZXXA 2FMLA 1HW7A 1GH6A 1OZ0A 2Q7CA 1NTMH 5IYZA 1OVUA 2ZVOB 1PFIA 3HD7B 1J1EC 3AG3B 5CCHA 4X66B 4IL6E 3BFRA 3TSIA 2UXCO 4TV8A 1H2LA 4K0KO 5LHIA 2PYLA 2B87A 2Q3IA 1D2DA 1KQLA 1SQGA 2NLJC 3GG2A 3CCSP 2QG4A 2DMXA 1VQ5P 5FPOA 5LXTB 5DECA 1F4NA 3F5HA 1H38A 1SFCB 4HNAB 4IFDK 2ZD9A 1CI6A 4PA9A 1GAXA 4LR3A 2A9HA 4X89A 2JJ1G 1N8RQ 1N34O 2WVRA 2HP8A 4U3JB 3D8CA 1AV1A 2LFSA 3QNEA 3JASA 5LYJA 3CMEP 3STLC 1M57C 3WFVA 1L0LE 2XUMA 3B09A 3OMNB 3FB5C 4KT0J 1YJ9V 4KP4A 3WUVA 2HODB 5KMGA 3HUSB 2QM7A 3L74H 5C8YA 5IYBO 5BU5A 1Q82Q 2OYIB 3P8CE 5TISE 1PIXA 4ASWA 3BAAA 4H44C 4DUZO 3B5ND 4DK0A 1MUUA 1NTMG 3H1JD 1N2DC 4W80A 1B3QA 2HVJC 4PA3A 1W5CE 4DOJA 4QIWF 1L1FA 4D6TG 1EN6A 3K5MA 4BW5A 1IFIA 1IBLB 1KB9H 1KQGB 5AW2B 1NYHA 3O6QB 5KTBA 2OT5A 1TVKB 1R3LC 1SQVD 1NU1E 1XOUA 4P2ZA 2IJHA 1PGOA 1VQMP 1PGPA 2R44A 4U7OA 3CCJV 3JCUE 3L73D 2CGNA 1CZQA 1U7MA 1GN6A 5KHKA 1HTLC 4L76A 2C9NY 2K1EA 1LTTC 3JASB 4DR5O 2POHA 3L73E 4H37A 1SQQD 2XZRA 5EIBD 4DR7B 2J59M 3APQA 1LTGC 3L70E 1DD3A 5KJ7C 1YF2A 3S3XA 1S4XA 4JI1O 1SFCA 5HFMA 2PP6A 3TNUB 1WAZA 5BR8O 3CXCU 4GOFA 3S9OA 1SERA 1SZTA 2D2CB 3H1KD 4LWSB 4TV9A 2WPQA 1P49A 2XAGA 4I5SA 3SPHA 3TJTA 1SQXD 3JARB 1IZNB 1JTHA 4C7NA 3SYCA 1W2BU 1PP9D 5FL7G 2E75C 2F93B 3JAWB 1IBLO 1Q86W 2WITA 2R9IA 2YXQB 5IJ9B 4RO0A 2QKAA 3FKSG 4JTAB 1WP8A 3HD7D 1CXZB 4FIPC 5KLVE 2J5UA 2M5AA 2NPSB 1SZXA 5E79Z 3TDKA 1N7LA 4NR1A 2Q5UA 5TISH 4FVMA 1MZEA 2O1JA 3OTOO 3UT5A 1KB9D 1S5JA 2DYRC 5IY5B 5J2UA 2QVAA 3RK3B 4DR5B 2JRIA 3CRQA 4P9OA 1JM0A 4YJ2A 3ITKA 2XASA 2WLLB 4DO2A 4FLWA 3H32B 2CUGA 3USSA 4PD4D 1PV0A 4AQYB 3GMAA 1ZN5A 4GX1A 3BVHA 2EIKC 1PV3A 1XNRO 2GA1A 5KHHA 1RFYA 1MFZA 3IN6A 5B66E 3BA8A 1AJQA 2K9JB 2YIUB 5CBNA 3H6PA 5GTIZ 1COWG 2G8YA 1FZBA 1CEZA 2Q8VA 1GKFA 5JVDA 2RQ6A 4X65B 5J2UB 1FD9A 3B40A 1KYOD 4X1IB 2YNYA 1H2MA 2KG7B 1N33O 2FFDC 1G2CA 1NS1A 2Y9YA 1BSHA 4UB6H 5JWPA 1N36O 3WU2Z 4NVPA 1QLED 1EZVI 4BWNA 2OYQA 2Y4UA 2Y0DA 4X20A 3N2KB 5APWA 4X64B 3CCMV 3GLMA 4C7NB 1Q6HA 4MT8A 1XREA 2UXBO 2EIMC 4ZKUA 3JARA 3UCSC 2EILC 3Q3DA 2L35A 2P06A 3F5WC 4J42A 1OX3A 4EKWA 1SQFA 2EZPA 3K06A 2WSSG 3UKMA 5KA5A 1RF1A 2M7WA 3KYQA 5CHXA 1FXHA 4JI5B 1YI2V 4FFKA 3TYYA 3AE2C 2JGDB 5APQA 1YVWA 2KLUA 3OR7C 1LTSC 4WCEV 4X62O 2K37A 1QQCA 1LWUB 2H3OA 1NAYA 3VTPC 3CPWO 2ZCEA 1BCCE 2H8PC 3CXHF 4ZBMA 1G1XB 1VF7A 3L36A 2ZIOA 1L0NG 1Y76A 1QHTA 1KYOH 3AE1C 2Q5ZA 3C90A 2NRGA 2GTAA 1JCHA 4NXNO 3RL0C 3W67A 1QLEC 3SJCC 4PDRA 2HLOA 1Y67A 2GHYA 2YIBD 3H01A 1AI7A 1N0NA 4PDVA 1FC2C 3W7XA 2J58A 4U7NA 2M3BA 5LMUO 3B5NC 5B1NA 2KQXA 3OUSA 3QO8A 2QTOA 4DV2O 2JJ2G 1BE3D 3O6QA 1AP6A 2M3EA 2ZIMA 2P7TC 1WJZA 1GK9A 3G9RA 1JO5A 2BOCC 4O2AA 1T2KC 4HYOA 2JDIG 2E74D 4JBZA 5H2FH 4PD4F 1G2CB 2FY8A 1BDCA 3CI9A 5EBMC 1P84F 1IXMA 1PL4A 4IFMA 4GKKO 2YKOA 3SWFA 3RGBA 1XBLA 1L0ND 1K4CC 2IH3C 2N9YB 3BASA 3ASOB 2E76B 1RSOB 4UB8E 1MZFA 3A0HE 2YIAA 2FXMA 2ZAEB 1JCDA 1L0NK 2A06G 1QVGU 2X6BA 3JSNA 3G6EP 1KYOE 1M57B 4MTOA 2WTYA 2YIBA 5BY1A 5C93A 1U96A 1PGJA 4O4IA 5L3CA 3GHGB 4CS4A 4DV7B 1GMGA 4NTXA 1JY2O 1K9MW 3TGUJ 4D6TJ 1OV9A 1GRJA 4HNAA 3SPJA 1OCRC 1KUQA 4UCRA 3DC5A 3G6EV 2ZT9C 3JYCA 4KHPO 4PDLA 1KBHA 1XTGB 4DZOA 2L5GB 3LNNA 2IM9A 3FYEB 4LGDE 2W0FC 2B88A 4HZ3A 4YXDC 2XAJA 3OD4A 2DOSA 3M9QA 1BGYE 4EFBA 3G67A 3JAWA 2OCCB 4JV5O 1G4YB 2KSJA 1XDCA 3L73H 1I94B 3BCCH 2FB5A 1JTHB 1LTIC 2KI7B 2OTJV 3H1IE 5E79H 4H13D 4FK5C 2IFNA 1IXBA 3HUSC 3K04A 2XU6A 2F43G 2JO1A 1J1DB 1NH2D 4H44B 1K4DC 4NXMB 1KQSO 5AW0B 1F4MA 3EWKA 1R6TA 2HG5D 1H0TB 4DRXB 3LIDA 1RF0C
chains in the Genus database with same CATH topology
2QJKC 2WSCJ 1ZP0C 1WMKA 3AE2C 1OW6A 1IK7A 3AE7C 1ZRTE 3D6ZA 4PV1B 3R4YA 2NZ2A 1RQUA 2D2CC 1KQFB 3AE9C 3SFEC 2QIWA 3AE1C 1DD3A 1KMIZ 2ZT9D 4XFJA 3RK3E 4OGQD 2YIUC 1TU3F 2BEZF 4U7JA 1U57A 1VF5C 3Q5SA 1KTMA 4OGQB 2WPVB 2D2CD 1OMIA 2WQYC 1FDOA 2ZT9B 3ABVC 3AEDC 3S9OA 1DIPA 2D2CB 1YQ4C 2WSEJ 1YQ3C 3AEAC 1HJ0A 4PV1D 4Y28J 3AE5C 5KLIC 3O6QA 5L8RJ 2P10A 1VF5B 3Q2YA 3G9RA 2E75C 1HF9A 1S1CX 2E74D 1VF5D 2QJYC 3D70A 1OW7A 3C8VA 2OQQA 2J5UA 1S5LX 2E74B 3AE6C 4R4LA 1ZMEC 3H25A 1RQVA 1JB0J 1Q90D 3D71A 4RKUJ 2E75B 4H0LC 2O01J 2E76B 2E75D 3AEEC 2WSFJ 5KKZC 1KILE 3Q5RA 3GF3A 4IL6X 2FBWC 2G3AA 3T97B 2MKVA 1Y9BA 2E76D 2YMKA 3GMAA 4YTPC 1K05A 4PV1C 2JP3A 4H0LB 1NGMB 1DD4A 1PV3A 3FGAD 2H89C 3IN6A 3D6YA 2V7QJ 1OW8A 3IAOA 1UIXA 2QSIA 4OGQC 3RL0g 2G8YA 2ZT9C 3AEBC 4H13C 1MKMA 1K04A 4KT0J 2BEQD 3AEGC 1AJYA 3AE4C 1FDIA 3AEFC 3AE3C 4H44D 4YXDC 2K9YA 2FXPA 1PIXA 3Q5PA 4TT3H 2H88C 4H44C 4H13B 1KORA 4I7ZB 1GMJA 1R8EA 4H0LD 3LW5J 3Q1MA 3GF7A 2IDBA 4H13D 3GLMA 4R4MA 1EXJA 1EXIA 2JO1A 3B71A 2FYNC 1KQGB 3Q3DA 2E74C 1NYHA 4H44B 4I7ZC 1PL5A 3EWKA 3SFDC 2QJPC 3AECC 1ZOYC 2E76C 3AE8C 4GDOA 4Z1MH 1VL2A 5M1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJK C;  2WSC J;  4IL6 X;  5KLI C;  2K9Y A;  5L8R J;  1VF5 B;  4Y28 J;  4H13 B;  4I7Z B;  1ZRT E;  4PV1 B;  4H0L B;  3LW5 J;  2QJY C;  2QIW A;  3C8V A;  2FYN C;  2YIU C;  1S5L X;  2E74 B;  2QSI A;  4H44 B;  4OGQ B;  2WPV B;  1JB0 J;  1Q90 D;  2ZT9 B;  4RKU J;  2E75 B;  2QJP C;  2D2C B;  4KT0 J;  2O01 J;  2E76 B;  2WSE J;  2WSF J;  5KKZ C; 
#chains in the Genus database with same CATH topology
 1ZL8 A;  2ZNJ A;  2HFE D;  3OW2 U;  1NR1 A;  3SPI A;  4LFC O;  3TGU G;  2OWO A;  2M8R A;  3BVO A;  4AQR D;  4UVC A;  5JJJ B;  3JC2 2;  4W7Y A;  1S9K D;  2P22 C;  4JI8 B;  3CC7 V;  4X8A A;  5IWA B;  1JY3 N;  2A79 B;  2KUB A;  1QX8 A;  3IF4 A;  1RF1 C;  1XMO B;  2BEZ F;  1SVF A;  5AVU B;  1NKD A;  1SA0 B;  4B08 A;  2WPV B;  2JIZ G;  3M0A A;  2WQY C;  5APY A;  3PLN A;  3U1A A;  4O4L B;  2KOG A;  4IOI H;  3AEI A;  4IYH A;  4KFM A;  1EDK A;  2Q7G A;  4FFB B;  3K5L A;  2Z3Y A;  1YYC A;  1JY3 P;  5AW7 B;  5B5E Z;  1OVR A;  1FAF A;  3CLQ A;  1Z5W A;  2GUS A;  3CXH D;  1LP1 B;  1KV4 A;  1H8A A;  2GUV A;  3CWB E;  2Z4E A;  3DTU B;  4NKG B;  3FYI B;  4W4L A;  2XHB A;  2PY5 A;  1SKV A;  2CDY A;  2OYI A;  2Q67 A;  3JCU Z;  1JY3 O;  3H1I G;  1JY2 P;  1A32 A;  2HOD A;  3OEE G;  1L0L J;  1S5L X;  2Y0P A;  1DF4 A;  1RPO A;  1GM9 A;  4Z1M H;  5CCH C;  2WLN A;  5AVW B;  1XHX A;  3KCX A;  2E75 B;  1KD1 Q;  3SR2 C;  2A45 I;  5LYJ B;  1VQL V;  2HPC B;  4LFC B;  1KC8 W;  3G6B A;  1RE3 A;  3I5C A;  1R3K C;  1K8A Q;  3QG5 A;  2GUZ B;  3HKC B;  3QTC A;  1AR1 B;  4U3F H;  1VQ9 V;  1FZA A;  5AG2 A;  5DN6 G;  2JP3 A;  4H0L B;  1P4R A;  1WT6 A;  3FWL A;  1DK1 A;  2FYU E;  2WPS A;  2WSE H;  5D5Q A;  5LA6 B;  4DV6 B;  2FFD B;  3D6Y A;  2AEJ A;  2JWA A;  4JYB A;  3RL0 B;  2N1T D;  2ZVN B;  3ZX6 A;  1NU1 J;  1AJN A;  1WB8 A;  1QNM A;  4ZHQ B;  2PUS A;  2MK3 A;  1IBM B;  1RF0 A;  3BCC J;  3T4Z A;  3AE4 C;  3AEF C;  1FJP A;  4H44 D;  3HD7 A;  5B66 H;  3RK2 B;  3N2K A;  3THO A;  4DV0 O;  1T3U A;  1P84 I;  1LT9 A;  3ZRS A;  2WLJ A;  2ZDI A;  4H0L D;  4WBA A;  3FB8 C;  4FZ0 A;  4EYY Q;  5CJ4 A;  3T1H B;  4JI3 B;  2JEE A;  5CCG C;  2ATK C;  3ZDM A;  2VQF B;  1L0N J;  5E1A C;  3RL0 D;  4YPC A;  5JVD B;  4X66 O;  2YXH A;  4J7K A;  1OWA A;  2H43 A;  1KIL B;  1M56 C;  2ZDI C;  5LP6 C;  2UUA B;  5AVS B;  5KAF H;  1EZV D;  4UB6 Z;  3ETE A;  3WU2 H;  1USD A;  1VF6 C;  2H94 A;  1SQB G;  2B89 A;  3RK2 D;  1NHL A;  4BW9 A;  3ABM C;  5JCO C;  4I50 A;  2WLH A;  2LW7 A;  3HKE B;  4HAM A;  3G71 P;  2QTS A;  1FZF A;  4FM2 A;  4X1K B;  3T1C A;  2JDI H;  3GHG C;  4YJ2 B;  3SJA C;  3VP8 A;  4PD4 E;  4BIO A;  2KZJ A;  2RMK B;  4U7J A;  1KTM A;  2FYZ A;  4DK1 A;  2F23 A;  4OWF A;  3L74 E;  2PGD A;  5JCO A;  2LP7 A;  2YIC A;  3G4S V;  3FXE A;  2SPZ A;  2M5A B;  3L75 J;  1AQT A;  3V5B A;  1M5I A;  4MVM A;  4DV0 B;  1VQ5 V;  4ZIB A;  2L91 A;  1LT1 A;  5AW3 B;  2CTQ A;  2R5D A;  3UM7 A;  2IYO A;  2Q9I A;  2F4V O;  2KB1 A;  3WMM 0;  1WPX A;  2EIJ C;  1HF9 A;  3CCJ P;  4N21 A;  2DWD C;  1EQ7 A;  1IC2 A;  5EZY A;  5APX A;  3H9V A;  2WSC H;  1KB9 I;  4DT0 A;  4I6M C;  1IVS A;  1URQ D;  2V4H A;  1H2S B;  1IBK O;  1MFT A;  3G80 A;  3QO5 A;  1D5A A;  3KCY A;  4LWS A;  3RVY A;  3FXD A;  4YHH B;  5KAI E;  1D5N A;  5LHH A;  2W83 C;  3ZRW B;  3D3Q A;  4N3Y B;  2A0L A;  1B6Q A;  4UCV A;  1NTK G;  4BXL A;  1MZ9 A;  1LR1 A;  5H2F Z;  1SQX G;  2CPB A;  1RP3 B;  5FNV B;  3RYH A;  3CXH E;  3B2E E;  2R32 A;  3M91 A;  2BSK A;  1NO4 A;  3H1J E;  3FGA D;  3CC4 P;  4UB8 H;  1GU4 A;  1K9M Q;  1S5H C;  4DR7 O;  2XNX A;  1YJW P;  4OPH A;  1V55 B;  4IIJ A;  1IFN A;  5CBG A;  3KKY A;  3TET A;  2XOK G;  4JI4 O;  5EBL C;  2BCC E;  2RNB A;  1SQV E;  3MUD A;  3VMX A;  3OTF A;  3JCZ A;  3RBZ A;  3L4F A;  1KEC A;  1L0L K;  1MOF A;  1LTJ A;  2IZ1 A;  2IH1 C;  2Y4T A;  5AVX B;  4JYC A;  4FLY A;  2WAM A;  2OTJ P;  3RT3 C;  2LXB A;  2QRX A;  4I1L A;  5JJN B;  1MMM A;  4UB8 Z;  1L4A B;  4MSW C;  3O65 A;  1EXJ A;  4UV9 A;  2XKM A;  2JS5 A;  2OCC C;  4MW8 A;  2CK3 H;  5LOV A;  1Y66 A;  2KKW A;  4JF7 A;  1H89 A;  2IU0 A;  2KYV A;  2E42 A;  3L74 D;  1LGH B;  1CP9 A;  1YJW V;  3L35 A;  3IC9 A;  1JX9 A;  2BCC H;  3K3W A;  2AW9 A;  3AG2 C;  3W7U A;  1N34 B;  2Q4P A;  4Q6G A;  1NU1 K;  3IJ4 A;  1R3I C;  2YO3 A;  3K5B A;  5DJU B;  1NTM K;  4J10 A;  5CMU A;  1VIB A;  4AQY O;  4KUM A;  1YTZ I;  4DUY B;  1K73 W;  2C0X A;  1ZW0 A;  4DV3 B;  1TU3 F;  2AXC A;  1SQV H;  3H1L H;  4LF4 B;  1EZV E;  1VQN V;  1LTB C;  2VRS A;  1NTM J;  4O4J B;  3MDS A;  3TGU D;  1YTZ T;  4OVN F;  4UVB A;  1N7S D;  1AQ5 A;  4DUZ B;  1EFR G;  5KLI C;  4CS2 A;  1GL2 A;  5AW6 B;  4R8C A;  1BL8 A;  1YIJ V;  1WRG A;  2P10 A;  3HE5 A;  5L8R J;  2K1A A;  1M1J C;  2K3R A;  3V2P A;  5KAI H;  1GW4 A;  3CCM P;  1HP8 A;  4NPD A;  5BMV A;  1BGY D;  2X0L A;  4OPA A;  3CSX A;  5CCH D;  1S3J A;  2A45 H;  1KFN A;  5KAF Z;  4HKZ H;  4X64 O;  1HH0 A;  4IHJ A;  2IW5 A;  3CJH A;  1YJN P;  4ICG A;  4Z1M G;  2RN9 A;  1D7M A;  1SQX E;  5AW1 B;  2ODM A;  2HYN A;  2WA4 A;  3E22 B;  3EHB B;  4WFB V;  3GF3 A;  4BAY A;  3KZI H;  2UUB O;  3ABU A;  4TT3 G;  1R6N A;  2QE7 G;  3L70 H;  5JH7 B;  5D5P A;  4JYA O;  1NTZ E;  3BPZ A;  4JI5 O;  4PA6 A;  4WY4 C;  3RK3 D;  1FZG A;  1FPO A;  2QWR B;  3L73 G;  5KLV D;  2ZE6 A;  4DV5 O;  1KP2 A;  5CA0 A;  4PDM A;  1J5E O;  2OTL P;  3RYI A;  2BCC J;  2QWQ B;  3H1H E;  1K92 A;  3EVK A;  1YI2 P;  3II6 A;  5GTI H;  1Q43 A;  4TOI A;  4WY4 D;  1K04 A;  3ZMS A;  4NXN B;  3LDC A;  3H1L G;  2ADP A;  3LUT B;  2WZ7 A;  1AJY A;  4AUW A;  4XDJ A;  3PRJ A;  1JFF B;  3PJS K;  4FLT A;  1Q82 W;  2ZR2 A;  1IK9 A;  3JD0 A;  1NTM D;  3TXQ A;  3OGI B;  4JAU A;  3MD0 A;  4AHC A;  2IJJ A;  3B8E B;  4PI0 A;  2WLI B;  4I7Z B;  2HJD A;  1SQB J;  3P8C D;  2Q69 A;  2GBO A;  3SDL A;  2OYH A;  2BCC G;  5LBQ A;  2W27 A;  2WLI A;  1J1E B;  1VQ7 P;  1PPJ H;  2YI8 A;  3ZHU A;  5BZB A;  3OTO B;  3M0D A;  5KLV G;  3OR6 C;  1GK6 A;  4PJ0 H;  2B1I A;  3MHV A;  2ZM6 B;  4R6Z A;  3A2A A;  2FYU H;  4WBN A;  3B8M A;  4GKK B;  1AA0 A;  4NTW A;  3HKB A;  1F51 A;  2QJK C;  2R3S A;  4L87 A;  1BQ0 A;  3NMD A;  3ABK B;  2B9B A;  3RYI B;  2CGO A;  3GWK C;  4WFG A;  2RDC A;  5DED A;  2XTA A;  3E89 A;  2YKP A;  2BOB C;  1DLB A;  2ZT9 D;  3N2G A;  3T1Y O;  1HJB A;  2P1J A;  1DEE G;  5GTH E;  1GN2 A;  3VMZ A;  2KZI A;  2Y48 A;  1FDO A;  3CCV P;  1S77 D;  3D36 A;  2EIJ B;  1IX9 A;  1M1K Q;  2UXD O;  4GZR B;  3RFR A;  4PHZ A;  2K88 A;  3RK2 C;  1EBO A;  3H1I D;  1YIT V;  2Q68 A;  2QWP B;  2AGA A;  2LXC B;  4JV5 B;  2LJ2 A;  3FAV A;  4GKJ B;  4ABM A;  5KX5 A;  2YDE A;  3OGC C;  2OQQ A;  2AEF A;  3L70 J;  2E74 B;  2P5O A;  1GL2 C;  2N1T A;  4MVU A;  2Q7E A;  1TAE A;  1YTF B;  1KB9 E;  4KHX A;  1Q90 D;  3B5N A;  3CD6 V;  2B5U A;  3BAT A;  4IGG A;  1M56 B;  5LP6 B;  3OUF A;  1T2K D;  2OTL V;  3WB0 A;  1WPB A;  2UUC O;  5B5E H;  3VQV A;  4B3R O;  4FM1 A;  2X6C A;  5GTI E;  1Q8I A;  2XAF A;  1FJK A;  1Y9B A;  5BVZ A;  5EC1 C;  1G1J A;  2ZQM A;  3ABT A;  1MSD A;  4LF5 B;  3E35 A;  1K05 A;  1R3J C;  3KPE A;  5AVQ B;  2VQE B;  1K3E A;  3HE4 A;  4MTG A;  1QL1 A;  2WSF H;  5JQG A;  1L0N E;  4H33 A;  2H89 C;  3CHX A;  1VQL P;  4QJF B;  1OCZ C;  1PPJ G;  3A3Y B;  2P4V A;  4NB5 A;  2E5L O;  1FFX A;  5AVV B;  4GUN A;  3DXR B;  1Z5V A;  5CA1 B;  1O9H A;  1SP4 A;  3HTK A;  1K73 Q;  3CCU V;  3P3P A;  4D6T D;  1VP7 A;  2QDO A;  3FX7 A;  5KX5 B;  3CWB G;  2P6J A;  1IFM A;  3F7V C;  4ZI7 B;  2P4K A;  4BRY B;  1R8E A;  4F6R A;  1RM1 B;  5BU8 B;  1JNM A;  2JEU A;  5L3B A;  4R4M A;  1QCE A;  1GL2 D;  1EXI A;  3WG7 C;  1Q6U A;  1IDS A;  1XEQ A;  1ZV8 A;  2GSM B;  1E79 G;  3AG7 A;  3S1K A;  3L75 E;  1KKD A;  1M93 A;  3MHS C;  4I2L C;  1ARO P;  1EM1 A;  1X9V A;  3FX0 A;  2V7Q H;  1NT2 B;  3JD2 A;  1EZV H;  4LF5 O;  2V4D A;  4DV7 O;  4PV1 B;  1N4C A;  3I56 V;  3BRC A;  5FNV A;  3M8A A;  3J80 N;  1CW5 A;  5CBF A;  2QIW A;  1YBK A;  3H1J G;  4BIU A;  4QE7 A;  4RUF A;  4GIF A;  2YID A;  1AB3 A;  2C0W A;  2GTS A;  3A2F A;  1QU7 A;  4LC1 A;  2NPS D;  4PEL A;  2YIU C;  5KUM A;  3ZBH A;  4NYK A;  1B04 A;  2P67 A;  4DV6 O;  2PRR A;  3FFQ A;  3ZRX A;  2BAS A;  4E4E A;  3CCS V;  3K9S A;  1HUC A;  1X8Y A;  3AEA C;  4WBN B;  2WPR A;  2ZFC A;  1AJP A;  4DR3 B;  1RHZ B;  2KNC B;  1YTF D;  3AG1 C;  1VF5 B;  5ITZ A;  1RE4 C;  2K9P A;  1MG1 A;  3KDP B;  1S72 P;  4YY3 O;  1M56 D;  1Q3E A;  1FXV A;  4UCS A;  4UCU A;  3CXH H;  4GLX A;  3IR9 A;  3E1I A;  1ZR4 A;  2DW4 A;  2YC0 A;  3H1K H;  3L71 J;  2NNU A;  1PNL A;  2W8Z A;  4F6E A;  1URQ C;  3RYF B;  2KS1 A;  2Y9Z A;  4JTD B;  1URF A;  2Q7H A;  4PD4 I;  2WSF J;  1FYJ A;  2PGG A;  4EI2 A;  2QJK B;  1JJO A;  2UUA O;  2G3A A;  4TSF G;  3T97 B;  1VQK V;  3HE4 B;  1M90 W;  3P7K A;  3IAY A;  1W0K G;  3KG2 A;  5AVY B;  3V2N A;  4LNU B;  2L6L A;  2PF4 E;  4YIP A;  5J2T B;  2Q9L A;  1VQ6 P;  2N1T C;  4A5U B;  3I5D A;  4XDK A;  3GVM A;  4X1Y B;  2JKV A;  4EIJ A;  2QSI A;  2W90 A;  3EQ2 A;  3FB6 C;  2DN9 A;  5LP6 A;  1BHA A;  4MVZ A;  1YEW A;  1FKA O;  2FYU K;  1BGY H;  1GW3 A;  1P7B A;  4WFH A;  1PNM A;  1KN7 A;  3W7T A;  2Z5I A;  2JWD A;  1GZL A;  1E1Q G;  3SYA A;  1F7Y A;  1HNZ O;  5KLI B;  4RQE A;  3JSL A;  2YMY A;  1H88 A;  4JPR A;  3E2E A;  1Q7Y W;  2FKX A;  1HR0 O;  4N78 E;  4TT3 H;  1VQ4 P;  4I55 B;  1KD1 W;  1UJW B;  3P30 A;  5K5G B;  1R73 A;  1JA8 A;  3AK2 A;  1GM8 A;  1S5L Z;  1YHQ P;  1CPY A;  5A9G A;  3OA7 A;  1N73 B;  4MN4 C;  1MA1 A;  1OCO B;  2CH7 B;  1LTJ C;  1GL2 B;  4JI6 B;  3TGU E;  2A45 G;  2AZ0 A;  3L70 D;  4L75 A;  1PM9 A;  1JEK A;  2JVD A;  4GX2 A;  4YHH O;  4CPG A;  1AVY A;  1YCI A;  2ZNI A;  2YKQ A;  1AFO A;  3GB7 C;  4X1Y A;  5CB4 A;  3K79 A;  1IUR A;  2EIL B;  4QPJ A;  1IK7 A;  4I4T B;  4HH2 A;  5J2T A;  3NTN A;  4LFB B;  4DCK A;  1BGY J;  3QO7 A;  2E43 A;  4O2B B;  4RWU A;  5CBH A;  3SFE C;  3T97 A;  1KMI Z;  4J7J A;  1URQ A;  2O01 N;  3STZ C;  2KXP B;  1JY2 N;  4U3F J;  1YQ4 C;  2QJ1 A;  2ILM A;  5B3S C;  3MHH C;  4MVR A;  3JD3 A;  2AXT Z;  3H1K J;  4RES B;  1HR0 B;  3AE5 C;  3ZHV A;  3HPL C;  5LGT A;  5LOV B;  1MAB G;  2ZYA A;  1P84 E;  1VQ8 P;  1F23 A;  4K35 A;  1ZUQ A;  3ZRV A;  1ZXG A;  3L71 E;  3B4S A;  2YSU B;  1BGY G;  4TWK A;  3N7N A;  1QR8 A;  2D3O W;  2QEX P;  3CC2 P;  4TUY A;  3A8T A;  2OIG A;  4UCO A;  5EYP A;  1LP1 A;  2LR2 A;  1NBM G;  1JMB A;  2AHZ A;  3WG7 B;  3CCQ V;  1R5S A;  4R4L A;  3H25 A;  2CPS A;  2Y0C A;  1A02 J;  4RKU J;  3CMA V;  3IFX A;  1DF5 A;  2WLK A;  4EB6 A;  1RE4 A;  3K0G A;  4J9Y B;  5GTH H;  2BTQ B;  5LHG A;  1T3J A;  2LO1 A;  1BCC D;  3ZJZ A;  1DGS A;  4W4K A;  5H6R A;  1AVO A;  4UUJ C;  1SQB E;  1FZC A;  1OCR B;  3L72 H;  3V6I A;  3EFG A;  2LGW A;  4K8X A;  3ASN B;  4RUE A;  1TUB B;  3CWB J;  5DJT B;  2OGU A;  1OIP A;  5LMN B;  1W2B O;  1H2K A;  1OW8 A;  3LDE A;  1USE A;  5GON B;  3RL0 g;  4DUY O;  1ZL8 B;  4WY4 A;  4DV3 O;  2IX7 C;  3JD4 A;  3TXS A;  4LF4 O;  1S5L E;  1RM1 C;  5B1A C;  4MTF A;  4C46 A;  3ZIA G;  1JPX A;  3DSQ A;  1NR7 A;  3AG1 B;  3K9A A;  1J1D C;  1S9K E;  2FKW B;  4H13 B;  1I5Y A;  4WFF A;  5EZY B;  4O9B A;  3NFQ A;  1VQ6 V;  1NH2 B;  3CCR V;  1HBW A;  1LT9 C;  2UXC B;  2Z5U A;  3EXA A;  5CA1 A;  1WP7 A;  1WNS A;  4MW3 A;  3WU2 E;  5LGU A;  5H9C A;  1GU5 A;  1NTK D;  1MNG A;  2E76 C;  1ZTE A;  4P30 A;  4DR1 O;  1N7S C;  3CX5 D;  4XA4 A;  5GON A;  1AI4 A;  1XMQ O;  2A06 E;  3CRM A;  4MVQ A;  3ICX A;  2WT7 B;  1GTW A;  1B06 A;  4AIL C;  2UUB B;  3ZHQ A;  2PZS A;  4U3F E;  2AXT E;  1SQP D;  1RE3 C;  4G28 B;  4XFJ A;  3H1K E;  1FZC B;  2IBZ I;  4YJ3 B;  2HEP A;  4N23 A;  3TK1 A;  3L71 G;  1DEB A;  3R2P A;  5KJ7 D;  5K1P A;  3J7A U;  1G8M A;  2LGQ A;  4PA4 A;  4KJM A;  1SQP J;  4JI2 B;  3ETD A;  1OHH G;  2YI9 A;  3M99 B;  3ZHT A;  1K5S A;  1L4A A;  4QGP A;  4D7S A;  4FJC C;  4UCT A;  3ZED A;  4G27 B;  1Q81 W;  1PP9 H;  2F95 B;  5EYP B;  3L74 G;  2HVK C;  1N33 B;  3SJB C;  3SWY A;  3PP5 A;  2VWJ A;  2Q6Q A;  1N36 B;  3CC4 V;  4LF9 O;  4LF7 O;  4IL6 H;  3T4D A;  2Z5H A;  2YXY A;  1EN5 A;  3SYP A;  3DGE A;  5BXZ A;  3WUU A;  2QM8 A;  1XL4 A;  2OTK E;  4X9Q A;  4ZNC A;  1LUW A;  1SQP G;  2QKC A;  3VOU A;  2UXB B;  5CCG D;  1Q5O A;  3B77 A;  4DR1 B;  4IIJ B;  2P2U A;  4H0L C;  1W0J G;  2YXL A;  4FLZ A;  1G6U A;  1S0V A;  5KKZ C;  1ROP A;  4EOT A;  2QA4 P;  5LL6 Y;  3NXS A;  2JS3 A;  1IJD B;  4XE5 B;  3K57 A;  1NU1 H;  1S76 D;  1URQ B;  3ETG A;  3U11 A;  2FYU D;  1Y76 B;  2M0B A;  1NTZ H;  1CSB A;  2IBZ G;  2OAR A;  5AW8 B;  4X62 B;  2IJK A;  4DV1 O;  3OEH G;  4I4T A;  1X22 A;  5AVT B;  1XL6 A;  1VDF A;  5B1O A;  4JI2 O;  2YO2 A;  4UVA A;  1PL0 A;  3JAT B;  2C9L Y;  1V9P A;  2HFE C;  4D6T E;  3G4S P;  1NU1 D;  4I9Q A;  2FXP A;  5LMU B;  2OYH B;  1Q86 Q;  2GDS A;  1L0L G;  2HG5 C;  1XNQ O;  4A7P A;  1P84 D;  4FMT A;  4X20 B;  1T8Z A;  1FOS E;  1Y8A A;  1HNW B;  1I5X A;  2IDB A;  4B7K A;  3HD7 C;  4I55 A;  4JTC B;  3L72 G;  4GKJ O;  1QEX A;  3S3W A;  1GTO A;  3RWR D;  4JGS A;  3ABM B;  2LFR A;  3JCU H;  4EDF A;  4FFB A;  3VYI A;  3L73 J;  2FXO A;  4WFE A;  1WMK A;  1NTK E;  1SQV J;  2PYJ A;  5CA0 B;  1Q6I A;  1NTZ G;  2K9J A;  3SJQ C;  3W7S A;  4DV5 B;  5A2Q N;  3IFM A;  1XNR B;  1ZRT E;  5KAI Z;  2YUA A;  1R1B A;  1KIL C;  1NU1 G;  5JH7 A;  3LNM B;  4LNU A;  3WB1 A;  2WT7 A;  3E22 A;  3H32 A;  1KU9 A;  2VQE O;  2W6B A;  2IZ0 A;  1VQP V;  1IFJ A;  3F5T A;  1EZJ A;  4DV4 O;  1NVP B;  3IGA C;  4KXR A;  1FS0 E;  1PKX A;  3K5O A;  4C7U A;  4R7C A;  2ZXE B;  3CCV V;  5IDJ A;  2KS1 B;  4J41 A;  2OYI C;  4JAA A;  3TGU H;  1DH3 A;  4QNH B;  2Q1K A;  3Q2Y A;  1EZV G;  1SQX H;  5KLV J;  3PH0 A;  4B7E A;  5DM6 V;  4FLV A;  3A7O A;  3K5N A;  3QWO C;  1A02 F;  2WPD G;  2XND G;  2XDJ A;  3LSQ A;  4JZ2 A;  3E83 A;  4K8Z A;  3C8V A;  1I94 O;  1N73 C;  4EEQ A;  2R9R B;  3CCL P;  5ITZ B;  4O4J A;  2ZM6 O;  3OMA B;  5TIS Z;  3L72 E;  3JAT A;  1GK4 A;  2QSA A;  2IJI A;  1RQV A;  3D71 A;  4UXN A;  2E5T A;  4ZHQ A;  1Y47 A;  3CCQ P;  2E75 D;  1SQQ H;  1GN4 A;  2HKO A;  1KP3 A;  4K3A A;  3C3S A;  1PZQ A;  4JAS A;  5B1B B;  1VQ7 V;  3ZN0 A;  2PAJ A;  2O1K A;  1N32 B;  1U97 A;  2WWW A;  3HKD A;  5C39 A;  3RVZ A;  4YTP C;  1VQO P;  3T1Y B;  1N8R W;  1QLN A;  1SQP K;  3L70 G;  3OMI B;  3BCC D;  4DR4 B;  3CX5 I;  2V7Q J;  2HPC A;  5L3E A;  3IAO A;  5IWA O;  4CS3 A;  4Q20 A;  2BTQ A;  3ZMT A;  2UXD B;  3OJA B;  1Y4M A;  1DTO A;  1RSO A;  1XMO O;  1EC5 A;  2IBZ E;  3TF5 A;  5EIB C;  3ML0 A;  2WLM A;  2BEQ D;  2Q6A A;  3CWB H;  5L3G A;  1TVK A;  2IPP A;  1NI8 A;  3AE3 C;  3SYQ A;  2MJZ A;  3ETQ A;  1SFC D;  5JJE B;  2HHH O;  3JSV C;  2GM4 A;  4DR3 O;  1VPC A;  1IO4 A;  3MUD C;  2W6I G;  3IC7 A;  3ZS8 C;  2QJY B;  3LW5 J;  1FZE A;  4ASU G;  2XT9 A;  2X6A A;  1FE6 A;  3HUS A;  1FDM A;  1NTK J;  4O4L A;  3CCL V;  2UUC B;  5H2F E;  2Q0O C;  2O3J A;  3RGU A;  2QJP C;  3L71 D;  1ZOY C;  1BCC G;  4B3R B;  5M1B A;  1TGO A;  1MSW D;  1RY3 A;  1YDX A;  3R65 A;  4KL1 A;  1N32 O;  2A3Q A;  1M1K W;  1NTK K;  1S2E A;  1HDJ A;  3HKD B;  3VMA A;  4U3J A;  3D6Z A;  1VQ4 V;  1GDT A;  2D2C C;  1BT8 A;  2IU3 A;  1JMM A;  4PI2 A;  1H2N A;  1CI6 B;  4RQF A;  4HJG H;  1ZAU A;  1X59 A;  1V55 C;  3M7M X;  2HJF C;  2ZXW C;  2A06 H;  1H0T A;  3JD1 A;  2PTM A;  1NWQ A;  5LXT A;  3AED C;  3CP1 A;  3L37 A;  2GV9 A;  2ZE5 A;  1HJ0 A;  4IT5 A;  2HHH B;  1DX7 A;  4LLH A;  3WUT A;  1PNK A;  2CH7 A;  2ZE8 A;  2PI4 A;  1ZLZ A;  5H5N A;  4Y99 C;  3K03 A;  1KC8 Q;  3TCU A;  2NN4 A;  1VF5 D;  3KZI Z;  2RN0 A;  1ZSP A;  4NXM O;  1YJ9 P;  3A0H Z;  3F7Y C;  1FFT B;  3E7K A;  1N86 A;  3AE6 C;  4L74 A;  3JAM N;  5L3F A;  5APS A;  1XIL A;  4OH8 B;  1JB0 J;  4B3M O;  1J95 A;  5LGN A;  1BDD A;  1NOH A;  4WY4 B;  2LW1 A;  2KK7 A;  3U59 A;  3AEE C;  2QKS A;  3VQX A;  4LF8 B;  1YHQ V;  2VRZ A;  4IL6 Z;  2KSD A;  2MKV A;  2YMK A;  1AR4 A;  1E5W A;  5J9P C;  5AVR B;  4JI8 O;  3GWO A;  4I50 B;  3K0D A;  1X79 B;  1DD4 A;  1R6K A;  5IY5 C;  5F2V O;  1SQB D;  1AR5 A;  4DW0 A;  3OM3 B;  1KB9 F;  1AI6 A;  1UFI A;  2WLL A;  2QR4 A;  3FWN A;  3ZHR A;  4LCU C;  5FPR A;  5KLV K;  3C9I A;  4GX0 A;  4J11 A;  3ZHS A;  1SQB K;  2AEM A;  3LW5 H;  4DW1 A;  2QA4 V;  3AEG C;  3K08 A;  3L71 H;  4AYC A;  1HNX O;  4B3T B;  2ITC C;  2DQ0 A;  1K97 A;  3QF7 A;  2EIM B;  1LJ2 A;  2NPS A;  5CJ0 A;  1I0H A;  4HBN A;  4JI7 B;  5E79 E;  5APU A;  1PGQ A;  2H88 C;  4CC6 A;  3I56 P;  4CZZ A;  3MIW A;  4OX9 B;  2ZE7 A;  1BE3 E;  2ADQ B;  2QWN B;  5IT9 N;  3RYC A;  2F4V B;  2R72 A;  3OW2 O;  1PP9 G;  2RJZ A;  3UO3 A;  3CCR P;  3FD9 A;  2IBZ D;  1L4A D;  3NR7 A;  3ABK C;  2NPS C;  2FYN C;  2UWJ E;  2OYH C;  2E74 C;  5FLX N;  4I7Z C;  2W6A A;  1PL5 A;  1RPR A;  2EX3 A;  3ZCC A;  3K58 A;  1IBK B;  2WMM A;  1GM7 A;  3SGI A;  5AVZ B;  4K0K B;  4JI0 O;  3D3I A;  2WSE J;  3VN0 A;  3CCE P;  3BRT B;  3RK3 C;  2R9A A;  2WSC J;  4WF9 V;  5B66 Z;  3TNU A;  4W7Z A;  1X0T A;  4WFA V;  4O2B A;  2X7R B;  1K8A W;  1S72 V;  3ABL B;  2Q0A A;  4BWA A;  2NZ2 A;  1VMG A;  1AVM A;  1ORQ C;  1PPJ D;  3S4R A;  1GO3 F;  2C2A A;  2V1D A;  2GUZ A;  2MW2 B;  4XDL A;  2BTO A;  5IE9 A;  5IYC O;  4OGQ D;  1SET A;  1BSN A;  5IYD O;  2Y0I A;  4L73 A;  5AW9 B;  2DE0 X;  1JUN A;  3C3T A;  4B3T O;  2Y69 B;  3OFN G;  4PV1 D;  1N73 A;  1SS1 A;  1EN4 A;  1H2G A;  1K34 A;  3UIA A;  4RO2 A;  1L0L H;  5TJH A;  3U10 A;  3CMA P;  4PA7 A;  1V54 C;  1NTM E;  3P32 A;  3T1H O;  1BE3 G;  2KSE A;  2YS8 A;  1S1C X;  2IYP A;  3ASO C;  2QJY C;  1SQQ J;  1BS3 A;  4J7Z A;  3BY6 A;  3P8M C;  4JI6 O;  1OZH A;  4GOD A;  4XBF A;  1W2E A;  3HE5 B;  2KB7 P;  5C8Y B;  3W68 A;  4JI0 B;  3CL3 D;  1I08 A;  4TQD A;  2QEX V;  3CC2 V;  4B3S O;  4JQ0 D;  2NR5 A;  3L9D A;  2Q73 A;  2E5Y A;  2YXR B;  3A0B E;  1FXK C;  1L0L D;  2AZ2 A;  4QPK A;  1FFX B;  4N6J A;  4RJT A;  2CTR A;  4YJ3 A;  2RMZ A;  1KIL E;  2O57 A;  4CH5 A;  2ZYG A;  5AW4 B;  3AG4 B;  5KAF E;  1Z56 A;  3SWK A;  2E76 D;  1LWU C;  3Q4H A;  4PV1 C;  3H1L E;  1NGM B;  3LDD A;  2EJR A;  4EFE A;  3LSS A;  2UU9 O;  2LQT A;  1M57 D;  3H1K G;  2BE3 A;  1SQV K;  1VF6 A;  3H1J H;  2EIN B;  5B1B C;  1QLE B;  1XUQ A;  2ZXW B;  1E79 H;  3AEB C;  3LIE A;  1QVF O;  4FLU A;  1MKM A;  1EDI A;  2UXN A;  2N9B A;  1BE3 J;  3F89 A;  3B5N B;  3H1H J;  1PP9 E;  1SQQ G;  5IJ9 A;  4CC5 A;  1ZLL A;  1KKC A;  1SES A;  1NTK H;  4J9Z B;  3FAV B;  5IYZ B;  3RBX A;  2QJP B;  1SLQ A;  1XQ8 A;  1HVV A;  1M8O B;  2R3C A;  3Q1M A;  5EC2 C;  2IBZ H;  4B86 A;  4UB6 E;  2VWK A;  5H6Q A;  3OAA G;  1KYO F;  2XAH A;  4LF9 B;  2WSS H;  4B3S B;  2OIE A;  4GCZ A;  4GYC B;  4TV9 B;  3N27 A;  5EBW C;  2ZKO A;  2I8D A;  1KIL D;  3PHL A;  4IYI A;  4YXW G;  1HWY A;  3A0R A;  2FL4 A;  1JQ0 A;  1RH5 B;  3KHU A;  2DJV A;  4LP8 A;  4GDO A;  3KZI E;  1FJG B;  3BA9 A;  3BHP A;  2KIK A;  4I9W A;  1OW6 A;  1LUV A;  1H8E G;  2JGU A;  1TUB A;  1BZK A;  4P9P A;  2BSK B;  2P58 A;  3AE9 C;  3RYH B;  5AW5 B;  3D36 C;  4PJ0 Z;  4ZOL A;  4C7R A;  2RKL A;  1NJI W;  1OCZ B;  1HGZ A;  3E1R A;  1Q7Y Q;  1AI5 A;  4CH6 A;  4EB6 B;  4D7T A;  1VF5 C;  4ASV A;  1BSM A;  4OGQ B;  1J5E B;  2IFM A;  4JI4 B;  1VEW A;  2OCH A;  2H7H A;  2ZIN A;  3RN4 A;  2LKM A;  1IFP A;  4RAI A;  5EK0 A;  1SQQ E;  5KUK A;  3ZN1 A;  5GTH Z;  4HYT B;  1L2P A;  3P3N A;  2ETN A;  4TUY B;  5CMZ A;  4F6R B;  4F4L A;  1P7G A;  4O2A B;  4FPP A;  3CME V;  3BCC G;  4MVO A;  4ZKP A;  4Z2W A;  3CEI A;  2N04 A;  2HLD G;  4GT1 A;  1LNQ A;  3R66 A;  5KHG A;  1XNQ B;  4IFF A;  1NKZ B;  4UV8 A;  3HTK B;  2F1M A;  3N4X A;  1OW7 A;  5KMG B;  2AHY A;  4GX5 A;  1FAV A;  4Y99 B;  1HNW O;  3VBB A;  3DXR A;  3JAK B;  1JFF A;  1FJG O;  4BIZ A;  1AIL A;  1KFM A;  3VMY A;  1XMQ B;  4I0X B;  4JPZ B;  1OCC B;  3SSU A;  4IL6 X;  2FBW C;  1KQS U;  2OYO A;  3H1J J;  1JCC A;  1NAF A;  3BEH A;  4WVZ A;  4QE9 A;  1U7J A;  2KLV A;  4NPF X;  2A06 D;  3U0Z A;  3H1H D;  3H1I J;  4HB1 A;  2HR3 A;  4JI1 B;  2JGD A;  3H1H H;  5CB4 B;  1H8H G;  1PD3 A;  5BR8 B;  1S5L H;  1RF1 B;  3OT7 A;  4L8J A;  4LF6 B;  1PP9 J;  2H8P D;  1JOC A;  2ZR3 A;  3E86 A;  3X2Q B;  4AI8 A;  2E3C A;  4TV8 B;  2N1T B;  3HB3 B;  1FDI A;  2I1J A;  2RCV A;  4DV4 B;  1QVF U;  3A0B H;  1W59 A;  1X4T A;  4IHJ B;  5GW7 A;  3EFF K;  2K9Y A;  1XHZ A;  4PD4 H;  1OCO C;  1FU1 A;  1P84 H;  3M9B A;  1VQK P;  4DV2 B;  4LF7 B;  1KOR A;  5CCG A;  5BMV B;  1G1I A;  3L75 G;  5L3D A;  3JAL A;  2W6J H;  3SPC A;  3MAQ A;  4GKG A;  3O9O A;  3GW6 A;  2KG7 A;  3AK1 A;  4QMA A;  3B71 A;  4X1I A;  1GN3 A;  3CX5 F;  3CXH I;  3W7W A;  1NQT A;  3ABL C;  3H1I H;  2RH0 A;  3V2R A;  3CX5 E;  3MP7 B;  1JOY A;  3AE8 C;  1ZX3 A;  4E2L A;  4PJ0 E;  4U3F G;  2XAQ A;  3CRC A;  4JYA B;  4MS2 A;  4D6T H;  3K59 A;  1ZP0 C;  1SFC C;  3AE7 C;  1L0N H;  1L8D A;  2FFD A;  4WWI A;  4DV1 B;  3ASN C;  1LTA C;  1TA8 A;  2Y69 C;  2QWO B;  3A0B Z;  5B3S B;  1O9G A;  4M3L A;  3RW0 A;  4LF6 O;  1Y74 B;  3H1L D;  4X65 O;  1KZU B;  3HKB B;  2WA3 A;  1U57 A;  3Q5S A;  1OMI A;  3UT5 B;  1V54 B;  2KP8 A;  1DIP A;  2EBO A;  3RYF A;  5HFL A;  4FM0 A;  1FOS F;  2R5B A;  4Y28 J;  2E5L B;  3CX5 H;  2CTW A;  4KHP B;  1FBM A;  3HR0 A;  4JZG A;  3AG3 C;  2W0X A;  3JAK A;  4O4H A;  1HWT C;  1YXB A;  1E1R G;  1OFC X;  1Q81 Q;  1QGK B;  1VAR A;  2ZYD A;  3CD6 P;  1UPG A;  5IJ0 A;  1Q2N A;  2A7W A;  1NTZ K;  1T5E A;  2PI5 A;  2FYU J;  1ZR2 A;  3MZW B;  4Z1V A;  1YSC A;  4DR6 O;  4JAV A;  2KNC A;  3G3Z A;  3CRA A;  3D70 A;  3CWB D;  2UXX A;  1K7D A;  1M1J A;  5EFW B;  1AP5 A;  1ENV A;  2B9Z A;  1LTJ B;  2FYN B;  2DYS B;  1XTC C;  3SYO A;  3BCC E;  3WB2 A;  2XND H;  3BRV B;  1NTZ J;  3KXD A;  3E8H A;  2QE7 H;  4NTY A;  5KHI A;  3AK3 A;  2EZO A;  2YEV B;  2R70 A;  3H1H G;  2QGN A;  3CPW U;  1T6A A;  3CCU P;  4FLX A;  1IFD A;  4DR2 B;  3QVN A;  4ZOL B;  4LFA O;  1WB7 A;  3CS5 A;  4FZ1 A;  3I55 P;  1FXK B;  5CBO A;  5KHJ A;  1N7S A;  3AG4 C;  1FZC C;  2AXT H;  3PN1 A;  1M9N A;  3CE2 A;  1QVG O;  2ITA A;  4H13 C;  2W6J G;  4WB4 A;  1JMK C;  3ZRW A;  5K1X A;  1OVV A;  1K5Q A;  5CN0 A;  1SC5 B;  1BCC H;  4R50 A;  1NH4 A;  2Y0E A;  1WLE A;  1US6 A;  1NJI Q;  1OXZ A;  4U3F D;  3Q5P A;  1SQX K;  1M1J B;  1EDJ A;  3G71 V;  4BRY A;  4ZI7 A;  3LSU A;  4DR6 B;  1M7L A;  1WA8 A;  1BHB A;  4ZKI A;  2FTK A;  2M6Y A;  5IJ0 B;  1JR9 A;  3OE7 G;  1R5L A;  4GOE A;  4NPE A;  4BR6 A;  1J2J B;  3L74 J;  3QH9 A;  4TQF A;  3MGN A;  3SFD C;  4LH7 A;  2VS0 A;  3AEC C;  1SRY A;  1BQZ A;  3U1C A;  1NKN A;  4OXS A;  1SQQ K;  1VL2 A;  2I1K A;  2JK5 C;  3ZMU A;  1NTZ D;  1ZRT D;  5JQG B;  4DYL A;  4DR2 O;  2JR8 A;  4LFA B;  1YIT P;  1Y74 A;  3V4W A;  4O4I B;  3GHG A;  1FS0 G;  2N05 A;  4X1K A;  1SQP H;  5CA3 A;  1JJ2 U;  4DR4 O;  3MTU E;  1KQF B;  3VOP A;  1XI1 A;  1M90 Q;  3Q4H B;  2B1G A;  4LBE C;  2Q3E A;  2EIN C;  3AG2 B;  2F66 C;  4JYY A;  2B87 B;  3SPG A;  3VP9 A;  3E8G A;  5B1A B;  1IBM O;  2DWE C;  3CYO A;  1ZWI C;  1WA8 B;  3BAB A;  3H1L J;  4CBC A;  5KA6 A;  4UFZ A;  2ZJS E;  1Y6X A;  1WN7 A;  1LT9 B;  1QL2 A;  1GD2 E;  2DQ3 A;  4OX9 O;  1BCC J;  1SS3 A;  3APO A;  3I55 V;  1L4A C;  1JVM A;  3M9H A;  4JI3 O;  1VQ8 V;  1BMF G;  1ZME C;  3OAK A;  2G38 A;  1VQM V;  2VQF O;  3M06 A;  2JJL A;  3CB2 A;  3VQY A;  2O01 J;  4YXW H;  1VQP P;  1KYO I;  4MVS A;  3ZMZ A;  1N7S B;  3N2G B;  3Q5R A;  1PPJ E;  4J80 A;  2XV5 A;  1FXK A;  1VQO V;  3DC6 A;  5LA6 A;  3A5T A;  1THZ A;  4CH4 A;  2DYR B;  4MTX A;  2YEV A;  4LFB O;  1LWU A;  4TLF A;  1QR9 A;  1SQV G;  3V2Q A;  3HKC A;  1UIX A;  3L75 D;  4OGQ C;  3E8F A;  3L72 J;  3V4Q A;  4I0X A;  2EIK B;  1Z2G A;  2ITD C;  3PTZ A;  3E8B A;  4YY3 B;  2DW3 A;  3CC7 P;  3ZMV A;  2P90 A;  2Z0A A;  4CH3 A;  2CAZ C;  2BCC D;  1VQ9 P;  2CTP A;  3T2M A;  4DJG A;  1GMJ A;  1HGV A;  3VQW A;  3RYC B;  2O01 H;  3UO2 A;  2CK3 G;  3B8N A;  3GF7 A;  4O4H B;  3L75 H;  1QBZ A;  1K33 A;  1N0J A;  4G2K A;  4B3M B;  1YJN V;  2PFX A;  2DYS C;  2EUL A;  5KJ7 A;  4LF8 O;  1UII A;  1SQB H;  1TUE B;  5APT A;  4DXW A;  5KKZ B;  1NVO A;  1OCC C;  2QM4 A;  1SA0 A;  3CCE V;  1SF9 A;  3C1L A;  4LH6 A;  2P7J A;  1YIJ P;  2EJ7 A;  3HKE A;  3R4Y A;  4YIO A;  1RQU A;  1BE3 H;  3KQG A;  1IZ3 A;  3FB7 C;  4N78 D;  2FYU G;  1NVP D;  3HRN A;  3RK3 E;  4ZMD A;  1VQN P;  5B5E E;  3A0H H;  5LMN O;  1OJH A;  4JF3 A;  1SQX J;  5KLV H;  2UU9 B;  1KIL A;  1YZB A;  2D2C D;  3ABV C;  3UQ8 A;  2ZT9 B;  3CRR A;  1NZ6 A;  3X2Q C;  3L72 D;  1HNX B;  3CJH B;  1HNZ B;  1YQ3 C;  2N74 A;  4DRX A;  1MV8 A;  1I7F A;  2ARH A;  4X88 A;  4JI7 O;  2V7Q G;  1EDL A;  3M0D C;  1M4U A;  3J81 N;  2CE4 A;  3O8Z A;  2JEX A;  3JAL B;  5APV A;  1SQP E;  2ZXX A;  2FML A;  1HW7 A;  1GH6 A;  1OZ0 A;  2Q7C A;  1NTM H;  5IYZ A;  1OVU A;  2ZVO B;  1PFI A;  3HD7 B;  1J1E C;  3AG3 B;  5CCH A;  4X66 B;  4IL6 E;  3BFR A;  3TSI A;  2UXC O;  4TV8 A;  1H2L A;  4K0K O;  5LHI A;  2PYL A;  2B87 A;  2Q3I A;  1D2D A;  1KQL A;  1SQG A;  2NLJ C;  3GG2 A;  3CCS P;  2QG4 A;  2DMX A;  1VQ5 P;  5FPO A;  5LXT B;  5DEC A;  1F4N A;  3F5H A;  1H38 A;  1SFC B;  4HNA B;  4IFD K;  2ZD9 A;  1CI6 A;  4PA9 A;  1GAX A;  4LR3 A;  2A9H A;  4X89 A;  2JJ1 G;  1N8R Q;  1N34 O;  2WVR A;  2HP8 A;  4U3J B;  3D8C A;  1AV1 A;  2LFS A;  3QNE A;  3JAS A;  5LYJ A;  3CME P;  3STL C;  1M57 C;  3WFV A;  1L0L E;  2XUM A;  3B09 A;  3OMN B;  3FB5 C;  4KT0 J;  1YJ9 V;  4KP4 A;  3WUV A;  2HOD B;  5KMG A;  3HUS B;  2QM7 A;  3L74 H;  5C8Y A;  5IYB O;  5BU5 A;  1Q82 Q;  2OYI B;  3P8C E;  5TIS E;  1PIX A;  4ASW A;  3BAA A;  4H44 C;  4DUZ O;  3B5N D;  4DK0 A;  1MUU A;  1NTM G;  3H1J D;  1N2D C;  4W80 A;  1B3Q A;  2HVJ C;  4PA3 A;  1W5C E;  4DOJ A;  4QIW F;  1L1F A;  4D6T G;  1EN6 A;  3K5M A;  4BW5 A;  1IFI A;  1IBL B;  1KB9 H;  1KQG B;  5AW2 B;  1NYH A;  3O6Q B;  5KTB A;  2OT5 A;  1TVK B;  1R3L C;  1SQV D;  1NU1 E;  1XOU A;  4P2Z A;  2IJH A;  1PGO A;  1VQM P;  1PGP A;  2R44 A;  4U7O A;  3CCJ V;  3JCU E;  3L73 D;  2CGN A;  1CZQ A;  1U7M A;  1GN6 A;  5KHK A;  1HTL C;  4L76 A;  2C9N Y;  2K1E A;  1LTT C;  3JAS B;  4DR5 O;  2POH A;  3L73 E;  4H37 A;  1SQQ D;  2XZR A;  5EIB D;  4DR7 B;  2J59 M;  3APQ A;  1LTG C;  3L70 E;  1DD3 A;  5KJ7 C;  1YF2 A;  3S3X A;  1S4X A;  4JI1 O;  1SFC A;  5HFM A;  2PP6 A;  3TNU B;  1WAZ A;  5BR8 O;  3CXC U;  4GOF A;  3S9O A;  1SER A;  1SZT A;  2D2C B;  3H1K D;  4LWS B;  4TV9 A;  2WPQ A;  1P49 A;  2XAG A;  4I5S A;  3SPH A;  3TJT A;  1SQX D;  3JAR B;  1IZN B;  1JTH A;  4C7N A;  3SYC A;  1W2B U;  1PP9 D;  5FL7 G;  2E75 C;  2F93 B;  3JAW B;  1IBL O;  1Q86 W;  2WIT A;  2R9I A;  2YXQ B;  5IJ9 B;  4RO0 A;  2QKA A;  3FKS G;  4JTA B;  1WP8 A;  3HD7 D;  1CXZ B;  4FIP C;  5KLV E;  2J5U A;  2M5A A;  2NPS B;  1SZX A;  5E79 Z;  3TDK A;  1N7L A;  4NR1 A;  2Q5U A;  5TIS H;  4FVM A;  1MZE A;  2O1J A;  3OTO O;  3UT5 A;  1KB9 D;  1S5J A;  2DYR C;  5IY5 B;  5J2U A;  2QVA A;  3RK3 B;  4DR5 B;  2JRI A;  3CRQ A;  4P9O A;  1JM0 A;  4YJ2 A;  3ITK A;  2XAS A;  2WLL B;  4DO2 A;  4FLW A;  3H32 B;  2CUG A;  3USS A;  4PD4 D;  1PV0 A;  4AQY B;  3GMA A;  1ZN5 A;  4GX1 A;  3BVH A;  2EIK C;  1PV3 A;  1XNR O;  2GA1 A;  5KHH A;  1RFY A;  1MFZ A;  3IN6 A;  5B66 E;  3BA8 A;  1AJQ A;  2K9J B;  2YIU B;  5CBN A;  3H6P A;  5GTI Z;  1COW G;  2G8Y A;  1FZB A;  1CEZ A;  2Q8V A;  1GKF A;  5JVD A;  2RQ6 A;  4X65 B;  5J2U B;  1FD9 A;  3B40 A;  1KYO D;  4X1I B;  2YNY A;  1H2M A;  2KG7 B;  1N33 O;  2FFD C;  1G2C A;  1NS1 A;  2Y9Y A;  1BSH A;  4UB6 H;  5JWP A;  1N36 O;  3WU2 Z;  4NVP A;  1QLE D;  1EZV I;  4BWN A;  2OYQ A;  2Y4U A;  2Y0D A;  4X20 A;  3N2K B;  5APW A;  4X64 B;  3CCM V;  3GLM A;  4C7N B;  1Q6H A;  4MT8 A;  1XRE A;  2UXB O;  2EIM C;  4ZKU A;  3JAR A;  3UCS C;  2EIL C;  3Q3D A;  2L35 A;  2P06 A;  3F5W C;  4J42 A;  1OX3 A;  4EKW A;  1SQF A;  2EZP A;  3K06 A;  2WSS G;  3UKM A;  5KA5 A;  1RF1 A;  2M7W A;  3KYQ A;  5CHX A;  1FXH A;  4JI5 B;  1YI2 V;  4FFK A;  3TYY A;  3AE2 C;  2JGD B;  5APQ A;  1YVW A;  2KLU A;  3OR7 C;  1LTS C;  4WCE V;  4X62 O;  2K37 A;  1QQC A;  1LWU B;  2H3O A;  1NAY A;  3VTP C;  3CPW O;  2ZCE A;  1BCC E;  2H8P C;  3CXH F;  4ZBM A;  1G1X B;  1VF7 A;  3L36 A;  2ZIO A;  1L0N G;  1Y76 A;  1QHT A;  1KYO H;  3AE1 C;  2Q5Z A;  3C90 A;  2NRG A;  2GTA A;  1JCH A;  4NXN O;  3RL0 C;  3W67 A;  1QLE C;  3SJC C;  4PDR A;  2HLO A;  1Y67 A;  2GHY A;  2YIB D;  3H01 A;  1AI7 A;  1N0N A;  4PDV A;  1FC2 C;  3W7X A;  2J58 A;  4U7N A;  2M3B A;  5LMU O;  3B5N C;  5B1N A;  2KQX A;  3OUS A;  3QO8 A;  2QTO A;  4DV2 O;  2JJ2 G;  1BE3 D;  3O6Q A;  1AP6 A;  2M3E A;  2ZIM A;  2P7T C;  1WJZ A;  1GK9 A;  3G9R A;  1JO5 A;  2BOC C;  4O2A A;  1T2K C;  4HYO A;  2JDI G;  2E74 D;  4JBZ A;  5H2F H;  4PD4 F;  1G2C B;  2FY8 A;  1BDC A;  3CI9 A;  5EBM C;  1P84 F;  1IXM A;  1PL4 A;  4IFM A;  4GKK O;  2YKO A;  3SWF A;  3RGB A;  1XBL A;  1L0N D;  1K4C C;  2IH3 C;  2N9Y B;  3BAS A;  3ASO B;  2E76 B;  1RSO B;  4UB8 E;  1MZF A;  3A0H E;  2YIA A;  2FXM A;  2ZAE B;  1JCD A;  1L0N K;  2A06 G;  1QVG U;  2X6B A;  3JSN A;  3G6E P;  1KYO E;  1M57 B;  4MTO A;  2WTY A;  2YIB A;  5BY1 A;  5C93 A;  1U96 A;  1PGJ A;  4O4I A;  5L3C A;  3GHG B;  4CS4 A;  4DV7 B;  1GMG A;  4NTX A;  1JY2 O;  1K9M W;  3TGU J;  4D6T J;  1OV9 A;  1GRJ A;  4HNA A;  3SPJ A;  1OCR C;  1KUQ A;  4UCR A;  3DC5 A;  3G6E V;  2ZT9 C;  3JYC A;  4KHP O;  4PDL A;  1KBH A;  1XTG B;  4DZO A;  2L5G B;  3LNN A;  2IM9 A;  3FYE B;  4LGD E;  2W0F C;  2B88 A;  4HZ3 A;  4YXD C;  2XAJ A;  3OD4 A;  2DOS A;  3M9Q A;  1BGY E;  4EFB A;  3G67 A;  3JAW A;  2OCC B;  4JV5 O;  1G4Y B;  2KSJ A;  1XDC A;  3L73 H;  1I94 B;  3BCC H;  2FB5 A;  1JTH B;  1LTI C;  2KI7 B;  2OTJ V;  3H1I E;  5E79 H;  4H13 D;  4FK5 C;  2IFN A;  1IXB A;  3HUS C;  3K04 A;  2XU6 A;  2F43 G;  2JO1 A;  1J1D B;  1NH2 D;  4H44 B;  1K4D C;  4NXM B;  1KQS O;  5AW0 B;  1F4M A;  3EWK A;  1R6T A;  2HG5 D;  1H0T B;  4DRX B;  3LID A;  1RF0 C; 
#chains in the Genus database with same CATH homology
 2QJK C;  2WSC J;  1ZP0 C;  1WMK A;  3AE2 C;  1OW6 A;  1IK7 A;  3AE7 C;  1ZRT E;  3D6Z A;  4PV1 B;  3R4Y A;  2NZ2 A;  1RQU A;  2D2C C;  1KQF B;  3AE9 C;  3SFE C;  2QIW A;  3AE1 C;  1DD3 A;  1KMI Z;  2ZT9 D;  4XFJ A;  3RK3 E;  4OGQ D;  2YIU C;  1TU3 F;  2BEZ F;  4U7J A;  1U57 A;  1VF5 C;  3Q5S A;  1KTM A;  4OGQ B;  2WPV B;  2D2C D;  1OMI A;  2WQY C;  1FDO A;  2ZT9 B;  3ABV C;  3AED C;  3S9O A;  1DIP A;  2D2C B;  1YQ4 C;  2WSE J;  1YQ3 C;  3AEA C;  1HJ0 A;  4PV1 D;  4Y28 J;  3AE5 C;  5KLI C;  3O6Q A;  5L8R J;  2P10 A;  1VF5 B;  3Q2Y A;  3G9R A;  2E75 C;  1HF9 A;  1S1C X;  2E74 D;  1VF5 D;  2QJY C;  3D70 A;  1OW7 A;  3C8V A;  2OQQ A;  2J5U A;  1S5L X;  2E74 B;  3AE6 C;  4R4L A;  1ZME C;  3H25 A;  1RQV A;  1JB0 J;  1Q90 D;  3D71 A;  4RKU J;  2E75 B;  4H0L C;  2O01 J;  2E76 B;  2E75 D;  3AEE C;  2WSF J;  5KKZ C;  1KIL E;  3Q5R A;  3GF3 A;  4IL6 X;  2FBW C;  2G3A A;  3T97 B;  2MKV A;  1Y9B A;  2E76 D;  2YMK A;  3GMA A;  4YTP C;  1K05 A;  4PV1 C;  2JP3 A;  4H0L B;  1NGM B;  1DD4 A;  1PV3 A;  3FGA D;  2H89 C;  3IN6 A;  3D6Y A;  2V7Q J;  1OW8 A;  3IAO A;  1UIX A;  2QSI A;  4OGQ C;  3RL0 g;  2G8Y A;  2ZT9 C;  3AEB C;  4H13 C;  1MKM A;  1K04 A;  4KT0 J;  2BEQ D;  3AEG C;  1AJY A;  3AE4 C;  1FDI A;  3AEF C;  3AE3 C;  4H44 D;  4YXD C;  2K9Y A;  2FXP A;  1PIX A;  3Q5P A;  4TT3 H;  2H88 C;  4H44 C;  4H13 B;  1KOR A;  4I7Z B;  1GMJ A;  1R8E A;  4H0L D;  3LW5 J;  3Q1M A;  3GF7 A;  2IDB A;  4H13 D;  3GLM A;  4R4M A;  1EXJ A;  1EXI A;  2JO1 A;  3B71 A;  2FYN C;  1KQG B;  3Q3D A;  2E74 C;  1NYH A;  4H44 B;  4I7Z C;  1PL5 A;  3EWK A;  3SFD C;  2QJP C;  3AEC C;  1ZOY C;  2E76 C;  3AE8 C;  4GDO A;  4Z1M H;  1VL2 A;  5M1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...