4I7ZB

Crystal structure of cytochrome b6f in dopg, with disordered rieske iron-sulfur protein soluble domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
159
structure length
159
Chain Sequence
ATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Lipid-induced conformational changes within the cytochrome b6f complex of oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 38
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4i7zB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4i7zB01
2K9YA 2O01J 2QJYC 2WSCJ 5KLIC 2QSIA 5L8RJ 4OGQB 4I7ZB 1Q90D 2D2CB 3C8VA 1ZRTE 2E75B 2YIUC 5KKZC 4KT0J 1JB0J 4H13B 4H44B 2QIWA 2WPVB 2WSEJ 4IL6X 2E76B 2E74B 1S5LX 2QJPC 4H0LB 3LW5J 2ZT9B 1VF5B 4PV1B 2WSFJ 4RKUJ 4Y28J 2FYNC 2QJKC
chains in the Genus database with same CATH superfamily
1EZVE 3CC2V 1NKNA 1H0TA 1U96A 3ABMB 3ABUA 4YJ2B 4CH6A 2GUZB 3ABVC 2OIEA 1EC5A 1V55B 3V5BA 1E5WA 5EYPB 3ZRWA 5C93A 1BGYG 3RBZA 4A5UB 1YVWA 3H1KD 2Y4TA 3BHPA 1HGZA 1VQLV 1M56D 1HF9A 2JKVA 1HVVA 1M90Q 2LQTA 1OVVA 1Y47A 5E79Z 2BE3A 1M56C 1PP9G 1RM1B 1BE3D 1OXZA 3ZRVA 4RUEA 4NXNB 1T3JA 4HYTB 2X7RB 1Z2GA 1VL2A 3H1KJ 4I9QA 4LF4B 3CCLP 3E89A 4HBNA 5FNVB 5LA6B 3M0DA 4GDOA 1L0LG 3CCMV 4N23A 2YXHA 2Y9YA 5AVYB 3GHGA 5BY1A 4PDVA 1EQ7A 1NYHA 4JI3B 3A0BZ 1RQVA 1BE3J 4J7KA 5HFLA 1OCRC 1SZTA 3EXAA 3ZRXA 2W6IG 1KYOH 1PGJA 1H88A 2ZIMA 1RF0C 4IT5A 2OTLP 3ASNB 5AW2B 1IX9A 4LNUA 5HFMA 4J11A 1KQSU 2IH1C 2QG4A 5C39A 3O8ZA 4WBNA 4LC1A 4LF5O 4LF7O 2VQFO 2IJKA 2AEJA 3FWLA 3LDDA 1SESA 2QEXP 5KMGA 2FYUD 4E4EA 1FKAO 3GF7A 4WWIA 1SQVE 3K0DA 1YQ4C 3F5TA 3RL0D 3H1JH 2EULA 2OYHA 3HKEA 3CEIA 2A79B 4U3JB 3SDLA 1ZAUA 5KLIB 3QF7A 2UXNA 2R3SA 4QPKA 2XNDH 2Z5HA 4UXNA 1NTMD 2YI8A 2FYUJ 2E75D 5TJHA 4TQDA 3AEBC 4H44D 1R1BA 3HKCB 5J2TB 2E75C 3NTNA 2IW5A 2OCCB 1V55C 1R73A 3TGUH 2HHHO 4LFCO 3HB3B 2A06H 3UT5A 3AK2A 2PY5A 1L0NE 3Q1MA 1VQ6P 1J1DC 1K33A 3VP9A 5JVDB 1BSHA 3BCCG 1JFFA 1NTMJ 3RK3B 2EILB 3RVYA 3CHXA 1H2SB 1NR1A 2KSDA 4G28B 2R5DA 3O6QA 2YIAA 2ZXWB 1K04A 3L4FA 4EIJA 1H2GA 4MVRA 1G1XB 1MZFA 3H1IH 1GZLA 1ZRTE 2JO1A 5CCGA 2GTAA 4IFDK 5IWAB 1FDIA 3K9AA 2KG7A 5LMUO 1D5NA 2ZYDA 2WPVB 2WSFH 4GX1A 3RYFA 4L87A 3UM7A 1L0LK 4MTFA 3L71D 1EM1A 5AW0B 1IZNB 3X2QC 2R3CA 5AVWB 3L70G 1N8RW 1FBMA 1NTKG 1M1JB 1Z5WA 2LGQA 5H6RA 3L74H 1XBLA 4PA7A 3ASNC 4I9WA 2Q0AA 4GLXA 3E7KA 1URQD 4ZKUA 1XHZA 2L6LA 2ZYGA 2QA4P 2F66C 3OMAB 3L71J 1VQ8V 2E76D 1ZL8B 3L37A 2ADPA 1URQC 2QDOA 2ZT9D 5LBQA 5AG2A 5EC2C 1R8EA 4I4TA 1RFYA 2E76C 2HFED 4X65B 1FJGO 5AVQB 4O4JA 3L72H 3TXQA 2VS0A 2ZT9C 3I56P 5EBLC 4GKJB 4TV8B 1K3EA 4ZIBA 2HFEC 5KUKA 1RE4A 1GKFA 2H94A 3P30A 2JS3A 1LTJB 5KLIC 1H2KA 3ZMTA 1WP8A 1O9GA 2M6YA 4GZRB 4X20A 2F4VB 1LT9A 2N9BA 2Y48A 2CTPA 4DUZB 1ZMEC 1A32A 4GX2A 3JALA 3CX5H 3SPGA 1T3UA 2LXBA 2FL4A 3VMZA 4YPCA 3TYYA 4ASWA 1F7YA 4X62O 1JCCA 1DF5A 2Q6AA 3TSIA 4AI8A 1QQCA 2JEUA 2QM7A 5CBGA 2G8YA 3L73G 4FZ0A 1YHQP 1GN4A 3BPZA 2QE7H 2QSAA 1BHAA 4I50B 3E1RA 4NTWA 1SVFA 4QMAA 1N73A 2JEXA 1LJ2A 5KLVE 3CS5A 2POHA 1QEXA 4TUYA 1OW6A 2CTQA 1EN4A 1YITV 2Q6QA 3G6BA 1XMQO 4DV2O 3THOA 2M8RA 3SSUA 2JDIG 1IBMO 4W80A 3B71A 1JMKC 1QU7A 1N0JA 4UCSA 3H1HG 3V2QA 4F6RB 4LFAB 2BCCE 2GTSA 4MSWC 3GMAA 2UUAO 5LYJA 2WSCJ 4L8JA 3SGIA 1WJZA 3M91A 5AW5B 4W4KA 4FLVA 1QVFU 3ML0A 1UIXA 1NTZK 1AJQA 1USDA 4N78D 1NGMB 2C9LY 4X66B 5KHKA 4H13B 3B5NA 1R3LC 1AI7A 4LP8A 5AW6B 2W6JH 1O9HA 1OJHA 2ITCC 4YTPC 2UUBO 4RAIA 5H5NA 4NTYA 1K34A 4ASUG 4DR3O 4ZKPA 2KLUA 3WU2H 1H89A 2WTYA 5B1BB 5BU8B 4LF6O 1VQMV 3C9IA 2HLOA 3V4WA 1HNZO 1BSMA 1OZ0A 5KA5A 2PTMA 4WFHA 5TISE 2WLHA 1L4AD 5LP6C 2CUGA 3AE8C 1UIIA 4D6TE 1SFCA 3CX5I 4U7NA 2Q4PA 1S76D 1L4AC 5EK0A 3K04A 1KYOD 2KLVA 2Q73A 3FAVA 4L74A 4H0LD 2YC0A 3TDKA 3VMYA 3N2KA 4UB8H 3N2GB 2X6BA 3SJAC 4UFZA 5K1XA 4H0LC 3DC6A 1XI1A 1N4CA 5CCHD 4BWAA 2FYNC 5CA0B 3AE6C 1NTZH 2YNYA 1R3KC 1S5LZ 4FFBB 3I55P 4Y99B 3KDPB 5JVDA 2P2UA 5CCHC 5LGUA 4LR3A 2EINC 1N7LA 1PM9A 4LBEC 3H1JD 1VF6A 1Q86W 2XASA 4HYOA 2XAHA 4DV6B 3A2AA 3T97A 3G6EP 3FGAD 5CJ0A 3V6IA 1OCOB 2WLIB 3ETQA 1ENVA 1BCCG 3JCUH 3HUSA 5IE9A 2L5GB 4DO2A 2CH7A 1N2DC 5JQGA 2ZE8A 2R9AA 1FAVA 2GV9A 1KC8W 2Q1KA 1NJIQ 3L75G 3OA7A 3ZDMA 1U57A 3H1JJ 2LFSA 1SQXK 2XNXA 3ABKC 2A06D 1YYCA 2YIDA 3S3XA 1NWQA 1SQQK 4O4HB 4NXNO 4DR6B 4N6JA 3KCXA 1FXKA 4ZI7A 2OTJP 1LTTC 3CX5F 4IYHA 4HH2A 4EFBA 4FFKA 3W7UA 4JPRA 1OVRA 3H1ID 2K1EA 5CB4B 3S3WA 3K57A 3HKBA 2EIKB 3B2EE 4O9BA 5B1BC 1GL2D 1U7JA 2NPSA 3SWFA 4Q6GA 2QSIA 1DLBA 3ZMVA 3OR6C 4R6ZA 4RUFA 1GL2C 3OFNG 3HD7A 1SRYA 4O4IB 3RK2B 1FZCB 3ETEA 3H1IJ 1Z5VA 4YIPA 3ZJZA 1VF5D 3WG7B 4K8XA 1SQXH 3L74D 1Q81Q 2XZRA 1KV4A 1P4RA 2WSFJ 3JAWA 1ZXGA 3AG2C 2H8PD 1VF5C 3A7OA 2Q9LA 1MMMA 3RYCA 4FM0A 1BGYD 3UO2A 2IZ0A 1SQQH 3B4SA 3BRCA 1Q6IA 1P84H 2ZKOA 5EZYB 4JYYA 3Q5RA 2H8PC 4LF5B 4LF7B 3OW2U 4Y99C 2HJDA 2H3OA 2HODA 2YIUB 1QBZA 3G71V 2QA4V 1N32B 4U3FG 3L74J 2ADQB 1M7LA 1PP9D 3AK3A 3ZCCA 1OIPA 2EZOA 2JIZG 5LXTA 5A2QN 2QJPB 1Y67A 1OHHG 1BGYJ 2P7JA 1NU1G 4DK0A 4RQEA 3N27A 2KUBA 3CWBE 1L0LD 1XNQO 4KXRA 2QJYB 3USSA 1YJ9P 3OMNB 2QJKC 1Y76B 2A45G 4TT3G 3CRAA 4MVZA 3A5TA 1PP9J 4OWFA 3MHHC 3F89A 2D2CD 2Y0EA 3Q2YA 2IU3A 2O01N 4X1YA 3C8VA 2QKAA 1IFJA 4PA4A 3S9OA 2D2CC 1PL5A 4LFCB 2IM9A 2Y4UA 2M5AA 2B5UA 4LWSA 4MT8A 1L0LJ 1K73Q 5CMUA 1SA0B 4TOIA 1SQBK 3CXHD 2GM4A 3CCUP 4JTDB 3AG4C 1KKDA 3SPCA 3CMAP 4Y28J 4OPHA 3MIWA 3VQXA 5FPOA 5AW8B 1RSOA 4HJGH 3F5HA 3ITKA 1AQTA 4JF3A 3T1CA 3Q3DA 1LUVA 1KILB 2P90A 1FS0E 1XHXA 4P30A 3IC7A 5AVXB 4C46A 4PJ0Z 5GTIZ 3AG7A 2H43A 3JATA 4A7PA 2QWRB 3H1LG 1YJNP 1WAZA 5B5EZ 1EZVG 1F51A 4K35A 3RK2C 1VQ7P 2HPCA 1W0KG 1NKZB 2YIBA 3S4RA 4J80A 1S0VA 1FOSE 1BE3E 4WVZA 1HNWB 4X65O 3G9RA 1P84I 3Q4HA 1GK9A 5KAFE 1M1KW 3CSXA 1ZOYC 1SQBH 3W67A 4CZZA 5IJ0B 1OW8A 2YO3A 2V7QH 1T8ZA 4UVAA 4FFBA 4BR6A 4YIOA 1XREA 2PYLA 1ZUQA 1S77D 3TJTA 4DUZO 2E74D 1KMIZ 3U59A 1DX7A 1HWTC 1S9KD 2G3AA 3CRMA 1FJGB 5JCOA 1OX3A 1NTMH 2QJPC 2UXXA 3M7MX 3ZBHA 1N7SB 4UB6Z 1IK9A 2E74C 2KOGA 1JY3O 3JAKB 1FAFA 2GHYA 2KS1A 4IL6E 4XA4A 1SQGA 4BIUA 1X79B 2VWKA 1RF1C 2QJYC 2A9HA 1ZSPA 3MHVA 4XDLA 3LUTB 4B3SO 4DR2B 1PPJE 1BDCA 3TCUA 2FKXA 5LMNB 1AROP 1LTAC 2FYUE 3STLC 3L70D 5KTBA 5CJ4A 2CK3H 3Q5PA 3JASA 4X62B 1FDMA 2VQEB 4NPFX 3ICXA 2XKMA 1CP9A 3IF4A 1SS1A 1QL2A 4B7KA 5J2UA 4WY4A 5L3CA 3RL0g 4ZMDA 4E2LA 2YO2A 2AGAA 3M8AA 1PGPA 3DGEA 1UFIA 1S1CX 4IFMA 1DD4A 1W2BU 3L70J 3DSQA 3HE5B 3L71H 4LF9O 3F7YC 4WF9V 1XMQB 3K5OA 3KZIH 3PLNA 1SQVG 4DV2B 1CEZA 1MNGA 3AE9C 2IDBA 1IBMB 1JR9A 4TWKA 5APTA 4NTXA 2ETNA 3SWKA 4J9YB 2KB1A 4DR7O 4X66O 5K1PA 1TU3F 2UU9O 1Y66A 3BEHA 1ZLZA 5BR8B 3CCVV 2UUAB 1M56B 2Q7EA 3ZIAG 3ZS8C 4JI8O 2RQ6A 5B66H 5KJ7A 2N1TB 1FFXA 1HTLC 1JO5A 1N36O 4ZOLB 5B5EH 1HW7A 1MV8A 1L0NG 3A0RA 2K9JA 2Y0PA 2UUBB 2P4VA 2WLJA 2OTJV 3K5MA 1GD2E 1GTOA 3CCJP 5BU5A 2AXTE 3KCYA 4AUWA 1JA8A 1OCRB 1S2EA 1JCDA 4LF6B 4I6MC 1PKXA 3KXDA 1N7SC 3W68A 1HNZB 4CS3A 1KD1Q 1I94B 2P22C 3RT3C 2CTRA 2YEVB 3OAAG 3M0DC 1WB7A 3VYIA 3K5BA 3MP7B 5APVA 3CCRP 3SJQC 3RYIA 1MFTA 3H1HD 5GTHE 3GHGC 1G2CB 2ZXXA 2WPQA 3SFDC 3NFQA 1ZR2A 2E42A 3SPIA 2YKOA 4JPZB 3IC9A 1YQ3C 1SQQD 4IL6X 2PGGA 5KAIE 4AQRD 4G2KA 4GX5A 3HKDA 4WFGA 3CJHA 3H1HJ 3APOA 2I1JA 3RL0B 4MVOA 2Q0OC 3RFRA 1OW7A 1SQPK 3CYOA 2PRRA 4FLZA 3R4YA 3P7KA 1Q7YQ 1FDOA 3H32B 1SQQJ 2OCHA 3AEEC 1Q82Q 1QGKB 2EZPA 2E75B 1G4YB 1Q8IA 2LFRA 2B87B 1K9MW 3BY6A 1XMOB 4KFMA 4H44B 2WT7A 5AW7B 3RK3E 3MDSA 4O2BA 4DR6O 1FZAA 1J1DB 2BTQA 5AW9B 3LW5J 1YJWV 1EFRG 3ZMUA 3JAMN 4BRYB 1IFPA 4IHJA 2WQYC 3C90A 2N1TD 1IK7A 2RN9A 1VQ5P 1JY2O 1QL1A 3G4SV 1HP8A 3CRRA 4L73A 3TF5A 1Y6XA 2N1TC 4JV5O 2KQXA 4JTCB 1LTBC 1THZA 2ZDIA 4XDJA 1R3IC 1JY3P 3A2FA 4F6EA 4JF7A 2BSKB 2GDSA 1PL0A 2PZSA 2IBZH 4YXDC 4AYCA 1SQPH 4HNAB 4CPGA 3OM3B 2FFDA 3X2QB 5KLVG 1L8DA 3GW6A 4X1KA 3LNNA 4UCOA 3DXRB 4XDKA 1EDKA 1XTCC 2YXYA 2R5BA 2H7HA 1M9NA 2HP8A 2LR2A 3VMAA 4O2AA 2PUSA 4JI6O 3CC7P 4DW1A 2W0XA 2QWQB 2J5UA 4N78E 4O4LA 2AXCA 3U0ZA 2IPPA 2Q5ZA 3QNEA 1U7MA 3HTKB 5AVRB 1H8AA 4GOFA 2OYIA 4AQYO 1URQB 4IYIA 3ZHVA 1YJNV 1N32O 2BCCG 2E76B 5APQA 1VQ4V 4PHZA 2F43G 2ZT9B 1SQBD 5APUA 1PV3A 1I5YA 4NVPA 3RN4A 2JWAA 2E5YA 2DW3A 3RL0C 1WPBA 5EC1C 1NAFA 4B86A 2LW7A 4I7ZB 2MW2B 4LGDE 1TVKB 5BMVA 1DEBA 4CC6A 3LNMB 4N3YB 3J81N 2DYSC 1SQBJ 2V7QJ 4BAYA 3D3IA 4I55B 1B3QA 3N4XA 3CMEP 1RE3A 5GONB 4H44C 2W90A 1RE4C 2QRXA 4XBFA 1XNQB 4EB6A 2C9NY 3P8CD 1M90W 5FPRA 4Z2WA 1WA8B 4D6TG 4XE5B 2O01J 2KKWA 1GM7A 1K5SA 3E22A 3K9SA 1N86A 3H1JE 1G1IA 5L3GA 2ZM6O 4BW5A 3PN1A 4DYLA 4ZHQB 2PAJA 4YXWH 1S5HC 3G80A 5B1OA 2ZVNB 2YI9A 4MVSA 4FMTA 2IBZI 5E79H 4J42A 2IFMA 2JR8A 1N73C 1YIJP 3W7XA 5JH7B 4BIOA 4X89A 1H8EG 3K06A 4RO2A 3TETA 2B1IA 1KYOI 1XL4A 2P5OA 3TGUE 2A06E 1AVYA 2HLDG 5TISZ 2PYJA 4B7EA 1HNWO 4WB4A 3A0BH 2UXBO 1RF0A 1Q90D 1WRGA 3H25A 2DOSA 3D36C 1J1EC 1J5EO 1BGYH 1H2MA 2OTKE 3JD3A 1WLEA 1ZN5A 3H01A 3VQWA 5IJ9B 1GM9A 4EOTA 5CBFA 3P32A 3CP1A 2I8DA 2YSUB 3Q5SA 1PP9H 4TV9A 2QJ1A 5LHIA 1VQ9V 5ITZB 5LP6B 1VQPP 4YJ3A 5F2VO 5L3BA 1KECA 5LOVA 3IAOA 4X88A 2WA4A 3WUUA 2YKQA 1GN3A 2F1MA 1L4AB 1IVSA 1L0LH 2WSEH 4DR2O 1KN7A 4QE7A 4I7ZC 2QKSA 1JUNA 1Y74B 5LMNO 3BABA 2WITA 4JQ0D 4FZ1A 3L74E 1AP5A 4YJ2A 2GUZA 2ZR2A 1GMGA 1OFCX 5IDJA 1NAYA 1JY2P 1SFCD 2KI7B 4H0LB 5KX5B 2VQEO 2B9BA 1AI5A 1HDJA 1ZP0C 4LH7A 3AECC 5DN6G 4J7JA 2FYNB 3TXSA 5EYPA 1VQNP 3OMIB 3SJCC 1SFCC 4B3SB 2LO1A 3H1LD 3CXHH 4DV1B 4IFFA 3CCRV 4OGQD 2OIGA 2EINB 1KYOF 3L72E 2ILMA 5E1AC 4OGQC 4J7ZA 2XTAA 3CCEP 4FPPA 2ZE5A 2KK7A 3JSNA 1DGSA 3CC4V 2Q9IA 2SPZA 3AE2C 3H1LJ 2B89A 3CX5E 3QG5A 4CH5A 5FNVA 5LA6A 5H9CA 2V4DA 4FLUA 1NR7A 1QVGO 2WPRA 4RKUJ 5BXZA 1YIJV 1FZBA 4LF9B 5BR8O 1RH5B 1VF6C 3ABKB 3PJSK 3MGNA 2WSSG 2WLLB 2OWOA 3HE4B 5KKZB 2C2AA 1KKCA 1YI2P 3SYQA 1MZEA 3K5LA 1NTKK 5H2FE 2ZIOA 2PI5A 1KQLA 1FFTB 2Q3IA 4DR7B 3U11A 4DRXB 3HUSC 2UU9B 3CWBG 1S72P 1SF9A 4R50A 2N9YB 1AV1A 4DV0O 3OE7G 3ASOB 3FB7C 3PP5A 3BCCH 4C7NB 1PZQA 4JI8B 1HNXO 2KSJA 1VQKP 2Z0AA 1N36B 4W7YA 2AHYA 4LCUC 2XV5A 1I94O 1IDSA 2IBZD 2DYRC 1FXKC 1GM8A 5CMZA 1EBOA 1SQPD 4FM1A 1GL2B 4IIJB 2UXDB 1S3JA 1UJWB 1G8MA 2NLJC 4U3JA 3CCLV 1XTGB 1EDIA 2FXOA 2NPSD 1RHZB 4R7CA 3AG1C 2QR4A 2RN0A 1EN6A 3AG2B 3HKCA 3FKSG 1VF5B 5J2TA 1AVMA 2NPSC 2UXCO 1DF4A 3L70H 5CA1B 1K7DA 1SQPJ 1KB9H 1FS0G 1NTKH 1NQTA 4JI1B 3CRCA 5LHGA 3CXHI 1GW3A 1KP3A 4IGGA 3CC7V 4IOIH 5KHGA 2OTLV 1WMKA 3H1KG 3BATA 2KSEA 1N33B 3WU2E 2CPBA 3IFMA 4UV8A 1P7GA 5M1BA 3JCZA 2QEXV 1T6AA 1AR5A 1BE3G 1XMOO 3UQ8A 1KQSO 3BFRA 2HYNA 3JARB 2CGOA 1Q6UA 2ZVOB 2QJKB 4X9QA 1SS3A 1L1FA 4UB8E 1X59A 3CL3D 1LR1A 5IYCO 1VARA 2NR5A 1TUEB 2D2CB 1NTZE 2MKVA 2CTWA 5KKZC 1Q43A 2IJHA 1LWUB 1M1JA 3JD4A 3AG4B 1TUBB 1K97A 2P58A 3L73H 3CCSP 1GK6A 4JI2O 4JI7B 1VQ6V 3D6ZA 3ASOC 2KZIA 3BAAA 1PPJG 4CH3A 3K79A 4I2LC 2ITDC 2M3BA 1XL6A 2PI4A 1ZL8A 1KILE 1OVUA 1OCZB 2QM8A 1D5AA 2ZINA 2FYUG 3K03A 5KAFZ 4JV5B 1AJNA 2JGDB 1R6TA 2FTKA 4Z1MG 3JCUE 2ZAEB 5EFWB 3DTUB 3ZHQA 3CXHF 2JEEA 3B8EB 4TV8A 3AEFC 5IYZB 3SFEC 2IX7C 1IJDB 2JDIH 2BOCC 1CI6B 5JJNB 2DJVA 1A02J 4JI4B 1XDCA 1LTJA 3JSLA 3H1HH 4UVCA 2C0WA 1XOUA 1Y74A 3LDEA 1WP7A 4IL6Z 4JI6B 1KB9I 4I1LA 1K8AQ 3IGAC 1BZKA 4PA9A 3F7VC 2YIBD 4X1IB 3ZHRA 2DE0X 1OMIA 4OH8B 3EWKA 4AQYB 1KQGB 1VQOP 3A8TA 4FLYA 3CWBH 4I50A 3L9DA 4AILC 1E1RG 1X22A 1JTHB 3LW5H 2DQ0A 2PF4E 3STZC 1PIXA 1S5LH 1WB8A 2P06A 1OCCB 1YSCA 2BTOA 2E74B 3RYHB 3M99B 4PDMA 3TNUB 2R9RB 3I56V 4ZKIA 3CC2P 1RF1B 1YEWA 2FY8A 5C8YB 1S4XA 4W4LA 1NJIW 3VQVA 2IJJA 1SQXE 4CC5A 3ZN0A 1NBMG 2O57A 4F6RA 5JCOC 2AHZA 1QR8A 4NB5A 2Y9ZA 1SQQE 3J7AU 3KG2A 1AR1B 2Z5IA 1P84E 3QO7A 3ETDA 4WFAV 2WSEJ 1CXZB 3K58A 5AVTB 3QH9A 4MW8A 1LWUC 1JMBA 4PI2A 1YHQV 3R65A 4X64B 1ZR4A 5B1AC 1I0HA 3P3NA 2PFXA 4B3TB 1QCEA 4MN4C 4WFFA 2BCCD 5A9GA 1HR0B 3A0HE 3WB2A 1OCZC 2DWDC 2ZM6B 2AEMA 2BEQD 3CCMP 1LNQA 2JWDA 3MD0A 3BVOA 1TGOA 3UKMA 1FU1A 3H1KE 2H88C 4UCRA 2FXPA 2H89C 1AVOA 4JYAO 1SQFA 2AXTZ 4JYBA 1H0TB 2Q3EA 1BCCH 2BCCJ 1CZQA 1Q81W 3W7WA 3F5WC 4HAMA 1LT1A 3L75H 1BDDA 4FVMA 4WCEV 3MUDA 3N2GA 3ZRWB 2UXBB 4JGSA 5GTHZ 4TSFG 1J5EB 1JCHA 3FXEA 3MTUE 3HPLC 3VP8A 3BCCD 1R5SA 1LUWA 5CA0A 3UIAA 4MS2A 1W59A 1Q5OA 4H33A 4QGPA 1BS3A 1SP4A 5KJ7D 1AILA 5KAIZ 1E79G 3ZRSA 2Y0IA 4KL1A 4PD4H 2W83C 3OR7C 5B3SB 1QVFO 4NXMB 2O01H 1OCCC 2YXQB 3MHSC 2FYZA 3BCCJ 3T4ZA 4QJFB 4B3RB 5IYBO 1BSNA 3LSSA 4P9PA 1NU1K 1M57B 3GHGB 2FB5A 1I5XA 4WFEA 2WLIA 2IZ1A 3QO5A 3SPJA 4DV1O 2EIMC 3H9VA 2UUCB 2BOBC 4RQFA 4Q20A 5CA3A 2Z3YA 4QIWF 1WT6A 3FX7A 3B40A 3GVMA 2D3OW 1KB9D 1LTSC 1NH2D 1NTKD 1K73W 3P8MC 1SQBE 5FL7G 3PHLA 2Q67A 3C3TA 4UCTA 4LNUB 1KBHA 1IC2A 1GU4A 5BZBA 4DV4O 3CPWU 4O4HA 4WBNB 3E8HA 3BASA 1MABG 2XUMA 2K9YA 5BVZA 1NTME 3EFFK 1EXIA 3OT7A 5KMGB 3I55V 1NTKJ 1URFA 4WFBV 2JJ1G 1U97A 3VBBA 4U3FH 2ZNJA 4UVBA 2M0BA 1P84F 1K4DC 2OYHB 3ZMZA 5CB4A 3HKEB 3E2EA 1QR9A 4LF8B 3OUFA 2QIWA 4DV3B 4EI2A 2JK5C 3B8NA 1MA1A 2XT9A 3R2PA 3E86A 3G6EV 4PV1D 1NU1H 4JAUA 1SC5B 4U7JA 2GBOA 4B3MO 2RNBA 4OXSA 3BRTB 3EHBB 4O4IA 2KXPB 2A45H 1ZTEA 1FZCA 4TT3H 4RO0A 1W0JG 2NN4A 4PJ0H 5GTIH 4JZGA 3UT5B 3P3PA 3L73D 1ZWIC 1MSWD 1JFFB 2YXRB 3KHUA 2UWJE 1VQ8P 4DV0B 5AW3B 5EZYA 2OGUA 2UXDO 3FFQA 3L71E 1WPXA 1J95A 1LTIC 1Z56A 3KZIE 4PD4I 2JRIA 1HNXB 3T1HO 2PGDA 2ZCEA 4G27B 1JTHA 3H1JG 3L73J 5B3SC 4AHCA 1RPOA 3QTCA 1M57D 2KG7B 3T4DA 3GWKC 3OEHG 1M4UA 1PNLA 1YTFD 4CH4A 3C3SA 2K37A 4JI1O 2XNDG 3RYFB 1DIPA 1M57C 5CBHA 3VTPC 1AA0A 4RWUA 5B66E 3UCSC 1NH4A 1JQ0A 4DXWA 3CXCU 4UB6H 2FFDC 1Y76A 1N33O 1FJKA 3H1LH 1KZUB 4NPEA 3OD4A 2XHBA 1EZVH 1J2JB 2GA1A 3TGUG 2UXCB 2EJ7A 4NYKA 2A06G 1KUQA 1FZEA 3TK1A 2ZXEB 3HRNA 2OQQA 1MFZA 3CWBD 1JPXA 2LW1A 1CSBA 1SA0A 1PL4A 5KHIA 2OYIC 1R6NA 2FMLA 3LIDA 3M06A 4GIFA 1YITP 2J58A 2GUSA 3I5DA 1YBKA 2ITAA 1QHTA 4I4TB 2DYSB 2XAQA 1JX9A 4O4JB 1JY3N 2C0XA 3AEAC 1H8HG 4DT0A 5APWA 2LP7A 1AB3A 5LGTA 4HB1A 2OYHC 3OTOO 1HGVA 1SQVK 3CWBJ 1KILA 3E8FA 3OW2O 5L3FA 4GKGA 1LT9B 4X20B 1S5JA 2A45I 3JALB 2DMXA 4JI7O 2RH0A 3B09A 3WFVA 1YJ9V 1T2KD 2ZYAA 3SPHA 2ATKC 4GKKO 2YUAA 1XUQA 4R4LA 4K8ZA 3OGCC 3RWRD 3L74G 4PDRA 1RE3C 1T2KC 4EEQA 3RBXA 5CBOA 4EDFA 1EZJA 3VN0A 3AK1A 1COWG 2HVKC 3VOUA 4DR1B 1RY3A 2R44A 3B77A 2BASA 4NPDA 4QNHB 1GDTA 3K0GA 1H2NA 4JI2B 1N73B 1LP1B 5IJ0A 4M3LA 1L0NK 3CCUV 4TUYB 4JI4O 5CCGD 3CMAV 1IBLO 3L72G 3H6PA 1KD1W 2OYQA 2WA3A 4TQFA 1VQMP 1GU5A 1PNKA 5CCGC 1OZHA 2VRSA 4BWNA 4TLFA 1N7SA 1XQ8A 3IJ4A 3FB6C 3CD6P 3O65A 2P67A 1SQVH 3JAKA 3E35A 1BCCD 3B8MA 4UCVA 1J1EB 2KNCB 3LDCA 4JTAB 1R5LA 3ZHSA 3L75D 3PRJA 3LSUA 4PI0A 1EZVI 1BHBA 1QLED 4JAAA 5LYJB 1F4NA 1VQ7V 2V4HA 5D5QA 1QLEC 2A0LA 1GH6A 1ROPA 1VP7A 1X8YA 2QE7G 1US6A 3O9OA 1BCCJ 1Q3EA 1N8RQ 4YY3B 3CI9A 2IBZE 1F23A 4ABMA 1K05A 3B5NB 1SQPE 2Y69C 4DR5O 1Q7YW 1OV9A 3L75J 3JYCA 4PD4D 4OX9O 3AG3C 1PPJD 1GMJA 1L0NH 3OGIB 1Q82W 5EBMC 1KYOE 4QPJA 1IBKO 2XAJA 4GUNA 2Q7GA 1K92A 2EIJC 2QWPB 1I7FA 4JI5B 3HR0A 2ZQMA 1LTGC 2WPDG 1SKVA 3U1AA 3HE5A 3JC22 1V54C 2WAMA 1PNMA 1SERA 3JD0A 2P10A 3IN6A 1XNRB 1WN7A 4KP4A 1SFCB 3D8CA 2HKOA 1AI6A 1IXBA 5L3EA 1LT9C 2JS5A 3EVKA 4X64O 3L35A 4DZOA 3FAVB 2J59M 3N7NA 1JNMA 2QGNA 3N2KB 1M8OB 4B3TO 3ABMC 1KP2A 4OGQB 3WUVA 5D5PA 5H2FZ 1HR0O 1MSDA 2Q5UA 2WLNA 5EIBD 2WVRA 2VWJA 2ZR3A 1JB0J 1DD3A 2N1TA 3WUTA 4J41A 5EIBC 3ZHTA 4ZOLA 2W6JG 3FXDA 2W6AA 4U3FD 5IY5B 3V2NA 3D6YA 5APSA 3T97B 1MZ9A 1FPOA 5KLVK 2M7WA 4MVUA 2R70A 1TAEA 1RM1C 2JJ2G 1NU1D 1PGQA 3CPWO 5J9PC 2WPSA 1L2PA 2B1GA 3CRQA 1ZW0A 1FZGA 5K5GB 3HUSB 2K88A 2YEVA 4CS2A 4JYAB 2CH7B 2Q69A 1FZFA 4U3FJ 5JQGB 1W2BO 1JY2N 1G2CA 4DK1A 3H1IE 2R9IA 1JM0A 3CCQP 1SLQA 1NU1J 2R72A 4NR1A 1M93A 3B5ND 4CS4A 5E79E 1V9PA 4NXMO 4YHHO 1NTZG 2WWWA 2DYRB 3QVNA 1FXKB 4ZI7B 1XEQA 3ZMSA 1EDJA 1BT8A 1YZBA 3B5NC 2L91A 3WU2Z 4B3RO 4I5SA 4PDLA 4JI0B 2R32A 3G71P 3R66A 4MVQA 1LGHB 3ZHUA 1JJ2U 1YDXA 4JYCA 1AJPA 3AG1B 2UUCO 2KIKA 3H32A 1SETA 3HKBB 3A0BE 2EX3A 1G6UA 3GG2A 3ABLB 5KLVH 3CCJV 2NPSB 1GRJA 3FB8C 1BGYE 2B87A 4X8AA 4KHPB 2HG5D 4UB8Z 3HD7B 4K0KB 3II6A 1ZV8A 1K5QA 4GCZA 5IT9N 3FWNA 3G3ZA 2Q7CA 1EZVD 2HG5C 1VMGA 2IJIA 2ZE7A 3EQ2A 4D7TA 2K9PA 4KUMA 3M0AA 1Y8AA 4BRYA 1PP9E 1ZX3A 1IO4A 3JAWB 1IZ3A 4D7SA 1IFMA 2IFNA 4DV7O 3WB0A 2G38A 3RYCB 1NVPB 2BCCH 3VOPA 2OCCC 2ZE6A 4DV4B 2FBWC 2LXCB 4KHXA 2MK3A 4MVMA 2RKLA 2CDYA 3RK3D 1QNMA 4LF8O 1L0LE 4DV3O 1EN5A 2ZFCA 5FLXN 2HODB 3VQYA 1MOFA 5H2FH 2HVJC 2BSKA 3RK3C 2YMKA 2EILC 3D70A 1P49A 1LP1A 4C7UA 3K59A 5LXTB 2P6JA 2P4KA 3JCUZ 4HNAA 5B1NA 5IY5C 2E5LB 5KUMA 2VRZA 1N34O 4DR4O 1NZ6A 5L8RJ 2ZXWC 3DXRA 5H6QA 2XAGA 4PA6A 3CXHE 1Q86Q 1YTZT 2W6BA 3FYEB 3K08A 4FIPC 2KYVA 3D36A 1QLNA 2JP3A 1NOHA 4B3MB 2KNCA 4LLHA 2O3JA 4DUYB 2QWOB 1XILA 5TISH 2QWNB 3HTKA 1SQXG 2AW9A 2B88A 2F93B 3NR7A 4X1YB 4D6TH 1W2EA 1Y9BA 1URQA 3U1CA 4NKGB 1KC8Q 3ZEDA 5APYA 2M5AB 1SQQG 4LWSB 4GODA 2Q7HA 1VQ5V 4GT1A 1M1JC 3BA8A 2ZNIA 1HUCA 1AJYA 1N0NA 2WMMA 4LH6A 1BL8A 1RSOB 2F95B 3T1HB 1A02F 3M9HA 1GN2A 1F4MA 1TVKA 2QM4A 3MAQA 1SQVD 3ABLC 4Z1VA 5AW4B 3HD7D 4OPAA 4I55A 2EBOA 2N05A 5GONA 3JATB 3BCCE 3V2RA 3KKYA 5JWPA 4BIZA 2KP8A 3HD7C 3CD6V 4PELA 1FXVA 1LTJC 3K3WA 3BVHA 2HPCB 1WA8A 4B08A 1GN6A 3T1YO 1NVPD 1S9KE 1SQVJ 1VF7A 1HWYA 2JVDA 1KU9A 3SYPA 3FD9A 1MUUA 3BRVB 1DH3A 2QTOA 4MTGA 2RJZA 1JVMA 5CN0A 3Q4HB 3V2PA 4GX0A 4UCUA 3SYAA 3CB2A 4FJCC 4ZHQA 2AEFA 1PD3A 2NNUA 4P9OA 1L0ND 5KHHA 3IR9A 1P7BA 1IXMA 1VDFA 1NVOA 2Z5UA 1HH0A 3OTFA 4DV5B 2LGWA 4P2ZA 1H38A 3A0HZ 2HEPA 5JH7A 2GSMB 2WLKA 3L70E 1B6QA 1KB9E 1NTKE 2W27A 5KHJA 3OTOB 2KS1B 4LFBB 2KB7P 4GYCB 1G1JA 1ZRTD 2F23A 4JBZA 5JJEB 1L0NJ 2NZ2A 3S1KA 3CMEV 4F4LA 4DR1O 3L36A 4L76A 4DW0A 2W8ZA 2YKPA 2OARA 4JZ2A 3CCVP 5EBWC 5B1AB 2A7WA 2ZD9A 2P1JA 4HKZH 4GKKB 2Z4EA 3AE1C 2CAZC 3PTZA 5IJ9A 3JASB 3TGUD 2PP6A 3FB5C 3E1IA 1OWAA 3AEIA 1DK1A 5J2UB 2A3QA 4H37A 1SQBG 2M3EA 3NXSA 4WY4B 1AI4A 4H13D 5CHXA 2V7QG 4PA3A 3AE7C 1UPGA 1X0TA 2YDEA 3RGUA 3GLMA 5ITZA 5LP6A 4LF4O 4H13C 2BEZF 3I5CA 4EFEA 2LJ2A 1IBLB 1L4AA 1NTMG 4JI3O 3W7SA 3TGUJ 1GAXA 4C7RA 1R3JC 4DOJA 4J10A 3GF3A 3APQA 4OVNF 1YCIA 1YTZI 3L73E 2V1DA 2WSSH 3JSVC 5KX5A 2YMYA 4YY3O 4I0XB 2X6CA 4BW9A 2W0FC 4N21A 1MG1A 3QO8A 2AZ2A 4KT0J 4KJMA 5CCHA 2EJRA 3E8GA 2CK3G 1T5EA 3KYQA 1HBWA 1K4CC 4JI5O 1FFXB 2IH3C 3MUDC 1M5IA 1Y4MA 3CCQV 3AE5C 1KTMA 2QTSA 3A3YB 5DM6V 4DR5B 3AE4C 1NHLA 2K9JB 4FM2A 1PGOA 1XNRO 3H1HE 4R8CA 4OX9B 2WZ7A 1M1KQ 1VQPV 2VQFB 2K3RA 1IBKB 3RW0A 2EIMB 3D3QA 5KLVD 4MW3A 1IFDA 3L71G 1NS1A 4GOEA 3L72D 1E1QG 2AZ0A 2XU6A 4EYYQ 3OEEG 1AFOA 1KORA 1W5CE 5DEDA 3PH0A 4XFJA 3MZWB 2WLLA 2K1AA 3HE4A 2B9ZA 1NH2B 3A0HH 4R4MA 1YJWP 3SYOA 3RYIB 1VQLP 2N04A 1JMMA 3ZN1A 1OCOC 1RP3B 4BXLA 4UUJC 3CX5D 1BQ0A 4DRXA 3T2MA 2QKCA 4U7OA 5KA6A 3OAKA 5KLVJ 1EDLA 1VQNV 3L72J 1S5LE 3G4SP 2XAFA 3UO3A 3H1KH 3KPEA 4C7NA 1QX8A 2CPSA 2Y0CA 4WY4D 4FLWA 2DQ3A 1KB9F 3HKDB 4ZBMA 1D7MA 3CJHB 2FYUK 2HHHB 4WY4C 3CCEV 1IFIA 1H2LA 1BE3H 5IWAO 3CE2A 3JD1A 2FXMA 2RMZA 3KZIZ 3VMXA 3W7TA 1GL2A 4DCKA 5KAFH 4IIJA 1VIBA 2O1KA 4L75A 4PV1B 1CW5A 3M9QA 2DWEC 1B06A 1PV0A 4UV9A 2ODMA 1NTMK 5L3DA 1K8AW 2WT7B 2RDCA 3DC5A 2X6AA 1YF2A 2EIKC 4O2BB 1FYJA 3IFXA 2BTQB 5LMUB 2Q68A 5CA1A 1KFNA 1YI2V 5B66Z 3RK2D 5LGNA 4D6TD 4IHJB 4DJGA 4JI0O 4IL6H 1B04A 1S72V 1FZCC 1VQ4P 2WLMA 3M9BA 1HJBA 5KJ7C 1PPJH 5APXA 3WG7C 3J80N 2LKMA 1AQ5A 2YS8A 1JOYA 4YHHB 1IURA 1KFMA 1JJOA 2FYUH 1GO3F 4QE9A 1NT2B 1CPYA 2CE4A 4GKJO 1BCCE 1Q2NA 1VQKV 5AVVB 4D6TJ 4Z1MH 4KHPO 3CLQA 2Y0DA 1AP6A 4K0KO 1HJ0A 2OYOA 3JARA 4HZ3A 2P7TC 4JASA 4MTOA 5LHHA 1YTFB 3L75E 2FFDB 2YIUC 4X1KB 2JJLA 2F4VO 5LL6Y 3SWYA 3AEDC 3BA9A 2NRGA 1MKMA 4O2AB 3SYCA 3GB7C 3V4QA 3IAYA 4FLTA 2XDJA 4O4LB 3WMM0 1RQUA 1LWUA 1X4TA 2OYIB 1BMFG 4PD4E 1TUBA 2ZJSE 1I08A 4DV7B 2JGUA 2XOKG 5AVUB 2E5LO 3FX0A 1GK4A 3AE3C 3AEGC 1NO4A 2IYPA 3GWOA 1NTZD 1AR4A 4ASVA 2JGDA 3LSQA 3ZX6A 2FKWB 1FJPA 1FXHA 3P8CE 2IBZG 1S5LX 4W7ZA 2X0LA 1ORQC 1SQPG 1VPCA 5IYZA 1NI8A 1D2DA 5DJUB 5BMVB 4DUYO 3RVZA 1TA8A 1CI6A 3ABTA 4ZNCA 4PV1C 2E43A 3OJAB 5CBNA 1N34B 1NKDA 2N74A 4DR4B 4LFAO 4WBAA 1KILD 2IYOA 1Q6HA 3QWOC 1NTZJ 2RCVA 2AXTH 2RMKB 3U10A 2HJFC 1RPRA 4EB6B 5IYDO 1KILC 3C1LA 3RGBA 1K9MQ 4FLXA 1DTOA 2E3CA 3WB1A 4I0XA 4X1IA 3JD2A 1VEWA 3E22B 4U3FE 2ARHA 2IU0A 4J9ZB 3CCSV 3E8BA 3O6QB 5GTHH 1DEEG 4RESB 3E83A 5JJJB 3KQGA 5AW1B 2MJZA 1VQ9P 1WNSA 2HR3A 2CGNA 1PFIA 5DJTB 3LIEA 1NU1E 2DN9A 2ZDIC 2I1KA 4EKWA 1R6KA 3RYHA 3D71A 3TNUA 1JOCA 5KAIH 1GW4A 1EXJA 1RF1A 5C8YA 4PJ0E 5GTIE 1FE6A 4FK5C 1N7SD 3EFGA 4DR3B 3K5NA 2GUVA 5B5EE 2Q8VA 2YXLA 1JEKA 3SJBC 1USEA 1IFNA 1QLEB 1FOSF 1X9VA 1ZLLA 5AVSB 3SR2C 3NMDA 2O1JA 2Y69B 2DW4A 4K3AA 5DECA 4RJTA 3AG3B 3OUSA 4JAVA 4ICGA 1SQXD 3T1YB 1GTWA 4DV5O 1FC2C 2EIJB 2YICA 2E5TA 2QVAA 1SZXA 2OT5A 4MTXA 1VQOV 1QVGU 3CC4P 3H1IG 4YXWG 1V54B 4TV9B 1E79H 1P84D 3G67A 3ETGA 5GW7A 5AVZB 4DV6O 4LFBO 4YJ3B 1YXBA 1FD9A 5LOVB 4UB6E 4CBCA 3FYIB 2WSCH 2L35A 1BQZA 1SQXJ 2KZJA 3H1LE 1KQFB 4PD4F
chains in the Genus database with same CATH topology
3AE4C 3G9RA 3GMAA 4TT3H 2WSCJ 4OGQD 3O6QA 1ZOYC 1K04A 2QSIA 1OW8A 3ABVC 4I7ZB 2D2CB 1ZRTE 2JO1A 1UIXA 2BEQD 4OGQC 3SFDC 2MKVA 1NGMB 3AE3C 3AEGC 5KKZC 1FDIA 4H13B 1KORA 2V7QJ 2E74D 1KMIZ 1YQ3C 2H88C 2WPVB 2G3AA 2FXPA 2H89C 4IL6X 4XFJA 4H44C 3AE2C 1VF5D 4YTPC 1S5LX 2QJPC 4R4MA 1HF9A 2E74C 3D6ZA 2WSFJ 1VF5C 1KILE 4PV1C 4RKUJ 2O01J 1K05A 1OW7A 2QJYC 3Q5RA 3R4YA 1FDOA 1DIPA 3AE8C 1GMJA 1VL2A 3AEEC 2E75B 3AEFC 4GDOA 3SFEC 4H44B 2E76D 3Q5PA 4H0LD 1NYHA 1RQVA 2NZ2A 2ZT9D 2FBWC 3RK3E 1R8EA 3LW5J 2E76C 2P10A 3IN6A 3RL0g 4PV1B 4H0LC 2ZT9C 2WQYC 2OQQA 2FYNC 1S1CX 2QJKC 2YMKA 3AE6C 1IK7A 3AE1C 1DD4A 3D70A 2D2CD 5KLIC 3D71A 1OMIA 3Q2YA 5L8RJ 4OGQB 3EWKA 1Q90D 3C8VA 4H13D 3H25A 1KQGB 1ZMEC 3AE7C 3AE9C 3S9OA 2D2CC 2IDBA 1EXJA 1PL5A 1JB0J 3AEAC 1DD3A 3GLMA 4H13C 2BEZF 3GF7A 2JP3A 1PIXA 4YXDC 1TU3F 1YQ4C 3FGAD 2E74B 2G8YA 1VF5B 4Y28J 1Y9BA 3Q5SA 3GF3A 2K9YA 1EXIA 3D6YA 1U57A 3T97B 4Z1MH 1WMKA 4R4LA 1OW6A 2J5UA 3IAOA 3Q3DA 2E75D 1HJ0A 1AJYA 3AEBC 4H44D 2YIUC 4I7ZC 4KT0J 2E75C 5M1BA 3AEDC 2QIWA 1MKMA 2WSEJ 3B71A 2E76B 4PV1D 3Q1MA 4H0LB 4U7JA 3AECC 2ZT9B 1ZP0C 1RQUA 1PV3A 3AE5C 1KTMA 1KQFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9Y A;  2O01 J;  2QJY C;  2WSC J;  5KLI C;  2QSI A;  5L8R J;  4OGQ B;  4I7Z B;  1Q90 D;  2D2C B;  3C8V A;  1ZRT E;  2E75 B;  2YIU C;  5KKZ C;  4KT0 J;  1JB0 J;  4H13 B;  4H44 B;  2QIW A;  2WPV B;  2WSE J;  4IL6 X;  2E76 B;  2E74 B;  1S5L X;  2QJP C;  4H0L B;  3LW5 J;  2ZT9 B;  1VF5 B;  4PV1 B;  2WSF J;  4RKU J;  4Y28 J;  2FYN C;  2QJK C; 
#chains in the Genus database with same CATH topology
 1EZV E;  3CC2 V;  1NKN A;  1H0T A;  1U96 A;  3ABM B;  3ABU A;  4YJ2 B;  4CH6 A;  2GUZ B;  3ABV C;  2OIE A;  1EC5 A;  1V55 B;  3V5B A;  1E5W A;  5EYP B;  3ZRW A;  5C93 A;  1BGY G;  3RBZ A;  4A5U B;  1YVW A;  3H1K D;  2Y4T A;  3BHP A;  1HGZ A;  1VQL V;  1M56 D;  1HF9 A;  2JKV A;  1HVV A;  1M90 Q;  2LQT A;  1OVV A;  1Y47 A;  5E79 Z;  2BE3 A;  1M56 C;  1PP9 G;  1RM1 B;  1BE3 D;  1OXZ A;  3ZRV A;  4RUE A;  4NXN B;  1T3J A;  4HYT B;  2X7R B;  1Z2G A;  1VL2 A;  3H1K J;  4I9Q A;  4LF4 B;  3CCL P;  3E89 A;  4HBN A;  5FNV B;  5LA6 B;  3M0D A;  4GDO A;  1L0L G;  3CCM V;  4N23 A;  2YXH A;  2Y9Y A;  5AVY B;  3GHG A;  5BY1 A;  4PDV A;  1EQ7 A;  1NYH A;  4JI3 B;  3A0B Z;  1RQV A;  1BE3 J;  4J7K A;  5HFL A;  1OCR C;  1SZT A;  3EXA A;  3ZRX A;  2W6I G;  1KYO H;  1PGJ A;  1H88 A;  2ZIM A;  1RF0 C;  4IT5 A;  2OTL P;  3ASN B;  5AW2 B;  1IX9 A;  4LNU A;  5HFM A;  4J11 A;  1KQS U;  2IH1 C;  2QG4 A;  5C39 A;  3O8Z A;  4WBN A;  4LC1 A;  4LF5 O;  4LF7 O;  2VQF O;  2IJK A;  2AEJ A;  3FWL A;  3LDD A;  1SES A;  2QEX P;  5KMG A;  2FYU D;  4E4E A;  1FKA O;  3GF7 A;  4WWI A;  1SQV E;  3K0D A;  1YQ4 C;  3F5T A;  3RL0 D;  3H1J H;  2EUL A;  2OYH A;  3HKE A;  3CEI A;  2A79 B;  4U3J B;  3SDL A;  1ZAU A;  5KLI B;  3QF7 A;  2UXN A;  2R3S A;  4QPK A;  2XND H;  2Z5H A;  4UXN A;  1NTM D;  2YI8 A;  2FYU J;  2E75 D;  5TJH A;  4TQD A;  3AEB C;  4H44 D;  1R1B A;  3HKC B;  5J2T B;  2E75 C;  3NTN A;  2IW5 A;  2OCC B;  1V55 C;  1R73 A;  3TGU H;  2HHH O;  4LFC O;  3HB3 B;  2A06 H;  3UT5 A;  3AK2 A;  2PY5 A;  1L0N E;  3Q1M A;  1VQ6 P;  1J1D C;  1K33 A;  3VP9 A;  5JVD B;  1BSH A;  3BCC G;  1JFF A;  1NTM J;  3RK3 B;  2EIL B;  3RVY A;  3CHX A;  1H2S B;  1NR1 A;  2KSD A;  4G28 B;  2R5D A;  3O6Q A;  2YIA A;  2ZXW B;  1K04 A;  3L4F A;  4EIJ A;  1H2G A;  4MVR A;  1G1X B;  1MZF A;  3H1I H;  1GZL A;  1ZRT E;  2JO1 A;  5CCG A;  2GTA A;  4IFD K;  5IWA B;  1FDI A;  3K9A A;  2KG7 A;  5LMU O;  1D5N A;  2ZYD A;  2WPV B;  2WSF H;  4GX1 A;  3RYF A;  4L87 A;  3UM7 A;  1L0L K;  4MTF A;  3L71 D;  1EM1 A;  5AW0 B;  1IZN B;  3X2Q C;  2R3C A;  5AVW B;  3L70 G;  1N8R W;  1FBM A;  1NTK G;  1M1J B;  1Z5W A;  2LGQ A;  5H6R A;  3L74 H;  1XBL A;  4PA7 A;  3ASN C;  4I9W A;  2Q0A A;  4GLX A;  3E7K A;  1URQ D;  4ZKU A;  1XHZ A;  2L6L A;  2ZYG A;  2QA4 P;  2F66 C;  3OMA B;  3L71 J;  1VQ8 V;  2E76 D;  1ZL8 B;  3L37 A;  2ADP A;  1URQ C;  2QDO A;  2ZT9 D;  5LBQ A;  5AG2 A;  5EC2 C;  1R8E A;  4I4T A;  1RFY A;  2E76 C;  2HFE D;  4X65 B;  1FJG O;  5AVQ B;  4O4J A;  3L72 H;  3TXQ A;  2VS0 A;  2ZT9 C;  3I56 P;  5EBL C;  4GKJ B;  4TV8 B;  1K3E A;  4ZIB A;  2HFE C;  5KUK A;  1RE4 A;  1GKF A;  2H94 A;  3P30 A;  2JS3 A;  1LTJ B;  5KLI C;  1H2K A;  3ZMT A;  1WP8 A;  1O9G A;  2M6Y A;  4GZR B;  4X20 A;  2F4V B;  1LT9 A;  2N9B A;  2Y48 A;  2CTP A;  4DUZ B;  1ZME C;  1A32 A;  4GX2 A;  3JAL A;  3CX5 H;  3SPG A;  1T3U A;  2LXB A;  2FL4 A;  3VMZ A;  4YPC A;  3TYY A;  4ASW A;  1F7Y A;  4X62 O;  1JCC A;  1DF5 A;  2Q6A A;  3TSI A;  4AI8 A;  1QQC A;  2JEU A;  2QM7 A;  5CBG A;  2G8Y A;  3L73 G;  4FZ0 A;  1YHQ P;  1GN4 A;  3BPZ A;  2QE7 H;  2QSA A;  1BHA A;  4I50 B;  3E1R A;  4NTW A;  1SVF A;  4QMA A;  1N73 A;  2JEX A;  1LJ2 A;  5KLV E;  3CS5 A;  2POH A;  1QEX A;  4TUY A;  1OW6 A;  2CTQ A;  1EN4 A;  1YIT V;  2Q6Q A;  3G6B A;  1XMQ O;  4DV2 O;  3THO A;  2M8R A;  3SSU A;  2JDI G;  1IBM O;  4W80 A;  3B71 A;  1JMK C;  1QU7 A;  1N0J A;  4UCS A;  3H1H G;  3V2Q A;  4F6R B;  4LFA B;  2BCC E;  2GTS A;  4MSW C;  3GMA A;  2UUA O;  5LYJ A;  2WSC J;  4L8J A;  3SGI A;  1WJZ A;  3M91 A;  5AW5 B;  4W4K A;  4FLV A;  1QVF U;  3ML0 A;  1UIX A;  1NTZ K;  1AJQ A;  1USD A;  4N78 D;  1NGM B;  2C9L Y;  4X66 B;  5KHK A;  4H13 B;  3B5N A;  1R3L C;  1AI7 A;  4LP8 A;  5AW6 B;  2W6J H;  1O9H A;  1OJH A;  2ITC C;  4YTP C;  2UUB O;  4RAI A;  5H5N A;  4NTY A;  1K34 A;  4ASU G;  4DR3 O;  4ZKP A;  2KLU A;  3WU2 H;  1H89 A;  2WTY A;  5B1B B;  5BU8 B;  4LF6 O;  1VQM V;  3C9I A;  2HLO A;  3V4W A;  1HNZ O;  1BSM A;  1OZ0 A;  5KA5 A;  2PTM A;  4WFH A;  5TIS E;  2WLH A;  1L4A D;  5LP6 C;  2CUG A;  3AE8 C;  1UII A;  4D6T E;  1SFC A;  3CX5 I;  4U7N A;  2Q4P A;  1S76 D;  1L4A C;  5EK0 A;  3K04 A;  1KYO D;  2KLV A;  2Q73 A;  3FAV A;  4L74 A;  4H0L D;  2YC0 A;  3TDK A;  3VMY A;  3N2K A;  4UB8 H;  3N2G B;  2X6B A;  3SJA C;  4UFZ A;  5K1X A;  4H0L C;  3DC6 A;  1XI1 A;  1N4C A;  5CCH D;  4BWA A;  2FYN C;  5CA0 B;  3AE6 C;  1NTZ H;  2YNY A;  1R3K C;  1S5L Z;  4FFB B;  3I55 P;  4Y99 B;  3KDP B;  5JVD A;  2P2U A;  5CCH C;  5LGU A;  4LR3 A;  2EIN C;  1N7L A;  1PM9 A;  4LBE C;  3H1J D;  1VF6 A;  1Q86 W;  2XAS A;  4HYO A;  2XAH A;  4DV6 B;  3A2A A;  3T97 A;  3G6E P;  3FGA D;  5CJ0 A;  3V6I A;  1OCO B;  2WLI B;  3ETQ A;  1ENV A;  1BCC G;  3JCU H;  3HUS A;  5IE9 A;  2L5G B;  4DO2 A;  2CH7 A;  1N2D C;  5JQG A;  2ZE8 A;  2R9A A;  1FAV A;  2GV9 A;  1KC8 W;  2Q1K A;  1NJI Q;  3L75 G;  3OA7 A;  3ZDM A;  1U57 A;  3H1J J;  2LFS A;  1SQX K;  2XNX A;  3ABK C;  2A06 D;  1YYC A;  2YID A;  3S3X A;  1NWQ A;  1SQQ K;  4O4H B;  4NXN O;  4DR6 B;  4N6J A;  3KCX A;  1FXK A;  4ZI7 A;  2OTJ P;  1LTT C;  3CX5 F;  4IYH A;  4HH2 A;  4EFB A;  4FFK A;  3W7U A;  4JPR A;  1OVR A;  3H1I D;  2K1E A;  5CB4 B;  3S3W A;  3K57 A;  3HKB A;  2EIK B;  3B2E E;  4O9B A;  5B1B C;  1GL2 D;  1U7J A;  2NPS A;  3SWF A;  4Q6G A;  2QSI A;  1DLB A;  3ZMV A;  3OR6 C;  4R6Z A;  4RUF A;  1GL2 C;  3OFN G;  3HD7 A;  1SRY A;  4O4I B;  3RK2 B;  1FZC B;  3ETE A;  3H1I J;  1Z5V A;  4YIP A;  3ZJZ A;  1VF5 D;  3WG7 B;  4K8X A;  1SQX H;  3L74 D;  1Q81 Q;  2XZR A;  1KV4 A;  1P4R A;  2WSF J;  3JAW A;  1ZXG A;  3AG2 C;  2H8P D;  1VF5 C;  3A7O A;  2Q9L A;  1MMM A;  3RYC A;  4FM0 A;  1BGY D;  3UO2 A;  2IZ0 A;  1SQQ H;  3B4S A;  3BRC A;  1Q6I A;  1P84 H;  2ZKO A;  5EZY B;  4JYY A;  3Q5R A;  2H8P C;  4LF5 B;  4LF7 B;  3OW2 U;  4Y99 C;  2HJD A;  2H3O A;  2HOD A;  2YIU B;  1QBZ A;  3G71 V;  2QA4 V;  1N32 B;  4U3F G;  3L74 J;  2ADQ B;  1M7L A;  1PP9 D;  3AK3 A;  3ZCC A;  1OIP A;  2EZO A;  2JIZ G;  5LXT A;  5A2Q N;  2QJP B;  1Y67 A;  1OHH G;  1BGY J;  2P7J A;  1NU1 G;  4DK0 A;  4RQE A;  3N27 A;  2KUB A;  3CWB E;  1L0L D;  1XNQ O;  4KXR A;  2QJY B;  3USS A;  1YJ9 P;  3OMN B;  2QJK C;  1Y76 B;  2A45 G;  4TT3 G;  3CRA A;  4MVZ A;  3A5T A;  1PP9 J;  4OWF A;  3MHH C;  3F89 A;  2D2C D;  2Y0E A;  3Q2Y A;  2IU3 A;  2O01 N;  4X1Y A;  3C8V A;  2QKA A;  1IFJ A;  4PA4 A;  3S9O A;  2D2C C;  1PL5 A;  4LFC B;  2IM9 A;  2Y4U A;  2M5A A;  2B5U A;  4LWS A;  4MT8 A;  1L0L J;  1K73 Q;  5CMU A;  1SA0 B;  4TOI A;  1SQB K;  3CXH D;  2GM4 A;  3CCU P;  4JTD B;  3AG4 C;  1KKD A;  3SPC A;  3CMA P;  4Y28 J;  4OPH A;  3MIW A;  3VQX A;  5FPO A;  5AW8 B;  1RSO A;  4HJG H;  3F5H A;  3ITK A;  1AQT A;  4JF3 A;  3T1C A;  3Q3D A;  1LUV A;  1KIL B;  2P90 A;  1FS0 E;  1XHX A;  4P30 A;  3IC7 A;  5AVX B;  4C46 A;  4PJ0 Z;  5GTI Z;  3AG7 A;  2H43 A;  3JAT A;  4A7P A;  2QWR B;  3H1L G;  1YJN P;  1WAZ A;  5B5E Z;  1EZV G;  1F51 A;  4K35 A;  3RK2 C;  1VQ7 P;  2HPC A;  1W0K G;  1NKZ B;  2YIB A;  3S4R A;  4J80 A;  1S0V A;  1FOS E;  1BE3 E;  4WVZ A;  1HNW B;  4X65 O;  3G9R A;  1P84 I;  3Q4H A;  1GK9 A;  5KAF E;  1M1K W;  3CSX A;  1ZOY C;  1SQB H;  3W67 A;  4CZZ A;  5IJ0 B;  1OW8 A;  2YO3 A;  2V7Q H;  1T8Z A;  4UVA A;  4FFB A;  4BR6 A;  4YIO A;  1XRE A;  2PYL A;  1ZUQ A;  1S77 D;  3TJT A;  4DUZ O;  2E74 D;  1KMI Z;  3U59 A;  1DX7 A;  1HWT C;  1S9K D;  2G3A A;  3CRM A;  1FJG B;  5JCO A;  1OX3 A;  1NTM H;  2QJP C;  2UXX A;  3M7M X;  3ZBH A;  1N7S B;  4UB6 Z;  1IK9 A;  2E74 C;  2KOG A;  1JY3 O;  3JAK B;  1FAF A;  2GHY A;  2KS1 A;  4IL6 E;  4XA4 A;  1SQG A;  4BIU A;  1X79 B;  2VWK A;  1RF1 C;  2QJY C;  2A9H A;  1ZSP A;  3MHV A;  4XDL A;  3LUT B;  4B3S O;  4DR2 B;  1PPJ E;  1BDC A;  3TCU A;  2FKX A;  5LMN B;  1ARO P;  1LTA C;  2FYU E;  3STL C;  3L70 D;  5KTB A;  5CJ4 A;  2CK3 H;  3Q5P A;  3JAS A;  4X62 B;  1FDM A;  2VQE B;  4NPF X;  3ICX A;  2XKM A;  1CP9 A;  3IF4 A;  1SS1 A;  1QL2 A;  4B7K A;  5J2U A;  4WY4 A;  5L3C A;  3RL0 g;  4ZMD A;  4E2L A;  2YO2 A;  2AGA A;  3M8A A;  1PGP A;  3DGE A;  1UFI A;  1S1C X;  4IFM A;  1DD4 A;  1W2B U;  3L70 J;  3DSQ A;  3HE5 B;  3L71 H;  4LF9 O;  3F7Y C;  4WF9 V;  1XMQ B;  3K5O A;  3KZI H;  3PLN A;  1SQV G;  4DV2 B;  1CEZ A;  1MNG A;  3AE9 C;  2IDB A;  1IBM B;  1JR9 A;  4TWK A;  5APT A;  4NTX A;  2ETN A;  3SWK A;  4J9Y B;  2KB1 A;  4DR7 O;  4X66 O;  5K1P A;  1TU3 F;  2UU9 O;  1Y66 A;  3BEH A;  1ZLZ A;  5BR8 B;  3CCV V;  2UUA B;  1M56 B;  2Q7E A;  3ZIA G;  3ZS8 C;  4JI8 O;  2RQ6 A;  5B66 H;  5KJ7 A;  2N1T B;  1FFX A;  1HTL C;  1JO5 A;  1N36 O;  4ZOL B;  5B5E H;  1HW7 A;  1MV8 A;  1L0N G;  3A0R A;  2K9J A;  2Y0P A;  2UUB B;  2P4V A;  2WLJ A;  2OTJ V;  3K5M A;  1GD2 E;  1GTO A;  3CCJ P;  5BU5 A;  2AXT E;  3KCY A;  4AUW A;  1JA8 A;  1OCR B;  1S2E A;  1JCD A;  4LF6 B;  4I6M C;  1PKX A;  3KXD A;  1N7S C;  3W68 A;  1HNZ B;  4CS3 A;  1KD1 Q;  1I94 B;  2P22 C;  3RT3 C;  2CTR A;  2YEV B;  3OAA G;  3M0D C;  1WB7 A;  3VYI A;  3K5B A;  3MP7 B;  5APV A;  3CCR P;  3SJQ C;  3RYI A;  1MFT A;  3H1H D;  5GTH E;  3GHG C;  1G2C B;  2ZXX A;  2WPQ A;  3SFD C;  3NFQ A;  1ZR2 A;  2E42 A;  3SPI A;  2YKO A;  4JPZ B;  3IC9 A;  1YQ3 C;  1SQQ D;  4IL6 X;  2PGG A;  5KAI E;  4AQR D;  4G2K A;  4GX5 A;  3HKD A;  4WFG A;  3CJH A;  3H1H J;  3APO A;  2I1J A;  3RL0 B;  4MVO A;  2Q0O C;  3RFR A;  1OW7 A;  1SQP K;  3CYO A;  2PRR A;  4FLZ A;  3R4Y A;  3P7K A;  1Q7Y Q;  1FDO A;  3H32 B;  1SQQ J;  2OCH A;  3AEE C;  1Q82 Q;  1QGK B;  2EZP A;  2E75 B;  1G4Y B;  1Q8I A;  2LFR A;  2B87 B;  1K9M W;  3BY6 A;  1XMO B;  4KFM A;  4H44 B;  2WT7 A;  5AW7 B;  3RK3 E;  3MDS A;  4O2B A;  4DR6 O;  1FZA A;  1J1D B;  2BTQ A;  5AW9 B;  3LW5 J;  1YJW V;  1EFR G;  3ZMU A;  3JAM N;  4BRY B;  1IFP A;  4IHJ A;  2WQY C;  3C90 A;  2N1T D;  1IK7 A;  2RN9 A;  1VQ5 P;  1JY2 O;  1QL1 A;  3G4S V;  1HP8 A;  3CRR A;  4L73 A;  3TF5 A;  1Y6X A;  2N1T C;  4JV5 O;  2KQX A;  4JTC B;  1LTB C;  1THZ A;  2ZDI A;  4XDJ A;  1R3I C;  1JY3 P;  3A2F A;  4F6E A;  4JF7 A;  2BSK B;  2GDS A;  1PL0 A;  2PZS A;  2IBZ H;  4YXD C;  4AYC A;  1SQP H;  4HNA B;  4CPG A;  3OM3 B;  2FFD A;  3X2Q B;  5KLV G;  1L8D A;  3GW6 A;  4X1K A;  3LNN A;  4UCO A;  3DXR B;  4XDK A;  1EDK A;  1XTC C;  2YXY A;  2R5B A;  2H7H A;  1M9N A;  2HP8 A;  2LR2 A;  3VMA A;  4O2A A;  2PUS A;  4JI6 O;  3CC7 P;  4DW1 A;  2W0X A;  2QWQ B;  2J5U A;  4N78 E;  4O4L A;  2AXC A;  3U0Z A;  2IPP A;  2Q5Z A;  3QNE A;  1U7M A;  3HTK B;  5AVR B;  1H8A A;  4GOF A;  2OYI A;  4AQY O;  1URQ B;  4IYI A;  3ZHV A;  1YJN V;  1N32 O;  2BCC G;  2E76 B;  5APQ A;  1VQ4 V;  4PHZ A;  2F43 G;  2ZT9 B;  1SQB D;  5APU A;  1PV3 A;  1I5Y A;  4NVP A;  3RN4 A;  2JWA A;  2E5Y A;  2DW3 A;  3RL0 C;  1WPB A;  5EC1 C;  1NAF A;  4B86 A;  2LW7 A;  4I7Z B;  2MW2 B;  4LGD E;  1TVK B;  5BMV A;  1DEB A;  4CC6 A;  3LNM B;  4N3Y B;  3J81 N;  2DYS C;  1SQB J;  2V7Q J;  4BAY A;  3D3I A;  4I55 B;  1B3Q A;  3N4X A;  3CME P;  1RE3 A;  5GON B;  4H44 C;  2W90 A;  1RE4 C;  2QRX A;  4XBF A;  1XNQ B;  4EB6 A;  2C9N Y;  3P8C D;  1M90 W;  5FPR A;  4Z2W A;  1WA8 B;  4D6T G;  4XE5 B;  2O01 J;  2KKW A;  1GM7 A;  1K5S A;  3E22 A;  3K9S A;  1N86 A;  3H1J E;  1G1I A;  5L3G A;  2ZM6 O;  4BW5 A;  3PN1 A;  4DYL A;  4ZHQ B;  2PAJ A;  4YXW H;  1S5H C;  3G80 A;  5B1O A;  2ZVN B;  2YI9 A;  4MVS A;  4FMT A;  2IBZ I;  5E79 H;  4J42 A;  2IFM A;  2JR8 A;  1N73 C;  1YIJ P;  3W7X A;  5JH7 B;  4BIO A;  4X89 A;  1H8E G;  3K06 A;  4RO2 A;  3TET A;  2B1I A;  1KYO I;  1XL4 A;  2P5O A;  3TGU E;  2A06 E;  1AVY A;  2HLD G;  5TIS Z;  2PYJ A;  4B7E A;  1HNW O;  4WB4 A;  3A0B H;  2UXB O;  1RF0 A;  1Q90 D;  1WRG A;  3H25 A;  2DOS A;  3D36 C;  1J1E C;  1J5E O;  1BGY H;  1H2M A;  2OTK E;  3JD3 A;  1WLE A;  1ZN5 A;  3H01 A;  3VQW A;  5IJ9 B;  1GM9 A;  4EOT A;  5CBF A;  3P32 A;  3CP1 A;  2I8D A;  2YSU B;  3Q5S A;  1PP9 H;  4TV9 A;  2QJ1 A;  5LHI A;  1VQ9 V;  5ITZ B;  5LP6 B;  1VQP P;  4YJ3 A;  5F2V O;  5L3B A;  1KEC A;  5LOV A;  3IAO A;  4X88 A;  2WA4 A;  3WUU A;  2YKQ A;  1GN3 A;  2F1M A;  1L4A B;  1IVS A;  1L0L H;  2WSE H;  4DR2 O;  1KN7 A;  4QE7 A;  4I7Z C;  2QKS A;  1JUN A;  1Y74 B;  5LMN O;  3BAB A;  2WIT A;  4JQ0 D;  4FZ1 A;  3L74 E;  1AP5 A;  4YJ2 A;  2GUZ A;  2ZR2 A;  1GMG A;  1OFC X;  5IDJ A;  1NAY A;  1JY2 P;  1SFC D;  2KI7 B;  4H0L B;  5KX5 B;  2VQE O;  2B9B A;  1AI5 A;  1HDJ A;  1ZP0 C;  4LH7 A;  3AEC C;  5DN6 G;  4J7J A;  2FYN B;  3TXS A;  5EYP A;  1VQN P;  3OMI B;  3SJC C;  1SFC C;  4B3S B;  2LO1 A;  3H1L D;  3CXH H;  4DV1 B;  4IFF A;  3CCR V;  4OGQ D;  2OIG A;  2EIN B;  1KYO F;  3L72 E;  2ILM A;  5E1A C;  4OGQ C;  4J7Z A;  2XTA A;  3CCE P;  4FPP A;  2ZE5 A;  2KK7 A;  3JSN A;  1DGS A;  3CC4 V;  2Q9I A;  2SPZ A;  3AE2 C;  3H1L J;  2B89 A;  3CX5 E;  3QG5 A;  4CH5 A;  5FNV A;  5LA6 A;  5H9C A;  2V4D A;  4FLU A;  1NR7 A;  1QVG O;  2WPR A;  4RKU J;  5BXZ A;  1YIJ V;  1FZB A;  4LF9 B;  5BR8 O;  1RH5 B;  1VF6 C;  3ABK B;  3PJS K;  3MGN A;  2WSS G;  2WLL B;  2OWO A;  3HE4 B;  5KKZ B;  2C2A A;  1KKC A;  1YI2 P;  3SYQ A;  1MZE A;  3K5L A;  1NTK K;  5H2F E;  2ZIO A;  2PI5 A;  1KQL A;  1FFT B;  2Q3I A;  4DR7 B;  3U11 A;  4DRX B;  3HUS C;  2UU9 B;  3CWB G;  1S72 P;  1SF9 A;  4R50 A;  2N9Y B;  1AV1 A;  4DV0 O;  3OE7 G;  3ASO B;  3FB7 C;  3PP5 A;  3BCC H;  4C7N B;  1PZQ A;  4JI8 B;  1HNX O;  2KSJ A;  1VQK P;  2Z0A A;  1N36 B;  4W7Y A;  2AHY A;  4LCU C;  2XV5 A;  1I94 O;  1IDS A;  2IBZ D;  2DYR C;  1FXK C;  1GM8 A;  5CMZ A;  1EBO A;  1SQP D;  4FM1 A;  1GL2 B;  4IIJ B;  2UXD B;  1S3J A;  1UJW B;  1G8M A;  2NLJ C;  4U3J A;  3CCL V;  1XTG B;  1EDI A;  2FXO A;  2NPS D;  1RHZ B;  4R7C A;  3AG1 C;  2QR4 A;  2RN0 A;  1EN6 A;  3AG2 B;  3HKC A;  3FKS G;  1VF5 B;  5J2T A;  1AVM A;  2NPS C;  2UXC O;  1DF4 A;  3L70 H;  5CA1 B;  1K7D A;  1SQP J;  1KB9 H;  1FS0 G;  1NTK H;  1NQT A;  4JI1 B;  3CRC A;  5LHG A;  3CXH I;  1GW3 A;  1KP3 A;  4IGG A;  3CC7 V;  4IOI H;  5KHG A;  2OTL V;  1WMK A;  3H1K G;  3BAT A;  2KSE A;  1N33 B;  3WU2 E;  2CPB A;  3IFM A;  4UV8 A;  1P7G A;  5M1B A;  3JCZ A;  2QEX V;  1T6A A;  1AR5 A;  1BE3 G;  1XMO O;  3UQ8 A;  1KQS O;  3BFR A;  2HYN A;  3JAR B;  2CGO A;  1Q6U A;  2ZVO B;  2QJK B;  4X9Q A;  1SS3 A;  1L1F A;  4UB8 E;  1X59 A;  3CL3 D;  1LR1 A;  5IYC O;  1VAR A;  2NR5 A;  1TUE B;  2D2C B;  1NTZ E;  2MKV A;  2CTW A;  5KKZ C;  1Q43 A;  2IJH A;  1LWU B;  1M1J A;  3JD4 A;  3AG4 B;  1TUB B;  1K97 A;  2P58 A;  3L73 H;  3CCS P;  1GK6 A;  4JI2 O;  4JI7 B;  1VQ6 V;  3D6Z A;  3ASO C;  2KZI A;  3BAA A;  1PPJ G;  4CH3 A;  3K79 A;  4I2L C;  2ITD C;  2M3B A;  1XL6 A;  2PI4 A;  1ZL8 A;  1KIL E;  1OVU A;  1OCZ B;  2QM8 A;  1D5A A;  2ZIN A;  2FYU G;  3K03 A;  5KAF Z;  4JV5 B;  1AJN A;  2JGD B;  1R6T A;  2FTK A;  4Z1M G;  3JCU E;  2ZAE B;  5EFW B;  3DTU B;  3ZHQ A;  3CXH F;  2JEE A;  3B8E B;  4TV8 A;  3AEF C;  5IYZ B;  3SFE C;  2IX7 C;  1IJD B;  2JDI H;  2BOC C;  1CI6 B;  5JJN B;  2DJV A;  1A02 J;  4JI4 B;  1XDC A;  1LTJ A;  3JSL A;  3H1H H;  4UVC A;  2C0W A;  1XOU A;  1Y74 A;  3LDE A;  1WP7 A;  4IL6 Z;  4JI6 B;  1KB9 I;  4I1L A;  1K8A Q;  3IGA C;  1BZK A;  4PA9 A;  3F7V C;  2YIB D;  4X1I B;  3ZHR A;  2DE0 X;  1OMI A;  4OH8 B;  3EWK A;  4AQY B;  1KQG B;  1VQO P;  3A8T A;  4FLY A;  3CWB H;  4I50 A;  3L9D A;  4AIL C;  1E1R G;  1X22 A;  1JTH B;  3LW5 H;  2DQ0 A;  2PF4 E;  3STZ C;  1PIX A;  1S5L H;  1WB8 A;  2P06 A;  1OCC B;  1YSC A;  2BTO A;  2E74 B;  3RYH B;  3M99 B;  4PDM A;  3TNU B;  2R9R B;  3I56 V;  4ZKI A;  3CC2 P;  1RF1 B;  1YEW A;  2FY8 A;  5C8Y B;  1S4X A;  4W4L A;  1NJI W;  3VQV A;  2IJJ A;  1SQX E;  4CC5 A;  3ZN0 A;  1NBM G;  2O57 A;  4F6R A;  5JCO C;  2AHZ A;  1QR8 A;  4NB5 A;  2Y9Z A;  1SQQ E;  3J7A U;  3KG2 A;  1AR1 B;  2Z5I A;  1P84 E;  3QO7 A;  3ETD A;  4WFA V;  2WSE J;  1CXZ B;  3K58 A;  5AVT B;  3QH9 A;  4MW8 A;  1LWU C;  1JMB A;  4PI2 A;  1YHQ V;  3R65 A;  4X64 B;  1ZR4 A;  5B1A C;  1I0H A;  3P3N A;  2PFX A;  4B3T B;  1QCE A;  4MN4 C;  4WFF A;  2BCC D;  5A9G A;  1HR0 B;  3A0H E;  3WB2 A;  1OCZ C;  2DWD C;  2ZM6 B;  2AEM A;  2BEQ D;  3CCM P;  1LNQ A;  2JWD A;  3MD0 A;  3BVO A;  1TGO A;  3UKM A;  1FU1 A;  3H1K E;  2H88 C;  4UCR A;  2FXP A;  2H89 C;  1AVO A;  4JYA O;  1SQF A;  2AXT Z;  4JYB A;  1H0T B;  2Q3E A;  1BCC H;  2BCC J;  1CZQ A;  1Q81 W;  3W7W A;  3F5W C;  4HAM A;  1LT1 A;  3L75 H;  1BDD A;  4FVM A;  4WCE V;  3MUD A;  3N2G A;  3ZRW B;  2UXB B;  4JGS A;  5GTH Z;  4TSF G;  1J5E B;  1JCH A;  3FXE A;  3MTU E;  3HPL C;  3VP8 A;  3BCC D;  1R5S A;  1LUW A;  5CA0 A;  3UIA A;  4MS2 A;  1W59 A;  1Q5O A;  4H33 A;  4QGP A;  1BS3 A;  1SP4 A;  5KJ7 D;  1AIL A;  5KAI Z;  1E79 G;  3ZRS A;  2Y0I A;  4KL1 A;  4PD4 H;  2W83 C;  3OR7 C;  5B3S B;  1QVF O;  4NXM B;  2O01 H;  1OCC C;  2YXQ B;  3MHS C;  2FYZ A;  3BCC J;  3T4Z A;  4QJF B;  4B3R B;  5IYB O;  1BSN A;  3LSS A;  4P9P A;  1NU1 K;  1M57 B;  3GHG B;  2FB5 A;  1I5X A;  4WFE A;  2WLI A;  2IZ1 A;  3QO5 A;  3SPJ A;  4DV1 O;  2EIM C;  3H9V A;  2UUC B;  2BOB C;  4RQF A;  4Q20 A;  5CA3 A;  2Z3Y A;  4QIW F;  1WT6 A;  3FX7 A;  3B40 A;  3GVM A;  2D3O W;  1KB9 D;  1LTS C;  1NH2 D;  1NTK D;  1K73 W;  3P8M C;  1SQB E;  5FL7 G;  3PHL A;  2Q67 A;  3C3T A;  4UCT A;  4LNU B;  1KBH A;  1IC2 A;  1GU4 A;  5BZB A;  4DV4 O;  3CPW U;  4O4H A;  4WBN B;  3E8H A;  3BAS A;  1MAB G;  2XUM A;  2K9Y A;  5BVZ A;  1NTM E;  3EFF K;  1EXI A;  3OT7 A;  5KMG B;  3I55 V;  1NTK J;  1URF A;  4WFB V;  2JJ1 G;  1U97 A;  3VBB A;  4U3F H;  2ZNJ A;  4UVB A;  2M0B A;  1P84 F;  1K4D C;  2OYH B;  3ZMZ A;  5CB4 A;  3HKE B;  3E2E A;  1QR9 A;  4LF8 B;  3OUF A;  2QIW A;  4DV3 B;  4EI2 A;  2JK5 C;  3B8N A;  1MA1 A;  2XT9 A;  3R2P A;  3E86 A;  3G6E V;  4PV1 D;  1NU1 H;  4JAU A;  1SC5 B;  4U7J A;  2GBO A;  4B3M O;  2RNB A;  4OXS A;  3BRT B;  3EHB B;  4O4I A;  2KXP B;  2A45 H;  1ZTE A;  1FZC A;  4TT3 H;  4RO0 A;  1W0J G;  2NN4 A;  4PJ0 H;  5GTI H;  4JZG A;  3UT5 B;  3P3P A;  3L73 D;  1ZWI C;  1MSW D;  1JFF B;  2YXR B;  3KHU A;  2UWJ E;  1VQ8 P;  4DV0 B;  5AW3 B;  5EZY A;  2OGU A;  2UXD O;  3FFQ A;  3L71 E;  1WPX A;  1J95 A;  1LTI C;  1Z56 A;  3KZI E;  4PD4 I;  2JRI A;  1HNX B;  3T1H O;  2PGD A;  2ZCE A;  4G27 B;  1JTH A;  3H1J G;  3L73 J;  5B3S C;  4AHC A;  1RPO A;  3QTC A;  1M57 D;  2KG7 B;  3T4D A;  3GWK C;  3OEH G;  1M4U A;  1PNL A;  1YTF D;  4CH4 A;  3C3S A;  2K37 A;  4JI1 O;  2XND G;  3RYF B;  1DIP A;  1M57 C;  5CBH A;  3VTP C;  1AA0 A;  4RWU A;  5B66 E;  3UCS C;  1NH4 A;  1JQ0 A;  4DXW A;  3CXC U;  4UB6 H;  2FFD C;  1Y76 A;  1N33 O;  1FJK A;  3H1L H;  1KZU B;  4NPE A;  3OD4 A;  2XHB A;  1EZV H;  1J2J B;  2GA1 A;  3TGU G;  2UXC B;  2EJ7 A;  4NYK A;  2A06 G;  1KUQ A;  1FZE A;  3TK1 A;  2ZXE B;  3HRN A;  2OQQ A;  1MFZ A;  3CWB D;  1JPX A;  2LW1 A;  1CSB A;  1SA0 A;  1PL4 A;  5KHI A;  2OYI C;  1R6N A;  2FML A;  3LID A;  3M06 A;  4GIF A;  1YIT P;  2J58 A;  2GUS A;  3I5D A;  1YBK A;  2ITA A;  1QHT A;  4I4T B;  2DYS B;  2XAQ A;  1JX9 A;  4O4J B;  1JY3 N;  2C0X A;  3AEA C;  1H8H G;  4DT0 A;  5APW A;  2LP7 A;  1AB3 A;  5LGT A;  4HB1 A;  2OYH C;  3OTO O;  1HGV A;  1SQV K;  3CWB J;  1KIL A;  3E8F A;  3OW2 O;  5L3F A;  4GKG A;  1LT9 B;  4X20 B;  1S5J A;  2A45 I;  3JAL B;  2DMX A;  4JI7 O;  2RH0 A;  3B09 A;  3WFV A;  1YJ9 V;  1T2K D;  2ZYA A;  3SPH A;  2ATK C;  4GKK O;  2YUA A;  1XUQ A;  4R4L A;  4K8Z A;  3OGC C;  3RWR D;  3L74 G;  4PDR A;  1RE3 C;  1T2K C;  4EEQ A;  3RBX A;  5CBO A;  4EDF A;  1EZJ A;  3VN0 A;  3AK1 A;  1COW G;  2HVK C;  3VOU A;  4DR1 B;  1RY3 A;  2R44 A;  3B77 A;  2BAS A;  4NPD A;  4QNH B;  1GDT A;  3K0G A;  1H2N A;  4JI2 B;  1N73 B;  1LP1 B;  5IJ0 A;  4M3L A;  1L0N K;  3CCU V;  4TUY B;  4JI4 O;  5CCG D;  3CMA V;  1IBL O;  3L72 G;  3H6P A;  1KD1 W;  2OYQ A;  2WA3 A;  4TQF A;  1VQM P;  1GU5 A;  1PNK A;  5CCG C;  1OZH A;  2VRS A;  4BWN A;  4TLF A;  1N7S A;  1XQ8 A;  3IJ4 A;  3FB6 C;  3CD6 P;  3O65 A;  2P67 A;  1SQV H;  3JAK A;  3E35 A;  1BCC D;  3B8M A;  4UCV A;  1J1E B;  2KNC B;  3LDC A;  4JTA B;  1R5L A;  3ZHS A;  3L75 D;  3PRJ A;  3LSU A;  4PI0 A;  1EZV I;  1BHB A;  1QLE D;  4JAA A;  5LYJ B;  1F4N A;  1VQ7 V;  2V4H A;  5D5Q A;  1QLE C;  2A0L A;  1GH6 A;  1ROP A;  1VP7 A;  1X8Y A;  2QE7 G;  1US6 A;  3O9O A;  1BCC J;  1Q3E A;  1N8R Q;  4YY3 B;  3CI9 A;  2IBZ E;  1F23 A;  4ABM A;  1K05 A;  3B5N B;  1SQP E;  2Y69 C;  4DR5 O;  1Q7Y W;  1OV9 A;  3L75 J;  3JYC A;  4PD4 D;  4OX9 O;  3AG3 C;  1PPJ D;  1GMJ A;  1L0N H;  3OGI B;  1Q82 W;  5EBM C;  1KYO E;  4QPJ A;  1IBK O;  2XAJ A;  4GUN A;  2Q7G A;  1K92 A;  2EIJ C;  2QWP B;  1I7F A;  4JI5 B;  3HR0 A;  2ZQM A;  1LTG C;  2WPD G;  1SKV A;  3U1A A;  3HE5 A;  3JC2 2;  1V54 C;  2WAM A;  1PNM A;  1SER A;  3JD0 A;  2P10 A;  3IN6 A;  1XNR B;  1WN7 A;  4KP4 A;  1SFC B;  3D8C A;  2HKO A;  1AI6 A;  1IXB A;  5L3E A;  1LT9 C;  2JS5 A;  3EVK A;  4X64 O;  3L35 A;  4DZO A;  3FAV B;  2J59 M;  3N7N A;  1JNM A;  2QGN A;  3N2K B;  1M8O B;  4B3T O;  3ABM C;  1KP2 A;  4OGQ B;  3WUV A;  5D5P A;  5H2F Z;  1HR0 O;  1MSD A;  2Q5U A;  2WLN A;  5EIB D;  2WVR A;  2VWJ A;  2ZR3 A;  1JB0 J;  1DD3 A;  2N1T A;  3WUT A;  4J41 A;  5EIB C;  3ZHT A;  4ZOL A;  2W6J G;  3FXD A;  2W6A A;  4U3F D;  5IY5 B;  3V2N A;  3D6Y A;  5APS A;  3T97 B;  1MZ9 A;  1FPO A;  5KLV K;  2M7W A;  4MVU A;  2R70 A;  1TAE A;  1RM1 C;  2JJ2 G;  1NU1 D;  1PGQ A;  3CPW O;  5J9P C;  2WPS A;  1L2P A;  2B1G A;  3CRQ A;  1ZW0 A;  1FZG A;  5K5G B;  3HUS B;  2K88 A;  2YEV A;  4CS2 A;  4JYA B;  2CH7 B;  2Q69 A;  1FZF A;  4U3F J;  5JQG B;  1W2B O;  1JY2 N;  1G2C A;  4DK1 A;  3H1I E;  2R9I A;  1JM0 A;  3CCQ P;  1SLQ A;  1NU1 J;  2R72 A;  4NR1 A;  1M93 A;  3B5N D;  4CS4 A;  5E79 E;  1V9P A;  4NXM O;  4YHH O;  1NTZ G;  2WWW A;  2DYR B;  3QVN A;  1FXK B;  4ZI7 B;  1XEQ A;  3ZMS A;  1EDJ A;  1BT8 A;  1YZB A;  3B5N C;  2L91 A;  3WU2 Z;  4B3R O;  4I5S A;  4PDL A;  4JI0 B;  2R32 A;  3G71 P;  3R66 A;  4MVQ A;  1LGH B;  3ZHU A;  1JJ2 U;  1YDX A;  4JYC A;  1AJP A;  3AG1 B;  2UUC O;  2KIK A;  3H32 A;  1SET A;  3HKB B;  3A0B E;  2EX3 A;  1G6U A;  3GG2 A;  3ABL B;  5KLV H;  3CCJ V;  2NPS B;  1GRJ A;  3FB8 C;  1BGY E;  2B87 A;  4X8A A;  4KHP B;  2HG5 D;  4UB8 Z;  3HD7 B;  4K0K B;  3II6 A;  1ZV8 A;  1K5Q A;  4GCZ A;  5IT9 N;  3FWN A;  3G3Z A;  2Q7C A;  1EZV D;  2HG5 C;  1VMG A;  2IJI A;  2ZE7 A;  3EQ2 A;  4D7T A;  2K9P A;  4KUM A;  3M0A A;  1Y8A A;  4BRY A;  1PP9 E;  1ZX3 A;  1IO4 A;  3JAW B;  1IZ3 A;  4D7S A;  1IFM A;  2IFN A;  4DV7 O;  3WB0 A;  2G38 A;  3RYC B;  1NVP B;  2BCC H;  3VOP A;  2OCC C;  2ZE6 A;  4DV4 B;  2FBW C;  2LXC B;  4KHX A;  2MK3 A;  4MVM A;  2RKL A;  2CDY A;  3RK3 D;  1QNM A;  4LF8 O;  1L0L E;  4DV3 O;  1EN5 A;  2ZFC A;  5FLX N;  2HOD B;  3VQY A;  1MOF A;  5H2F H;  2HVJ C;  2BSK A;  3RK3 C;  2YMK A;  2EIL C;  3D70 A;  1P49 A;  1LP1 A;  4C7U A;  3K59 A;  5LXT B;  2P6J A;  2P4K A;  3JCU Z;  4HNA A;  5B1N A;  5IY5 C;  2E5L B;  5KUM A;  2VRZ A;  1N34 O;  4DR4 O;  1NZ6 A;  5L8R J;  2ZXW C;  3DXR A;  5H6Q A;  2XAG A;  4PA6 A;  3CXH E;  1Q86 Q;  1YTZ T;  2W6B A;  3FYE B;  3K08 A;  4FIP C;  2KYV A;  3D36 A;  1QLN A;  2JP3 A;  1NOH A;  4B3M B;  2KNC A;  4LLH A;  2O3J A;  4DUY B;  2QWO B;  1XIL A;  5TIS H;  2QWN B;  3HTK A;  1SQX G;  2AW9 A;  2B88 A;  2F93 B;  3NR7 A;  4X1Y B;  4D6T H;  1W2E A;  1Y9B A;  1URQ A;  3U1C A;  4NKG B;  1KC8 Q;  3ZED A;  5APY A;  2M5A B;  1SQQ G;  4LWS B;  4GOD A;  2Q7H A;  1VQ5 V;  4GT1 A;  1M1J C;  3BA8 A;  2ZNI A;  1HUC A;  1AJY A;  1N0N A;  2WMM A;  4LH6 A;  1BL8 A;  1RSO B;  2F95 B;  3T1H B;  1A02 F;  3M9H A;  1GN2 A;  1F4M A;  1TVK A;  2QM4 A;  3MAQ A;  1SQV D;  3ABL C;  4Z1V A;  5AW4 B;  3HD7 D;  4OPA A;  4I55 A;  2EBO A;  2N05 A;  5GON A;  3JAT B;  3BCC E;  3V2R A;  3KKY A;  5JWP A;  4BIZ A;  2KP8 A;  3HD7 C;  3CD6 V;  4PEL A;  1FXV A;  1LTJ C;  3K3W A;  3BVH A;  2HPC B;  1WA8 A;  4B08 A;  1GN6 A;  3T1Y O;  1NVP D;  1S9K E;  1SQV J;  1VF7 A;  1HWY A;  2JVD A;  1KU9 A;  3SYP A;  3FD9 A;  1MUU A;  3BRV B;  1DH3 A;  2QTO A;  4MTG A;  2RJZ A;  1JVM A;  5CN0 A;  3Q4H B;  3V2P A;  4GX0 A;  4UCU A;  3SYA A;  3CB2 A;  4FJC C;  4ZHQ A;  2AEF A;  1PD3 A;  2NNU A;  4P9O A;  1L0N D;  5KHH A;  3IR9 A;  1P7B A;  1IXM A;  1VDF A;  1NVO A;  2Z5U A;  1HH0 A;  3OTF A;  4DV5 B;  2LGW A;  4P2Z A;  1H38 A;  3A0H Z;  2HEP A;  5JH7 A;  2GSM B;  2WLK A;  3L70 E;  1B6Q A;  1KB9 E;  1NTK E;  2W27 A;  5KHJ A;  3OTO B;  2KS1 B;  4LFB B;  2KB7 P;  4GYC B;  1G1J A;  1ZRT D;  2F23 A;  4JBZ A;  5JJE B;  1L0N J;  2NZ2 A;  3S1K A;  3CME V;  4F4L A;  4DR1 O;  3L36 A;  4L76 A;  4DW0 A;  2W8Z A;  2YKP A;  2OAR A;  4JZ2 A;  3CCV P;  5EBW C;  5B1A B;  2A7W A;  2ZD9 A;  2P1J A;  4HKZ H;  4GKK B;  2Z4E A;  3AE1 C;  2CAZ C;  3PTZ A;  5IJ9 A;  3JAS B;  3TGU D;  2PP6 A;  3FB5 C;  3E1I A;  1OWA A;  3AEI A;  1DK1 A;  5J2U B;  2A3Q A;  4H37 A;  1SQB G;  2M3E A;  3NXS A;  4WY4 B;  1AI4 A;  4H13 D;  5CHX A;  2V7Q G;  4PA3 A;  3AE7 C;  1UPG A;  1X0T A;  2YDE A;  3RGU A;  3GLM A;  5ITZ A;  5LP6 A;  4LF4 O;  4H13 C;  2BEZ F;  3I5C A;  4EFE A;  2LJ2 A;  1IBL B;  1L4A A;  1NTM G;  4JI3 O;  3W7S A;  3TGU J;  1GAX A;  4C7R A;  1R3J C;  4DOJ A;  4J10 A;  3GF3 A;  3APQ A;  4OVN F;  1YCI A;  1YTZ I;  3L73 E;  2V1D A;  2WSS H;  3JSV C;  5KX5 A;  2YMY A;  4YY3 O;  4I0X B;  2X6C A;  4BW9 A;  2W0F C;  4N21 A;  1MG1 A;  3QO8 A;  2AZ2 A;  4KT0 J;  4KJM A;  5CCH A;  2EJR A;  3E8G A;  2CK3 G;  1T5E A;  3KYQ A;  1HBW A;  1K4C C;  4JI5 O;  1FFX B;  2IH3 C;  3MUD C;  1M5I A;  1Y4M A;  3CCQ V;  3AE5 C;  1KTM A;  2QTS A;  3A3Y B;  5DM6 V;  4DR5 B;  3AE4 C;  1NHL A;  2K9J B;  4FM2 A;  1PGO A;  1XNR O;  3H1H E;  4R8C A;  4OX9 B;  2WZ7 A;  1M1K Q;  1VQP V;  2VQF B;  2K3R A;  1IBK B;  3RW0 A;  2EIM B;  3D3Q A;  5KLV D;  4MW3 A;  1IFD A;  3L71 G;  1NS1 A;  4GOE A;  3L72 D;  1E1Q G;  2AZ0 A;  2XU6 A;  4EYY Q;  3OEE G;  1AFO A;  1KOR A;  1W5C E;  5DED A;  3PH0 A;  4XFJ A;  3MZW B;  2WLL A;  2K1A A;  3HE4 A;  2B9Z A;  1NH2 B;  3A0H H;  4R4M A;  1YJW P;  3SYO A;  3RYI B;  1VQL P;  2N04 A;  1JMM A;  3ZN1 A;  1OCO C;  1RP3 B;  4BXL A;  4UUJ C;  3CX5 D;  1BQ0 A;  4DRX A;  3T2M A;  2QKC A;  4U7O A;  5KA6 A;  3OAK A;  5KLV J;  1EDL A;  1VQN V;  3L72 J;  1S5L E;  3G4S P;  2XAF A;  3UO3 A;  3H1K H;  3KPE A;  4C7N A;  1QX8 A;  2CPS A;  2Y0C A;  4WY4 D;  4FLW A;  2DQ3 A;  1KB9 F;  3HKD B;  4ZBM A;  1D7M A;  3CJH B;  2FYU K;  2HHH B;  4WY4 C;  3CCE V;  1IFI A;  1H2L A;  1BE3 H;  5IWA O;  3CE2 A;  3JD1 A;  2FXM A;  2RMZ A;  3KZI Z;  3VMX A;  3W7T A;  1GL2 A;  4DCK A;  5KAF H;  4IIJ A;  1VIB A;  2O1K A;  4L75 A;  4PV1 B;  1CW5 A;  3M9Q A;  2DWE C;  1B06 A;  1PV0 A;  4UV9 A;  2ODM A;  1NTM K;  5L3D A;  1K8A W;  2WT7 B;  2RDC A;  3DC5 A;  2X6A A;  1YF2 A;  2EIK C;  4O2B B;  1FYJ A;  3IFX A;  2BTQ B;  5LMU B;  2Q68 A;  5CA1 A;  1KFN A;  1YI2 V;  5B66 Z;  3RK2 D;  5LGN A;  4D6T D;  4IHJ B;  4DJG A;  4JI0 O;  4IL6 H;  1B04 A;  1S72 V;  1FZC C;  1VQ4 P;  2WLM A;  3M9B A;  1HJB A;  5KJ7 C;  1PPJ H;  5APX A;  3WG7 C;  3J80 N;  2LKM A;  1AQ5 A;  2YS8 A;  1JOY A;  4YHH B;  1IUR A;  1KFM A;  1JJO A;  2FYU H;  1GO3 F;  4QE9 A;  1NT2 B;  1CPY A;  2CE4 A;  4GKJ O;  1BCC E;  1Q2N A;  1VQK V;  5AVV B;  4D6T J;  4Z1M H;  4KHP O;  3CLQ A;  2Y0D A;  1AP6 A;  4K0K O;  1HJ0 A;  2OYO A;  3JAR A;  4HZ3 A;  2P7T C;  4JAS A;  4MTO A;  5LHH A;  1YTF B;  3L75 E;  2FFD B;  2YIU C;  4X1K B;  2JJL A;  2F4V O;  5LL6 Y;  3SWY A;  3AED C;  3BA9 A;  2NRG A;  1MKM A;  4O2A B;  3SYC A;  3GB7 C;  3V4Q A;  3IAY A;  4FLT A;  2XDJ A;  4O4L B;  3WMM 0;  1RQU A;  1LWU A;  1X4T A;  2OYI B;  1BMF G;  4PD4 E;  1TUB A;  2ZJS E;  1I08 A;  4DV7 B;  2JGU A;  2XOK G;  5AVU B;  2E5L O;  3FX0 A;  1GK4 A;  3AE3 C;  3AEG C;  1NO4 A;  2IYP A;  3GWO A;  1NTZ D;  1AR4 A;  4ASV A;  2JGD A;  3LSQ A;  3ZX6 A;  2FKW B;  1FJP A;  1FXH A;  3P8C E;  2IBZ G;  1S5L X;  4W7Z A;  2X0L A;  1ORQ C;  1SQP G;  1VPC A;  5IYZ A;  1NI8 A;  1D2D A;  5DJU B;  5BMV B;  4DUY O;  3RVZ A;  1TA8 A;  1CI6 A;  3ABT A;  4ZNC A;  4PV1 C;  2E43 A;  3OJA B;  5CBN A;  1N34 B;  1NKD A;  2N74 A;  4DR4 B;  4LFA O;  4WBA A;  1KIL D;  2IYO A;  1Q6H A;  3QWO C;  1NTZ J;  2RCV A;  2AXT H;  2RMK B;  3U10 A;  2HJF C;  1RPR A;  4EB6 B;  5IYD O;  1KIL C;  3C1L A;  3RGB A;  1K9M Q;  4FLX A;  1DTO A;  2E3C A;  3WB1 A;  4I0X A;  4X1I A;  3JD2 A;  1VEW A;  3E22 B;  4U3F E;  2ARH A;  2IU0 A;  4J9Z B;  3CCS V;  3E8B A;  3O6Q B;  5GTH H;  1DEE G;  4RES B;  3E83 A;  5JJJ B;  3KQG A;  5AW1 B;  2MJZ A;  1VQ9 P;  1WNS A;  2HR3 A;  2CGN A;  1PFI A;  5DJT B;  3LIE A;  1NU1 E;  2DN9 A;  2ZDI C;  2I1K A;  4EKW A;  1R6K A;  3RYH A;  3D71 A;  3TNU A;  1JOC A;  5KAI H;  1GW4 A;  1EXJ A;  1RF1 A;  5C8Y A;  4PJ0 E;  5GTI E;  1FE6 A;  4FK5 C;  1N7S D;  3EFG A;  4DR3 B;  3K5N A;  2GUV A;  5B5E E;  2Q8V A;  2YXL A;  1JEK A;  3SJB C;  1USE A;  1IFN A;  1QLE B;  1FOS F;  1X9V A;  1ZLL A;  5AVS B;  3SR2 C;  3NMD A;  2O1J A;  2Y69 B;  2DW4 A;  4K3A A;  5DEC A;  4RJT A;  3AG3 B;  3OUS A;  4JAV A;  4ICG A;  1SQX D;  3T1Y B;  1GTW A;  4DV5 O;  1FC2 C;  2EIJ B;  2YIC A;  2E5T A;  2QVA A;  1SZX A;  2OT5 A;  4MTX A;  1VQO V;  1QVG U;  3CC4 P;  3H1I G;  4YXW G;  1V54 B;  4TV9 B;  1E79 H;  1P84 D;  3G67 A;  3ETG A;  5GW7 A;  5AVZ B;  4DV6 O;  4LFB O;  4YJ3 B;  1YXB A;  1FD9 A;  5LOV B;  4UB6 E;  4CBC A;  3FYI B;  2WSC H;  2L35 A;  1BQZ A;  1SQX J;  2KZJ A;  3H1L E;  1KQF B;  4PD4 F; 
#chains in the Genus database with same CATH homology
 3AE4 C;  3G9R A;  3GMA A;  4TT3 H;  2WSC J;  4OGQ D;  3O6Q A;  1ZOY C;  1K04 A;  2QSI A;  1OW8 A;  3ABV C;  4I7Z B;  2D2C B;  1ZRT E;  2JO1 A;  1UIX A;  2BEQ D;  4OGQ C;  3SFD C;  2MKV A;  1NGM B;  3AE3 C;  3AEG C;  5KKZ C;  1FDI A;  4H13 B;  1KOR A;  2V7Q J;  2E74 D;  1KMI Z;  1YQ3 C;  2H88 C;  2WPV B;  2G3A A;  2FXP A;  2H89 C;  4IL6 X;  4XFJ A;  4H44 C;  3AE2 C;  1VF5 D;  4YTP C;  1S5L X;  2QJP C;  4R4M A;  1HF9 A;  2E74 C;  3D6Z A;  2WSF J;  1VF5 C;  1KIL E;  4PV1 C;  4RKU J;  2O01 J;  1K05 A;  1OW7 A;  2QJY C;  3Q5R A;  3R4Y A;  1FDO A;  1DIP A;  3AE8 C;  1GMJ A;  1VL2 A;  3AEE C;  2E75 B;  3AEF C;  4GDO A;  3SFE C;  4H44 B;  2E76 D;  3Q5P A;  4H0L D;  1NYH A;  1RQV A;  2NZ2 A;  2ZT9 D;  2FBW C;  3RK3 E;  1R8E A;  3LW5 J;  2E76 C;  2P10 A;  3IN6 A;  3RL0 g;  4PV1 B;  4H0L C;  2ZT9 C;  2WQY C;  2OQQ A;  2FYN C;  1S1C X;  2QJK C;  2YMK A;  3AE6 C;  1IK7 A;  3AE1 C;  1DD4 A;  3D70 A;  2D2C D;  5KLI C;  3D71 A;  1OMI A;  3Q2Y A;  5L8R J;  4OGQ B;  3EWK A;  1Q90 D;  3C8V A;  4H13 D;  3H25 A;  1KQG B;  1ZME C;  3AE7 C;  3AE9 C;  3S9O A;  2D2C C;  2IDB A;  1EXJ A;  1PL5 A;  1JB0 J;  3AEA C;  1DD3 A;  3GLM A;  4H13 C;  2BEZ F;  3GF7 A;  2JP3 A;  1PIX A;  4YXD C;  1TU3 F;  1YQ4 C;  3FGA D;  2E74 B;  2G8Y A;  1VF5 B;  4Y28 J;  1Y9B A;  3Q5S A;  3GF3 A;  2K9Y A;  1EXI A;  3D6Y A;  1U57 A;  3T97 B;  4Z1M H;  1WMK A;  4R4L A;  1OW6 A;  2J5U A;  3IAO A;  3Q3D A;  2E75 D;  1HJ0 A;  1AJY A;  3AEB C;  4H44 D;  2YIU C;  4I7Z C;  4KT0 J;  2E75 C;  5M1B A;  3AED C;  2QIW A;  1MKM A;  2WSE J;  3B71 A;  2E76 B;  4PV1 D;  3Q1M A;  4H0L B;  4U7J A;  3AEC C;  2ZT9 B;  1ZP0 C;  1RQU A;  1PV3 A;  3AE5 C;  1KTM A;  1KQF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...