4I7ZB

Crystal structure of cytochrome b6f in dopg, with disordered rieske iron-sulfur protein soluble domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
159
structure length
159
Chain Sequence
ATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Cytochrome b6
publication title Lipid-induced conformational changes within the cytochrome b6f complex of oxygenic photosynthesis.
pubmed doi rcsb
total genus 38
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4i7zB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4i7zB01
2WSFJ 1VF5B 2QSIA 2D2CB 2WSEJ 3C8VA 4RKUJ 4Y28J 1S5LX 5KKZC 2QIWA 2ZT9B 2E74B 4PV1B 2O01J 4IL6X 4H44B 3LW5J 1Q90D 5KLIC 2E76B 2WPVB 4KT0J 2YIUC 2E75B 2QJYC 1JB0J 2QJPC 4I7ZB 4OGQB 2FYNC 1ZRTE 5L8RJ 4H0LB 4H13B 2K9YA 2WSCJ 2QJKC
chains in the Genus database with same CATH superfamily
1NTZJ 4UVCA 2EIMB 1THZA 3JSLA 1Y76B 1SQBH 1EZJA 4DV4O 4GODA 3C1LA 4XE5B 2OCCC 1KD1W 4TT3G 1KUQA 3HD7C 3WU2E 4MVQA 3LW5J 1YI2P 3VMZA 4DZOA 1S4XA 3BCCD 4W80A 5KAFH 3RBXA 4X1IB 1R3LC 3L70E 2EJRA 2RN0A 1KB9H 4GX0A 2JRIA 4CBCA 4CC6A 1ZTEA 4TQFA 2WT7A 1BCCE 3FAVA 1BGYJ 3GG2A 4NTWA 2NPSD 2WWWA 1GL2B 2QE7G 1XBLA 4MVMA 2UUBO 2Q7CA 3OE7G 3V4WA 2AHYA 3FFQA 1GZLA 2F1MA 2LP7A 3W7WA 1JFFA 1J95A 3JALA 2UXCO 1IFNA 1IFJA 3K58A 1FC2C 2OYIC 5B1BB 3H1LD 3SWYA 4UB6H 3AG2C 2R9RB 4YXDC 2CK3G 2AEJA 4HBNA 3GW6A 3RK2D 1VQPV 3HPLC 4JYAO 2A45G 2FTKA 4QE9A 2OTJP 4JGSA 2N05A 2X6AA 1SQPD 4YXWH 4HAMA 4WY4D 3ZIAG 4I1LA 4O4LA 3CXCU 2FYUD 3J80N 2AW9A 4DJGA 5CHXA 1D7MA 3ZHQA 4WFHA 1Y8AA 1P7GA 2QA4P 3C90A 1FBMA 4KFMA 2M5AA 4EB6A 1SQVH 5BR8O 1OIPA 2LXBA 4W7ZA 3TNUB 3J81N 2OWOA 1NTMJ 1VQ7V 4DV6B 2JK5C 3AG3C 3KKYA 2A06G 2P10A 4NXNO 2HP8A 1N32B 3CC2V 2YIDA 3F5WC 3C3SA 1JNMA 1VQKV 3K08A 5JWPA 2Y69C 1L0LK 4E2LA 1XUQA 2OT5A 3SYQA 1L0LG 3H1IE 1R8EA 2V4DA 4JYBA 3B09A 1T2KC 4L76A 1WPBA 1X79B 3SFDC 1EDLA 4I9WA 2H8PD 3V4QA 1JJOA 1F4MA 1S5JA 2WTYA 4PD4I 4MVSA 1I94O 5KX5A 1FJKA 2HPCB 3AG1B 1FXKC 2QRXA 1CZQA 2RMZA 5KMGA 2QJPC 1DTOA 4OGQB 1GDTA 3CCRP 3L72D 1YIJP 1RFYA 2LFRA 4FLVA 2LR2A 1NR1A 2W6JH 2FFDB 2IYPA 5IJ9B 1AP5A 5KUKA 1BGYG 3H1HJ 2Y9YA 3AK1A 3IN6A 3MHHC 3ZMTA 3D36A 3VQVA 4O4HA 4X62O 1N33B 4DUZO 1HNWO 3WMM0 1K9MQ 2HEPA 1K33A 2Y48A 4LF5O 1PGPA 4NXMB 1WN7A 2H89C 1WB7A 4DR5B 3WU2Z 3T1HB 4ICGA 2OYOA 2YI9A 4PA3A 1BSNA 1SQBK 3S3WA 4UVAA 4UCUA 4IT5A 2P1JA 3HKDB 1G8MA 5LMUB 1SQBG 2Y0CA 1S72P 3MUDA 1BSHA 5APXA 1HDJA 3CCSP 2L5GB 4J9YB 2IJKA 4DR3O 3L75E 4LF9O 1Y74A 2UU9O 1W5CE 3P8CE 3USSA 2XAGA 2AXTH 5JCOA 2Y4UA 3K57A 5IYCO 1ZN5A 4YJ2A 1J2JB 4TUYB 3RN4A 1P84I 2UUCO 4PJ0E 4IIJA 4J7JA 3RK3E 3BVOA 3M9HA 3UT5B 1RSOA 4TLFA 1Q86W 1M1KW 1OFCX 4OXSA 2LW1A 4UCSA 3TXSA 3T1YO 2Q1KA 1H8AA 1JM0A 3QO7A 1LTJC 5C93A 2ZT9C 1LT9A 3OR7C 4HYOA 3K5LA 1TGOA 1EZVI 3CCLV 2KUBA 3E8GA 3AEGC 2JJ2G 1N86A 3EXAA 2EIJC 4FFBB 3U1CA 3KDPB 4YXWG 1AJYA 3D36C 2IU0A 2XZRA 4L75A 3MIWA 4YY3B 1XNRB 3CEIA 1BDCA 2KZIA 3CJHB 1YHQV 1KILA 3VMYA 1IVSA 2W83C 2F4VO 1SQQJ 1NH2D 3EWKA 3PRJA 4D6TD 1VQLP 2E74C 3L35A 2ZIOA 3OFNG 4TSFG 3P3PA 4CH4A 1G1XB 3C8VA 2QSAA 4Y99C 4LF8O 3BCCH 2Q7EA 2H3OA 1J1EB 1SQVK 3G6EV 1SQVG 2N74A 3ZRWB 1SLQA 3M91A 3V5BA 2EIKB 1BT8A 4NKGB 1N2DC 2ZJSE 3CXHE 4CH3A 2X6CA 3HKCB 1M1JB 4HYTB 1S76D 2W90A 1DX7A 2YXYA 2VQEO 4LFBB 1N0NA 1K04A 4N3YB 4ASUG 5AW4B 5GTIZ 3C3TA 5CCGA 2Q5ZA 3S9OA 2QVAA 1BS3A 4UFZA 4DRXB 2IFNA 4B3MB 1B06A 2KB1A 1QL2A 2K3RA 2IBZE 1EQ7A 1JR9A 2X0LA 3BFRA 4KXRA 3R4YA 4RKUJ 1H0TB 4DR2B 5LL6Y 4G27B 3CCUV 2WITA 2A79B 3FKSG 1PNLA 3RYFA 5KHJA 2BCCD 1W59A 3JAWB 2PYJA 1LT9C 5AVSB 1KB9F 3JARA 4YJ3B 1GK6A 1S1CX 3KZIH 5E79E 2YSUB 2DOSA 2W6JG 2QJ1A 3BCCJ 2ZXWB 1YJWV 5AW0B 1GN6A 3V2NA 3ABKB 1L1FA 3ABLB 1ZX3A 4B7EA 5AW5B 5LGTA 1FZCA 4Z1MG 4UV8A 5CBOA 2KG7A 4A5UB 3D6ZA 1LP1B 1KILC 1T8ZA 2HFED 1BCCH 3BABA 3HD7D 1CW5A 3HUSA 2WLMA 2FB5A 2PGDA 4QPJA 1NHLA 3WFVA 2YIBD 1FZFA 1GTOA 3JCUE 1ENVA 2W6IG 4LFAB 1QHTA 4QPKA 4TV9B 4AHCA 4C46A 3B4SA 5AW6B 4R8CA 4PJ0Z 1GRJA 5LBQA 3DXRA 4M3LA 2MW2B 1PV0A 3VQYA 1SQPJ 4UUJC 4NYKA 3PH0A 2CH7A 3LNNA 1RH5B 2W0FC 3I56V 1LJ2A 1XTCC 2Q0AA 1MUUA 2HJDA 3A0BE 1NI8A 1QLEC 1RF0A 5KKZB 1AJPA 3CCEP 4PDRA 3ABTA 3T2MA 3WG7C 5DEDA 4I7ZB 1SFCD 3L73H 1HWYA 3HKBA 4JF7A 3QWOC 1CPYA 3N2GB 2R9IA 1QBZA 1IBMO 4KL1A 3P30A 1SQXE 5AW8B 3ETQA 3VMAA 5EK0A 3LDCA 1VQ4P 3B5NC 1DGSA 2EBOA 1RM1C 3CWBE 3WB1A 1EDIA 5KHIA 1FZCC 3JATB 2P22C 5L3FA 4DW0A 4QIWF 3UCSC 2KNCB 2EZOA 1PNMA 3F5TA 3RBZA 3HUSC 5CBNA 3HTKA 1UPGA 1MG1A 4F4LA 3BCCG 1B6QA 1FKAO 4IL6Z 3BHPA 3L72J 3B8MA 1UIIA 4A7PA 4N23A 3RYCA 4RQEA 2ITAA 1T2KD 3ASNB 3MAQA 1M56C 2A06D 5J9PC 2JGDA 2JP3A 3BRTB 1SVFA 1EM1A 1UFIA 5LXTA 3HE5B 3T1CA 1TAEA 3MD0A 4RESB 3V2PA 5BU5A 4JI5O 1L0LD 5LP6B 3A2AA 1RF0C 3OMIB 1MZEA 1SP4A 4NB5A 2FYZA 1LTBC 3G3ZA 4O4JA 2YEVB 2ZR3A 3E22B 1N33O 1MZFA 1BE3E 1SKVA 2VQFO 5H2FH 2OYHC 4GOFA 1SF9A 1AP6A 3A0HZ 2ZKOA 3T1HO 3PP5A 1BHAA 2E76D 4JI7B 4WWIA 5C8YA 1PL4A 4LC1A 4KHPB 1GN2A 5J2UA 4PD4E 4U3FE 3TYYA 3T4DA 4GKKB 1H2LA 1WT6A 1WA8B 2WZ7A 2O57A 2DQ0A 1FDMA 1KBHA 2WLIB 4XDLA 1FS0G 2P4VA 5D5QA 3THOA 1OHHG 3NR7A 1FDIA 4XFJA 3FD9A 2G8YA 3JAKA 5TISZ 5BU8B 1WLEA 4GX1A 1BCCG 1IURA 2BSKA 4X89A 2YKQA 2DYSB 3OTFA 3FWLA 3H1JE 3RL0C 4NPFX 1RF1A 3CCMV 2PI4A 1G1IA 2QEXP 2HLDG 1SQBD 2K37A 3TSIA 3SPGA 1KYOF 3Q5RA 1Q86Q 1NTME 1AB3A 4O2AA 2JDIH 4GDOA 1L4AA 2QTSA 1Q7YW 1N0JA 3A0BZ 3ZMUA 1CI6A 3VYIA 5IWAB 2GTSA 5CJ4A 3K59A 1YTFB 3P8MC 1WJZA 2SPZA 1VQ8V 1OCRC 4WB4A 2DMXA 1KB9D 1S5LH 1KP3A 1HJ0A 3AE9C 3F7YC 2WSSH 3ETDA 2QJKB 4RAIA 4ZHQB 3BATA 5IT9N 2K9JB 3CB2A 1XNRO 4D6TJ 4CH6A 1TA8A 1DEEG 1L0NE 1KQLA 1OMIA 1Q6UA 3L73G 2HODB 2WPRA 4H0LD 2GUZB 1IBLO 1JB0J 1P84E 4X8AA 5CCHA 3WUTA 1Q82W 1GN3A 1M93A 2OIEA 2C9NY 1M5IA 3ZHSA 4H13B 1OVRA 3CXHH 2N04A 5L3CA 2J5UA 3JD2A 5HFMA 2K1EA 3ZEDA 1MKMA 2E74D 3ZRXA 1IJDB 4OX9O 4DT0A 1EN6A 1YJ9P 5LA6B 2Q68A 4LFBO 1COWG 1PPJE 3A2FA 4LF6O 4J11A 1EZVE 4OPHA 3E86A 1DH3A 1XHZA 1GM7A 4B3MO 3AEIA 2JEXA 3LIEA 2PF4E 2CTWA 3Q5SA 2WLLB 2ZVOB 2FXOA 2E75B 4BIOA 1RF1C 1KC8W 2ZQMA 2UXBO 2DYRB 1HH0A 1KZUB 1SQVD 4DR2O 1S77D 3CX5H 3U1AA 4JF3A 4EIJA 1MMMA 1FXVA 3E83A 2UXDB 1L4AC 1AILA 4RWUA 2J59M 2WPDG 4DR6B 1I0HA 1ZL8A 2ZM6O 1L2PA 1VQNV 1FFTB 4B3SB 1WP8A 1TUBA 4FZ1A 5CA1A 5KHKA 5LYJA 1IFPA 3CMAV 3ZJZA 1YBKA 2KKWA 2B5UA 2ZDIA 3HKEA 3Q4HA 3KPEA 4U3JB 1HNXB 5KTBA 1LWUA 3M8AA 1SZTA 3NTNA 4JI3B 1BHBA 3ZHUA 4WBNB 5GONA 4ZI7B 2WLHA 2OTLP 4FJCC 1U97A 1FJGB 1JCHA 4NVPA 4DYLA 1YI2V 1PIXA 1Y67A 4JI0B 4OVNF 3JCUH 5CCHC 1R3KC 5KLVE 3D6YA 4CZZA 1OVUA 3QG5A 1U7JA 3MHVA 1KILD 3SFEC 5KAFZ 4PHZA 2G38A 2XKMA 2M6YA 4J7KA 1HP8A 3ABMB 3E35A 1Y76A 3FGAD 2QGNA 1ZRTD 1NTKE 1M90Q 3JD1A 1BZKA 1GKFA 1YEWA 3QNEA 4P30A 5L8RJ 3OMAB 1H2NA 5H6RA 1N36B 2DWEC 1VQOP 3FYEB 4X1IA 1RY3A 4IOIH 3E1RA 4EEQA 1PD3A 2A06H 2P90A 1W2BU 5CCGD 2C0XA 1EBOA 3IFXA 4JYYA 2KS1B 2IU3A 3B2EE 1Q81W 1ZV8A 1EN5A 1NU1E 4I0XB 1VDFA 4IL6X 2JDIG 5AW9B 1QLED 4BIUA 3LSQA 2V7QH 1GL2A 4L87A 3RK3C 4R50A 4LBEC 2Y0EA 1JY2O 2R3CA 2IDBA 4FLTA 1XI1A 2WSSG 2HHHO 3D70A 1N7SB 2ZDIC 3SPIA 4EYYQ 2QA4V 3AG4C 3E8BA 5APQA 4KP4A 1LWUC 3ZDMA 4B86A 1W2BO 1FZGA 1NR7A 2Q4PA 1VQ9V 4W4LA 3A0RA 4WBAA 3Q1MA 2FKXA 2AEFA 4GX5A 4NPEA 1KFNA 1MABG 4DXWA 1W2EA 1NZ6A 4LP8A 5B66Z 3OA7A 4HJGH 2EIMC 3P3NA 2J58A 1PGJA 5BVZA 1IX9A 2KIKA 3TNUA 3MZWB 5CA0B 1KYOD 4EFEA 1L0LJ 2V7QJ 1NT2B 2RNBA 5L3GA 2YO3A 5C39A 3JYCA 2NNUA 4X64B 3M0DA 1M56D 4K8ZA 3OJAB 2HFEC 3OW2U 1AJNA 3CCRV 3IR9A 1YIJV 2G3AA 1N73B 1IDSA 1XILA 2XNDH 4W4KA 2OARA 1K8AQ 3H1LE 1SS1A 2GDSA 1JOCA 3KXDA 4J7ZA 3IAYA 1GL2C 3VP9A 1BL8A 4JI7O 2W27A 3JD3A 2HPCA 4YHHO 4I50B 4KHPO 1GM8A 1VF5B 3L71E 3ZRSA 5FLXN 4GKKO 1HF9A 1MSDA 4MVZA 5B1BC 1PP9E 3AEEC 2JEEA 2FYUE 1VEWA 2RMKB 1RE3A 2FFDA 1Y66A 1K4CC 1JPXA 3CRCA 5AVYB 3OW2O 4BW5A 4ZKIA 5F2VO 1FE6A 5IJ9A 4BIZA 4F6RB 1YYCA 1S72V 2KZJA 1M57B 2KI7B 4KT0J 2W6BA 5AVUB 3CCSV 3AEDC 1R6TA 2QG4A 1Q6IA 2QM8A 2E5YA 2ZINA 3OAKA 4AYCA 3ZMSA 1SFCC 1SQBJ 3WB0A 2W6AA 1A02F 3S1KA 5EIBC 4MW3A 1E5WA 3SYPA 1KMIZ 2ODMA 3RL0D 2P06A 2XASA 3HKDA 3SGIA 5IWAO 2O1KA 2WSFH 3R2PA 4XA4A 5TJHA 5K5GB 2WAMA 1R5LA 3M0DC 1BCCD 3SR2C 5EBLC 1NOHA 3CXHF 2GA1A 4GOEA 4HZ3A 4UCTA 3CRMA 1L0NH 2B1IA 4UCRA 2PRRA 5AVTB 3E8HA 4TUYA 1NWQA 1P84H 3PTZA 1A32A 2MK3A 4PV1D 2V7QG 3UT5A 3O9OA 2CGOA 3UO3A 3H1KE 3CD6P 1Q82Q 3AG1C 5GTIE 2NRGA 3H6PA 1S2EA 5KLIC 4X66B 4OGQC 1L8DA 2ZE7A 2N1TB 2RDCA 2I8DA 1SESA 1EZVH 1I7FA 3KCYA 3CX5F 1RE3C 2FFDC 2YIUB 1ZP0C 1TVKB 2IH1C 3QF7A 2XDJA 4FFBA 1YVWA 2PP6A 2Y0DA 4NPDA 3TETA 3ZN1A 2ZE5A 4FFKA 2D2CB 4DUYB 1SQVJ 3IJ4A 3BASA 4JI8B 3L73D 3BA8A 3H32B 3CJHA 5IYZB 1X4TA 5LOVB 3E8FA 5H9CA 3BRVB 4X1KB 1KC8Q 3O65A 1IFMA 1WMKA 2O3JA 4Z1MH 2E76C 1OX3A 4DV2B 3OTOB 4K0KO 5APTA 3JASB 2R44A 2JR8A 2UXDO 1D2DA 3ZHVA 2DE0X 1YSCA 3FB6C 4DR6O 1O9HA 3ZRWA 1FXKB 1SQGA 2UWJE 1B04A 2QJPB 5JH7B 4L8JA 5KAIE 3SYAA 3HKCA 1M1JA 3H1ID 3CYOA 4YTPC 1IXMA 2MJZA 4B3SO 2Q3IA 1L4AD 2KSDA 2PUSA 2YKPA 3AEAC 4DRXA 2OCHA 3W68A 3CPWU 3N7NA 2XNDG 2WA3A 1AQ5A 3KZIZ 4O2BB 4N78E 4WCEV 4JPRA 1H0TA 2P6JA 1NKDA 4JI0O 3U59A 4HNAB 3SYCA 1AI5A 3SJQC 3ZBHA 3PN1A 3UQ8A 1RE4A 3W67A 1K92A 1IXBA 3JAWA 4WFGA 1VQPP 2ZFCA 4UCOA 4YJ3A 1NTKH 2ARHA 4TV8B 5CCHD 1KN7A 4C7NB 3CC4P 3AE2C 5L3DA 4L73A 1Y4MA 2ITDC 4JI6B 4H44C 3L74E 3O6QB 1IZNB 1I5YA 2YXHA 2OTKE 3CPWO 1M8OB 1USDA 3IGAC 1N36O 2IM9A 4HB1A 4R4MA 2XAQA 5H5NA 1LP1A 2VRSA 1HGVA 2MKVA 5CN0A 4ASVA 4H0LC 1KYOH 4LR3A 1UJWB 1K7DA 2BTQB 3L75D 3NFQA 5KA5A 4LLHA 2GUSA 2XAHA 1LNQA 3X2QB 1GAXA 3SJBC 3CMEP 1J1EC 3KG2A 4TOIA 4WFEA 1JOYA 3CCEV 1OXZA 2JKVA 2L6LA 3P8CD 1N34B 1NVPD 4FMTA 4G2KA 3CC2P 5LMNB 5BY1A 1K97A 1M9NA 2ZT9B 4TV9A 1LTJB 1URQB 1VPCA 1M1JC 1V55B 1Z2GA 2GSMB 2JGUA 3MUDC 4WF9V 3LDDA 4HKZH 3RK3D 2KK7A 1L0NK 1QQCA 2R5BA 1L0NG 2BCCE 3K5NA 1DF5A 2UXNA 3JSNA 1K73W 2BASA 1HJBA 1VQ4V 4IL6E 4MVOA 2WQYC 2K9YA 5JCOC 2ZYAA 2Z4EA 3SPHA 3JSVC 2XV5A 1YTZT 1NJIQ 3GHGB 1X0TA 2P4KA 1PV3A 3HE4B 3CCVV 3N2GA 1GM9A 4R6ZA 4JI1B 1QGKB 3N2KB 1KQGB 1R5SA 1EZVG 3Q3DA 4GKJB 3QTCA 2ZXWC 3W7SA 2VWJA 2LKMA 1FJPA 5CBGA 3ABKC 1MZ9A 2WLJA 3RFRA 2B9BA 1P49A 1ORQC 3WU2H 2YKOA 5B1OA 3CHXA 3H9VA 3JATA 4LWSB 3JCZA 3E89A 1G4YB 3A0HE 4C7RA 1F23A 1KD1Q 1Q6HA 2KNCA 5JJNB 2Z5IA 3L70H 1PL0A 3TGUE 3DSQA 2Q6AA 2ZR2A 5KAIZ 1N8RW 3CXHD 5FPRA 5AVVB 1DIPA 1QCEA 1OCCB 3RYHB 2W8ZA 3CCJP 1YJNP 5AVQB 1OCZC 1FZEA 5JVDB 2Q73A 4N21A 3K03A 1Q90D 5AW1B 3L71H 1BMFG 1JX9A 1GK4A 1F7YA 1NBMG 1SERA 1PP9H 1IC2A 3APQA 5J2TB 5L3EA 2IBZD 3NMDA 5TISE 1GL2D 3BRCA 4O4IB 1Z56A 2DQ3A 4PA4A 5JJEB 3HE5A 5LP6A 2D3OW 5CCGC 2WVRA 5KKZC 3CX5D 4J9ZB 2WSCH 1NVOA 5H6QA 5AVWB 3OUFA 3RYIB 2B87B 2YEVA 2Q9LA 1URFA 3E22A 3M99B 5M1BA 1PL5A 1Z5WA 4I7ZC 2KOGA 1ZR2A 3TK1A 2GBOA 3L70J 2EJ7A 3BA9A 4JI2B 1NTKK 3FB5C 2QWRB 1ZLLA 1OCOC 1NTKG 2IW5A 1R6NA 2LGQA 1P84F 5EIBD 3FYIB 2IFMA 2FYNB 1BCCJ 2H43A 1WA8A 1YCIA 2QEXV 1OW6A 1E1QG 5EBWC 2WLIA 2YC0A 3VN0A 3ASOB 4KJMA 2M3BA 5IDJA 5B5EE 1VL2A 3UM7A 4DV6O 2PYLA 1J5EB 2ILMA 1HR0B 1N32O 1JY3O 4J41A 4I5SA 2ZCEA 3A3YB 2NR5A 3H1IH 5KHHA 3AEBC 3I5CA 2KB7P 3B8EB 3LUTB 4PI2A 3CRRA 1LT1A 3WG7B 4BWNA 1QLNA 1QVFO 1S5LZ 3RW0A 3SJCC 1NTZE 4OH8B 2XHBA 2XNXA 3R65A 1VQ5P 3BY6A 3JD4A 1KKCA 3DC5A 2JS3A 2PI5A 4X66O 4JV5B 1FDOA 2KSJA 1XMQB 1E79H 1G2CB 1X22A 1GMJA 1AV1A 3B5NB 5EZYB 1NYHA 4ZMDA 1RM1B 4DCKA 3L73J 2POHA 2R9AA 4RJTA 4OGQD 5LP6C 4I4TB 2Q67A 4ZHQA 4DUYO 2K9JA 3CC7P 5ITZB 1SQXD 1YJ9V 3AE5C 3ICXA 4FM0A 1GW3A 1U96A 1BGYE 4J80A 4RUEA 4P9PA 2HODA 3M7MX 4B7KA 4DV2O 3CWBD 2GUZA 3OTOO 2Q7GA 2E5LB 1Z5VA 1YJWP 4NXMO 3EHBB 3H1IJ 1IFIA 3ZS8C 1OVVA 4DR5O 2EILB 2CTQA 3AE3C 3AE1C 3UIAA 3JC22 3L75H 1WAZA 1S3JA 5LMUO 4IYIA 5LA6A 1VMGA 1AVYA 1SQBE 4LF4B 3L9DA 4UB8Z 1NAYA 1YITP 3L70G 3F89A 2YXRB 2DYSC 2WLLA 3OR6C 5KAFE 4UVBA 2JO1A 3E7KA 3HB3B 4PJ0H 2R3SA 4FLZA 3QH9A 2UUAB 2B1GA 4LH6A 3DC6A 3RT3C 2NPSB 3M06A 5FNVB 3NXSA 4X88A 1ROPA 3T97B 4LCUC 1B3QA 3L71G 2OYHB 1J1DC 3OD4A 5GTHZ 1PP9G 5BXZA 2UUBB 2YICA 2OTLV 3GB7C 3I56P 4I9QA 1M1KQ 2V1DA 4GUNA 2H94A 2ZNJA 2YXQB 1FXHA 1QU7A 1HW7A 3L74H 3CCQP 3UKMA 2ZE8A 2UXCB 3RK2B 2A0LA 1BE3D 4ZOLB 4DV0B 4JI6O 3A5TA 1YQ4C 1YDXA 2QJKC 4JYAB 2YS8A 2X6BA 3GF7A 1ZXGA 4UB6E 4U3JA 4DR4B 2IZ0A 4BWAA 4WY4B 3L75J 2ADQB 4PV1C 1H2GA 4TWKA 4WBNA 1R3JC 4ZBMA 4ZI7A 1IBKB 2E5TA 4H44D 1RP3B 4YY3O 1PGOA 4RO0A 2OYQA 3TXQA 3K5MA 1USEA 4EI2A 1JCCA 1VQOV 4JBZA 5B5EZ 1IK7A 2ITCC 1FZBA 4H13C 1XDCA 5LMNO 1RPOA 4Q6GA 2QJYB 3MHSC 4BAYA 5BR8B 3H1JD 3FX7A 3B40A 3F7VC 2Q8VA 4MW8A 5IY5B 4OPAA 1T3UA 1W0KG 3I5DA 3H1HE 1KFMA 2CPBA 2ETNA 3EQ2A 2ZYGA 4IHJB 4NXNB 4NTXA 4IL6H 1JMMA 4U7NA 1X8YA 2P7TC 2BTOA 5B66E 3H1IG 3SWKA 1QVGO 1PM9A 2IBZH 3IF4A 5EYPB 2DYRC 1HWTC 1YTZI 2KS1A 1A02J 3OUSA 4I0XA 1JJ2U 5A9GA 4DOJA 1GO3F 4CH5A 1OJHA 3IFMA 1E79G 4K3AA 2P5OA 2QKCA 4GKJO 5E79H 1L0ND 4BW9A 4O9BA 5IJ0B 2FKWB 3LIDA 5B3SC 1EFRG 2CDYA 1N7SA 4MVRA 1P84D 3A0HH 3G71P 1QR8A 4ZIBA 5EBMC 2K9PA 4JZGA 1NGMB 1SC5B 3FB7C 2IH3C 3TGUH 2RH0A 1YXBA 2DW4A 3A8TA 3KHUA 1JUNA 1VQMP 2QDOA 5IYDO 3OEEG 1K9MW 1MNGA 1ZRTE 1XHXA 3FX0A 1ZLZA 4GCZA 1JY2P 5CB4B 1EZVD 1K05A 1PPJD 1JVMA 2R5DA 1SS3A 3V6IA 1SZXA 1JTHB 3WUUA 2A3QA 5BMVB 5TISH 3ABMC 5APUA 1VARA 3L75G 4YIPA 5CA0A 4LFAO 2JIZG 4PA6A 3H01A 4DR3B 3G80A 4LF7B 1R6KA 2WA4A 2R32A 3CCMP 3H32A 3ZMZA 1OWAA 3GMAA 3A7OA 5IYBO 3VTPC 3D8CA 5JJJB 5APSA 3A0BH 1Q43A 1AR5A 1N73A 3F5HA 1SQQE 3S4RA 4X1YB 1EDKA 4U7JA 5B1AB 5K1XA 1DD4A 4B3RB 1FOSE 4JI2O 4MTXA 4UB6Z 3RVYA 1AQTA 5AVXB 4K35A 2OTJV 1ZW0A 4I50A 3L74G 1SQXH 1S9KE 4BRYB 5AW7B 2M3EA 4Z1VA 1K4DC 1LGHB 3CWBH 2XU6A 5AVRB 1JY2N 5KLVD 4ZNCA 1G1JA 1XL6A 2UXXA 4PI0A 1H2MA 4F6RA 1J5EO 5EFWB 1SA0B 2KLUA 5EC2C 1HR0O 4LH7A 1LTIC 5K1PA 2QSIA 1GD2E 1XNQB 2ZYDA 1OZ0A 4I55B 1NH2B 4JTAB 1LTTC 1NTKD 2FBWC 2CE4A 1OZHA 2LW7A 3APOA 4DK0A 3AK2A 2CAZC 5D5PA 1TU3F 1EXJA 4JV5O 2NZ2A 5BZBA 2AHZA 3BCCE 4QJFB 3LW5H 3K04A 1V54B 1XMQO 1RHZB 2EINB 4FIPC 1XL4A 2Q7HA 4MVUA 1ZMEC 3CD6V 2IPPA 4XBFA 1LR1A 3AE8C 1NU1D 1HBWA 1SQXJ 1WRGA 5APVA 3AG4B 4H33A 4LNUB 2IBZG 1N73C 3CWBJ 1FZAA 2A45I 2Y0IA 1FFXB 3K0DA 1BE3H 3SDLA 4AQRD 4WFFA 1AFOA 2E5LO 3N27A 3KCXA 5JQGB 2LFSA 1CEZA 1K5SA 4Z2WA 4IFMA 2E3CA 3VBBA 1VF5C 3EFFK 4U3FH 2PY5A 4PD4H 4GYCB 2N1TA 1BQZA 1SQPE 3KZIE 4FK5C 1TVKA 4ABMA 1DLBA 1QX8A 4LF4O 3TGUG 3ZHTA 2QWQB 3SSUA 1N4CA 1M57C 3OGIB 4J10A 4CS2A 2OCCB 3BPZA 3HD7B 5KJ7A 1FS0E 2WPSA 4JTCB 4QGPA 5CMUA 3H1JH 5IYZA 5LOVA 3CE2A 4EKWA 1DEBA 4X1KA 2UUAO 1DD3A 3OGCC 1K34A 3JASA 3V2QA 3M9BA 1NTMH 3GWOA 5CA3A 3G4SP 2BOCC 1GK9A 1BE3J 4Y28J 1FXKA 4LFCB 2FMLA 5JH7A 3CI9A 2BOBC 1Q7YQ 2AXTZ 3LDEA 1YQ3C 3BEHA 1MOFA 3B77A 4PDLA 3WB2A 4DV0O 4EDFA 4MSWC 4MT8A 2CTRA 3L70D 2YDEA 3D3IA 1O9GA 2PAJA 4U3FJ 4FM1A 2OYIB 1PGQA 4X65B 1YTFD 4DR4O 3AG2B 3K9AA 2ZXEB 1AI4A 2O01H 3CC4V 1AI7A 1XMOB 1DK1A 1IBKO 4O2BA 3L71D 1KORA 1SFCB 2BEZF 2PGGA 1V9PA 3I55P 1H88A 1PP9D 1VIBA 3L72E 1JMKC 3P7KA 1GU5A 4HNAA 3ZRVA 4WVZA 1SQXK 2Q69A 3U10A 3H1JJ 1SQXG 3LSUA 2CTPA 1Q2NA 1NO4A 2B89A 3L73E 2QKAA 2A9HA 1IBMB 4X20B 1LUVA 2N1TC 4AI8A 4TV8A 5DM6V 3H1HH 1NH4A 3JD0A 3CWBG 3CRQA 4C7NA 3T4ZA 1M4UA 2YIUC 3CMEV 4H13D 1VQ9P 4MTOA 4FPPA 3O6QA 1VQLV 1R73A 1PPJH 5B66H 5LHHA 2F43G 3MDSA 1HNZB 5APYA 2D2CC 3HR0A 4ZKUA 3AG3B 5KJ7C 4JI4B 1NTZK 3ITKA 2WSFJ 1NTZG 2BTQA 3FWNA 1VQ6P 2V4HA 1KB9I 2Y69B 1ZOYC 2VRZA 2O01J 1VF6A 1CXZB 2Z0AA 3STZC 3CL3D 5APWA 2E75D 1IFDA 3ZCCA 1L0NJ 2VS0A 2WT7B 3FAVB 3PJSK 5FPOA 2QWOB 1D5NA 1LTJA 1S5HC 5AG2A 1URQA 5KLIB 3ML0A 1IZ3A 3CS5A 2YI8A 1JFFB 1H8HG 3JALB 4XDJA 4JI5B 3H1KD 2JWAA 2YO2A 4AQYB 3AG7A 1BE3G 3SYOA 5AVZB 4PA9A 2F66C 1HNXO 2KSEA 2WMMA 4QE7A 4JI3O 5B1NA 4TQDA 2A7WA 2VQFB 2WSEH 2E76B 1FJGO 5KLVH 1EDJA 3GHGA 2ADPA 4O4LB 1ZR4A 2JS5A 3HE4A 5H2FE 4U3FG 4PDVA 2YIAA 2IJJA 3ZX6A 3E2EA 4PA7A 3N2KA 3TJTA 4ASWA 1YJNV 3CCJV 5CMZA 2M5AB 4EB6B 1QR9A 4F6EA 4LF7O 3Q2YA 2P58A 4I6MC 2BE3A 4D6TE 2ZD9A 4LWSA 4CC5A 3CSXA 1SQQH 4GT1A 3VQXA 3H1JG 4YIOA 2KYVA 3S3XA 5LHIA 1AVOA 3ETEA 2RN9A 1YF2A 3CRAA 4DV3B 2JJLA 1NTMK 3RYHA 3X2QC 1VF6C 1QL1A 3O8ZA 4B3RO 1NTMG 1NU1H 5JVDA 4DR1B 2Z5UA 1Q81Q 3VOUA 1VQ7P 1URQC 1GTWA 3W7UA 2AGAA 5J2TA 2WSEJ 1V55C 5KX5B 5KLVJ 2GV9A 1YZBA 1Y6XA 2O1JA 3SJAC 3AEFC 4N78D 3RVZA 2EIKC 4O4IA 5KMGB 4OWFA 1PKXA 4H44B 1VQKP 3VP8A 1RQVA 1WB8A 4JPZB 3D3QA 4K8XA 1S5LE 1QNMA 1H2KA 1RPRA 3JAMN 1FU1A 2IZ1A 4C7UA 1NTKJ 2EIJB 3RYIA 2B87A 4YPCA 1N7SD 1XNQO 3DGEA 2EULA 4H0LB 2KLVA 3K9SA 1CSBA 2AZ0A 4O4HB 1Q3EA 1JCDA 3GHGC 1IBLB 3L74D 4DV7B 2QM7A 2IJHA 1H38A 4B3TB 2RKLA 1AR1B 2LO1A 3H1HG 2E74B 4PDMA 1RE4C 1PFIA 4Y99B 4IFFA 1NU1J 1MV8A 1EXIA 1UIXA 1IK9A 2Y0PA 4OX9B 1HVVA 2CPSA 5AW3B 1PPJG 1PZQA 2P2UA 1T5EA 4DR7B 1GN4A 1VQ5V 5CJ0A 3IC7A 4LF6B 3TDKA 1FD9A 4RUFA 4GLXA 2KQXA 1AROP 3ABLC 1Y74B 3SWFA 2AXCA 4IYHA 4PD4F 4X64O 3EVKA 3OT7A 2I1JA 1GU4A 2XTAA 3OAAG 4FLYA 2WPQA 5CBHA 2UXBB 1OCCC 3H1LH 2EX3A 2AZ2A 4DV1B 2ZVNB 2DN9A 1E1RG 4YJ2B 2IYOA 4IIJB 3STLC 5AW2B 3CC7V 1KTMA 4WFAV 1AI6A 1XOUA 4JYCA 3CX5E 1RSOB 2HVJC 2YXLA 2E42A 1SQPH 2JWDA 4UB8E 3U0ZA 3ABUA 1WP7A 1VP7A 1XQ8A 2RQ6A 2ZM6B 2DWDC 3KYQA 1G2CA 3B5NA 2FYUH 1LT9B 5EZYA 1JY3P 1JO5A 3AE7C 1VF5D 2HG5C 2R72A 4I4TA 5H2FZ 3EFGA 1AA0A 5GTHE 5ITZA 3LNMB 1KYOI 1KECA 2ZXXA 4FLXA 1KKDA 1EC5A 5KLVK 5KHGA 2XAJA 5KLVG 4FZ0A 5DJTB 1M57D 2M7WA 1YITV 1KILB 1BSMA 4JAAA 2HVKC 1OCZB 1N7LA 3GLMA 2HLOA 1Q5OA 3G67A 3CCLP 3H1LJ 4HH2A 3VOPA 1QVFU 2FYNC 4LFCO 1KQSU 4AILC 3TGUD 2YNYA 4H37A 4DO2A 3ASOC 1M90W 2Z5HA 5DN6G 1SQQK 1SQQG 2H88C 2QTOA 3Q5PA 2Q6QA 2XUMA 3L71J 2QIWA 1YHQP 5DJUB 4X65O 3OMNB 1AJQA 1PP9J 3VQWA 4P9OA 1GW4A 2FYUJ 1QEXA 2N9BA 4I2LC 3CCQV 1KV4A 1VF7A 1XMOO 5LGNA 3M9QA 3L72H 1I08A 2EZPA 1NU1K 1LTGC 2GUVA 1NU1G 1QLEB 1JY3N 2A06E 2NPSA 3CLQA 3GF3A 4JAUA 5FNVA 3G6EP 4RO2A 3T97A 1G6UA 3K5BA 4E4EA 2OYHA 5DECA 3H1KH 1BDDA 3B71A 2JJ1G 1FAVA 3J7AU 2WSCJ 1KQSO 5GTIH 2AEMA 1OCOB 1L0LE 3RYFB 4GX2A 5FL7G 2OIGA 1NKNA 3ASNC 2GM4A 5CBFA 1F4NA 3RWRD 5IE9A 2Q9IA 3JARB 3BAAA 4ZOLA 2HHHB 1HUCA 4QMAA 1U7MA 2VWKA 4MTFA 3MTUE 2N1TD 3E1IA 2OQQA 4EFBA 1HNZO 4WY4A 2P7JA 4CS3A 4JI4O 3MP7B 3PHLA 3CCVP 1LUWA 1FZCB 3CCUP 3H25A 2KG7B 1FYJA 1Q8IA 2E43A 4JI8O 4RQFA 1P7BA 2PFXA 2W0XA 2D2CD 3P32A 5KA6A 3HUSB 5KJ7D 2IX7C 2LXCB 5L3BA 5HFLA 4MS2A 3AE6C 2H7HA 2EILC 2FL4A 2CUGA 4XDKA 1WNSA 4DV5B 2LQTA 3GVMA 5KAIH 2BEQD 1H8EG 3H1KJ 4R4LA 1ZUQA 1R1BA 1GH6A 1M56B 4IHJA 4DV4B 1NTZD 2Q3EA 3DXRB 3AK3A 4G28B 2KXPB 4FLUA 4N6JA 2ZAEB 3CP1A 1R3IC 2Q0OC 2CH7B 2Y9ZA 2QWPB 4AQYO 3QO5A 3H1LG 1W0JG 1DF4A 5EYPA 1K8AW 5E79Z 4WFBV 3II6A 2NPSC 3G71V 4GKGA 3L36A 5LGUA 2GHYA 2B88A 1TUEB 1SQPK 3HRNA 1NQTA 4UV9A 1SQPG 4JASA 1KB9E 1VQMV 4FM2A 4YHHB 2Q5UA 3HKBB 2KP8A 2FYUK 3B8NA 2FYUG 2OGUA 2IJIA 1FAFA 3RK2C 1FOSF 2Z3YA 5IJ0A 1BGYD 2XOKG 4D6TH 4D7TA 2ATKC 2YMKA 1S0VA 2LJ2A 1GMGA 4WY4C 2M0BA 1K5QA 3JCUZ 1IO4A 4AUWA 3ZMVA 1K3EA 3FXDA 2X7RB 1MSWD 3KQGA 2JVDA 3FXEA 3G9RA 4FVMA 4B08A 4DV3O 4PD4D 4U3FD 2P67A 3SPJA 1FPOA 4DR1O 3RL0B 1QVGU 5CB4A 1I5XA 1HTLC 4P2ZA 1J1DB 3HTKB 4KUMA 1JTHA 2RJZA 1OW7A 5BMVA 2K88A 2QJYC 1US6A 3LSSA 4JTDB 2ZNIA 1WPXA 4BXLA 2FY8A 1N34O 1ZSPA 2GTAA 2FXPA 4W7YA 1AR4A 5IY5C 3RYCB 4LGDE 4IFDK 4GIFA 1OV9A 3RGUA 2JGDB 1PNKA 2ZT9D 4NR1A 1URQD 2FXMA 3W7TA 2BCCH 1SQVE 1F51A 3L37A 5LXTB 5EC1C 1SETA 1OCRB 3UO2A 3L72G 2PTMA 4PV1B 2H8PC 1CP9A 1NTMD 3L74J 2WLKA 3SPCA 4X1YA 1K73Q 3K3WA 4J42A 3IC9A 4GZRB 2E75C 4O4JB 3H1KG 2WPVB 4L74A 3TF5A 5A2QN 1KP2A 4DV7O 5KUMA 5LHGA 3ABVC 3ETGA 2F23A 4B3TO 5GW7A 2B9ZA 1EN4A 3DTUB 3OEHG 4BRYA 5E1AC 1SQFA 2O01N 3PLNA 1I94B 3G6BA 5C8YB 1X9VA 2F95B 4JI1O 4MTGA 4UCVA 5J2UB 4QNHB 2N9YB 2YMYA 4DR7O 3QO8A 2ZIMA 4JQ0D 2LGWA 2YUAA 2L35A 2M8RA 4IGGA 1SA0A 4X9QA 1KILE 2QR4A 2NN4A 3K79A 3ZHRA 4I55A 3RGBA 1HGZA 4TT3H 2C9LY 1LTSC 3JAKB 2BCCJ 1KQFB 1Y47A 4DV1O 2BSKB 1BQ0A 3U11A 4X62B 4K0KB 3H1HD 4DUZB 3L4FA 1N8RQ 1HNWB 1RF1B 2ZE6A 4UB8H 3ZN0A 1XREA 4LF5B 3K06A 1AVMA 1H2SB 2NLJC 3K0GA 3AECC 3M0AA 2RCVA 4O2AB 4CS4A 4EOTA 4KHXA 1L4AB 2QE7H 2HR3A 1CI6B 5B3SB 3AE4C 5GTHH 3D71A 1NS1A 2HYNA 4LF9B 4LNUA 2UU9B 2R70A 1X59A 3GWKC 2CK3H 1FFXA 2CGNA 4DW1A 2A45H 2C0WA 5B1AC 2I1KA 2HG5D 2UUCB 2AXTE 5JQGA 1RQUA 2QKSA 3R66A 4R7CA 3TGUJ 2C2AA 1S5LX 4DK1A 1VQ8P 2XAFA 2XT9A 3T1YB 4JAVA 3CXHI 3FB8C 4D6TG 2PZSA 1M7LA 4NTYA 3G4SV 4CPGA 5B5EH 1P4RA 4FLWA 1JA8A 1N7SC 1MFTA 4Q20A 3W7XA 2QM4A 3HD7A 2IBZI 2F93B 3K5OA 4UXNA 3IAOA 3C9IA 4MN4C 2QWNB 2Y4TA 1D5AA 2WLNA 2YIBA 4U7OA 3TCUA 1JEKA 1XTGB 3VMXA 1KYOE 2DJVA 1NVPB 1NTZH 1L0LH 2K1AA 2F4VB 3CX5I 3N4XA 1JQ0A 3I55V 1V54C 3WUVA 4LF8B 3BVHA 1SQQD 3RK3B 2EINC 4BR6A 3RL0g 3OM3B 1T3JA 1ZL8B 1T6AA 2BCCG 1NAFA 1XEQA 4PELA 2OYIA 2VQEB 1H89A 1TUBB 5CA1B 5LYJB 3B5ND 4JZ2A 1MA1A 3HKEB 3Q4HB 1ZAUA 2HJFC 2DW3A 1S9KD 1LWUB 1U57A 1LTAC 1SFCA 2L91A 1SRYA 1BGYH 3MGNA 1ZWIC 4ZKPA 5GONB 3QVNA 1KU9A 4D7SA 1NJIW 1OW8A 3V2RA 1VQNP 2HKOA 1Y9BA 1MFZA 4X20A 4DV5O 1VQ6V 2JEUA 1NKZB 1JMBA 3CMAP
chains in the Genus database with same CATH topology
3GF7A 3AECC 1MKMA 2E74D 1OW6A 4U7JA 4PV1D 3Q2YA 3R4YA 4RKUJ 4PV1C 4Y28J 1DD4A 4H44D 2ZT9B 3IN6A 1VL2A 1YQ3C 2JP3A 3LW5J 3Q1MA 3AE4C 5KLIC 3D71A 4OGQC 3Q5SA 2H89C 1IK7A 3GLMA 3AEBC 4H13C 2E75B 1S1CX 2FYNC 2YMKA 1ZP0C 2WQYC 2K9YA 2BEZF 1KORA 2V7QJ 1RQUA 2H88C 2QSIA 2WSEJ 2D2CB 1FDOA 3G9RA 3D6ZA 3Q5PA 1S5LX 2QIWA 3AEFC 1PV3A 1GMJA 1WMKA 2E76D 1NYHA 4Z1MH 4H44B 2E76C 1RQVA 2FBWC 2G3AA 1KQGB 4YXDC 3Q3DA 4OGQD 1OW7A 3GF3A 2YIUC 4H13D 2QJYC 1TU3F 3O6QA 2NZ2A 3RK3E 1EXJA 3B71A 2FXPA 3AE5C 4H0LB 2WSCJ 1FDIA 2D2CC 4XFJA 4YTPC 1ZMEC 2G8YA 3IAOA 2ZT9D 3AE8C 2WSFJ 1PIXA 2ZT9C 3D6YA 1VF5B 1HF9A 3AEAC 1DIPA 2E74B 3AEEC 1ZOYC 3SFEC 4PV1B 2O01J 3AE3C 3AE1C 3AEGC 1EXIA 1UIXA 2E75D 2OQQA 3FGAD 2E75C 1Q90D 1NGMB 3Q5RA 2WPVB 4KT0J 4GDOA 1AJYA 3AEDC 3ABVC 3H25A 4I7ZB 3RL0g 2P10A 1ZRTE 5L8RJ 1VF5C 2D2CD 3EWKA 1K05A 2E74C 2JO1A 1HJ0A 3AE9C 3AE6C 1KMIZ 3C8VA 3AE2C 1R8EA 5KKZC 4H44C 3SFDC 3T97B 1U57A 2BEQD 4IL6X 1KTMA 4R4LA 5M1BA 1PL5A 4I7ZC 4R4MA 1OMIA 1KILE 2E76B 4TT3H 2MKVA 1OW8A 4H0LD 3GMAA 1JB0J 1K04A 4H0LC 2QJPC 1KQFB 4OGQB 1Y9BA 3S9OA 1DD3A 4H13B 2IDBA 3D70A 3AE7C 2J5UA 1YQ4C 1VF5D 2QJKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSF J;  1VF5 B;  2QSI A;  2D2C B;  2WSE J;  3C8V A;  4RKU J;  4Y28 J;  1S5L X;  5KKZ C;  2QIW A;  2ZT9 B;  2E74 B;  4PV1 B;  2O01 J;  4IL6 X;  4H44 B;  3LW5 J;  1Q90 D;  5KLI C;  2E76 B;  2WPV B;  4KT0 J;  2YIU C;  2E75 B;  2QJY C;  1JB0 J;  2QJP C;  4I7Z B;  4OGQ B;  2FYN C;  1ZRT E;  5L8R J;  4H0L B;  4H13 B;  2K9Y A;  2WSC J;  2QJK C; 
#chains in the Genus database with same CATH topology
 1NTZ J;  4UVC A;  2EIM B;  1THZ A;  3JSL A;  1Y76 B;  1SQB H;  1EZJ A;  4DV4 O;  4GOD A;  3C1L A;  4XE5 B;  2OCC C;  1KD1 W;  4TT3 G;  1KUQ A;  3HD7 C;  3WU2 E;  4MVQ A;  3LW5 J;  1YI2 P;  3VMZ A;  4DZO A;  1S4X A;  3BCC D;  4W80 A;  5KAF H;  3RBX A;  4X1I B;  1R3L C;  3L70 E;  2EJR A;  2RN0 A;  1KB9 H;  4GX0 A;  2JRI A;  4CBC A;  4CC6 A;  1ZTE A;  4TQF A;  2WT7 A;  1BCC E;  3FAV A;  1BGY J;  3GG2 A;  4NTW A;  2NPS D;  2WWW A;  1GL2 B;  2QE7 G;  1XBL A;  4MVM A;  2UUB O;  2Q7C A;  3OE7 G;  3V4W A;  2AHY A;  3FFQ A;  1GZL A;  2F1M A;  2LP7 A;  3W7W A;  1JFF A;  1J95 A;  3JAL A;  2UXC O;  1IFN A;  1IFJ A;  3K58 A;  1FC2 C;  2OYI C;  5B1B B;  3H1L D;  3SWY A;  4UB6 H;  3AG2 C;  2R9R B;  4YXD C;  2CK3 G;  2AEJ A;  4HBN A;  3GW6 A;  3RK2 D;  1VQP V;  3HPL C;  4JYA O;  2A45 G;  2FTK A;  4QE9 A;  2OTJ P;  4JGS A;  2N05 A;  2X6A A;  1SQP D;  4YXW H;  4HAM A;  4WY4 D;  3ZIA G;  4I1L A;  4O4L A;  3CXC U;  2FYU D;  3J80 N;  2AW9 A;  4DJG A;  5CHX A;  1D7M A;  3ZHQ A;  4WFH A;  1Y8A A;  1P7G A;  2QA4 P;  3C90 A;  1FBM A;  4KFM A;  2M5A A;  4EB6 A;  1SQV H;  5BR8 O;  1OIP A;  2LXB A;  4W7Z A;  3TNU B;  3J81 N;  2OWO A;  1NTM J;  1VQ7 V;  4DV6 B;  2JK5 C;  3AG3 C;  3KKY A;  2A06 G;  2P10 A;  4NXN O;  2HP8 A;  1N32 B;  3CC2 V;  2YID A;  3F5W C;  3C3S A;  1JNM A;  1VQK V;  3K08 A;  5JWP A;  2Y69 C;  1L0L K;  4E2L A;  1XUQ A;  2OT5 A;  3SYQ A;  1L0L G;  3H1I E;  1R8E A;  2V4D A;  4JYB A;  3B09 A;  1T2K C;  4L76 A;  1WPB A;  1X79 B;  3SFD C;  1EDL A;  4I9W A;  2H8P D;  3V4Q A;  1JJO A;  1F4M A;  1S5J A;  2WTY A;  4PD4 I;  4MVS A;  1I94 O;  5KX5 A;  1FJK A;  2HPC B;  3AG1 B;  1FXK C;  2QRX A;  1CZQ A;  2RMZ A;  5KMG A;  2QJP C;  1DTO A;  4OGQ B;  1GDT A;  3CCR P;  3L72 D;  1YIJ P;  1RFY A;  2LFR A;  4FLV A;  2LR2 A;  1NR1 A;  2W6J H;  2FFD B;  2IYP A;  5IJ9 B;  1AP5 A;  5KUK A;  1BGY G;  3H1H J;  2Y9Y A;  3AK1 A;  3IN6 A;  3MHH C;  3ZMT A;  3D36 A;  3VQV A;  4O4H A;  4X62 O;  1N33 B;  4DUZ O;  1HNW O;  3WMM 0;  1K9M Q;  2HEP A;  1K33 A;  2Y48 A;  4LF5 O;  1PGP A;  4NXM B;  1WN7 A;  2H89 C;  1WB7 A;  4DR5 B;  3WU2 Z;  3T1H B;  4ICG A;  2OYO A;  2YI9 A;  4PA3 A;  1BSN A;  1SQB K;  3S3W A;  4UVA A;  4UCU A;  4IT5 A;  2P1J A;  3HKD B;  1G8M A;  5LMU B;  1SQB G;  2Y0C A;  1S72 P;  3MUD A;  1BSH A;  5APX A;  1HDJ A;  3CCS P;  2L5G B;  4J9Y B;  2IJK A;  4DR3 O;  3L75 E;  4LF9 O;  1Y74 A;  2UU9 O;  1W5C E;  3P8C E;  3USS A;  2XAG A;  2AXT H;  5JCO A;  2Y4U A;  3K57 A;  5IYC O;  1ZN5 A;  4YJ2 A;  1J2J B;  4TUY B;  3RN4 A;  1P84 I;  2UUC O;  4PJ0 E;  4IIJ A;  4J7J A;  3RK3 E;  3BVO A;  3M9H A;  3UT5 B;  1RSO A;  4TLF A;  1Q86 W;  1M1K W;  1OFC X;  4OXS A;  2LW1 A;  4UCS A;  3TXS A;  3T1Y O;  2Q1K A;  1H8A A;  1JM0 A;  3QO7 A;  1LTJ C;  5C93 A;  2ZT9 C;  1LT9 A;  3OR7 C;  4HYO A;  3K5L A;  1TGO A;  1EZV I;  3CCL V;  2KUB A;  3E8G A;  3AEG C;  2JJ2 G;  1N86 A;  3EXA A;  2EIJ C;  4FFB B;  3U1C A;  3KDP B;  4YXW G;  1AJY A;  3D36 C;  2IU0 A;  2XZR A;  4L75 A;  3MIW A;  4YY3 B;  1XNR B;  3CEI A;  1BDC A;  2KZI A;  3CJH B;  1YHQ V;  1KIL A;  3VMY A;  1IVS A;  2W83 C;  2F4V O;  1SQQ J;  1NH2 D;  3EWK A;  3PRJ A;  4D6T D;  1VQL P;  2E74 C;  3L35 A;  2ZIO A;  3OFN G;  4TSF G;  3P3P A;  4CH4 A;  1G1X B;  3C8V A;  2QSA A;  4Y99 C;  4LF8 O;  3BCC H;  2Q7E A;  2H3O A;  1J1E B;  1SQV K;  3G6E V;  1SQV G;  2N74 A;  3ZRW B;  1SLQ A;  3M91 A;  3V5B A;  2EIK B;  1BT8 A;  4NKG B;  1N2D C;  2ZJS E;  3CXH E;  4CH3 A;  2X6C A;  3HKC B;  1M1J B;  4HYT B;  1S76 D;  2W90 A;  1DX7 A;  2YXY A;  2VQE O;  4LFB B;  1N0N A;  1K04 A;  4N3Y B;  4ASU G;  5AW4 B;  5GTI Z;  3C3T A;  5CCG A;  2Q5Z A;  3S9O A;  2QVA A;  1BS3 A;  4UFZ A;  4DRX B;  2IFN A;  4B3M B;  1B06 A;  2KB1 A;  1QL2 A;  2K3R A;  2IBZ E;  1EQ7 A;  1JR9 A;  2X0L A;  3BFR A;  4KXR A;  3R4Y A;  4RKU J;  1H0T B;  4DR2 B;  5LL6 Y;  4G27 B;  3CCU V;  2WIT A;  2A79 B;  3FKS G;  1PNL A;  3RYF A;  5KHJ A;  2BCC D;  1W59 A;  3JAW B;  2PYJ A;  1LT9 C;  5AVS B;  1KB9 F;  3JAR A;  4YJ3 B;  1GK6 A;  1S1C X;  3KZI H;  5E79 E;  2YSU B;  2DOS A;  2W6J G;  2QJ1 A;  3BCC J;  2ZXW B;  1YJW V;  5AW0 B;  1GN6 A;  3V2N A;  3ABK B;  1L1F A;  3ABL B;  1ZX3 A;  4B7E A;  5AW5 B;  5LGT A;  1FZC A;  4Z1M G;  4UV8 A;  5CBO A;  2KG7 A;  4A5U B;  3D6Z A;  1LP1 B;  1KIL C;  1T8Z A;  2HFE D;  1BCC H;  3BAB A;  3HD7 D;  1CW5 A;  3HUS A;  2WLM A;  2FB5 A;  2PGD A;  4QPJ A;  1NHL A;  3WFV A;  2YIB D;  1FZF A;  1GTO A;  3JCU E;  1ENV A;  2W6I G;  4LFA B;  1QHT A;  4QPK A;  4TV9 B;  4AHC A;  4C46 A;  3B4S A;  5AW6 B;  4R8C A;  4PJ0 Z;  1GRJ A;  5LBQ A;  3DXR A;  4M3L A;  2MW2 B;  1PV0 A;  3VQY A;  1SQP J;  4UUJ C;  4NYK A;  3PH0 A;  2CH7 A;  3LNN A;  1RH5 B;  2W0F C;  3I56 V;  1LJ2 A;  1XTC C;  2Q0A A;  1MUU A;  2HJD A;  3A0B E;  1NI8 A;  1QLE C;  1RF0 A;  5KKZ B;  1AJP A;  3CCE P;  4PDR A;  3ABT A;  3T2M A;  3WG7 C;  5DED A;  4I7Z B;  1SFC D;  3L73 H;  1HWY A;  3HKB A;  4JF7 A;  3QWO C;  1CPY A;  3N2G B;  2R9I A;  1QBZ A;  1IBM O;  4KL1 A;  3P30 A;  1SQX E;  5AW8 B;  3ETQ A;  3VMA A;  5EK0 A;  3LDC A;  1VQ4 P;  3B5N C;  1DGS A;  2EBO A;  1RM1 C;  3CWB E;  3WB1 A;  1EDI A;  5KHI A;  1FZC C;  3JAT B;  2P22 C;  5L3F A;  4DW0 A;  4QIW F;  3UCS C;  2KNC B;  2EZO A;  1PNM A;  3F5T A;  3RBZ A;  3HUS C;  5CBN A;  3HTK A;  1UPG A;  1MG1 A;  4F4L A;  3BCC G;  1B6Q A;  1FKA O;  4IL6 Z;  3BHP A;  3L72 J;  3B8M A;  1UII A;  4A7P A;  4N23 A;  3RYC A;  4RQE A;  2ITA A;  1T2K D;  3ASN B;  3MAQ A;  1M56 C;  2A06 D;  5J9P C;  2JGD A;  2JP3 A;  3BRT B;  1SVF A;  1EM1 A;  1UFI A;  5LXT A;  3HE5 B;  3T1C A;  1TAE A;  3MD0 A;  4RES B;  3V2P A;  5BU5 A;  4JI5 O;  1L0L D;  5LP6 B;  3A2A A;  1RF0 C;  3OMI B;  1MZE A;  1SP4 A;  4NB5 A;  2FYZ A;  1LTB C;  3G3Z A;  4O4J A;  2YEV B;  2ZR3 A;  3E22 B;  1N33 O;  1MZF A;  1BE3 E;  1SKV A;  2VQF O;  5H2F H;  2OYH C;  4GOF A;  1SF9 A;  1AP6 A;  3A0H Z;  2ZKO A;  3T1H O;  3PP5 A;  1BHA A;  2E76 D;  4JI7 B;  4WWI A;  5C8Y A;  1PL4 A;  4LC1 A;  4KHP B;  1GN2 A;  5J2U A;  4PD4 E;  4U3F E;  3TYY A;  3T4D A;  4GKK B;  1H2L A;  1WT6 A;  1WA8 B;  2WZ7 A;  2O57 A;  2DQ0 A;  1FDM A;  1KBH A;  2WLI B;  4XDL A;  1FS0 G;  2P4V A;  5D5Q A;  3THO A;  1OHH G;  3NR7 A;  1FDI A;  4XFJ A;  3FD9 A;  2G8Y A;  3JAK A;  5TIS Z;  5BU8 B;  1WLE A;  4GX1 A;  1BCC G;  1IUR A;  2BSK A;  4X89 A;  2YKQ A;  2DYS B;  3OTF A;  3FWL A;  3H1J E;  3RL0 C;  4NPF X;  1RF1 A;  3CCM V;  2PI4 A;  1G1I A;  2QEX P;  2HLD G;  1SQB D;  2K37 A;  3TSI A;  3SPG A;  1KYO F;  3Q5R A;  1Q86 Q;  1NTM E;  1AB3 A;  4O2A A;  2JDI H;  4GDO A;  1L4A A;  2QTS A;  1Q7Y W;  1N0J A;  3A0B Z;  3ZMU A;  1CI6 A;  3VYI A;  5IWA B;  2GTS A;  5CJ4 A;  3K59 A;  1YTF B;  3P8M C;  1WJZ A;  2SPZ A;  1VQ8 V;  1OCR C;  4WB4 A;  2DMX A;  1KB9 D;  1S5L H;  1KP3 A;  1HJ0 A;  3AE9 C;  3F7Y C;  2WSS H;  3ETD A;  2QJK B;  4RAI A;  4ZHQ B;  3BAT A;  5IT9 N;  2K9J B;  3CB2 A;  1XNR O;  4D6T J;  4CH6 A;  1TA8 A;  1DEE G;  1L0N E;  1KQL A;  1OMI A;  1Q6U A;  3L73 G;  2HOD B;  2WPR A;  4H0L D;  2GUZ B;  1IBL O;  1JB0 J;  1P84 E;  4X8A A;  5CCH A;  3WUT A;  1Q82 W;  1GN3 A;  1M93 A;  2OIE A;  2C9N Y;  1M5I A;  3ZHS A;  4H13 B;  1OVR A;  3CXH H;  2N04 A;  5L3C A;  2J5U A;  3JD2 A;  5HFM A;  2K1E A;  3ZED A;  1MKM A;  2E74 D;  3ZRX A;  1IJD B;  4OX9 O;  4DT0 A;  1EN6 A;  1YJ9 P;  5LA6 B;  2Q68 A;  4LFB O;  1COW G;  1PPJ E;  3A2F A;  4LF6 O;  4J11 A;  1EZV E;  4OPH A;  3E86 A;  1DH3 A;  1XHZ A;  1GM7 A;  4B3M O;  3AEI A;  2JEX A;  3LIE A;  2PF4 E;  2CTW A;  3Q5S A;  2WLL B;  2ZVO B;  2FXO A;  2E75 B;  4BIO A;  1RF1 C;  1KC8 W;  2ZQM A;  2UXB O;  2DYR B;  1HH0 A;  1KZU B;  1SQV D;  4DR2 O;  1S77 D;  3CX5 H;  3U1A A;  4JF3 A;  4EIJ A;  1MMM A;  1FXV A;  3E83 A;  2UXD B;  1L4A C;  1AIL A;  4RWU A;  2J59 M;  2WPD G;  4DR6 B;  1I0H A;  1ZL8 A;  2ZM6 O;  1L2P A;  1VQN V;  1FFT B;  4B3S B;  1WP8 A;  1TUB A;  4FZ1 A;  5CA1 A;  5KHK A;  5LYJ A;  1IFP A;  3CMA V;  3ZJZ A;  1YBK A;  2KKW A;  2B5U A;  2ZDI A;  3HKE A;  3Q4H A;  3KPE A;  4U3J B;  1HNX B;  5KTB A;  1LWU A;  3M8A A;  1SZT A;  3NTN A;  4JI3 B;  1BHB A;  3ZHU A;  4WBN B;  5GON A;  4ZI7 B;  2WLH A;  2OTL P;  4FJC C;  1U97 A;  1FJG B;  1JCH A;  4NVP A;  4DYL A;  1YI2 V;  1PIX A;  1Y67 A;  4JI0 B;  4OVN F;  3JCU H;  5CCH C;  1R3K C;  5KLV E;  3D6Y A;  4CZZ A;  1OVU A;  3QG5 A;  1U7J A;  3MHV A;  1KIL D;  3SFE C;  5KAF Z;  4PHZ A;  2G38 A;  2XKM A;  2M6Y A;  4J7K A;  1HP8 A;  3ABM B;  3E35 A;  1Y76 A;  3FGA D;  2QGN A;  1ZRT D;  1NTK E;  1M90 Q;  3JD1 A;  1BZK A;  1GKF A;  1YEW A;  3QNE A;  4P30 A;  5L8R J;  3OMA B;  1H2N A;  5H6R A;  1N36 B;  2DWE C;  1VQO P;  3FYE B;  4X1I A;  1RY3 A;  4IOI H;  3E1R A;  4EEQ A;  1PD3 A;  2A06 H;  2P90 A;  1W2B U;  5CCG D;  2C0X A;  1EBO A;  3IFX A;  4JYY A;  2KS1 B;  2IU3 A;  3B2E E;  1Q81 W;  1ZV8 A;  1EN5 A;  1NU1 E;  4I0X B;  1VDF A;  4IL6 X;  2JDI G;  5AW9 B;  1QLE D;  4BIU A;  3LSQ A;  2V7Q H;  1GL2 A;  4L87 A;  3RK3 C;  4R50 A;  4LBE C;  2Y0E A;  1JY2 O;  2R3C A;  2IDB A;  4FLT A;  1XI1 A;  2WSS G;  2HHH O;  3D70 A;  1N7S B;  2ZDI C;  3SPI A;  4EYY Q;  2QA4 V;  3AG4 C;  3E8B A;  5APQ A;  4KP4 A;  1LWU C;  3ZDM A;  4B86 A;  1W2B O;  1FZG A;  1NR7 A;  2Q4P A;  1VQ9 V;  4W4L A;  3A0R A;  4WBA A;  3Q1M A;  2FKX A;  2AEF A;  4GX5 A;  4NPE A;  1KFN A;  1MAB G;  4DXW A;  1W2E A;  1NZ6 A;  4LP8 A;  5B66 Z;  3OA7 A;  4HJG H;  2EIM C;  3P3N A;  2J58 A;  1PGJ A;  5BVZ A;  1IX9 A;  2KIK A;  3TNU A;  3MZW B;  5CA0 B;  1KYO D;  4EFE A;  1L0L J;  2V7Q J;  1NT2 B;  2RNB A;  5L3G A;  2YO3 A;  5C39 A;  3JYC A;  2NNU A;  4X64 B;  3M0D A;  1M56 D;  4K8Z A;  3OJA B;  2HFE C;  3OW2 U;  1AJN A;  3CCR V;  3IR9 A;  1YIJ V;  2G3A A;  1N73 B;  1IDS A;  1XIL A;  2XND H;  4W4K A;  2OAR A;  1K8A Q;  3H1L E;  1SS1 A;  2GDS A;  1JOC A;  3KXD A;  4J7Z A;  3IAY A;  1GL2 C;  3VP9 A;  1BL8 A;  4JI7 O;  2W27 A;  3JD3 A;  2HPC A;  4YHH O;  4I50 B;  4KHP O;  1GM8 A;  1VF5 B;  3L71 E;  3ZRS A;  5FLX N;  4GKK O;  1HF9 A;  1MSD A;  4MVZ A;  5B1B C;  1PP9 E;  3AEE C;  2JEE A;  2FYU E;  1VEW A;  2RMK B;  1RE3 A;  2FFD A;  1Y66 A;  1K4C C;  1JPX A;  3CRC A;  5AVY B;  3OW2 O;  4BW5 A;  4ZKI A;  5F2V O;  1FE6 A;  5IJ9 A;  4BIZ A;  4F6R B;  1YYC A;  1S72 V;  2KZJ A;  1M57 B;  2KI7 B;  4KT0 J;  2W6B A;  5AVU B;  3CCS V;  3AED C;  1R6T A;  2QG4 A;  1Q6I A;  2QM8 A;  2E5Y A;  2ZIN A;  3OAK A;  4AYC A;  3ZMS A;  1SFC C;  1SQB J;  3WB0 A;  2W6A A;  1A02 F;  3S1K A;  5EIB C;  4MW3 A;  1E5W A;  3SYP A;  1KMI Z;  2ODM A;  3RL0 D;  2P06 A;  2XAS A;  3HKD A;  3SGI A;  5IWA O;  2O1K A;  2WSF H;  3R2P A;  4XA4 A;  5TJH A;  5K5G B;  2WAM A;  1R5L A;  3M0D C;  1BCC D;  3SR2 C;  5EBL C;  1NOH A;  3CXH F;  2GA1 A;  4GOE A;  4HZ3 A;  4UCT A;  3CRM A;  1L0N H;  2B1I A;  4UCR A;  2PRR A;  5AVT B;  3E8H A;  4TUY A;  1NWQ A;  1P84 H;  3PTZ A;  1A32 A;  2MK3 A;  4PV1 D;  2V7Q G;  3UT5 A;  3O9O A;  2CGO A;  3UO3 A;  3H1K E;  3CD6 P;  1Q82 Q;  3AG1 C;  5GTI E;  2NRG A;  3H6P A;  1S2E A;  5KLI C;  4X66 B;  4OGQ C;  1L8D A;  2ZE7 A;  2N1T B;  2RDC A;  2I8D A;  1SES A;  1EZV H;  1I7F A;  3KCY A;  3CX5 F;  1RE3 C;  2FFD C;  2YIU B;  1ZP0 C;  1TVK B;  2IH1 C;  3QF7 A;  2XDJ A;  4FFB A;  1YVW A;  2PP6 A;  2Y0D A;  4NPD A;  3TET A;  3ZN1 A;  2ZE5 A;  4FFK A;  2D2C B;  4DUY B;  1SQV J;  3IJ4 A;  3BAS A;  4JI8 B;  3L73 D;  3BA8 A;  3H32 B;  3CJH A;  5IYZ B;  1X4T A;  5LOV B;  3E8F A;  5H9C A;  3BRV B;  4X1K B;  1KC8 Q;  3O65 A;  1IFM A;  1WMK A;  2O3J A;  4Z1M H;  2E76 C;  1OX3 A;  4DV2 B;  3OTO B;  4K0K O;  5APT A;  3JAS B;  2R44 A;  2JR8 A;  2UXD O;  1D2D A;  3ZHV A;  2DE0 X;  1YSC A;  3FB6 C;  4DR6 O;  1O9H A;  3ZRW A;  1FXK B;  1SQG A;  2UWJ E;  1B04 A;  2QJP B;  5JH7 B;  4L8J A;  5KAI E;  3SYA A;  3HKC A;  1M1J A;  3H1I D;  3CYO A;  4YTP C;  1IXM A;  2MJZ A;  4B3S O;  2Q3I A;  1L4A D;  2KSD A;  2PUS A;  2YKP A;  3AEA C;  4DRX A;  2OCH A;  3W68 A;  3CPW U;  3N7N A;  2XND G;  2WA3 A;  1AQ5 A;  3KZI Z;  4O2B B;  4N78 E;  4WCE V;  4JPR A;  1H0T A;  2P6J A;  1NKD A;  4JI0 O;  3U59 A;  4HNA B;  3SYC A;  1AI5 A;  3SJQ C;  3ZBH A;  3PN1 A;  3UQ8 A;  1RE4 A;  3W67 A;  1K92 A;  1IXB A;  3JAW A;  4WFG A;  1VQP P;  2ZFC A;  4UCO A;  4YJ3 A;  1NTK H;  2ARH A;  4TV8 B;  5CCH D;  1KN7 A;  4C7N B;  3CC4 P;  3AE2 C;  5L3D A;  4L73 A;  1Y4M A;  2ITD C;  4JI6 B;  4H44 C;  3L74 E;  3O6Q B;  1IZN B;  1I5Y A;  2YXH A;  2OTK E;  3CPW O;  1M8O B;  1USD A;  3IGA C;  1N36 O;  2IM9 A;  4HB1 A;  4R4M A;  2XAQ A;  5H5N A;  1LP1 A;  2VRS A;  1HGV A;  2MKV A;  5CN0 A;  4ASV A;  4H0L C;  1KYO H;  4LR3 A;  1UJW B;  1K7D A;  2BTQ B;  3L75 D;  3NFQ A;  5KA5 A;  4LLH A;  2GUS A;  2XAH A;  1LNQ A;  3X2Q B;  1GAX A;  3SJB C;  3CME P;  1J1E C;  3KG2 A;  4TOI A;  4WFE A;  1JOY A;  3CCE V;  1OXZ A;  2JKV A;  2L6L A;  3P8C D;  1N34 B;  1NVP D;  4FMT A;  4G2K A;  3CC2 P;  5LMN B;  5BY1 A;  1K97 A;  1M9N A;  2ZT9 B;  4TV9 A;  1LTJ B;  1URQ B;  1VPC A;  1M1J C;  1V55 B;  1Z2G A;  2GSM B;  2JGU A;  3MUD C;  4WF9 V;  3LDD A;  4HKZ H;  3RK3 D;  2KK7 A;  1L0N K;  1QQC A;  2R5B A;  1L0N G;  2BCC E;  3K5N A;  1DF5 A;  2UXN A;  3JSN A;  1K73 W;  2BAS A;  1HJB A;  1VQ4 V;  4IL6 E;  4MVO A;  2WQY C;  2K9Y A;  5JCO C;  2ZYA A;  2Z4E A;  3SPH A;  3JSV C;  2XV5 A;  1YTZ T;  1NJI Q;  3GHG B;  1X0T A;  2P4K A;  1PV3 A;  3HE4 B;  3CCV V;  3N2G A;  1GM9 A;  4R6Z A;  4JI1 B;  1QGK B;  3N2K B;  1KQG B;  1R5S A;  1EZV G;  3Q3D A;  4GKJ B;  3QTC A;  2ZXW C;  3W7S A;  2VWJ A;  2LKM A;  1FJP A;  5CBG A;  3ABK C;  1MZ9 A;  2WLJ A;  3RFR A;  2B9B A;  1P49 A;  1ORQ C;  3WU2 H;  2YKO A;  5B1O A;  3CHX A;  3H9V A;  3JAT A;  4LWS B;  3JCZ A;  3E89 A;  1G4Y B;  3A0H E;  4C7R A;  1F23 A;  1KD1 Q;  1Q6H A;  2KNC A;  5JJN B;  2Z5I A;  3L70 H;  1PL0 A;  3TGU E;  3DSQ A;  2Q6A A;  2ZR2 A;  5KAI Z;  1N8R W;  3CXH D;  5FPR A;  5AVV B;  1DIP A;  1QCE A;  1OCC B;  3RYH B;  2W8Z A;  3CCJ P;  1YJN P;  5AVQ B;  1OCZ C;  1FZE A;  5JVD B;  2Q73 A;  4N21 A;  3K03 A;  1Q90 D;  5AW1 B;  3L71 H;  1BMF G;  1JX9 A;  1GK4 A;  1F7Y A;  1NBM G;  1SER A;  1PP9 H;  1IC2 A;  3APQ A;  5J2T B;  5L3E A;  2IBZ D;  3NMD A;  5TIS E;  1GL2 D;  3BRC A;  4O4I B;  1Z56 A;  2DQ3 A;  4PA4 A;  5JJE B;  3HE5 A;  5LP6 A;  2D3O W;  5CCG C;  2WVR A;  5KKZ C;  3CX5 D;  4J9Z B;  2WSC H;  1NVO A;  5H6Q A;  5AVW B;  3OUF A;  3RYI B;  2B87 B;  2YEV A;  2Q9L A;  1URF A;  3E22 A;  3M99 B;  5M1B A;  1PL5 A;  1Z5W A;  4I7Z C;  2KOG A;  1ZR2 A;  3TK1 A;  2GBO A;  3L70 J;  2EJ7 A;  3BA9 A;  4JI2 B;  1NTK K;  3FB5 C;  2QWR B;  1ZLL A;  1OCO C;  1NTK G;  2IW5 A;  1R6N A;  2LGQ A;  1P84 F;  5EIB D;  3FYI B;  2IFM A;  2FYN B;  1BCC J;  2H43 A;  1WA8 A;  1YCI A;  2QEX V;  1OW6 A;  1E1Q G;  5EBW C;  2WLI A;  2YC0 A;  3VN0 A;  3ASO B;  4KJM A;  2M3B A;  5IDJ A;  5B5E E;  1VL2 A;  3UM7 A;  4DV6 O;  2PYL A;  1J5E B;  2ILM A;  1HR0 B;  1N32 O;  1JY3 O;  4J41 A;  4I5S A;  2ZCE A;  3A3Y B;  2NR5 A;  3H1I H;  5KHH A;  3AEB C;  3I5C A;  2KB7 P;  3B8E B;  3LUT B;  4PI2 A;  3CRR A;  1LT1 A;  3WG7 B;  4BWN A;  1QLN A;  1QVF O;  1S5L Z;  3RW0 A;  3SJC C;  1NTZ E;  4OH8 B;  2XHB A;  2XNX A;  3R65 A;  1VQ5 P;  3BY6 A;  3JD4 A;  1KKC A;  3DC5 A;  2JS3 A;  2PI5 A;  4X66 O;  4JV5 B;  1FDO A;  2KSJ A;  1XMQ B;  1E79 H;  1G2C B;  1X22 A;  1GMJ A;  1AV1 A;  3B5N B;  5EZY B;  1NYH A;  4ZMD A;  1RM1 B;  4DCK A;  3L73 J;  2POH A;  2R9A A;  4RJT A;  4OGQ D;  5LP6 C;  4I4T B;  2Q67 A;  4ZHQ A;  4DUY O;  2K9J A;  3CC7 P;  5ITZ B;  1SQX D;  1YJ9 V;  3AE5 C;  3ICX A;  4FM0 A;  1GW3 A;  1U96 A;  1BGY E;  4J80 A;  4RUE A;  4P9P A;  2HOD A;  3M7M X;  4B7K A;  4DV2 O;  3CWB D;  2GUZ A;  3OTO O;  2Q7G A;  2E5L B;  1Z5V A;  1YJW P;  4NXM O;  3EHB B;  3H1I J;  1IFI A;  3ZS8 C;  1OVV A;  4DR5 O;  2EIL B;  2CTQ A;  3AE3 C;  3AE1 C;  3UIA A;  3JC2 2;  3L75 H;  1WAZ A;  1S3J A;  5LMU O;  4IYI A;  5LA6 A;  1VMG A;  1AVY A;  1SQB E;  4LF4 B;  3L9D A;  4UB8 Z;  1NAY A;  1YIT P;  3L70 G;  3F89 A;  2YXR B;  2DYS C;  2WLL A;  3OR6 C;  5KAF E;  4UVB A;  2JO1 A;  3E7K A;  3HB3 B;  4PJ0 H;  2R3S A;  4FLZ A;  3QH9 A;  2UUA B;  2B1G A;  4LH6 A;  3DC6 A;  3RT3 C;  2NPS B;  3M06 A;  5FNV B;  3NXS A;  4X88 A;  1ROP A;  3T97 B;  4LCU C;  1B3Q A;  3L71 G;  2OYH B;  1J1D C;  3OD4 A;  5GTH Z;  1PP9 G;  5BXZ A;  2UUB B;  2YIC A;  2OTL V;  3GB7 C;  3I56 P;  4I9Q A;  1M1K Q;  2V1D A;  4GUN A;  2H94 A;  2ZNJ A;  2YXQ B;  1FXH A;  1QU7 A;  1HW7 A;  3L74 H;  3CCQ P;  3UKM A;  2ZE8 A;  2UXC B;  3RK2 B;  2A0L A;  1BE3 D;  4ZOL B;  4DV0 B;  4JI6 O;  3A5T A;  1YQ4 C;  1YDX A;  2QJK C;  4JYA B;  2YS8 A;  2X6B A;  3GF7 A;  1ZXG A;  4UB6 E;  4U3J A;  4DR4 B;  2IZ0 A;  4BWA A;  4WY4 B;  3L75 J;  2ADQ B;  4PV1 C;  1H2G A;  4TWK A;  4WBN A;  1R3J C;  4ZBM A;  4ZI7 A;  1IBK B;  2E5T A;  4H44 D;  1RP3 B;  4YY3 O;  1PGO A;  4RO0 A;  2OYQ A;  3TXQ A;  3K5M A;  1USE A;  4EI2 A;  1JCC A;  1VQO V;  4JBZ A;  5B5E Z;  1IK7 A;  2ITC C;  1FZB A;  4H13 C;  1XDC A;  5LMN O;  1RPO A;  4Q6G A;  2QJY B;  3MHS C;  4BAY A;  5BR8 B;  3H1J D;  3FX7 A;  3B40 A;  3F7V C;  2Q8V A;  4MW8 A;  5IY5 B;  4OPA A;  1T3U A;  1W0K G;  3I5D A;  3H1H E;  1KFM A;  2CPB A;  2ETN A;  3EQ2 A;  2ZYG A;  4IHJ B;  4NXN B;  4NTX A;  4IL6 H;  1JMM A;  4U7N A;  1X8Y A;  2P7T C;  2BTO A;  5B66 E;  3H1I G;  3SWK A;  1QVG O;  1PM9 A;  2IBZ H;  3IF4 A;  5EYP B;  2DYR C;  1HWT C;  1YTZ I;  2KS1 A;  1A02 J;  3OUS A;  4I0X A;  1JJ2 U;  5A9G A;  4DOJ A;  1GO3 F;  4CH5 A;  1OJH A;  3IFM A;  1E79 G;  4K3A A;  2P5O A;  2QKC A;  4GKJ O;  5E79 H;  1L0N D;  4BW9 A;  4O9B A;  5IJ0 B;  2FKW B;  3LID A;  5B3S C;  1EFR G;  2CDY A;  1N7S A;  4MVR A;  1P84 D;  3A0H H;  3G71 P;  1QR8 A;  4ZIB A;  5EBM C;  2K9P A;  4JZG A;  1NGM B;  1SC5 B;  3FB7 C;  2IH3 C;  3TGU H;  2RH0 A;  1YXB A;  2DW4 A;  3A8T A;  3KHU A;  1JUN A;  1VQM P;  2QDO A;  5IYD O;  3OEE G;  1K9M W;  1MNG A;  1ZRT E;  1XHX A;  3FX0 A;  1ZLZ A;  4GCZ A;  1JY2 P;  5CB4 B;  1EZV D;  1K05 A;  1PPJ D;  1JVM A;  2R5D A;  1SS3 A;  3V6I A;  1SZX A;  1JTH B;  3WUU A;  2A3Q A;  5BMV B;  5TIS H;  3ABM C;  5APU A;  1VAR A;  3L75 G;  4YIP A;  5CA0 A;  4LFA O;  2JIZ G;  4PA6 A;  3H01 A;  4DR3 B;  3G80 A;  4LF7 B;  1R6K A;  2WA4 A;  2R32 A;  3CCM P;  3H32 A;  3ZMZ A;  1OWA A;  3GMA A;  3A7O A;  5IYB O;  3VTP C;  3D8C A;  5JJJ B;  5APS A;  3A0B H;  1Q43 A;  1AR5 A;  1N73 A;  3F5H A;  1SQQ E;  3S4R A;  4X1Y B;  1EDK A;  4U7J A;  5B1A B;  5K1X A;  1DD4 A;  4B3R B;  1FOS E;  4JI2 O;  4MTX A;  4UB6 Z;  3RVY A;  1AQT A;  5AVX B;  4K35 A;  2OTJ V;  1ZW0 A;  4I50 A;  3L74 G;  1SQX H;  1S9K E;  4BRY B;  5AW7 B;  2M3E A;  4Z1V A;  1K4D C;  1LGH B;  3CWB H;  2XU6 A;  5AVR B;  1JY2 N;  5KLV D;  4ZNC A;  1G1J A;  1XL6 A;  2UXX A;  4PI0 A;  1H2M A;  4F6R A;  1J5E O;  5EFW B;  1SA0 B;  2KLU A;  5EC2 C;  1HR0 O;  4LH7 A;  1LTI C;  5K1P A;  2QSI A;  1GD2 E;  1XNQ B;  2ZYD A;  1OZ0 A;  4I55 B;  1NH2 B;  4JTA B;  1LTT C;  1NTK D;  2FBW C;  2CE4 A;  1OZH A;  2LW7 A;  3APO A;  4DK0 A;  3AK2 A;  2CAZ C;  5D5P A;  1TU3 F;  1EXJ A;  4JV5 O;  2NZ2 A;  5BZB A;  2AHZ A;  3BCC E;  4QJF B;  3LW5 H;  3K04 A;  1V54 B;  1XMQ O;  1RHZ B;  2EIN B;  4FIP C;  1XL4 A;  2Q7H A;  4MVU A;  1ZME C;  3CD6 V;  2IPP A;  4XBF A;  1LR1 A;  3AE8 C;  1NU1 D;  1HBW A;  1SQX J;  1WRG A;  5APV A;  3AG4 B;  4H33 A;  4LNU B;  2IBZ G;  1N73 C;  3CWB J;  1FZA A;  2A45 I;  2Y0I A;  1FFX B;  3K0D A;  1BE3 H;  3SDL A;  4AQR D;  4WFF A;  1AFO A;  2E5L O;  3N27 A;  3KCX A;  5JQG B;  2LFS A;  1CEZ A;  1K5S A;  4Z2W A;  4IFM A;  2E3C A;  3VBB A;  1VF5 C;  3EFF K;  4U3F H;  2PY5 A;  4PD4 H;  4GYC B;  2N1T A;  1BQZ A;  1SQP E;  3KZI E;  4FK5 C;  1TVK A;  4ABM A;  1DLB A;  1QX8 A;  4LF4 O;  3TGU G;  3ZHT A;  2QWQ B;  3SSU A;  1N4C A;  1M57 C;  3OGI B;  4J10 A;  4CS2 A;  2OCC B;  3BPZ A;  3HD7 B;  5KJ7 A;  1FS0 E;  2WPS A;  4JTC B;  4QGP A;  5CMU A;  3H1J H;  5IYZ A;  5LOV A;  3CE2 A;  4EKW A;  1DEB A;  4X1K A;  2UUA O;  1DD3 A;  3OGC C;  1K34 A;  3JAS A;  3V2Q A;  3M9B A;  1NTM H;  3GWO A;  5CA3 A;  3G4S P;  2BOC C;  1GK9 A;  1BE3 J;  4Y28 J;  1FXK A;  4LFC B;  2FML A;  5JH7 A;  3CI9 A;  2BOB C;  1Q7Y Q;  2AXT Z;  3LDE A;  1YQ3 C;  3BEH A;  1MOF A;  3B77 A;  4PDL A;  3WB2 A;  4DV0 O;  4EDF A;  4MSW C;  4MT8 A;  2CTR A;  3L70 D;  2YDE A;  3D3I A;  1O9G A;  2PAJ A;  4U3F J;  4FM1 A;  2OYI B;  1PGQ A;  4X65 B;  1YTF D;  4DR4 O;  3AG2 B;  3K9A A;  2ZXE B;  1AI4 A;  2O01 H;  3CC4 V;  1AI7 A;  1XMO B;  1DK1 A;  1IBK O;  4O2B A;  3L71 D;  1KOR A;  1SFC B;  2BEZ F;  2PGG A;  1V9P A;  3I55 P;  1H88 A;  1PP9 D;  1VIB A;  3L72 E;  1JMK C;  3P7K A;  1GU5 A;  4HNA A;  3ZRV A;  4WVZ A;  1SQX K;  2Q69 A;  3U10 A;  3H1J J;  1SQX G;  3LSU A;  2CTP A;  1Q2N A;  1NO4 A;  2B89 A;  3L73 E;  2QKA A;  2A9H A;  1IBM B;  4X20 B;  1LUV A;  2N1T C;  4AI8 A;  4TV8 A;  5DM6 V;  3H1H H;  1NH4 A;  3JD0 A;  3CWB G;  3CRQ A;  4C7N A;  3T4Z A;  1M4U A;  2YIU C;  3CME V;  4H13 D;  1VQ9 P;  4MTO A;  4FPP A;  3O6Q A;  1VQL V;  1R73 A;  1PPJ H;  5B66 H;  5LHH A;  2F43 G;  3MDS A;  1HNZ B;  5APY A;  2D2C C;  3HR0 A;  4ZKU A;  3AG3 B;  5KJ7 C;  4JI4 B;  1NTZ K;  3ITK A;  2WSF J;  1NTZ G;  2BTQ A;  3FWN A;  1VQ6 P;  2V4H A;  1KB9 I;  2Y69 B;  1ZOY C;  2VRZ A;  2O01 J;  1VF6 A;  1CXZ B;  2Z0A A;  3STZ C;  3CL3 D;  5APW A;  2E75 D;  1IFD A;  3ZCC A;  1L0N J;  2VS0 A;  2WT7 B;  3FAV B;  3PJS K;  5FPO A;  2QWO B;  1D5N A;  1LTJ A;  1S5H C;  5AG2 A;  1URQ A;  5KLI B;  3ML0 A;  1IZ3 A;  3CS5 A;  2YI8 A;  1JFF B;  1H8H G;  3JAL B;  4XDJ A;  4JI5 B;  3H1K D;  2JWA A;  2YO2 A;  4AQY B;  3AG7 A;  1BE3 G;  3SYO A;  5AVZ B;  4PA9 A;  2F66 C;  1HNX O;  2KSE A;  2WMM A;  4QE7 A;  4JI3 O;  5B1N A;  4TQD A;  2A7W A;  2VQF B;  2WSE H;  2E76 B;  1FJG O;  5KLV H;  1EDJ A;  3GHG A;  2ADP A;  4O4L B;  1ZR4 A;  2JS5 A;  3HE4 A;  5H2F E;  4U3F G;  4PDV A;  2YIA A;  2IJJ A;  3ZX6 A;  3E2E A;  4PA7 A;  3N2K A;  3TJT A;  4ASW A;  1YJN V;  3CCJ V;  5CMZ A;  2M5A B;  4EB6 B;  1QR9 A;  4F6E A;  4LF7 O;  3Q2Y A;  2P58 A;  4I6M C;  2BE3 A;  4D6T E;  2ZD9 A;  4LWS A;  4CC5 A;  3CSX A;  1SQQ H;  4GT1 A;  3VQX A;  3H1J G;  4YIO A;  2KYV A;  3S3X A;  5LHI A;  1AVO A;  3ETE A;  2RN9 A;  1YF2 A;  3CRA A;  4DV3 B;  2JJL A;  1NTM K;  3RYH A;  3X2Q C;  1VF6 C;  1QL1 A;  3O8Z A;  4B3R O;  1NTM G;  1NU1 H;  5JVD A;  4DR1 B;  2Z5U A;  1Q81 Q;  3VOU A;  1VQ7 P;  1URQ C;  1GTW A;  3W7U A;  2AGA A;  5J2T A;  2WSE J;  1V55 C;  5KX5 B;  5KLV J;  2GV9 A;  1YZB A;  1Y6X A;  2O1J A;  3SJA C;  3AEF C;  4N78 D;  3RVZ A;  2EIK C;  4O4I A;  5KMG B;  4OWF A;  1PKX A;  4H44 B;  1VQK P;  3VP8 A;  1RQV A;  1WB8 A;  4JPZ B;  3D3Q A;  4K8X A;  1S5L E;  1QNM A;  1H2K A;  1RPR A;  3JAM N;  1FU1 A;  2IZ1 A;  4C7U A;  1NTK J;  2EIJ B;  3RYI A;  2B87 A;  4YPC A;  1N7S D;  1XNQ O;  3DGE A;  2EUL A;  4H0L B;  2KLV A;  3K9S A;  1CSB A;  2AZ0 A;  4O4H B;  1Q3E A;  1JCD A;  3GHG C;  1IBL B;  3L74 D;  4DV7 B;  2QM7 A;  2IJH A;  1H38 A;  4B3T B;  2RKL A;  1AR1 B;  2LO1 A;  3H1H G;  2E74 B;  4PDM A;  1RE4 C;  1PFI A;  4Y99 B;  4IFF A;  1NU1 J;  1MV8 A;  1EXI A;  1UIX A;  1IK9 A;  2Y0P A;  4OX9 B;  1HVV A;  2CPS A;  5AW3 B;  1PPJ G;  1PZQ A;  2P2U A;  1T5E A;  4DR7 B;  1GN4 A;  1VQ5 V;  5CJ0 A;  3IC7 A;  4LF6 B;  3TDK A;  1FD9 A;  4RUF A;  4GLX A;  2KQX A;  1ARO P;  3ABL C;  1Y74 B;  3SWF A;  2AXC A;  4IYH A;  4PD4 F;  4X64 O;  3EVK A;  3OT7 A;  2I1J A;  1GU4 A;  2XTA A;  3OAA G;  4FLY A;  2WPQ A;  5CBH A;  2UXB B;  1OCC C;  3H1L H;  2EX3 A;  2AZ2 A;  4DV1 B;  2ZVN B;  2DN9 A;  1E1R G;  4YJ2 B;  2IYO A;  4IIJ B;  3STL C;  5AW2 B;  3CC7 V;  1KTM A;  4WFA V;  1AI6 A;  1XOU A;  4JYC A;  3CX5 E;  1RSO B;  2HVJ C;  2YXL A;  2E42 A;  1SQP H;  2JWD A;  4UB8 E;  3U0Z A;  3ABU A;  1WP7 A;  1VP7 A;  1XQ8 A;  2RQ6 A;  2ZM6 B;  2DWD C;  3KYQ A;  1G2C A;  3B5N A;  2FYU H;  1LT9 B;  5EZY A;  1JY3 P;  1JO5 A;  3AE7 C;  1VF5 D;  2HG5 C;  2R72 A;  4I4T A;  5H2F Z;  3EFG A;  1AA0 A;  5GTH E;  5ITZ A;  3LNM B;  1KYO I;  1KEC A;  2ZXX A;  4FLX A;  1KKD A;  1EC5 A;  5KLV K;  5KHG A;  2XAJ A;  5KLV G;  4FZ0 A;  5DJT B;  1M57 D;  2M7W A;  1YIT V;  1KIL B;  1BSM A;  4JAA A;  2HVK C;  1OCZ B;  1N7L A;  3GLM A;  2HLO A;  1Q5O A;  3G67 A;  3CCL P;  3H1L J;  4HH2 A;  3VOP A;  1QVF U;  2FYN C;  4LFC O;  1KQS U;  4AIL C;  3TGU D;  2YNY A;  4H37 A;  4DO2 A;  3ASO C;  1M90 W;  2Z5H A;  5DN6 G;  1SQQ K;  1SQQ G;  2H88 C;  2QTO A;  3Q5P A;  2Q6Q A;  2XUM A;  3L71 J;  2QIW A;  1YHQ P;  5DJU B;  4X65 O;  3OMN B;  1AJQ A;  1PP9 J;  3VQW A;  4P9O A;  1GW4 A;  2FYU J;  1QEX A;  2N9B A;  4I2L C;  3CCQ V;  1KV4 A;  1VF7 A;  1XMO O;  5LGN A;  3M9Q A;  3L72 H;  1I08 A;  2EZP A;  1NU1 K;  1LTG C;  2GUV A;  1NU1 G;  1QLE B;  1JY3 N;  2A06 E;  2NPS A;  3CLQ A;  3GF3 A;  4JAU A;  5FNV A;  3G6E P;  4RO2 A;  3T97 A;  1G6U A;  3K5B A;  4E4E A;  2OYH A;  5DEC A;  3H1K H;  1BDD A;  3B71 A;  2JJ1 G;  1FAV A;  3J7A U;  2WSC J;  1KQS O;  5GTI H;  2AEM A;  1OCO B;  1L0L E;  3RYF B;  4GX2 A;  5FL7 G;  2OIG A;  1NKN A;  3ASN C;  2GM4 A;  5CBF A;  1F4N A;  3RWR D;  5IE9 A;  2Q9I A;  3JAR B;  3BAA A;  4ZOL A;  2HHH B;  1HUC A;  4QMA A;  1U7M A;  2VWK A;  4MTF A;  3MTU E;  2N1T D;  3E1I A;  2OQQ A;  4EFB A;  1HNZ O;  4WY4 A;  2P7J A;  4CS3 A;  4JI4 O;  3MP7 B;  3PHL A;  3CCV P;  1LUW A;  1FZC B;  3CCU P;  3H25 A;  2KG7 B;  1FYJ A;  1Q8I A;  2E43 A;  4JI8 O;  4RQF A;  1P7B A;  2PFX A;  2W0X A;  2D2C D;  3P32 A;  5KA6 A;  3HUS B;  5KJ7 D;  2IX7 C;  2LXC B;  5L3B A;  5HFL A;  4MS2 A;  3AE6 C;  2H7H A;  2EIL C;  2FL4 A;  2CUG A;  4XDK A;  1WNS A;  4DV5 B;  2LQT A;  3GVM A;  5KAI H;  2BEQ D;  1H8E G;  3H1K J;  4R4L A;  1ZUQ A;  1R1B A;  1GH6 A;  1M56 B;  4IHJ A;  4DV4 B;  1NTZ D;  2Q3E A;  3DXR B;  3AK3 A;  4G28 B;  2KXP B;  4FLU A;  4N6J A;  2ZAE B;  3CP1 A;  1R3I C;  2Q0O C;  2CH7 B;  2Y9Z A;  2QWP B;  4AQY O;  3QO5 A;  3H1L G;  1W0J G;  1DF4 A;  5EYP A;  1K8A W;  5E79 Z;  4WFB V;  3II6 A;  2NPS C;  3G71 V;  4GKG A;  3L36 A;  5LGU A;  2GHY A;  2B88 A;  1TUE B;  1SQP K;  3HRN A;  1NQT A;  4UV9 A;  1SQP G;  4JAS A;  1KB9 E;  1VQM V;  4FM2 A;  4YHH B;  2Q5U A;  3HKB B;  2KP8 A;  2FYU K;  3B8N A;  2FYU G;  2OGU A;  2IJI A;  1FAF A;  3RK2 C;  1FOS F;  2Z3Y A;  5IJ0 A;  1BGY D;  2XOK G;  4D6T H;  4D7T A;  2ATK C;  2YMK A;  1S0V A;  2LJ2 A;  1GMG A;  4WY4 C;  2M0B A;  1K5Q A;  3JCU Z;  1IO4 A;  4AUW A;  3ZMV A;  1K3E A;  3FXD A;  2X7R B;  1MSW D;  3KQG A;  2JVD A;  3FXE A;  3G9R A;  4FVM A;  4B08 A;  4DV3 O;  4PD4 D;  4U3F D;  2P67 A;  3SPJ A;  1FPO A;  4DR1 O;  3RL0 B;  1QVG U;  5CB4 A;  1I5X A;  1HTL C;  4P2Z A;  1J1D B;  3HTK B;  4KUM A;  1JTH A;  2RJZ A;  1OW7 A;  5BMV A;  2K88 A;  2QJY C;  1US6 A;  3LSS A;  4JTD B;  2ZNI A;  1WPX A;  4BXL A;  2FY8 A;  1N34 O;  1ZSP A;  2GTA A;  2FXP A;  4W7Y A;  1AR4 A;  5IY5 C;  3RYC B;  4LGD E;  4IFD K;  4GIF A;  1OV9 A;  3RGU A;  2JGD B;  1PNK A;  2ZT9 D;  4NR1 A;  1URQ D;  2FXM A;  3W7T A;  2BCC H;  1SQV E;  1F51 A;  3L37 A;  5LXT B;  5EC1 C;  1SET A;  1OCR B;  3UO2 A;  3L72 G;  2PTM A;  4PV1 B;  2H8P C;  1CP9 A;  1NTM D;  3L74 J;  2WLK A;  3SPC A;  4X1Y A;  1K73 Q;  3K3W A;  4J42 A;  3IC9 A;  4GZR B;  2E75 C;  4O4J B;  3H1K G;  2WPV B;  4L74 A;  3TF5 A;  5A2Q N;  1KP2 A;  4DV7 O;  5KUM A;  5LHG A;  3ABV C;  3ETG A;  2F23 A;  4B3T O;  5GW7 A;  2B9Z A;  1EN4 A;  3DTU B;  3OEH G;  4BRY A;  5E1A C;  1SQF A;  2O01 N;  3PLN A;  1I94 B;  3G6B A;  5C8Y B;  1X9V A;  2F95 B;  4JI1 O;  4MTG A;  4UCV A;  5J2U B;  4QNH B;  2N9Y B;  2YMY A;  4DR7 O;  3QO8 A;  2ZIM A;  4JQ0 D;  2LGW A;  2YUA A;  2L35 A;  2M8R A;  4IGG A;  1SA0 A;  4X9Q A;  1KIL E;  2QR4 A;  2NN4 A;  3K79 A;  3ZHR A;  4I55 A;  3RGB A;  1HGZ A;  4TT3 H;  2C9L Y;  1LTS C;  3JAK B;  2BCC J;  1KQF B;  1Y47 A;  4DV1 O;  2BSK B;  1BQ0 A;  3U11 A;  4X62 B;  4K0K B;  3H1H D;  4DUZ B;  3L4F A;  1N8R Q;  1HNW B;  1RF1 B;  2ZE6 A;  4UB8 H;  3ZN0 A;  1XRE A;  4LF5 B;  3K06 A;  1AVM A;  1H2S B;  2NLJ C;  3K0G A;  3AEC C;  3M0A A;  2RCV A;  4O2A B;  4CS4 A;  4EOT A;  4KHX A;  1L4A B;  2QE7 H;  2HR3 A;  1CI6 B;  5B3S B;  3AE4 C;  5GTH H;  3D71 A;  1NS1 A;  2HYN A;  4LF9 B;  4LNU A;  2UU9 B;  2R70 A;  1X59 A;  3GWK C;  2CK3 H;  1FFX A;  2CGN A;  4DW1 A;  2A45 H;  2C0W A;  5B1A C;  2I1K A;  2HG5 D;  2UUC B;  2AXT E;  5JQG A;  1RQU A;  2QKS A;  3R66 A;  4R7C A;  3TGU J;  2C2A A;  1S5L X;  4DK1 A;  1VQ8 P;  2XAF A;  2XT9 A;  3T1Y B;  4JAV A;  3CXH I;  3FB8 C;  4D6T G;  2PZS A;  1M7L A;  4NTY A;  3G4S V;  4CPG A;  5B5E H;  1P4R A;  4FLW A;  1JA8 A;  1N7S C;  1MFT A;  4Q20 A;  3W7X A;  2QM4 A;  3HD7 A;  2IBZ I;  2F93 B;  3K5O A;  4UXN A;  3IAO A;  3C9I A;  4MN4 C;  2QWN B;  2Y4T A;  1D5A A;  2WLN A;  2YIB A;  4U7O A;  3TCU A;  1JEK A;  1XTG B;  3VMX A;  1KYO E;  2DJV A;  1NVP B;  1NTZ H;  1L0L H;  2K1A A;  2F4V B;  3CX5 I;  3N4X A;  1JQ0 A;  3I55 V;  1V54 C;  3WUV A;  4LF8 B;  3BVH A;  1SQQ D;  3RK3 B;  2EIN C;  4BR6 A;  3RL0 g;  3OM3 B;  1T3J A;  1ZL8 B;  1T6A A;  2BCC G;  1NAF A;  1XEQ A;  4PEL A;  2OYI A;  2VQE B;  1H89 A;  1TUB B;  5CA1 B;  5LYJ B;  3B5N D;  4JZ2 A;  1MA1 A;  3HKE B;  3Q4H B;  1ZAU A;  2HJF C;  2DW3 A;  1S9K D;  1LWU B;  1U57 A;  1LTA C;  1SFC A;  2L91 A;  1SRY A;  1BGY H;  3MGN A;  1ZWI C;  4ZKP A;  5GON B;  3QVN A;  1KU9 A;  4D7S A;  1NJI W;  1OW8 A;  3V2R A;  1VQN P;  2HKO A;  1Y9B A;  1MFZ A;  4X20 A;  4DV5 O;  1VQ6 V;  2JEU A;  1NKZ B;  1JMB A;  3CMA P; 
#chains in the Genus database with same CATH homology
 3GF7 A;  3AEC C;  1MKM A;  2E74 D;  1OW6 A;  4U7J A;  4PV1 D;  3Q2Y A;  3R4Y A;  4RKU J;  4PV1 C;  4Y28 J;  1DD4 A;  4H44 D;  2ZT9 B;  3IN6 A;  1VL2 A;  1YQ3 C;  2JP3 A;  3LW5 J;  3Q1M A;  3AE4 C;  5KLI C;  3D71 A;  4OGQ C;  3Q5S A;  2H89 C;  1IK7 A;  3GLM A;  3AEB C;  4H13 C;  2E75 B;  1S1C X;  2FYN C;  2YMK A;  1ZP0 C;  2WQY C;  2K9Y A;  2BEZ F;  1KOR A;  2V7Q J;  1RQU A;  2H88 C;  2QSI A;  2WSE J;  2D2C B;  1FDO A;  3G9R A;  3D6Z A;  3Q5P A;  1S5L X;  2QIW A;  3AEF C;  1PV3 A;  1GMJ A;  1WMK A;  2E76 D;  1NYH A;  4Z1M H;  4H44 B;  2E76 C;  1RQV A;  2FBW C;  2G3A A;  1KQG B;  4YXD C;  3Q3D A;  4OGQ D;  1OW7 A;  3GF3 A;  2YIU C;  4H13 D;  2QJY C;  1TU3 F;  3O6Q A;  2NZ2 A;  3RK3 E;  1EXJ A;  3B71 A;  2FXP A;  3AE5 C;  4H0L B;  2WSC J;  1FDI A;  2D2C C;  4XFJ A;  4YTP C;  1ZME C;  2G8Y A;  3IAO A;  2ZT9 D;  3AE8 C;  2WSF J;  1PIX A;  2ZT9 C;  3D6Y A;  1VF5 B;  1HF9 A;  3AEA C;  1DIP A;  2E74 B;  3AEE C;  1ZOY C;  3SFE C;  4PV1 B;  2O01 J;  3AE3 C;  3AE1 C;  3AEG C;  1EXI A;  1UIX A;  2E75 D;  2OQQ A;  3FGA D;  2E75 C;  1Q90 D;  1NGM B;  3Q5R A;  2WPV B;  4KT0 J;  4GDO A;  1AJY A;  3AED C;  3ABV C;  3H25 A;  4I7Z B;  3RL0 g;  2P10 A;  1ZRT E;  5L8R J;  1VF5 C;  2D2C D;  3EWK A;  1K05 A;  2E74 C;  2JO1 A;  1HJ0 A;  3AE9 C;  3AE6 C;  1KMI Z;  3C8V A;  3AE2 C;  1R8E A;  5KKZ C;  4H44 C;  3SFD C;  3T97 B;  1U57 A;  2BEQ D;  4IL6 X;  1KTM A;  4R4L A;  5M1B A;  1PL5 A;  4I7Z C;  4R4M A;  1OMI A;  1KIL E;  2E76 B;  4TT3 H;  2MKV A;  1OW8 A;  4H0L D;  3GMA A;  1JB0 J;  1K04 A;  4H0L C;  2QJP C;  1KQF B;  4OGQ B;  1Y9B A;  3S9O A;  1DD3 A;  4H13 B;  2IDB A;  3D70 A;  3AE7 C;  2J5U A;  1YQ4 C;  1VF5 D;  2QJK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...