4I7ZB

Crystal structure of cytochrome b6f in dopg, with disordered rieske iron-sulfur protein soluble domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
159
structure length
159
Chain Sequence
ATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lipid-induced conformational changes within the cytochrome b6f complex of oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 38
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4i7zB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4i7zB01
5KLIC 1JB0J 2QJPC 2O01J 2K9YA 1VF5B 4IL6X 2QJKC 2E74B 5KKZC 4H44B 2YIUC 1Q90D 4Y28J 2E76B 2QSIA 2WSCJ 2FYNC 4H0LB 2QIWA 4I7ZB 2WSEJ 4RKUJ 4OGQB 4KT0J 2D2CB 2ZT9B 2E75B 4H13B 1S5LX 2QJYC 4PV1B 3LW5J 3C8VA 2WSFJ 5L8RJ 2WPVB 1ZRTE
chains in the Genus database with same CATH superfamily
2ZFCA 1ZMEC 1JY3N 5APQA 3M91A 5BXZA 5JCOA 1SLQA 4LH6A 3L37A 2EIJB 1TGOA 1JOCA 1QL1A 2EILB 1CZQA 4HYOA 1GRJA 2WZ7A 5APYA 4JI2O 3GWOA 1L4AB 3H1JJ 2H94A 1KB9E 4U7NA 5KX5A 1L0LE 2W6JG 3CXHE 5KJ7D 1CXZB 4NB5A 1AI4A 2F95B 3CCQP 1XL6A 3VN0A 4GLXA 5CA0B 2B88A 1KMIZ 3SJAC 3D3QA 2CTWA 2OT5A 4FFBB 1SQBJ 1IC2A 2W8ZA 5C8YB 3AE7C 1P7BA 5KLVH 4JI5B 1FBMA 3APQA 1VQ5V 2DWEC 3FYEB 3H1LH 1O9HA 5IWAO 4H0LB 4NXMO 3L72D 2N74A 3ZRVA 3R4YA 4WFFA 5LMUO 2MK3A 2RDCA 4KP4A 3L74D 2WT7B 2OTKE 2DQ0A 2ZIMA 1LTIC 3JATB 4IL6Z 2RMZA 5H2FH 3W67A 1KP3A 5EZYA 2ZR2A 4XE5B 1ENVA 1YJWP 1AVYA 3BCCG 5IJ9B 3RL0D 1DX7A 1MNGA 1XBLA 2WVRA 3VMAA 4OGQC 1IK9A 5B1NA 1FJGO 3HKBA 1BDDA 2QWOB 2EBOA 1YTZT 2F4VB 1SQXH 1VQPV 1PGJA 1K9MW 2G38A 1P49A 3K58A 1AQTA 4DJGA 3CSXA 2GUVA 3A0BE 3ZIAG 2LQTA 1FZAA 1MFTA 3D71A 5AW8B 4PHZA 5CMUA 1AJPA 1Q3EA 2OYHA 3QNEA 1Q82W 1S1CX 2M5AB 3OUFA 1HWTC 2FYNB 5KAIH 2BCCG 3E1RA 1LT9A 1VF5B 4Q6GA 1GK6A 1GL2D 1K8AQ 1DIPA 3H32A 4WFAV 4LF5O 1HWYA 3T4DA 4PJ0H 3H1IH 4PDLA 4LP8A 1PP9G 3CWBE 2ZIOA 2JDIG 3ZBHA 4ZBMA 4D6TH 2PY5A 4DR2B 5IE9A 1IFJA 3HKDB 3VQXA 1ZRTD 4DRXB 3M06A 3M9QA 4LF6B 2Y9ZA 1FFTB 2VQEB 1FDIA 2BSKB 3G67A 3HKCB 3CC4V 2N1TB 4TUYA 4JBZA 1ZLZA 5KTBA 1R6TA 1XQ8A 2ITDC 1N0NA 4CZZA 4DUZO 1H38A 5BMVA 4DR6B 1M90W 1M1KW 3CXHI 2QM7A 1URQD 1S76D 3BRVB 1O9GA 4JI6B 1ZN5A 2LXBA 3S3WA 3D6YA 4JI8B 3ZN1A 1MV8A 1KECA 1KU9A 3R65A 5KHGA 1S5LH 4WVZA 4GKKO 2H7HA 1YDXA 2CDYA 3OD4A 2WLJA 4O4JA 1KQFB 3H1HD 4O2AB 4PDVA 4JYAB 2WPSA 4OVNF 1AJQA 1NT2B 1PFIA 5JJJB 4A7PA 4NVPA 1M57C 4J42A 4PDRA 5TISH 1KQSU 2O3JA 3HUSA 1Y67A 3P7KA 3JD0A 2Y0IA 3HPLC 2M3EA 2MJZA 2B1IA 4DR6O 3L70D 3EFGA 3SYOA 1XILA 2HVKC 3CX5H 2KG7B 4YJ2A 5CHXA 5KHJA 1QX8A 3KXDA 3ZDMA 3RVYA 1NJIQ 2QTOA 4YPCA 3C9IA 1MABG 1KB9I 1VQ6P 4OX9O 1MA1A 1VIBA 5BR8O 2ZXWC 2NNUA 4I9QA 1VQ7V 2BOCC 4JTAB 1N73B 1XOUA 1JCDA 1KP2A 1N34O 2RQ6A 5KAIZ 3L9DA 4P30A 5GTIZ 3L75J 2M6YA 4BRYA 4DW1A 4D6TJ 2PP6A 1M9NA 2DOSA 2IJHA 4JYBA 3U1AA 2R3SA 4JZ2A 1GL2A 1LWUB 1OCOB 4DV4O 4FFKA 5E79E 2IJKA 5IYZA 3RYIA 5CCHA 4LF4B 4RUFA 2Y0CA 1HP8A 4NPEA 2BTOA 4I55B 3PHLA 2ZKOA 4U3JB 3CXHF 4O2BB 1PPJH 4D6TE 3KCYA 4X88A 5APUA 3ASOB 1GAXA 4NR1A 4DR4B 4TT3H 4B7KA 3T1YB 3CX5D 1NTMK 5KLVG 2KP8A 2EJRA 3I55V 3ML0A 1M1JA 1M7LA 4JI3O 2M0BA 1GO3F 4CH5A 2YSUB 1F51A 1NU1H 1IFPA 2YMKA 4PJ0Z 4W4KA 5IDJA 3CC7P 1IDSA 1BHBA 1FOSF 3AG4C 4NTWA 1FXKA 5C93A 5AW5B 3U59A 2YIBD 3H1KJ 3IJ4A 5DECA 1QGKB 2QJKC 1QVGO 3HD7C 2KUBA 1VF7A 5KA5A 1CSBA 4YHHO 1W2BU 3W68A 1VQ6V 1RF1B 2RN9A 1PPJD 1NU1K 3Q5PA 2WLKA 2F43G 3KZIZ 3LNMB 2WLNA 2P90A 5LP6C 1WP8A 4HNAA 1FXVA 1T3JA 1VPCA 4DUYO 4DV6O 3FX0A 1NS1A 1VQOV 1S9KE 1BHAA 3BCCD 3ABLB 1TA8A 2UXBB 2ATKC 2ZINA 3ZMZA 5AVQB 1SQGA 5EYPB 1U96A 1SQVD 4JI2B 3STZC 1GZLA 3RYCA 4LCUC 3VP9A 5CB4A 1IBMB 5KAIE 3AEIA 1EC5A 3AK2A 4XFJA 3CXHH 3ASNB 5IY5B 4LFCB 1BE3D 1YI2V 4TV9A 3QH9A 4DV0B 1TUBA 1NU1E 5TISZ 3OR7C 3H1ID 3HE5B 3L71E 4B3SB 1SQQJ 3H1KG 3PRJA 1COWG 3G6EV 1MZFA 4FIPC 5CA3A 4DR1O 1R3KC 3F7VC 1BGYD 2HYNA 1N7SA 2JWDA 3JASB 4YXWG 4NYKA 2QTSA 4ZOLA 3WG7C 4DCKA 2KNCB 2OTJV 3CX5I 4FLWA 4CBCA 3ABVC 5H2FE 5CCHD 3HKDA 4WFGA 2HKOA 2JEXA 3AK1A 4TQDA 3CCJV 3N4XA 3V2QA 4JF3A 1JQ0A 4LGDE 5LMNO 3SWFA 1W5CE 2XAFA 1ZR4A 2EILC 4ZHQB 2ZR3A 1EZVH 1EN5A 1THZA 4L74A 3HUSC 3CXHD 1L4AC 2KZIA 3OAKA 5JH7B 5AW3B 5C39A 2P10A 1JVMA 1R1BA 1NR7A 1GU5A 1FDMA 1DTOA 3KG2A 3OTOB 1JY2N 5IJ0B 2IYPA 4YJ3B 4ZOLB 2W6AA 2YI9A 1IBMO 3ABKB 2W0FC 5IYBO 4Z2WA 4BW9A 3CRAA 4AYCA 2E43A 2UXDO 4DV5B 3SYQA 3L73J 2R5BA 1M90Q 1H8EG 3RYFB 2OTLP 1B6QA 4L73A 3K5NA 2R9AA 3DXRB 1OVRA 1VQ8V 5LOVA 3L73H 3KQGA 1CI6B 1IFMA 1BQ0A 2WMMA 1OZ0A 1RM1C 1NVPB 4JI1O 4LNUB 1ZUQA 1J1EB 3ZMUA 3N7NA 2EINC 2P2UA 2DYSB 1P84E 1PNLA 2ZQMA 3S9OA 4UVAA 1GK4A 1YHQV 2O1JA 2HHHO 1FPOA 4MTOA 2KS1A 1SFCD 3E1IA 2F4VO 2XTAA 4L75A 2AHYA 3E22B 1CPYA 5EZYB 3BRCA 3JATA 2OYIA 1FFXA 1B04A 2Y4UA 3RK2D 1AR5A 3VOUA 2WT7A 1IZNB 4PJ0E 1WNSA 1U97A 2IU0A 1P84I 1EDKA 4WCEV 5GW7A 5FNVB 3CC4P 1IJDB 1LUWA 3A3YB 1ZRTE 5AW4B 2Q67A 1VQ9P 4I2LC 1XMOO 3CCUP 1SC5B 3N27A 3C1LA 1SQQH 4RO0A 1NH4A 1LT9C 1KN7A 5AW0B 2Q5ZA 4FFBA 2QEXP 2WAMA 4CPGA 3AE2C 1RF1A 2FYUD 2WLLB 2WLLA 2OTLV 1Q5OA 1ZXGA 4DK0A 5KLIB 1KQSO 3V2PA 5KX5B 2P6JA 5AG2A 4IL6E 4ZI7A 1VF5C 2D2CB 4O9BA 4UCSA 1BCCJ 1NOHA 3CMEP 1XREA 2AZ0A 1OMIA 2NPSD 2LW1A 4WBAA 2HODB 5FNVA 4CS2A 2WSFJ 2N1TD 4NXNB 1FZBA 2QWRB 1VQ4P 2K9JA 1M1JB 1SF9A 4LF7O 3WU2H 3EHBB 4IHJB 2XHBA 2CPBA 3T2MA 3TXSA 2A0LA 3H1LD 3L4FA 5KKZC 2ZE8A 3JALB 1FFXB 1OCRC 3CMAV 2UUBO 1ZLLA 3LDDA 1OWAA 3N2KA 2BEZF 4ZKPA 3SFEC 1YF2A 2N1TC 1KYOI 2ZE5A 4K0KO 5H5NA 3L70H 5B1BC 3CCSV 1H2MA 1R3LC 4J11A 1AV1A 3LIEA 3HE4A 3TYYA 1PP9E 4J7KA 3CWBG 3OEHG 4Y99B 1URQC 1MUUA 3B8NA 3JYCA 1XNRB 4BRYB 4EIJA 4CS3A 3H1HE 3QO8A 1ZR2A 5KAFH 2ZDIA 3CEIA 1VQLV 2DE0X 4DXWA 1PGQA 3Q3DA 2C0WA 3SWKA 5IJ0A 2QKAA 4MVSA 4N6JA 3I5CA 2RNBA 4UB6Z 1H2GA 1DF4A 2P67A 1V55B 2QGNA 3FAVA 1AJNA 2CUGA 1L0NJ 2A3QA 1RSOB 1FJGB 1N8RW 4GT1A 1XEQA 1NBMG 3A0HZ 3B77A 3V4QA 5J2UB 3RT3C 2SPZA 1HGVA 2BCCD 4CH3A 2Z5UA 5CJ4A 2E76B 4DO2A 1S5LE 1VQOP 2CH7A 2LGQA 3M99B 3N2GA 2IPPA 3ZHVA 4LFAO 2BCCH 3CRRA 2EIJC 3K79A 1WT6A 3A0HE 4GOEA 1NTKK 4K3AA 2JRIA 3W7TA 4O4HB 2I8DA 2RMKB 1S72V 3MZWB 4HKZH 2OGUA 3P8CD 2ZYGA 1EBOA 2F1MA 4X1YB 1BE3G 1YJ9V 2NPSA 1GDTA 1VQMP 4DR5B 4TUYB 2ODMA 1OXZA 4FLZA 4QMAA 4TLFA 2QIWA 2AEFA 2DN9A 3OUSA 1RP3B 1PNKA 2RJZA 4GKJB 3WU2E 1OCCB 4JPZB 2AXTH 1SZTA 1X4TA 4EEQA 2MW2B 1QLNA 2WQYC 1G1XB 2IU3A 2YDEA 3H1JD 3RYHB 4LF8O 4PD4D 4O4LB 1R8EA 1HNWB 1RY3A 3B5NB 4B3MO 2YIUC 1IZ3A 3LSSA 2WSCJ 3RGUA 2VQEO 4ASVA 3AG4B 4J7ZA 3QF7A 4OGQB 3JCUZ 2QJKB 4X20B 1GTWA 1J5EO 1FAFA 3I56V 1HJ0A 4DV5O 5EIBC 1Q86Q 2JIZG 5D5QA 4U3FE 2ZE7A 3EWKA 2JWAA 1BCCE 2CPSA 2YXQB 5LP6B 4FLVA 3L72J 3ETEA 1VQNV 4P9PA 3L74J 3VTPC 1YJNV 3RK3E 2OCHA 4KUMA 1WRGA 4U3FG 3E8FA 3H1KH 3HKBB 2XDJA 3AG1C 2IZ0A 1K97A 3B5ND 3H1IG 5FPRA 3BASA 3K0GA 2L5GB 5CCGA 4FK5C 4UV9A 3GWKC 3UO3A 1L2PA 1HBWA 3WFVA 4W7ZA 3GHGB 1QLEB 1NU1J 4PD4H 3CCMV 4DR7B 2QKCA 1XNRO 2YEVA 1BSHA 5IYZB 3HKEB 1HNXO 4P2ZA 2Q7HA 4MSWC 4FM1A 3E89A 4BXLA 3BA8A 3H1IE 3L71D 1DEEG 3SPIA 1XL4A 1EZVE 2ETNA 2QG4A 2PYJA 3VQVA 1PP9J 2FYUK 3D6ZA 2QM8A 3G4SP 4PELA 4FM2A 1BGYE 5AVTB 2W6IG 4LWSB 4EDFA 4HAMA 5AW1B 1EZVG 3CXCU 4B3SO 1VDFA 1Q6IA 4LF5B 2QA4P 1KILD 5H6RA 3OGCC 3AEBC 3GLMA 1JFFA 2GHYA 3CI9A 1Q8IA 2WSFH 3WG7B 3PTZA 3V6IA 5EBWC 1FAVA 2F93B 3M7MX 1H0TB 1X59A 4ICGA 1UFIA 1SQQK 2IDBA 3OMAB 3L71G 1WJZA 2KYVA 2FFDA 1S2EA 2IBZD 3H1KE 3ZMTA 3T4ZA 2XUMA 3C3SA 5AW2B 4X89A 3ZN0A 1I94O 1N0JA 1HR0O 4GX1A 2V7QH 2O01N 1XMQB 4GODA 2ADPA 2JVDA 1S5LZ 4RKUJ 1YBKA 5LMNB 1ZAUA 5E79H 2WSEH 1S5HC 2P58A 1S3JA 4QPKA 1LTTC 3O6QB 4EI2A 3QG5A 5GONA 1BSMA 2Y48A 3QWOC 4X66O 1GU4A 2OWOA 2NLJC 3H25A 5DN6G 4YHHB 4QPJA 3CCEV 1N33B 3NTNA 4GIFA 4UB6E 2A7WA 2DJVA 5FPOA 2E75C 2FY8A 3L70E 5LP6A 4AILC 4Z1VA 3M9BA 3AG7A 1QBZA 3H1HJ 2ARHA 1WAZA 3HD7A 2DYSC 3FB6C 5LGTA 1W0KG 1VQPP 3H1HH 3B8EB 3HKCA 2OTJP 3JAKB 1ROPA 2DW3A 4JI6O 1L4AD 1L0LH 1FJPA 4EB6A 1PM9A 5B5EE 2HG5C 2HG5D 3F5HA 3CCEP 3VQYA 1AB3A 5BR8B 1KFNA 4C7NA 2LGWA 1RQUA 4AUWA 3K06A 3TDKA 5B1OA 3Q4HA 3H1JG 3B40A 3CL3D 1KB9D 4HZ3A 1LWUC 2L91A 3J80N 1L0LK 2QWPB 1NH2B 1RF0C 1AILA 1R5SA 2JGUA 3K03A 2AHZA 3MDSA 1BE3H 1J95A 4DV6B 1P84H 3K5BA 3RK3D 1S77D 1LT9B 4CC6A 2ZE6A 3IC7A 1SQXK 1F23A 5AW9B 3FWNA 1N32O 2R70A 1AJYA 3L75D 3ASOC 3LW5J 4MS2A 4D6TD 1I0HA 4AI8A 1GL2C 2WPQA 4X1YA 2DQ3A 2K9YA 1VF6A 5CJ0A 3G71P 4B3TO 3HKEA 1HDJA 2YC0A 5KJ7A 1RPOA 5EBLC 1KILA 1LR1A 4GCZA 1FE6A 1H2KA 2RCVA 2Q6AA 5K1XA 5L3DA 2QE7H 3CS5A 3CC7V 4AHCA 3T1YO 2AEJA 4I7ZB 2NN4A 4AQRD 3S3XA 2PI5A 4PD4I 4PI0A 1LJ2A 1R5LA 1WP7A 4TOIA 4B3RO 2IFNA 2NR5A 4DR4O 3K59A 4YIOA 5IYDO 2EULA 4UB8Z 1OCRB 1S5JA 4WFBV 4R50A 1F4MA 3CWBD 1ZX3A 1EDIA 3CJHB 1B3QA 5KMGA 2JEUA 4AQYO 3ABLC 1RSOA 1UJWB 5B1BB 2XAJA 1MKMA 3V4WA 1M8OB 2A45G 2XAHA 1SFCB 1URQB 3H1KD 2A45H 2OQQA 1YIJP 4U3FH 1CW5A 2KKWA 1LT1A 4R4MA 3Q5RA 3Q5SA 3VMYA 2UXNA 2PTMA 2C0XA 2IH3C 3VMZA 3L72H 3WMM0 1OV9A 1SZXA 3RK3B 4PA4A 5E79Z 4DR5O 1NTMD 2FB5A 2ZVOB 1DF5A 4H13C 2I1KA 1PZQA 4EYYQ 3BCCJ 1QVFU 1V55C 2WA3A 1LTBC 1U7JA 5KLVD 2E5LB 3VP8A 3CMEV 1JUNA 2Q9LA 1MSWD 3UIAA 1JJOA 3OTFA 2W90A 3ZRSA 3GF3A 2J5UA 2JO1A 3OJAB 1R73A 2E76C 1BE3J 5LHIA 1ZL8A 1YJ9P 3H1LG 2PAJA 4WBNA 4BAYA 3H1IJ 1D5AA 1KB9F 3M8AA 3OGIB 1SQQD 4OWFA 2GV9A 1EM1A 4UCTA 1Y9BA 3EXAA 5LMUB 2HODA 2XKMA 3MUDC 1FZCA 3L71H 1LTJB 1F7YA 1BGYJ 2E5TA 1FZGA 3L75G 3K5MA 2HLOA 4UUJC 3ZHTA 2GUZA 1URFA 1BGYH 3K08A 2A06D 3V5BA 5JVDB 3QVNA 1EXIA 5LXTA 2UUCO 1K4DC 3ABKC 3G4SV 3KYQA 5L3BA 2CAZC 5EK0A 2BTQA 3SJQC 3DC6A 2LFSA 2IW5A 1M56D 3V2RA 3RWRD 1NKNA 3SPGA 4WFHA 5J2TA 1OCCC 1V9PA 2C9NY 1WN7A 3CCVV 3LW5H 4PD4E 1RM1B 4W4LA 2YIDA 2Q7EA 1GM9A 3ABUA 2Q69A 5HFLA 4DV1O 1Y76B 4I5SA 1GN3A 1XI1A 5EC2C 1BS3A 1P84D 1CP9A 1SQVH 4GKJO 2WLIB 4X65B 1JPXA 2D3OW 1WA8B 4KFMA 2XU6A 2Q7GA 3SJCC 3P8MC 2P4KA 2CK3G 1KTMA 3TJTA 1AROP 4JI7B 4DK1A 1L8DA 4U3FJ 3ZEDA 1L0LG 2EIKC 1UIIA 1JY3P 1Y4MA 1Q2NA 2ZT9C 4ZMDA 3KDPB 4JI8O 2X0LA 4TV8B 1EZVD 1M93A 2A79B 5EIBD 2V1DA 3ZHRA 1BZKA 3KZIE 1FXHA 4IT5A 3I5DA 1SQBH 2JR8A 2H89C 3RYFA 1NTZD 1LTSC 3WU2Z 1VQLP 3FX7A 4K0KB 1HW7A 3VMXA 2XNDH 1OCZC 1KKCA 4TWKA 2HPCA 4F6RA 3UM7A 5JQGA 2PYLA 1PPJE 4WY4C 2K9JB 2VWJA 3DGEA 4DV3O 1Y74A 1MFZA 3LSQA 5H9CA 3CCLV 1T6AA 4UCOA 1GW3A 3AEAC 1VQ7P 5JH7A 2D2CC 3P3NA 3ETDA 2XAGA 5J2TB 1QLEC 1VQ4V 1S9KD 3TF5A 3BCCE 2EZPA 1RQVA 4H13D 1GN2A 1I5YA 1BCCG 2PRRA 1GN4A 1YIJV 2QSAA 2WSEJ 4PI2A 3D36A 1SQPK 3TNUB 1HF9A 3CMAP 2LR2A 5GTHE 2J58A 5L3EA 4R6ZA 2Q5UA 1TUEB 1YI2P 1JX9A 4K35A 2FYUJ 3TGUJ 2I1JA 1I7FA 1AR1B 1KZUB 2IBZH 1LTJA 4JI4O 1W2BO 1BSNA 1X8YA 3B71A 1SQPG 1K5QA 2E74B 4G2KA 1SQQG 4UCUA 4RQFA 1EN6A 1LTAC 2R9IA 2ZM6O 1L0NG 2BCCE 4I0XA 4MN4C 2CGNA 2YIBA 4GX0A 4UCVA 4LF4O 4M3LA 1X22A 1L0NH 1N4CA 1NTMH 3H1LJ 1QQCA 1D2DA 4DT0A 1TU3F 3IN6A 1WPBA 2KS1B 2XZRA 4B3MB 3QTCA 1VF5D 2A06E 1PNMA 3RYCB 4C7RA 3ZRWB 3K9SA 1YHQP 1OX3A 5DJTB 5LOVB 2KXPB 3G3ZA 3W7UA 4ASWA 3FB5C 3A8TA 4XA4A 1N32B 1T8ZA 3TGUG 3CP1A 4QE7A 3WUTA 1IFIA 1GW4A 2BE3A 4HNAB 1PD3A 1UPGA 3L35A 4BIOA 3AG2C 2VS0A 5E1AC 3TETA 1PGOA 1K5SA 1WPXA 1AFOA 1NWQA 1M1KQ 3RBZA 1SP4A 5LL6Y 1ZWIC 2O01J 4DW0A 3TNUA 3JD1A 1ZP0C 2K9PA 4NTYA 5H6QA 1UIXA 4U7JA 4FZ1A 1MMMA 3VBBA 4DR7O 2DMXA 4RUEA 5KMGB 1XTCC 3CB2A 3IFXA 2QSIA 2AXTZ 2OIEA 1L0ND 2UXCO 5JJNB 3ETGA 2JJ2G 1CEZA 4JTDB 1SQPH 3SPJA 1SQFA 3UCSC 1NAYA 1SQXE 2BCCJ 1K33A 1YITP 2AGAA 1SS3A 4RQEA 2V7QJ 2W0XA 4B3TB 2HP8A 4LFBO 1NTMG 5KLVK 3BAAA 1X0TA 4WFEA 1KBHA 4DUZB 3JAWB 5CBHA 1SQXG 4J9YB 3CRCA 4TV8A 3F5TA 4BWAA 3U0ZA 3FXDA 3SWYA 4L76A 2QJPB 1HNXB 3A5TA 2P06A 1GL2B 4G27B 4DR1B 1M57D 2O57A 2IZ1A 3KHUA 1QVFO 3SDLA 4J7JA 1FZFA 3ZCCA 1KKDA 1OW7A 3H1JE 2M8RA 5BU5A 3B5NC 4JGSA 2LFRA 1NTKD 5L3FA 2YIUB 1VQMV 3UT5A 3T1HB 2QWNB 2WLIA 4LFBB 5DEDA 5EYPA 1YVWA 1Y76A 4I7ZC 2IH1C 1N73A 5GTIH 1FYJA 1NHLA 1HNWO 1JMMA 3CCUV 5KHHA 3LNNA 2ZCEA 5ITZB 5KHKA 3BATA 5D5PA 3CCQV 4C7NB 5CA1A 2QA4V 1H88A 4WY4D 1OVVA 2E5YA 4X1IA 2B5UA 4D6TG 2Q4PA 3CRQA 3LIDA 5LXTB 3AE8C 1Z5WA 1NAFA 3JAKA 2QKSA 4G28B 1L1FA 5LHGA 4IYIA 1XTGB 1T2KC 2GUZB 4DUYB 3RBXA 2FKWB 3AG1B 3GG2A 1FXKB 5BZBA 3NR7A 1JOYA 3AEFC 2X7RB 1SFCC 2HEPA 3GHGC 3H01A 2Y0DA 2E74D 3J81N 4UXNA 3L73E 5KJ7C 1LGHB 1OJHA 4KXRA 5AVZB 1Q81Q 2X6AA 2OIGA 4OGQD 3TSIA 3RK3C 3E8GA 3CYOA 3HRNA 1L0LJ 1W59A 4H13B 3OE7G 1FC2C 1BCCH 3K3WA 3PN1A 3ZRXA 1GK9A 3C8VA 3KCXA 5HFMA 2PGDA 2Q8VA 2WWWA 1QU7A 1VARA 2WA4A 1GMJA 5H2FZ 2N05A 4I55A 2Y0EA 4IL6H 2Q1KA 3T1HO 3AG3B 4TT3G 3RYIB 2ZNJA 2JJ1G 2WTYA 1NU1D 1YEWA 2B87A 2IBZG 3M0DC 2V7QG 3L71J 1NQTA 5A2QN 1H0TA 1Q86W 3W7SA 1PP9D 1H89A 2PUSA 1BL8A 4MVOA 1U7MA 5TISE 4I6MC 1SQXJ 1YCIA 3U11A 2ZD9A 1A32A 4B3RB 3JC22 5B66E 1SQBE 2KIKA 3BFRA 1NVPD 5CBOA 4EOTA 2N04A 3OFNG 2KG7A 2Y0PA 4YJ2B 4I50A 5AW6B 3CLQA 3JSNA 4X65O 1XDCA 2UU9B 1YYCA 1OHHG 2IBZI 3AE4C 2E75B 3H1HG 3CC2V 3P8CE 2UXDB 1JA8A 1A02J 3DTUB 4B08A 2KZJA 4L87A 5LGUA 4DV2O 3ZRWA 1E1QG 1FJKA 4ZKIA 2CTQA 4MVZA 4WY4A 3L75E 5BVZA 1K92A 4X1KB 3MHHC 3OM3B 3SSUA 1S72P 1R6NA 2BEQD 2H8PD 1JR9A 1USDA 4X66B 3P30A 3BEHA 2R3CA 2Z5HA 3SJBC 1QR8A 4PDMA 4I0XB 1K04A 1SKVA 3AK3A 2EJ7A 1MZEA 4JAVA 2EIKB 1J2JB 3IGAC 1XUQA 4I50B 1KC8W 2LJ2A 2KSEA 4RESB 3PH0A 3OW2O 1MOFA 3CD6P 4MTGA 2CTRA 1NTZE 1B06A 2CE4A 2F66C 2KK7A 3OA7A 4YY3O 1AVOA 3ZHQA 4UVCA 1IO4A 1PGPA 4I9WA 2JP3A 3JAMN 1G6UA 1IFDA 1OCZB 3TK1A 3CCMP 5KAFE 1SQPJ 2K1EA 1FU1A 2WITA 1NZ6A 3RYHA 4KHPB 2OCCC 4GDOA 2DYRC 4DYLA 4BWNA 3RK2C 4FLTA 1Y8AA 1GTOA 2EIMB 3JD4A 1AQ5A 4EB6B 5JJEB 1QVGU 3A0RA 4JI4B 5AW7B 4MW8A 1KORA 5KUMA 4IL6X 2KSJA 2Q0AA 1PV3A 2HJDA 3H6PA 5KHIA 3JD3A 1P4RA 1V54C 1IVSA 1E79H 4YTPC 2BASA 2VQFO 5CBNA 2HPCB 1Y6XA 4FJCC 2OYHB 4A5UB 3W7XA 4H44B 1E1RG 2A9HA 4EFBA 3Q2YA 3K5LA 4PV1D 4LF8B 4LFAB 4PV1C 1K73Q 1H2NA 1IBKB 4QE9A 4GX5A 1SQVK 1PPJG 5KUKA 4DV2B 3H1JH 1WB8A 4O4HA 2XT9A 4ZKUA 1M56B 1IXMA 1VEWA 2Q6QA 4N3YB 4PA9A 4H33A 1KB9H 2E74C 1K4CC 2YXHA 3OTOO 1HGZA 3U1CA 1LP1B 1PKXA 5APVA 2ILMA 2CGOA 2QJ1A 4DR3O 4N78E 2JGDA 3N2GB 2UXCB 4EKWA 4KJMA 4WWIA 1OZHA 1PL0A 3O8ZA 5FLXN 1J5EB 1RHZB 1KC8Q 2FXPA 2VWKA 2VQFB 1DEBA 4I1LA 1W0JG 1NTKH 2P5OA 4BR6A 1SA0A 3WB0A 3II6A 1GD2E 2AZ2A 1G2CB 2C2AA 3PLNA 1WA8A 3AE6C 1I08A 3MD0A 1NVOA 1T3UA 2FFDB 4JI1B 1VP7A 3J7AU 1K05A 4MVQA 5CMZA 1YSCA 3AEDC 5AVVB 3CWBJ 2CK3H 2YS8A 3X2QC 2YMYA 1SQPE 3USSA 2G3AA 1KD1Q 2QE7G 3GB7C 1JFFB 2EX3A 1ZTEA 5AVRB 1IBLO 3LDEA 2B1GA 2E75D 4HB1A 2Y69C 2BTQB 5L3CA 1ZOYC 3F5WC 1GH6A 3SYCA 2UU9O 2WLHA 2NPSC 4OPHA 2ZJSE 3UT5B 1G2CA 4NXMB 5AVXB 3FB8C 3AG2B 3L74H 1NI8A 5M1BA 2R32A 4DV4B 1EXJA 1MG1A 3E8BA 3L74G 2R44A 4AQYB 3VOPA 3KZIH 1NTMJ 4F6EA 2QDOA 3R2PA 5KLVJ 3LDCA 1BGYG 3CCVP 1N7LA 3B09A 4LF7B 3GHGA 3JAWA 4K8ZA 4LFCO 4DV7B 3L74E 3TGUE 1LTJC 1NJIW 4JTCB 4FLUA 3ZHSA 3F89A 2H8PC 2JJLA 4OH8B 2N9YB 1RE3C 2K3RA 1K9MQ 3D36C 2N9BA 2YKOA 2JS3A 5B1AB 1VQ8P 3THOA 1Y66A 5B3SC 1XNQB 1VMGA 2KLUA 4UVBA 4JAAA 3UKMA 1VQKV 3CRMA 3I55P 2YO3A 1KILC 5EBMC 3U10A 1SQVG 3EVKA 4IIJA 1PV0A 4BW5A 4ZI7B 4UB6H 1E79G 4UB8E 2IM9A 3E86A 3SYAA 2QJPC 2ZVNB 1VF6C 4MVMA 1GN6A 3G9RA 2QWQB 2B9ZA 2YO2A 2W83C 2ZDIC 1R3IC 1Y47A 1H8AA 3GF7A 2GDSA 2Q9IA 1AP5A 4YXDC 1IBLB 1JTHB 2UXBO 1N7SD 3RL0B 1DGSA 4LF6O 2Q73A 1YXBA 2ZT9B 1N86A 4FM0A 3AE5C 2Z4EA 1BE3E 1KQGB 4GYCB 3SYPA 2FKXA 4LBEC 3ABMB 1KYOE 1SRYA 3L75H 2XNDG 3CJHA 1WLEA 1XMOB 4YXWH 2IFMA 1FS0E 1Q6UA 5B66Z 1QL2A 2OYIB 2MKVA 3SPHA 4E4EA 1AI7A 1QEXA 1FDOA 4N78D 2OYQA 4NTXA 4JI7O 4RAIA 1HTLC 2IJJA 3T97A 1FKAO 4HJGH 4U3FD 4WY4B 3CCJP 2Z3YA 1BQZA 1FS0G 2F23A 2DWDC 4LNUA 2FTKA 2IYOA 1N33O 1CI6A 1EZVI 2QJYC 2EZOA 4ABMA 2IX7C 1EDJA 4IFFA 1JB0J 2P4VA 2Q68A 1KQLA 3CWBH 1W2EA 1N2DC 2M7WA 1NTZJ 3AE1C 1K34A 4DZOA 1AR4A 4YJ3A 2C9LY 1MZ9A 1NTZH 3TXQA 3F7YC 5BY1A 2RH0A 1SQBD 1E5WA 2AW9A 1QCEA 3JCUH 3ZMVA 1T2KD 3AG3C 1FZEA 1JEKA 4JYYA 4IGGA 3FAVB 4UFZA 3RVZA 2XV5A 1QNMA 3Q4HB 1XHXA 1U57A 2WPDG 4WF9V 5KLVE 1NGMB 2JK5C 4MTXA 1Y74B 3MHSC 3KPEA 2WLMA 1M4UA 3BABA 2UWJE 4F6RB 3OEEG 1X79B 4H0LD 5LYJA 3L72G 3CD6V 2B87B 1VQKP 2WSCH 2GSMB 2ZT9D 5EC1C 4F4LA 3JARB 1Z56A 2L35A 1AA0A 3TGUD 4PA3A 1SA0B 1XHZA 1SESA 1J1DC 1N7SB 1Q43A 1G1JA 1PIXA 3IR9A 3PP5A 2XASA 3FKSG 5AVWB 3HE4B 2YXLA 4NPDA 5GTHZ 2HFED 2HFEC 3L72E 3AE3C 2IBZE 1LP1A 3HE5A 4I4TB 1LUVA 4CS4A 1GM8A 2ZM6B 4W7YA 4H0LC 5APWA 3BVHA 2QVAA 4LH7A 4JF7A 2Q7CA 2GTSA 2KLVA 3N2KB 1TAEA 4PD4F 2XNXA 4NPFX 3A2FA 4L8JA 2A06H 4RWUA 2VRZA 2H88C 1FOSE 1JY3O 2ZYDA 3D8CA 4R7CA 4HBNA 3GMAA 2H3OA 1YZBA 1IURA 3L36A 2O1KA 2FYUE 4RO2A 2GM4A 4J80A 2DW4A 3A0BZ 4FVMA 3ZMSA 2V4HA 1YTFD 3MHVA 4U7OA 2UUAB 3FGAD 1S0VA 4JV5B 2NZ2A 4GKKB 3SFDC 5CBGA 1KYOD 2KB7P 5ITZA 1HNZO 1RE3A 3JCZA 4JZGA 1YJWV 1HVVA 1YITV 2ZAEB 1TVKB 4JI0B 5K5GB 3E8HA 3OR6C 2WSSH 2NRGA 4LWSA 3L70G 1I5XA 5IYCO 2WSSG 4XDJA 5KA6A 3E35A 4W80A 2E76D 1JY2P 2XAQA 2AXTE 4N21A 1G8MA 1QHTA 2X6BA 3IC9A 2ZYAA 3JCUE 3E83A 1K3EA 2DYRB 1ZL8B 1OW6A 3M0DA 2O01H 1Q90D 1DK1A 2YKQA 2FXOA 3PJSK 5IT9N 1N8RQ 3E22A 2WPRA 1AP6A 2POHA 3P32A 4LF9O 4XBFA 4X1KA 4MT8A 1V54B 1Q7YQ 1KD1W 3K0DA 2KB1A 2A45I 1LWUA 4GUNA 1N36B 4ZIBA 2OYHC 2UXXA 2K37A 3IFMA 1SERA 3L70J 3DXRA 1LTGC 4JI0O 1Q6HA 3D70A 2HJFC 4X9QA 1M56C 3KKYA 3AECC 3G71V 5APTA 3H9VA 2ZXEB 4X64B 1NTKJ 2YNYA 3CPWO 4X20A 1DLBA 3ZHUA 1XMQO 4CC5A 1A02F 2W6BA 3A0HH 1X9VA 1HNZB 3A2AA 1FXKC 4FPPA 1SFCA 1M57B 2ADQB 1NKDA 1GM7A 3FYIB 2Z0AA 3MUDA 2R5DA 1FZCC 5AVYB 4H44D 4HH2A 4ZHQA 2KI7B 1NO4A 3M9HA 3B8MA 1JMKC 5L8RJ 1M5IA 1IXBA 2Y4TA 3T1CA 2JS5A 2FFDC 3TCUA 3DSQA 1Z5VA 3G6BA 4O4LA 1KFMA 2PF4E 1PL4A 1Q82Q 1N34B 1SETA 3X2QB 2AXCA 3AEGC 3NMDA 3FD9A 1S4XA 4NXNO 3CCRP 2YIAA 2KSDA 4UV8A 3OMIB 3P3PA 1DH3A 2ZXWB 3GVMA 2LXCB 1DD3A 3MTUE 3S1KA 2FL4A 2Y69B 4O4IA 3CE2A 4NKGB 3IAOA 5CCHC 4O4JB 3ITKA 3WUVA 2NPSB 1FD9A 1PP9H 4EFEA 4DR2O 2OYOA 1F4NA 2YXYA 4D7SA 1VQNP 2AEMA 4MVRA 1N36O 2Q3IA 1JCHA 3BHPA 1G1IA 5APSA 4IFDK 1KYOF 5BMVB 2GUSA 3Q1MA 2JEEA 1G4YB 4TV9B 3A0BH 1OCOC 2V4DA 1L0LD 3ICXA 3E7KA 3EQ2A 4OXSA 3RN4A 1Q7YW 1H2SB 4JYAO 2R9RB 1HR0B 2N1TA 4O4IB 5CN0A 3G6EP 3ETQA 3O9OA 2BSKA 4LC1A 1NYHA 2RKLA 2YUAA 2FXMA 2LW7A 2E3CA 3JSVC 4HYTB 1K8AW 2UUAO 2P7TC 1TVKA 2P22C 1H8HG 1EN4A 3WB2A 1SQQE 4X62O 4C7UA 2FBWC 5J2UA 1L0NE 2ZNIA 3FWLA 4WB4A 5B1AC 1JO5A 4X1IB 3BVOA 5CCGD 2PFXA 3V2NA 5CA1B 3H32B 1JCCA 2IJIA 4XDLA 4OX9B 5B66H 1SQXD 3JSLA 4CH4A 2HHHB 4PA7A 3VYIA 2CTPA 3H1LE 4IFMA 3K9AA 4Q20A 1SQVJ 4OPAA 1H2LA 2A06G 2G8YA 3HD7B 2GA1A 3B2EE 1EZJA 1PL5A 2LP7A 1QR9A 2PI4A 3RW0A 1NTKG 4DV1B 2D2CD 1K7DA 1NH2D 3FFQA 1RFYA 1SS1A 3RL0C 3WUUA 4GX2A 3BCCH 3HR0A 5GONB 3NXSA 4TSFG 2YI8A 1SQVE 4I4TA 3O6QA 4JPRA 1IBKO 1NTKE 4K8XA 3VQWA 3ABMC 4DV0O 5KAFZ 2FYNC 5TJHA 3R66A 3ZJZA 4U3JA 5F2VO 3K57A 2XOKG 5B5EZ 1JY2O 5DJUB 2OYIC 1RF0A 3ASNC 4X8AA 5IY5C 1AVMA 3SR2C 4DOJA 3JARA 4B86A 3AE9C 4IOIH 4IHJA 2E5LO 1OVUA 3SPCA 4R8CA 2GTAA 4FLXA 4JI3B 2OARA 2OCCB 1IFNA 5BU8B 4MTFA 4MVUA 1WB7A 3AEEC 3RK2B 2YXRB 1VL2A 1BDCA 2EIMC 3RGBA 2X6CA 4MW3A 5C8YA 3IF4A 2PZSA 2Q3EA 4X62B 3RFRA 3E2EA 2HR3A 1NTZK 4Z1MH 4H44C 1YJNP 4JI5O 3K5OA 4PV1B 2HLDG 1RE4A 2VRSA 1XNQO 1SQPD 2ITAA 4GZRB 3L73D 3HD7D 3ZS8C 4C46A 1RPRA 3WB1A 1KV4A 3CCLP 2K88A 1ORQC 3OT7A 3CCSP 2H43A 3C90A 3UO2A 3CC2P 2YEVB 4Y28J 5GTHH 3S4RA 4FMTA 4JAUA 3HUSB 1BT8A 1Z2GA 4X64O 4E2LA 3SGIA 4DV7O 1EQ7A 3FB7C 4WBNB 2FYZA 4N23A 2M3BA 4O2AA 5LHHA 2E42A 1S5LX 4JV5O 3NFQA 5LGNA 5LA6A 2FYUH 4LF9B 2WPVB 3CCRV 4GKGA 3BA9A 1J1DB 1N7SC 2QEXV 2RN0A 3JD2A 3QO5A 2L6LA 5J9PC 2P7JA 5JWPA 3BRTB 3BY6A 1DD4A 1OW8A 3O65A 1YQ4C 1J1EC 1EFRG 2EINB 2ITCC 4LLHA 3W7WA 1RH5B 3BPZA 3D3IA 1SQBK 1N73C 1JJ2U 5A9GA 4UB8H 1JTHA 5LYJB 1P84F 5DM6V 1QLED 4DV3B 3L73G 1MSDA 5AVSB 3CHXA 4DRXA 3OAAG 1GKFA 5L3GA 1Q81W 1KUQA 3B5NA 3RL0g 1R6KA 4J41A 4KL1A 3LSUA 3MAQA 1K73W 1URQA 1ZW0A 2W27A 4GOFA 4Z1MG 3MGNA 4LR3A 2Y9YA 4JQ0D 4D7TA 1BCCD 1JMBA 4P9OA 2B89A 1HH0A 1JNMA 5JCOC 1L0NK 1HJBA 4DR3B 5CCGC 3EFFK 3TGUH 5APXA 1RE4C 1LNQA 3UQ8A 5EFWB 4ASUG 2W6JH 2R72A 4QNHB 5JQGB 5K1PA 3HB3B 2KNCA 1T5EA 2M5AA 2KQXA 3FXEA 4H37A 3K04A 3IAYA 3M0AA 3C3TA 2QM4A 3JASA 5KLIC 5B5EH 2FMLA 3B4SA 5B3SB 4FLYA 2FYUG 1KYOH 1KILB 5FL7G 3QO7A 2UUBB 2BOBC 4J10A 3I56P 1M1JC 1R3JC 3T97B 2J59M 1TUBB 4ZNCA 3STLC 3OMNB 2K1AA 1YTFB 4KT0J 3MP7B 1SQBG 5IJ9A 5KKZB 2B9BA 1IK7A 1RF1C 2CH7B 1D5NA 4XDKA 4J9ZB 5CB4B 3MIWA 1I94B 2GBOA 4BIUA 1WMKA 2UUCB 1P7GA 1NU1G 4FZ0A 2Q0OC 3CX5E 3G80A 2ZXXA 1AI5A 4QGPA 2KOGA 2LKMA 3ZX6A 4YY3B 3LUTB 4IYHA 1OIPA 2JKVA 2Z5IA 4Y99C 1NTME 2YICA 2QR4A 4B7EA 1D7MA 4TQFA 2QRXA 3GW6A 4QJFB 1NKZB 1HUCA 4PA6A 4JASA 3OW2U 1GMGA 2LO1A 1SVFA 5CA0A 4KHXA 4RJTA 4R4LA 2YKPA 4YIPA 5JVDA 1BMFG 1VQ5P 1KILE 1EDLA 5AVUB 4IIJB 1US6A 3CPWU 1USEA 3ABTA 1L4AA 2JGDB 5IWAB 1FZCB 1VQ9V 3CX5F 1JM0A 4CH6A 1ZSPA 2QJYB 4UCRA 1NR1A 1ZV8A 3A7OA 1NTZG 2P1JA 5GTIE 1YQ3C 2PGGA 4BIZA 5LBQA 5CBFA 2HVJC 1IX9A 5LA6B 4JYCA 1YTZI 3APOA 2JDIH 3HTKB 1OFCX 3JALA 3DC5A 1AI6A 4KHPO 4QIWF 3HTKA 4O2BA
chains in the Genus database with same CATH topology
1FDIA 3S9OA 1NGMB 1ZMEC 3D70A 2D2CD 2K9YA 3AEFC 1VF5D 3AECC 2QJKC 4H0LD 3D6ZA 2E76B 2E74D 2JP3A 3O6QA 2ZT9D 3Q5PA 2FYNC 1PIXA 4I7ZB 4OGQD 3D6YA 4GDOA 4H13B 3AEBC 3GLMA 4H44D 3AE3C 1KMIZ 1KQFB 3C8VA 3AE9C 1KORA 5L8RJ 1ZRTE 4H0LC 4IL6X 1GMJA 5KLIC 1KTMA 1PV3A 2QJPC 2O01J 4YTPC 3G9RA 1ZP0C 2IDBA 1UIXA 3AE7C 4U7JA 2ZT9C 3AEGC 3AEEC 4H44B 4XFJA 1VL2A 3Q2YA 3AE2C 4PV1C 2H88C 2QSIA 3GF7A 4PV1D 1MKMA 4YXDC 1DD3A 4H0LB 3T97B 3GMAA 2QIWA 2H89C 3R4YA 4RKUJ 3IAOA 1VF5C 4KT0J 2D2CB 2OQQA 2ZT9B 1IK7A 3AE5C 1OMIA 1KQGB 2E74C 4Z1MH 4R4MA 4H44C 3Q5RA 2WQYC 4PV1B 2V7QJ 3Q5SA 2WSFJ 3H25A 1WMKA 3FGAD 1R8EA 2NZ2A 4OGQC 3Q1MA 3AEAC 2E75C 2FXPA 2MKVA 4H13C 3SFDC 2D2CC 5KKZC 2YIUC 4Y28J 1FDOA 3AE6C 2WSCJ 1RQVA 3ABVC 4H13D 1K05A 2BEZF 1NYHA 2WSEJ 3AEDC 1HF9A 3SFEC 4OGQB 3AE4C 3D71A 1OW7A 2E75B 3GF3A 1S5LX 2J5UA 2G3AA 2JO1A 1S1CX 1HJ0A 2QJYC 2E76C 2E76D 4R4LA 2FBWC 2WPVB 3EWKA 2E75D 1JB0J 2P10A 1RQUA 4I7ZC 1VF5B 1ZOYC 1KILE 3AE1C 3B71A 1DIPA 1OW6A 2E74B 2BEQD 3RK3E 1Q90D 1DD4A 1OW8A 1YQ4C 3Q3DA 5M1BA 1Y9BA 4TT3H 1EXJA 1YQ3C 1K04A 2G8YA 1TU3F 1PL5A 2YMKA 1AJYA 1EXIA 3AE8C 3IN6A 3LW5J 1U57A 3RL0g
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KLI C;  1JB0 J;  2QJP C;  2O01 J;  2K9Y A;  1VF5 B;  4IL6 X;  2QJK C;  2E74 B;  5KKZ C;  4H44 B;  2YIU C;  1Q90 D;  4Y28 J;  2E76 B;  2QSI A;  2WSC J;  2FYN C;  4H0L B;  2QIW A;  4I7Z B;  2WSE J;  4RKU J;  4OGQ B;  4KT0 J;  2D2C B;  2ZT9 B;  2E75 B;  4H13 B;  1S5L X;  2QJY C;  4PV1 B;  3LW5 J;  3C8V A;  2WSF J;  5L8R J;  2WPV B;  1ZRT E; 
#chains in the Genus database with same CATH topology
 2ZFC A;  1ZME C;  1JY3 N;  5APQ A;  3M91 A;  5BXZ A;  5JCO A;  1SLQ A;  4LH6 A;  3L37 A;  2EIJ B;  1TGO A;  1JOC A;  1QL1 A;  2EIL B;  1CZQ A;  4HYO A;  1GRJ A;  2WZ7 A;  5APY A;  4JI2 O;  3GWO A;  1L4A B;  3H1J J;  2H94 A;  1KB9 E;  4U7N A;  5KX5 A;  1L0L E;  2W6J G;  3CXH E;  5KJ7 D;  1CXZ B;  4NB5 A;  1AI4 A;  2F95 B;  3CCQ P;  1XL6 A;  3VN0 A;  4GLX A;  5CA0 B;  2B88 A;  1KMI Z;  3SJA C;  3D3Q A;  2CTW A;  2OT5 A;  4FFB B;  1SQB J;  1IC2 A;  2W8Z A;  5C8Y B;  3AE7 C;  1P7B A;  5KLV H;  4JI5 B;  1FBM A;  3APQ A;  1VQ5 V;  2DWE C;  3FYE B;  3H1L H;  1O9H A;  5IWA O;  4H0L B;  4NXM O;  3L72 D;  2N74 A;  3ZRV A;  3R4Y A;  4WFF A;  5LMU O;  2MK3 A;  2RDC A;  4KP4 A;  3L74 D;  2WT7 B;  2OTK E;  2DQ0 A;  2ZIM A;  1LTI C;  3JAT B;  4IL6 Z;  2RMZ A;  5H2F H;  3W67 A;  1KP3 A;  5EZY A;  2ZR2 A;  4XE5 B;  1ENV A;  1YJW P;  1AVY A;  3BCC G;  5IJ9 B;  3RL0 D;  1DX7 A;  1MNG A;  1XBL A;  2WVR A;  3VMA A;  4OGQ C;  1IK9 A;  5B1N A;  1FJG O;  3HKB A;  1BDD A;  2QWO B;  2EBO A;  1YTZ T;  2F4V B;  1SQX H;  1VQP V;  1PGJ A;  1K9M W;  2G38 A;  1P49 A;  3K58 A;  1AQT A;  4DJG A;  3CSX A;  2GUV A;  3A0B E;  3ZIA G;  2LQT A;  1FZA A;  1MFT A;  3D71 A;  5AW8 B;  4PHZ A;  5CMU A;  1AJP A;  1Q3E A;  2OYH A;  3QNE A;  1Q82 W;  1S1C X;  2M5A B;  3OUF A;  1HWT C;  2FYN B;  5KAI H;  2BCC G;  3E1R A;  1LT9 A;  1VF5 B;  4Q6G A;  1GK6 A;  1GL2 D;  1K8A Q;  1DIP A;  3H32 A;  4WFA V;  4LF5 O;  1HWY A;  3T4D A;  4PJ0 H;  3H1I H;  4PDL A;  4LP8 A;  1PP9 G;  3CWB E;  2ZIO A;  2JDI G;  3ZBH A;  4ZBM A;  4D6T H;  2PY5 A;  4DR2 B;  5IE9 A;  1IFJ A;  3HKD B;  3VQX A;  1ZRT D;  4DRX B;  3M06 A;  3M9Q A;  4LF6 B;  2Y9Z A;  1FFT B;  2VQE B;  1FDI A;  2BSK B;  3G67 A;  3HKC B;  3CC4 V;  2N1T B;  4TUY A;  4JBZ A;  1ZLZ A;  5KTB A;  1R6T A;  1XQ8 A;  2ITD C;  1N0N A;  4CZZ A;  4DUZ O;  1H38 A;  5BMV A;  4DR6 B;  1M90 W;  1M1K W;  3CXH I;  2QM7 A;  1URQ D;  1S76 D;  3BRV B;  1O9G A;  4JI6 B;  1ZN5 A;  2LXB A;  3S3W A;  3D6Y A;  4JI8 B;  3ZN1 A;  1MV8 A;  1KEC A;  1KU9 A;  3R65 A;  5KHG A;  1S5L H;  4WVZ A;  4GKK O;  2H7H A;  1YDX A;  2CDY A;  3OD4 A;  2WLJ A;  4O4J A;  1KQF B;  3H1H D;  4O2A B;  4PDV A;  4JYA B;  2WPS A;  4OVN F;  1AJQ A;  1NT2 B;  1PFI A;  5JJJ B;  4A7P A;  4NVP A;  1M57 C;  4J42 A;  4PDR A;  5TIS H;  1KQS U;  2O3J A;  3HUS A;  1Y67 A;  3P7K A;  3JD0 A;  2Y0I A;  3HPL C;  2M3E A;  2MJZ A;  2B1I A;  4DR6 O;  3L70 D;  3EFG A;  3SYO A;  1XIL A;  2HVK C;  3CX5 H;  2KG7 B;  4YJ2 A;  5CHX A;  5KHJ A;  1QX8 A;  3KXD A;  3ZDM A;  3RVY A;  1NJI Q;  2QTO A;  4YPC A;  3C9I A;  1MAB G;  1KB9 I;  1VQ6 P;  4OX9 O;  1MA1 A;  1VIB A;  5BR8 O;  2ZXW C;  2NNU A;  4I9Q A;  1VQ7 V;  2BOC C;  4JTA B;  1N73 B;  1XOU A;  1JCD A;  1KP2 A;  1N34 O;  2RQ6 A;  5KAI Z;  3L9D A;  4P30 A;  5GTI Z;  3L75 J;  2M6Y A;  4BRY A;  4DW1 A;  4D6T J;  2PP6 A;  1M9N A;  2DOS A;  2IJH A;  4JYB A;  3U1A A;  2R3S A;  4JZ2 A;  1GL2 A;  1LWU B;  1OCO B;  4DV4 O;  4FFK A;  5E79 E;  2IJK A;  5IYZ A;  3RYI A;  5CCH A;  4LF4 B;  4RUF A;  2Y0C A;  1HP8 A;  4NPE A;  2BTO A;  4I55 B;  3PHL A;  2ZKO A;  4U3J B;  3CXH F;  4O2B B;  1PPJ H;  4D6T E;  3KCY A;  4X88 A;  5APU A;  3ASO B;  1GAX A;  4NR1 A;  4DR4 B;  4TT3 H;  4B7K A;  3T1Y B;  3CX5 D;  1NTM K;  5KLV G;  2KP8 A;  2EJR A;  3I55 V;  3ML0 A;  1M1J A;  1M7L A;  4JI3 O;  2M0B A;  1GO3 F;  4CH5 A;  2YSU B;  1F51 A;  1NU1 H;  1IFP A;  2YMK A;  4PJ0 Z;  4W4K A;  5IDJ A;  3CC7 P;  1IDS A;  1BHB A;  1FOS F;  3AG4 C;  4NTW A;  1FXK A;  5C93 A;  5AW5 B;  3U59 A;  2YIB D;  3H1K J;  3IJ4 A;  5DEC A;  1QGK B;  2QJK C;  1QVG O;  3HD7 C;  2KUB A;  1VF7 A;  5KA5 A;  1CSB A;  4YHH O;  1W2B U;  3W68 A;  1VQ6 V;  1RF1 B;  2RN9 A;  1PPJ D;  1NU1 K;  3Q5P A;  2WLK A;  2F43 G;  3KZI Z;  3LNM B;  2WLN A;  2P90 A;  5LP6 C;  1WP8 A;  4HNA A;  1FXV A;  1T3J A;  1VPC A;  4DUY O;  4DV6 O;  3FX0 A;  1NS1 A;  1VQO V;  1S9K E;  1BHA A;  3BCC D;  3ABL B;  1TA8 A;  2UXB B;  2ATK C;  2ZIN A;  3ZMZ A;  5AVQ B;  1SQG A;  5EYP B;  1U96 A;  1SQV D;  4JI2 B;  3STZ C;  1GZL A;  3RYC A;  4LCU C;  3VP9 A;  5CB4 A;  1IBM B;  5KAI E;  3AEI A;  1EC5 A;  3AK2 A;  4XFJ A;  3CXH H;  3ASN B;  5IY5 B;  4LFC B;  1BE3 D;  1YI2 V;  4TV9 A;  3QH9 A;  4DV0 B;  1TUB A;  1NU1 E;  5TIS Z;  3OR7 C;  3H1I D;  3HE5 B;  3L71 E;  4B3S B;  1SQQ J;  3H1K G;  3PRJ A;  1COW G;  3G6E V;  1MZF A;  4FIP C;  5CA3 A;  4DR1 O;  1R3K C;  3F7V C;  1BGY D;  2HYN A;  1N7S A;  2JWD A;  3JAS B;  4YXW G;  4NYK A;  2QTS A;  4ZOL A;  3WG7 C;  4DCK A;  2KNC B;  2OTJ V;  3CX5 I;  4FLW A;  4CBC A;  3ABV C;  5H2F E;  5CCH D;  3HKD A;  4WFG A;  2HKO A;  2JEX A;  3AK1 A;  4TQD A;  3CCJ V;  3N4X A;  3V2Q A;  4JF3 A;  1JQ0 A;  4LGD E;  5LMN O;  3SWF A;  1W5C E;  2XAF A;  1ZR4 A;  2EIL C;  4ZHQ B;  2ZR3 A;  1EZV H;  1EN5 A;  1THZ A;  4L74 A;  3HUS C;  3CXH D;  1L4A C;  2KZI A;  3OAK A;  5JH7 B;  5AW3 B;  5C39 A;  2P10 A;  1JVM A;  1R1B A;  1NR7 A;  1GU5 A;  1FDM A;  1DTO A;  3KG2 A;  3OTO B;  1JY2 N;  5IJ0 B;  2IYP A;  4YJ3 B;  4ZOL B;  2W6A A;  2YI9 A;  1IBM O;  3ABK B;  2W0F C;  5IYB O;  4Z2W A;  4BW9 A;  3CRA A;  4AYC A;  2E43 A;  2UXD O;  4DV5 B;  3SYQ A;  3L73 J;  2R5B A;  1M90 Q;  1H8E G;  3RYF B;  2OTL P;  1B6Q A;  4L73 A;  3K5N A;  2R9A A;  3DXR B;  1OVR A;  1VQ8 V;  5LOV A;  3L73 H;  3KQG A;  1CI6 B;  1IFM A;  1BQ0 A;  2WMM A;  1OZ0 A;  1RM1 C;  1NVP B;  4JI1 O;  4LNU B;  1ZUQ A;  1J1E B;  3ZMU A;  3N7N A;  2EIN C;  2P2U A;  2DYS B;  1P84 E;  1PNL A;  2ZQM A;  3S9O A;  4UVA A;  1GK4 A;  1YHQ V;  2O1J A;  2HHH O;  1FPO A;  4MTO A;  2KS1 A;  1SFC D;  3E1I A;  2F4V O;  2XTA A;  4L75 A;  2AHY A;  3E22 B;  1CPY A;  5EZY B;  3BRC A;  3JAT A;  2OYI A;  1FFX A;  1B04 A;  2Y4U A;  3RK2 D;  1AR5 A;  3VOU A;  2WT7 A;  1IZN B;  4PJ0 E;  1WNS A;  1U97 A;  2IU0 A;  1P84 I;  1EDK A;  4WCE V;  5GW7 A;  5FNV B;  3CC4 P;  1IJD B;  1LUW A;  3A3Y B;  1ZRT E;  5AW4 B;  2Q67 A;  1VQ9 P;  4I2L C;  1XMO O;  3CCU P;  1SC5 B;  3N27 A;  3C1L A;  1SQQ H;  4RO0 A;  1NH4 A;  1LT9 C;  1KN7 A;  5AW0 B;  2Q5Z A;  4FFB A;  2QEX P;  2WAM A;  4CPG A;  3AE2 C;  1RF1 A;  2FYU D;  2WLL B;  2WLL A;  2OTL V;  1Q5O A;  1ZXG A;  4DK0 A;  5KLI B;  1KQS O;  3V2P A;  5KX5 B;  2P6J A;  5AG2 A;  4IL6 E;  4ZI7 A;  1VF5 C;  2D2C B;  4O9B A;  4UCS A;  1BCC J;  1NOH A;  3CME P;  1XRE A;  2AZ0 A;  1OMI A;  2NPS D;  2LW1 A;  4WBA A;  2HOD B;  5FNV A;  4CS2 A;  2WSF J;  2N1T D;  4NXN B;  1FZB A;  2QWR B;  1VQ4 P;  2K9J A;  1M1J B;  1SF9 A;  4LF7 O;  3WU2 H;  3EHB B;  4IHJ B;  2XHB A;  2CPB A;  3T2M A;  3TXS A;  2A0L A;  3H1L D;  3L4F A;  5KKZ C;  2ZE8 A;  3JAL B;  1FFX B;  1OCR C;  3CMA V;  2UUB O;  1ZLL A;  3LDD A;  1OWA A;  3N2K A;  2BEZ F;  4ZKP A;  3SFE C;  1YF2 A;  2N1T C;  1KYO I;  2ZE5 A;  4K0K O;  5H5N A;  3L70 H;  5B1B C;  3CCS V;  1H2M A;  1R3L C;  4J11 A;  1AV1 A;  3LIE A;  3HE4 A;  3TYY A;  1PP9 E;  4J7K A;  3CWB G;  3OEH G;  4Y99 B;  1URQ C;  1MUU A;  3B8N A;  3JYC A;  1XNR B;  4BRY B;  4EIJ A;  4CS3 A;  3H1H E;  3QO8 A;  1ZR2 A;  5KAF H;  2ZDI A;  3CEI A;  1VQL V;  2DE0 X;  4DXW A;  1PGQ A;  3Q3D A;  2C0W A;  3SWK A;  5IJ0 A;  2QKA A;  4MVS A;  4N6J A;  3I5C A;  2RNB A;  4UB6 Z;  1H2G A;  1DF4 A;  2P67 A;  1V55 B;  2QGN A;  3FAV A;  1AJN A;  2CUG A;  1L0N J;  2A3Q A;  1RSO B;  1FJG B;  1N8R W;  4GT1 A;  1XEQ A;  1NBM G;  3A0H Z;  3B77 A;  3V4Q A;  5J2U B;  3RT3 C;  2SPZ A;  1HGV A;  2BCC D;  4CH3 A;  2Z5U A;  5CJ4 A;  2E76 B;  4DO2 A;  1S5L E;  1VQO P;  2CH7 A;  2LGQ A;  3M99 B;  3N2G A;  2IPP A;  3ZHV A;  4LFA O;  2BCC H;  3CRR A;  2EIJ C;  3K79 A;  1WT6 A;  3A0H E;  4GOE A;  1NTK K;  4K3A A;  2JRI A;  3W7T A;  4O4H B;  2I8D A;  2RMK B;  1S72 V;  3MZW B;  4HKZ H;  2OGU A;  3P8C D;  2ZYG A;  1EBO A;  2F1M A;  4X1Y B;  1BE3 G;  1YJ9 V;  2NPS A;  1GDT A;  1VQM P;  4DR5 B;  4TUY B;  2ODM A;  1OXZ A;  4FLZ A;  4QMA A;  4TLF A;  2QIW A;  2AEF A;  2DN9 A;  3OUS A;  1RP3 B;  1PNK A;  2RJZ A;  4GKJ B;  3WU2 E;  1OCC B;  4JPZ B;  2AXT H;  1SZT A;  1X4T A;  4EEQ A;  2MW2 B;  1QLN A;  2WQY C;  1G1X B;  2IU3 A;  2YDE A;  3H1J D;  3RYH B;  4LF8 O;  4PD4 D;  4O4L B;  1R8E A;  1HNW B;  1RY3 A;  3B5N B;  4B3M O;  2YIU C;  1IZ3 A;  3LSS A;  2WSC J;  3RGU A;  2VQE O;  4ASV A;  3AG4 B;  4J7Z A;  3QF7 A;  4OGQ B;  3JCU Z;  2QJK B;  4X20 B;  1GTW A;  1J5E O;  1FAF A;  3I56 V;  1HJ0 A;  4DV5 O;  5EIB C;  1Q86 Q;  2JIZ G;  5D5Q A;  4U3F E;  2ZE7 A;  3EWK A;  2JWA A;  1BCC E;  2CPS A;  2YXQ B;  5LP6 B;  4FLV A;  3L72 J;  3ETE A;  1VQN V;  4P9P A;  3L74 J;  3VTP C;  1YJN V;  3RK3 E;  2OCH A;  4KUM A;  1WRG A;  4U3F G;  3E8F A;  3H1K H;  3HKB B;  2XDJ A;  3AG1 C;  2IZ0 A;  1K97 A;  3B5N D;  3H1I G;  5FPR A;  3BAS A;  3K0G A;  2L5G B;  5CCG A;  4FK5 C;  4UV9 A;  3GWK C;  3UO3 A;  1L2P A;  1HBW A;  3WFV A;  4W7Z A;  3GHG B;  1QLE B;  1NU1 J;  4PD4 H;  3CCM V;  4DR7 B;  2QKC A;  1XNR O;  2YEV A;  1BSH A;  5IYZ B;  3HKE B;  1HNX O;  4P2Z A;  2Q7H A;  4MSW C;  4FM1 A;  3E89 A;  4BXL A;  3BA8 A;  3H1I E;  3L71 D;  1DEE G;  3SPI A;  1XL4 A;  1EZV E;  2ETN A;  2QG4 A;  2PYJ A;  3VQV A;  1PP9 J;  2FYU K;  3D6Z A;  2QM8 A;  3G4S P;  4PEL A;  4FM2 A;  1BGY E;  5AVT B;  2W6I G;  4LWS B;  4EDF A;  4HAM A;  5AW1 B;  1EZV G;  3CXC U;  4B3S O;  1VDF A;  1Q6I A;  4LF5 B;  2QA4 P;  1KIL D;  5H6R A;  3OGC C;  3AEB C;  3GLM A;  1JFF A;  2GHY A;  3CI9 A;  1Q8I A;  2WSF H;  3WG7 B;  3PTZ A;  3V6I A;  5EBW C;  1FAV A;  2F93 B;  3M7M X;  1H0T B;  1X59 A;  4ICG A;  1UFI A;  1SQQ K;  2IDB A;  3OMA B;  3L71 G;  1WJZ A;  2KYV A;  2FFD A;  1S2E A;  2IBZ D;  3H1K E;  3ZMT A;  3T4Z A;  2XUM A;  3C3S A;  5AW2 B;  4X89 A;  3ZN0 A;  1I94 O;  1N0J A;  1HR0 O;  4GX1 A;  2V7Q H;  2O01 N;  1XMQ B;  4GOD A;  2ADP A;  2JVD A;  1S5L Z;  4RKU J;  1YBK A;  5LMN B;  1ZAU A;  5E79 H;  2WSE H;  1S5H C;  2P58 A;  1S3J A;  4QPK A;  1LTT C;  3O6Q B;  4EI2 A;  3QG5 A;  5GON A;  1BSM A;  2Y48 A;  3QWO C;  4X66 O;  1GU4 A;  2OWO A;  2NLJ C;  3H25 A;  5DN6 G;  4YHH B;  4QPJ A;  3CCE V;  1N33 B;  3NTN A;  4GIF A;  4UB6 E;  2A7W A;  2DJV A;  5FPO A;  2E75 C;  2FY8 A;  3L70 E;  5LP6 A;  4AIL C;  4Z1V A;  3M9B A;  3AG7 A;  1QBZ A;  3H1H J;  2ARH A;  1WAZ A;  3HD7 A;  2DYS C;  3FB6 C;  5LGT A;  1W0K G;  1VQP P;  3H1H H;  3B8E B;  3HKC A;  2OTJ P;  3JAK B;  1ROP A;  2DW3 A;  4JI6 O;  1L4A D;  1L0L H;  1FJP A;  4EB6 A;  1PM9 A;  5B5E E;  2HG5 C;  2HG5 D;  3F5H A;  3CCE P;  3VQY A;  1AB3 A;  5BR8 B;  1KFN A;  4C7N A;  2LGW A;  1RQU A;  4AUW A;  3K06 A;  3TDK A;  5B1O A;  3Q4H A;  3H1J G;  3B40 A;  3CL3 D;  1KB9 D;  4HZ3 A;  1LWU C;  2L91 A;  3J80 N;  1L0L K;  2QWP B;  1NH2 B;  1RF0 C;  1AIL A;  1R5S A;  2JGU A;  3K03 A;  2AHZ A;  3MDS A;  1BE3 H;  1J95 A;  4DV6 B;  1P84 H;  3K5B A;  3RK3 D;  1S77 D;  1LT9 B;  4CC6 A;  2ZE6 A;  3IC7 A;  1SQX K;  1F23 A;  5AW9 B;  3FWN A;  1N32 O;  2R70 A;  1AJY A;  3L75 D;  3ASO C;  3LW5 J;  4MS2 A;  4D6T D;  1I0H A;  4AI8 A;  1GL2 C;  2WPQ A;  4X1Y A;  2DQ3 A;  2K9Y A;  1VF6 A;  5CJ0 A;  3G71 P;  4B3T O;  3HKE A;  1HDJ A;  2YC0 A;  5KJ7 A;  1RPO A;  5EBL C;  1KIL A;  1LR1 A;  4GCZ A;  1FE6 A;  1H2K A;  2RCV A;  2Q6A A;  5K1X A;  5L3D A;  2QE7 H;  3CS5 A;  3CC7 V;  4AHC A;  3T1Y O;  2AEJ A;  4I7Z B;  2NN4 A;  4AQR D;  3S3X A;  2PI5 A;  4PD4 I;  4PI0 A;  1LJ2 A;  1R5L A;  1WP7 A;  4TOI A;  4B3R O;  2IFN A;  2NR5 A;  4DR4 O;  3K59 A;  4YIO A;  5IYD O;  2EUL A;  4UB8 Z;  1OCR B;  1S5J A;  4WFB V;  4R50 A;  1F4M A;  3CWB D;  1ZX3 A;  1EDI A;  3CJH B;  1B3Q A;  5KMG A;  2JEU A;  4AQY O;  3ABL C;  1RSO A;  1UJW B;  5B1B B;  2XAJ A;  1MKM A;  3V4W A;  1M8O B;  2A45 G;  2XAH A;  1SFC B;  1URQ B;  3H1K D;  2A45 H;  2OQQ A;  1YIJ P;  4U3F H;  1CW5 A;  2KKW A;  1LT1 A;  4R4M A;  3Q5R A;  3Q5S A;  3VMY A;  2UXN A;  2PTM A;  2C0X A;  2IH3 C;  3VMZ A;  3L72 H;  3WMM 0;  1OV9 A;  1SZX A;  3RK3 B;  4PA4 A;  5E79 Z;  4DR5 O;  1NTM D;  2FB5 A;  2ZVO B;  1DF5 A;  4H13 C;  2I1K A;  1PZQ A;  4EYY Q;  3BCC J;  1QVF U;  1V55 C;  2WA3 A;  1LTB C;  1U7J A;  5KLV D;  2E5L B;  3VP8 A;  3CME V;  1JUN A;  2Q9L A;  1MSW D;  3UIA A;  1JJO A;  3OTF A;  2W90 A;  3ZRS A;  3GF3 A;  2J5U A;  2JO1 A;  3OJA B;  1R73 A;  2E76 C;  1BE3 J;  5LHI A;  1ZL8 A;  1YJ9 P;  3H1L G;  2PAJ A;  4WBN A;  4BAY A;  3H1I J;  1D5A A;  1KB9 F;  3M8A A;  3OGI B;  1SQQ D;  4OWF A;  2GV9 A;  1EM1 A;  4UCT A;  1Y9B A;  3EXA A;  5LMU B;  2HOD A;  2XKM A;  3MUD C;  1FZC A;  3L71 H;  1LTJ B;  1F7Y A;  1BGY J;  2E5T A;  1FZG A;  3L75 G;  3K5M A;  2HLO A;  4UUJ C;  3ZHT A;  2GUZ A;  1URF A;  1BGY H;  3K08 A;  2A06 D;  3V5B A;  5JVD B;  3QVN A;  1EXI A;  5LXT A;  2UUC O;  1K4D C;  3ABK C;  3G4S V;  3KYQ A;  5L3B A;  2CAZ C;  5EK0 A;  2BTQ A;  3SJQ C;  3DC6 A;  2LFS A;  2IW5 A;  1M56 D;  3V2R A;  3RWR D;  1NKN A;  3SPG A;  4WFH A;  5J2T A;  1OCC C;  1V9P A;  2C9N Y;  1WN7 A;  3CCV V;  3LW5 H;  4PD4 E;  1RM1 B;  4W4L A;  2YID A;  2Q7E A;  1GM9 A;  3ABU A;  2Q69 A;  5HFL A;  4DV1 O;  1Y76 B;  4I5S A;  1GN3 A;  1XI1 A;  5EC2 C;  1BS3 A;  1P84 D;  1CP9 A;  1SQV H;  4GKJ O;  2WLI B;  4X65 B;  1JPX A;  2D3O W;  1WA8 B;  4KFM A;  2XU6 A;  2Q7G A;  3SJC C;  3P8M C;  2P4K A;  2CK3 G;  1KTM A;  3TJT A;  1ARO P;  4JI7 B;  4DK1 A;  1L8D A;  4U3F J;  3ZED A;  1L0L G;  2EIK C;  1UII A;  1JY3 P;  1Y4M A;  1Q2N A;  2ZT9 C;  4ZMD A;  3KDP B;  4JI8 O;  2X0L A;  4TV8 B;  1EZV D;  1M93 A;  2A79 B;  5EIB D;  2V1D A;  3ZHR A;  1BZK A;  3KZI E;  1FXH A;  4IT5 A;  3I5D A;  1SQB H;  2JR8 A;  2H89 C;  3RYF A;  1NTZ D;  1LTS C;  3WU2 Z;  1VQL P;  3FX7 A;  4K0K B;  1HW7 A;  3VMX A;  2XND H;  1OCZ C;  1KKC A;  4TWK A;  2HPC A;  4F6R A;  3UM7 A;  5JQG A;  2PYL A;  1PPJ E;  4WY4 C;  2K9J B;  2VWJ A;  3DGE A;  4DV3 O;  1Y74 A;  1MFZ A;  3LSQ A;  5H9C A;  3CCL V;  1T6A A;  4UCO A;  1GW3 A;  3AEA C;  1VQ7 P;  5JH7 A;  2D2C C;  3P3N A;  3ETD A;  2XAG A;  5J2T B;  1QLE C;  1VQ4 V;  1S9K D;  3TF5 A;  3BCC E;  2EZP A;  1RQV A;  4H13 D;  1GN2 A;  1I5Y A;  1BCC G;  2PRR A;  1GN4 A;  1YIJ V;  2QSA A;  2WSE J;  4PI2 A;  3D36 A;  1SQP K;  3TNU B;  1HF9 A;  3CMA P;  2LR2 A;  5GTH E;  2J58 A;  5L3E A;  4R6Z A;  2Q5U A;  1TUE B;  1YI2 P;  1JX9 A;  4K35 A;  2FYU J;  3TGU J;  2I1J A;  1I7F A;  1AR1 B;  1KZU B;  2IBZ H;  1LTJ A;  4JI4 O;  1W2B O;  1BSN A;  1X8Y A;  3B71 A;  1SQP G;  1K5Q A;  2E74 B;  4G2K A;  1SQQ G;  4UCU A;  4RQF A;  1EN6 A;  1LTA C;  2R9I A;  2ZM6 O;  1L0N G;  2BCC E;  4I0X A;  4MN4 C;  2CGN A;  2YIB A;  4GX0 A;  4UCV A;  4LF4 O;  4M3L A;  1X22 A;  1L0N H;  1N4C A;  1NTM H;  3H1L J;  1QQC A;  1D2D A;  4DT0 A;  1TU3 F;  3IN6 A;  1WPB A;  2KS1 B;  2XZR A;  4B3M B;  3QTC A;  1VF5 D;  2A06 E;  1PNM A;  3RYC B;  4C7R A;  3ZRW B;  3K9S A;  1YHQ P;  1OX3 A;  5DJT B;  5LOV B;  2KXP B;  3G3Z A;  3W7U A;  4ASW A;  3FB5 C;  3A8T A;  4XA4 A;  1N32 B;  1T8Z A;  3TGU G;  3CP1 A;  4QE7 A;  3WUT A;  1IFI A;  1GW4 A;  2BE3 A;  4HNA B;  1PD3 A;  1UPG A;  3L35 A;  4BIO A;  3AG2 C;  2VS0 A;  5E1A C;  3TET A;  1PGO A;  1K5S A;  1WPX A;  1AFO A;  1NWQ A;  1M1K Q;  3RBZ A;  1SP4 A;  5LL6 Y;  1ZWI C;  2O01 J;  4DW0 A;  3TNU A;  3JD1 A;  1ZP0 C;  2K9P A;  4NTY A;  5H6Q A;  1UIX A;  4U7J A;  4FZ1 A;  1MMM A;  3VBB A;  4DR7 O;  2DMX A;  4RUE A;  5KMG B;  1XTC C;  3CB2 A;  3IFX A;  2QSI A;  2AXT Z;  2OIE A;  1L0N D;  2UXC O;  5JJN B;  3ETG A;  2JJ2 G;  1CEZ A;  4JTD B;  1SQP H;  3SPJ A;  1SQF A;  3UCS C;  1NAY A;  1SQX E;  2BCC J;  1K33 A;  1YIT P;  2AGA A;  1SS3 A;  4RQE A;  2V7Q J;  2W0X A;  4B3T B;  2HP8 A;  4LFB O;  1NTM G;  5KLV K;  3BAA A;  1X0T A;  4WFE A;  1KBH A;  4DUZ B;  3JAW B;  5CBH A;  1SQX G;  4J9Y B;  3CRC A;  4TV8 A;  3F5T A;  4BWA A;  3U0Z A;  3FXD A;  3SWY A;  4L76 A;  2QJP B;  1HNX B;  3A5T A;  2P06 A;  1GL2 B;  4G27 B;  4DR1 B;  1M57 D;  2O57 A;  2IZ1 A;  3KHU A;  1QVF O;  3SDL A;  4J7J A;  1FZF A;  3ZCC A;  1KKD A;  1OW7 A;  3H1J E;  2M8R A;  5BU5 A;  3B5N C;  4JGS A;  2LFR A;  1NTK D;  5L3F A;  2YIU B;  1VQM V;  3UT5 A;  3T1H B;  2QWN B;  2WLI A;  4LFB B;  5DED A;  5EYP A;  1YVW A;  1Y76 A;  4I7Z C;  2IH1 C;  1N73 A;  5GTI H;  1FYJ A;  1NHL A;  1HNW O;  1JMM A;  3CCU V;  5KHH A;  3LNN A;  2ZCE A;  5ITZ B;  5KHK A;  3BAT A;  5D5P A;  3CCQ V;  4C7N B;  5CA1 A;  2QA4 V;  1H88 A;  4WY4 D;  1OVV A;  2E5Y A;  4X1I A;  2B5U A;  4D6T G;  2Q4P A;  3CRQ A;  3LID A;  5LXT B;  3AE8 C;  1Z5W A;  1NAF A;  3JAK A;  2QKS A;  4G28 B;  1L1F A;  5LHG A;  4IYI A;  1XTG B;  1T2K C;  2GUZ B;  4DUY B;  3RBX A;  2FKW B;  3AG1 B;  3GG2 A;  1FXK B;  5BZB A;  3NR7 A;  1JOY A;  3AEF C;  2X7R B;  1SFC C;  2HEP A;  3GHG C;  3H01 A;  2Y0D A;  2E74 D;  3J81 N;  4UXN A;  3L73 E;  5KJ7 C;  1LGH B;  1OJH A;  4KXR A;  5AVZ B;  1Q81 Q;  2X6A A;  2OIG A;  4OGQ D;  3TSI A;  3RK3 C;  3E8G A;  3CYO A;  3HRN A;  1L0L J;  1W59 A;  4H13 B;  3OE7 G;  1FC2 C;  1BCC H;  3K3W A;  3PN1 A;  3ZRX A;  1GK9 A;  3C8V A;  3KCX A;  5HFM A;  2PGD A;  2Q8V A;  2WWW A;  1QU7 A;  1VAR A;  2WA4 A;  1GMJ A;  5H2F Z;  2N05 A;  4I55 A;  2Y0E A;  4IL6 H;  2Q1K A;  3T1H O;  3AG3 B;  4TT3 G;  3RYI B;  2ZNJ A;  2JJ1 G;  2WTY A;  1NU1 D;  1YEW A;  2B87 A;  2IBZ G;  3M0D C;  2V7Q G;  3L71 J;  1NQT A;  5A2Q N;  1H0T A;  1Q86 W;  3W7S A;  1PP9 D;  1H89 A;  2PUS A;  1BL8 A;  4MVO A;  1U7M A;  5TIS E;  4I6M C;  1SQX J;  1YCI A;  3U11 A;  2ZD9 A;  1A32 A;  4B3R B;  3JC2 2;  5B66 E;  1SQB E;  2KIK A;  3BFR A;  1NVP D;  5CBO A;  4EOT A;  2N04 A;  3OFN G;  2KG7 A;  2Y0P A;  4YJ2 B;  4I50 A;  5AW6 B;  3CLQ A;  3JSN A;  4X65 O;  1XDC A;  2UU9 B;  1YYC A;  1OHH G;  2IBZ I;  3AE4 C;  2E75 B;  3H1H G;  3CC2 V;  3P8C E;  2UXD B;  1JA8 A;  1A02 J;  3DTU B;  4B08 A;  2KZJ A;  4L87 A;  5LGU A;  4DV2 O;  3ZRW A;  1E1Q G;  1FJK A;  4ZKI A;  2CTQ A;  4MVZ A;  4WY4 A;  3L75 E;  5BVZ A;  1K92 A;  4X1K B;  3MHH C;  3OM3 B;  3SSU A;  1S72 P;  1R6N A;  2BEQ D;  2H8P D;  1JR9 A;  1USD A;  4X66 B;  3P30 A;  3BEH A;  2R3C A;  2Z5H A;  3SJB C;  1QR8 A;  4PDM A;  4I0X B;  1K04 A;  1SKV A;  3AK3 A;  2EJ7 A;  1MZE A;  4JAV A;  2EIK B;  1J2J B;  3IGA C;  1XUQ A;  4I50 B;  1KC8 W;  2LJ2 A;  2KSE A;  4RES B;  3PH0 A;  3OW2 O;  1MOF A;  3CD6 P;  4MTG A;  2CTR A;  1NTZ E;  1B06 A;  2CE4 A;  2F66 C;  2KK7 A;  3OA7 A;  4YY3 O;  1AVO A;  3ZHQ A;  4UVC A;  1IO4 A;  1PGP A;  4I9W A;  2JP3 A;  3JAM N;  1G6U A;  1IFD A;  1OCZ B;  3TK1 A;  3CCM P;  5KAF E;  1SQP J;  2K1E A;  1FU1 A;  2WIT A;  1NZ6 A;  3RYH A;  4KHP B;  2OCC C;  4GDO A;  2DYR C;  4DYL A;  4BWN A;  3RK2 C;  4FLT A;  1Y8A A;  1GTO A;  2EIM B;  3JD4 A;  1AQ5 A;  4EB6 B;  5JJE B;  1QVG U;  3A0R A;  4JI4 B;  5AW7 B;  4MW8 A;  1KOR A;  5KUM A;  4IL6 X;  2KSJ A;  2Q0A A;  1PV3 A;  2HJD A;  3H6P A;  5KHI A;  3JD3 A;  1P4R A;  1V54 C;  1IVS A;  1E79 H;  4YTP C;  2BAS A;  2VQF O;  5CBN A;  2HPC B;  1Y6X A;  4FJC C;  2OYH B;  4A5U B;  3W7X A;  4H44 B;  1E1R G;  2A9H A;  4EFB A;  3Q2Y A;  3K5L A;  4PV1 D;  4LF8 B;  4LFA B;  4PV1 C;  1K73 Q;  1H2N A;  1IBK B;  4QE9 A;  4GX5 A;  1SQV K;  1PPJ G;  5KUK A;  4DV2 B;  3H1J H;  1WB8 A;  4O4H A;  2XT9 A;  4ZKU A;  1M56 B;  1IXM A;  1VEW A;  2Q6Q A;  4N3Y B;  4PA9 A;  4H33 A;  1KB9 H;  2E74 C;  1K4C C;  2YXH A;  3OTO O;  1HGZ A;  3U1C A;  1LP1 B;  1PKX A;  5APV A;  2ILM A;  2CGO A;  2QJ1 A;  4DR3 O;  4N78 E;  2JGD A;  3N2G B;  2UXC B;  4EKW A;  4KJM A;  4WWI A;  1OZH A;  1PL0 A;  3O8Z A;  5FLX N;  1J5E B;  1RHZ B;  1KC8 Q;  2FXP A;  2VWK A;  2VQF B;  1DEB A;  4I1L A;  1W0J G;  1NTK H;  2P5O A;  4BR6 A;  1SA0 A;  3WB0 A;  3II6 A;  1GD2 E;  2AZ2 A;  1G2C B;  2C2A A;  3PLN A;  1WA8 A;  3AE6 C;  1I08 A;  3MD0 A;  1NVO A;  1T3U A;  2FFD B;  4JI1 B;  1VP7 A;  3J7A U;  1K05 A;  4MVQ A;  5CMZ A;  1YSC A;  3AED C;  5AVV B;  3CWB J;  2CK3 H;  2YS8 A;  3X2Q C;  2YMY A;  1SQP E;  3USS A;  2G3A A;  1KD1 Q;  2QE7 G;  3GB7 C;  1JFF B;  2EX3 A;  1ZTE A;  5AVR B;  1IBL O;  3LDE A;  2B1G A;  2E75 D;  4HB1 A;  2Y69 C;  2BTQ B;  5L3C A;  1ZOY C;  3F5W C;  1GH6 A;  3SYC A;  2UU9 O;  2WLH A;  2NPS C;  4OPH A;  2ZJS E;  3UT5 B;  1G2C A;  4NXM B;  5AVX B;  3FB8 C;  3AG2 B;  3L74 H;  1NI8 A;  5M1B A;  2R32 A;  4DV4 B;  1EXJ A;  1MG1 A;  3E8B A;  3L74 G;  2R44 A;  4AQY B;  3VOP A;  3KZI H;  1NTM J;  4F6E A;  2QDO A;  3R2P A;  5KLV J;  3LDC A;  1BGY G;  3CCV P;  1N7L A;  3B09 A;  4LF7 B;  3GHG A;  3JAW A;  4K8Z A;  4LFC O;  4DV7 B;  3L74 E;  3TGU E;  1LTJ C;  1NJI W;  4JTC B;  4FLU A;  3ZHS A;  3F89 A;  2H8P C;  2JJL A;  4OH8 B;  2N9Y B;  1RE3 C;  2K3R A;  1K9M Q;  3D36 C;  2N9B A;  2YKO A;  2JS3 A;  5B1A B;  1VQ8 P;  3THO A;  1Y66 A;  5B3S C;  1XNQ B;  1VMG A;  2KLU A;  4UVB A;  4JAA A;  3UKM A;  1VQK V;  3CRM A;  3I55 P;  2YO3 A;  1KIL C;  5EBM C;  3U10 A;  1SQV G;  3EVK A;  4IIJ A;  1PV0 A;  4BW5 A;  4ZI7 B;  4UB6 H;  1E79 G;  4UB8 E;  2IM9 A;  3E86 A;  3SYA A;  2QJP C;  2ZVN B;  1VF6 C;  4MVM A;  1GN6 A;  3G9R A;  2QWQ B;  2B9Z A;  2YO2 A;  2W83 C;  2ZDI C;  1R3I C;  1Y47 A;  1H8A A;  3GF7 A;  2GDS A;  2Q9I A;  1AP5 A;  4YXD C;  1IBL B;  1JTH B;  2UXB O;  1N7S D;  3RL0 B;  1DGS A;  4LF6 O;  2Q73 A;  1YXB A;  2ZT9 B;  1N86 A;  4FM0 A;  3AE5 C;  2Z4E A;  1BE3 E;  1KQG B;  4GYC B;  3SYP A;  2FKX A;  4LBE C;  3ABM B;  1KYO E;  1SRY A;  3L75 H;  2XND G;  3CJH A;  1WLE A;  1XMO B;  4YXW H;  2IFM A;  1FS0 E;  1Q6U A;  5B66 Z;  1QL2 A;  2OYI B;  2MKV A;  3SPH A;  4E4E A;  1AI7 A;  1QEX A;  1FDO A;  4N78 D;  2OYQ A;  4NTX A;  4JI7 O;  4RAI A;  1HTL C;  2IJJ A;  3T97 A;  1FKA O;  4HJG H;  4U3F D;  4WY4 B;  3CCJ P;  2Z3Y A;  1BQZ A;  1FS0 G;  2F23 A;  2DWD C;  4LNU A;  2FTK A;  2IYO A;  1N33 O;  1CI6 A;  1EZV I;  2QJY C;  2EZO A;  4ABM A;  2IX7 C;  1EDJ A;  4IFF A;  1JB0 J;  2P4V A;  2Q68 A;  1KQL A;  3CWB H;  1W2E A;  1N2D C;  2M7W A;  1NTZ J;  3AE1 C;  1K34 A;  4DZO A;  1AR4 A;  4YJ3 A;  2C9L Y;  1MZ9 A;  1NTZ H;  3TXQ A;  3F7Y C;  5BY1 A;  2RH0 A;  1SQB D;  1E5W A;  2AW9 A;  1QCE A;  3JCU H;  3ZMV A;  1T2K D;  3AG3 C;  1FZE A;  1JEK A;  4JYY A;  4IGG A;  3FAV B;  4UFZ A;  3RVZ A;  2XV5 A;  1QNM A;  3Q4H B;  1XHX A;  1U57 A;  2WPD G;  4WF9 V;  5KLV E;  1NGM B;  2JK5 C;  4MTX A;  1Y74 B;  3MHS C;  3KPE A;  2WLM A;  1M4U A;  3BAB A;  2UWJ E;  4F6R B;  3OEE G;  1X79 B;  4H0L D;  5LYJ A;  3L72 G;  3CD6 V;  2B87 B;  1VQK P;  2WSC H;  2GSM B;  2ZT9 D;  5EC1 C;  4F4L A;  3JAR B;  1Z56 A;  2L35 A;  1AA0 A;  3TGU D;  4PA3 A;  1SA0 B;  1XHZ A;  1SES A;  1J1D C;  1N7S B;  1Q43 A;  1G1J A;  1PIX A;  3IR9 A;  3PP5 A;  2XAS A;  3FKS G;  5AVW B;  3HE4 B;  2YXL A;  4NPD A;  5GTH Z;  2HFE D;  2HFE C;  3L72 E;  3AE3 C;  2IBZ E;  1LP1 A;  3HE5 A;  4I4T B;  1LUV A;  4CS4 A;  1GM8 A;  2ZM6 B;  4W7Y A;  4H0L C;  5APW A;  3BVH A;  2QVA A;  4LH7 A;  4JF7 A;  2Q7C A;  2GTS A;  2KLV A;  3N2K B;  1TAE A;  4PD4 F;  2XNX A;  4NPF X;  3A2F A;  4L8J A;  2A06 H;  4RWU A;  2VRZ A;  2H88 C;  1FOS E;  1JY3 O;  2ZYD A;  3D8C A;  4R7C A;  4HBN A;  3GMA A;  2H3O A;  1YZB A;  1IUR A;  3L36 A;  2O1K A;  2FYU E;  4RO2 A;  2GM4 A;  4J80 A;  2DW4 A;  3A0B Z;  4FVM A;  3ZMS A;  2V4H A;  1YTF D;  3MHV A;  4U7O A;  2UUA B;  3FGA D;  1S0V A;  4JV5 B;  2NZ2 A;  4GKK B;  3SFD C;  5CBG A;  1KYO D;  2KB7 P;  5ITZ A;  1HNZ O;  1RE3 A;  3JCZ A;  4JZG A;  1YJW V;  1HVV A;  1YIT V;  2ZAE B;  1TVK B;  4JI0 B;  5K5G B;  3E8H A;  3OR6 C;  2WSS H;  2NRG A;  4LWS A;  3L70 G;  1I5X A;  5IYC O;  2WSS G;  4XDJ A;  5KA6 A;  3E35 A;  4W80 A;  2E76 D;  1JY2 P;  2XAQ A;  2AXT E;  4N21 A;  1G8M A;  1QHT A;  2X6B A;  3IC9 A;  2ZYA A;  3JCU E;  3E83 A;  1K3E A;  2DYR B;  1ZL8 B;  1OW6 A;  3M0D A;  2O01 H;  1Q90 D;  1DK1 A;  2YKQ A;  2FXO A;  3PJS K;  5IT9 N;  1N8R Q;  3E22 A;  2WPR A;  1AP6 A;  2POH A;  3P32 A;  4LF9 O;  4XBF A;  4X1K A;  4MT8 A;  1V54 B;  1Q7Y Q;  1KD1 W;  3K0D A;  2KB1 A;  2A45 I;  1LWU A;  4GUN A;  1N36 B;  4ZIB A;  2OYH C;  2UXX A;  2K37 A;  3IFM A;  1SER A;  3L70 J;  3DXR A;  1LTG C;  4JI0 O;  1Q6H A;  3D70 A;  2HJF C;  4X9Q A;  1M56 C;  3KKY A;  3AEC C;  3G71 V;  5APT A;  3H9V A;  2ZXE B;  4X64 B;  1NTK J;  2YNY A;  3CPW O;  4X20 A;  1DLB A;  3ZHU A;  1XMQ O;  4CC5 A;  1A02 F;  2W6B A;  3A0H H;  1X9V A;  1HNZ B;  3A2A A;  1FXK C;  4FPP A;  1SFC A;  1M57 B;  2ADQ B;  1NKD A;  1GM7 A;  3FYI B;  2Z0A A;  3MUD A;  2R5D A;  1FZC C;  5AVY B;  4H44 D;  4HH2 A;  4ZHQ A;  2KI7 B;  1NO4 A;  3M9H A;  3B8M A;  1JMK C;  5L8R J;  1M5I A;  1IXB A;  2Y4T A;  3T1C A;  2JS5 A;  2FFD C;  3TCU A;  3DSQ A;  1Z5V A;  3G6B A;  4O4L A;  1KFM A;  2PF4 E;  1PL4 A;  1Q82 Q;  1N34 B;  1SET A;  3X2Q B;  2AXC A;  3AEG C;  3NMD A;  3FD9 A;  1S4X A;  4NXN O;  3CCR P;  2YIA A;  2KSD A;  4UV8 A;  3OMI B;  3P3P A;  1DH3 A;  2ZXW B;  3GVM A;  2LXC B;  1DD3 A;  3MTU E;  3S1K A;  2FL4 A;  2Y69 B;  4O4I A;  3CE2 A;  4NKG B;  3IAO A;  5CCH C;  4O4J B;  3ITK A;  3WUV A;  2NPS B;  1FD9 A;  1PP9 H;  4EFE A;  4DR2 O;  2OYO A;  1F4N A;  2YXY A;  4D7S A;  1VQN P;  2AEM A;  4MVR A;  1N36 O;  2Q3I A;  1JCH A;  3BHP A;  1G1I A;  5APS A;  4IFD K;  1KYO F;  5BMV B;  2GUS A;  3Q1M A;  2JEE A;  1G4Y B;  4TV9 B;  3A0B H;  1OCO C;  2V4D A;  1L0L D;  3ICX A;  3E7K A;  3EQ2 A;  4OXS A;  3RN4 A;  1Q7Y W;  1H2S B;  4JYA O;  2R9R B;  1HR0 B;  2N1T A;  4O4I B;  5CN0 A;  3G6E P;  3ETQ A;  3O9O A;  2BSK A;  4LC1 A;  1NYH A;  2RKL A;  2YUA A;  2FXM A;  2LW7 A;  2E3C A;  3JSV C;  4HYT B;  1K8A W;  2UUA O;  2P7T C;  1TVK A;  2P22 C;  1H8H G;  1EN4 A;  3WB2 A;  1SQQ E;  4X62 O;  4C7U A;  2FBW C;  5J2U A;  1L0N E;  2ZNI A;  3FWL A;  4WB4 A;  5B1A C;  1JO5 A;  4X1I B;  3BVO A;  5CCG D;  2PFX A;  3V2N A;  5CA1 B;  3H32 B;  1JCC A;  2IJI A;  4XDL A;  4OX9 B;  5B66 H;  1SQX D;  3JSL A;  4CH4 A;  2HHH B;  4PA7 A;  3VYI A;  2CTP A;  3H1L E;  4IFM A;  3K9A A;  4Q20 A;  1SQV J;  4OPA A;  1H2L A;  2A06 G;  2G8Y A;  3HD7 B;  2GA1 A;  3B2E E;  1EZJ A;  1PL5 A;  2LP7 A;  1QR9 A;  2PI4 A;  3RW0 A;  1NTK G;  4DV1 B;  2D2C D;  1K7D A;  1NH2 D;  3FFQ A;  1RFY A;  1SS1 A;  3RL0 C;  3WUU A;  4GX2 A;  3BCC H;  3HR0 A;  5GON B;  3NXS A;  4TSF G;  2YI8 A;  1SQV E;  4I4T A;  3O6Q A;  4JPR A;  1IBK O;  1NTK E;  4K8X A;  3VQW A;  3ABM C;  4DV0 O;  5KAF Z;  2FYN C;  5TJH A;  3R66 A;  3ZJZ A;  4U3J A;  5F2V O;  3K57 A;  2XOK G;  5B5E Z;  1JY2 O;  5DJU B;  2OYI C;  1RF0 A;  3ASN C;  4X8A A;  5IY5 C;  1AVM A;  3SR2 C;  4DOJ A;  3JAR A;  4B86 A;  3AE9 C;  4IOI H;  4IHJ A;  2E5L O;  1OVU A;  3SPC A;  4R8C A;  2GTA A;  4FLX A;  4JI3 B;  2OAR A;  2OCC B;  1IFN A;  5BU8 B;  4MTF A;  4MVU A;  1WB7 A;  3AEE C;  3RK2 B;  2YXR B;  1VL2 A;  1BDC A;  2EIM C;  3RGB A;  2X6C A;  4MW3 A;  5C8Y A;  3IF4 A;  2PZS A;  2Q3E A;  4X62 B;  3RFR A;  3E2E A;  2HR3 A;  1NTZ K;  4Z1M H;  4H44 C;  1YJN P;  4JI5 O;  3K5O A;  4PV1 B;  2HLD G;  1RE4 A;  2VRS A;  1XNQ O;  1SQP D;  2ITA A;  4GZR B;  3L73 D;  3HD7 D;  3ZS8 C;  4C46 A;  1RPR A;  3WB1 A;  1KV4 A;  3CCL P;  2K88 A;  1ORQ C;  3OT7 A;  3CCS P;  2H43 A;  3C90 A;  3UO2 A;  3CC2 P;  2YEV B;  4Y28 J;  5GTH H;  3S4R A;  4FMT A;  4JAU A;  3HUS B;  1BT8 A;  1Z2G A;  4X64 O;  4E2L A;  3SGI A;  4DV7 O;  1EQ7 A;  3FB7 C;  4WBN B;  2FYZ A;  4N23 A;  2M3B A;  4O2A A;  5LHH A;  2E42 A;  1S5L X;  4JV5 O;  3NFQ A;  5LGN A;  5LA6 A;  2FYU H;  4LF9 B;  2WPV B;  3CCR V;  4GKG A;  3BA9 A;  1J1D B;  1N7S C;  2QEX V;  2RN0 A;  3JD2 A;  3QO5 A;  2L6L A;  5J9P C;  2P7J A;  5JWP A;  3BRT B;  3BY6 A;  1DD4 A;  1OW8 A;  3O65 A;  1YQ4 C;  1J1E C;  1EFR G;  2EIN B;  2ITC C;  4LLH A;  3W7W A;  1RH5 B;  3BPZ A;  3D3I A;  1SQB K;  1N73 C;  1JJ2 U;  5A9G A;  4UB8 H;  1JTH A;  5LYJ B;  1P84 F;  5DM6 V;  1QLE D;  4DV3 B;  3L73 G;  1MSD A;  5AVS B;  3CHX A;  4DRX A;  3OAA G;  1GKF A;  5L3G A;  1Q81 W;  1KUQ A;  3B5N A;  3RL0 g;  1R6K A;  4J41 A;  4KL1 A;  3LSU A;  3MAQ A;  1K73 W;  1URQ A;  1ZW0 A;  2W27 A;  4GOF A;  4Z1M G;  3MGN A;  4LR3 A;  2Y9Y A;  4JQ0 D;  4D7T A;  1BCC D;  1JMB A;  4P9O A;  2B89 A;  1HH0 A;  1JNM A;  5JCO C;  1L0N K;  1HJB A;  4DR3 B;  5CCG C;  3EFF K;  3TGU H;  5APX A;  1RE4 C;  1LNQ A;  3UQ8 A;  5EFW B;  4ASU G;  2W6J H;  2R72 A;  4QNH B;  5JQG B;  5K1P A;  3HB3 B;  2KNC A;  1T5E A;  2M5A A;  2KQX A;  3FXE A;  4H37 A;  3K04 A;  3IAY A;  3M0A A;  3C3T A;  2QM4 A;  3JAS A;  5KLI C;  5B5E H;  2FML A;  3B4S A;  5B3S B;  4FLY A;  2FYU G;  1KYO H;  1KIL B;  5FL7 G;  3QO7 A;  2UUB B;  2BOB C;  4J10 A;  3I56 P;  1M1J C;  1R3J C;  3T97 B;  2J59 M;  1TUB B;  4ZNC A;  3STL C;  3OMN B;  2K1A A;  1YTF B;  4KT0 J;  3MP7 B;  1SQB G;  5IJ9 A;  5KKZ B;  2B9B A;  1IK7 A;  1RF1 C;  2CH7 B;  1D5N A;  4XDK A;  4J9Z B;  5CB4 B;  3MIW A;  1I94 B;  2GBO A;  4BIU A;  1WMK A;  2UUC B;  1P7G A;  1NU1 G;  4FZ0 A;  2Q0O C;  3CX5 E;  3G80 A;  2ZXX A;  1AI5 A;  4QGP A;  2KOG A;  2LKM A;  3ZX6 A;  4YY3 B;  3LUT B;  4IYH A;  1OIP A;  2JKV A;  2Z5I A;  4Y99 C;  1NTM E;  2YIC A;  2QR4 A;  4B7E A;  1D7M A;  4TQF A;  2QRX A;  3GW6 A;  4QJF B;  1NKZ B;  1HUC A;  4PA6 A;  4JAS A;  3OW2 U;  1GMG A;  2LO1 A;  1SVF A;  5CA0 A;  4KHX A;  4RJT A;  4R4L A;  2YKP A;  4YIP A;  5JVD A;  1BMF G;  1VQ5 P;  1KIL E;  1EDL A;  5AVU B;  4IIJ B;  1US6 A;  3CPW U;  1USE A;  3ABT A;  1L4A A;  2JGD B;  5IWA B;  1FZC B;  1VQ9 V;  3CX5 F;  1JM0 A;  4CH6 A;  1ZSP A;  2QJY B;  4UCR A;  1NR1 A;  1ZV8 A;  3A7O A;  1NTZ G;  2P1J A;  5GTI E;  1YQ3 C;  2PGG A;  4BIZ A;  5LBQ A;  5CBF A;  2HVJ C;  1IX9 A;  5LA6 B;  4JYC A;  1YTZ I;  3APO A;  2JDI H;  3HTK B;  1OFC X;  3JAL A;  3DC5 A;  1AI6 A;  4KHP O;  4QIW F;  3HTK A;  4O2B A; 
#chains in the Genus database with same CATH homology
 1FDI A;  3S9O A;  1NGM B;  1ZME C;  3D70 A;  2D2C D;  2K9Y A;  3AEF C;  1VF5 D;  3AEC C;  2QJK C;  4H0L D;  3D6Z A;  2E76 B;  2E74 D;  2JP3 A;  3O6Q A;  2ZT9 D;  3Q5P A;  2FYN C;  1PIX A;  4I7Z B;  4OGQ D;  3D6Y A;  4GDO A;  4H13 B;  3AEB C;  3GLM A;  4H44 D;  3AE3 C;  1KMI Z;  1KQF B;  3C8V A;  3AE9 C;  1KOR A;  5L8R J;  1ZRT E;  4H0L C;  4IL6 X;  1GMJ A;  5KLI C;  1KTM A;  1PV3 A;  2QJP C;  2O01 J;  4YTP C;  3G9R A;  1ZP0 C;  2IDB A;  1UIX A;  3AE7 C;  4U7J A;  2ZT9 C;  3AEG C;  3AEE C;  4H44 B;  4XFJ A;  1VL2 A;  3Q2Y A;  3AE2 C;  4PV1 C;  2H88 C;  2QSI A;  3GF7 A;  4PV1 D;  1MKM A;  4YXD C;  1DD3 A;  4H0L B;  3T97 B;  3GMA A;  2QIW A;  2H89 C;  3R4Y A;  4RKU J;  3IAO A;  1VF5 C;  4KT0 J;  2D2C B;  2OQQ A;  2ZT9 B;  1IK7 A;  3AE5 C;  1OMI A;  1KQG B;  2E74 C;  4Z1M H;  4R4M A;  4H44 C;  3Q5R A;  2WQY C;  4PV1 B;  2V7Q J;  3Q5S A;  2WSF J;  3H25 A;  1WMK A;  3FGA D;  1R8E A;  2NZ2 A;  4OGQ C;  3Q1M A;  3AEA C;  2E75 C;  2FXP A;  2MKV A;  4H13 C;  3SFD C;  2D2C C;  5KKZ C;  2YIU C;  4Y28 J;  1FDO A;  3AE6 C;  2WSC J;  1RQV A;  3ABV C;  4H13 D;  1K05 A;  2BEZ F;  1NYH A;  2WSE J;  3AED C;  1HF9 A;  3SFE C;  4OGQ B;  3AE4 C;  3D71 A;  1OW7 A;  2E75 B;  3GF3 A;  1S5L X;  2J5U A;  2G3A A;  2JO1 A;  1S1C X;  1HJ0 A;  2QJY C;  2E76 C;  2E76 D;  4R4L A;  2FBW C;  2WPV B;  3EWK A;  2E75 D;  1JB0 J;  2P10 A;  1RQU A;  4I7Z C;  1VF5 B;  1ZOY C;  1KIL E;  3AE1 C;  3B71 A;  1DIP A;  1OW6 A;  2E74 B;  2BEQ D;  3RK3 E;  1Q90 D;  1DD4 A;  1OW8 A;  1YQ4 C;  3Q3D A;  5M1B A;  1Y9B A;  4TT3 H;  1EXJ A;  1YQ3 C;  1K04 A;  2G8Y A;  1TU3 F;  1PL5 A;  2YMK A;  1AJY A;  1EXI A;  3AE8 C;  3IN6 A;  3LW5 J;  1U57 A;  3RL0 g; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...