4I7ZB

Crystal structure of cytochrome b6f in dopg, with disordered rieske iron-sulfur protein soluble domain
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
159
structure length
159
Chain Sequence
b'ATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Lipid-induced conformational changes within the cytochrome b6f complex of oxygenic photosynthesis.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 38
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2012-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4i7zB02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4i7zB01
2QJYC 5KKZC 5L8RJ 2E75B 4IL6X 3LW5J 3C8VA 2QJKC 4Y28J 2D2CB 4PV1B 4RKUJ 2E74B 2ZT9B 2WPVB 1ZRTE 1S5LX 2WSEJ 2WSCJ 2YIUC 2QJPC 4H44B 4H0LB 2QSIA 2FYNC 1Q90D 2K9YA 2O01J 2QIWA 2WSFJ 2E76B 4KT0J 5KLIC 4H13B 1VF5B 4OGQB 1JB0J 4I7ZB
chains in the Genus database with same CATH superfamily
2M5AB 3II6A 2IU3A 3V4QA 1NYHA 2CTWA 5E79H 4U3JB 2EINC 2X6BA 4WY4B 3GLMA 3B40A 2QTOA 3E1IA 1EM1A 1MZFA 1AI4A 4PDVA 4JI1O 3ZIAG 2P58A 3NFQA 5IYDO 1PZQA 3BA9A 1X8YA 5CHXA 2O01J 2NPSC 1SRYA 2PF4E 2W83C 3SWYA 2VWKA 2BCCH 1M57B 2EINB 4DK1A 3D6YA 3A0HH 4DXWA 3B4SA 1NTZH 5KTBA 3P8CD 1PL5A 1RPOA 4PDMA 1KECA 3IFMA 4X1KB 1N7SC 2UXBO 1AJPA 1RPRA 4PDLA 1VQ9V 1VQLP 1PPJE 2WSCJ 5AW2B 1NGMB 1CI6A 2ZDIC 1M9NA 1R3JC 3HKEB 4JI0O 1G1JA 3H1LG 5H2FE 4A7PA 4YTPC 2CDYA 1E79H 1HWYA 3ZEDA 2WAMA 4FMTA 1TUBA 1NKDA 2NRGA 1XREA 4EDFA 3K57A 2IJJA 1BSHA 2N9YB 1PV0A 3CCSV 3WU2E 1N7SA 1OCZB 2KIKA 3ZS8C 2SPZA 1JJ2U 4PJ0H 1M1JB 3R2PA 5JVDA 3OW2U 3G6EP 2VS0A 1YVWA 4X1YA 3SPJA 3APQA 2W6JH 4R4LA 4O2AB 1RE4C 1L8DA 2LW1A 2ZIOA 4DR3O 2CGOA 5A2QN 1L2PA 3OT7A 1E1RG 4UB8H 3AG3B 3OTOO 2QR4A 4MT8A 4U7JA 3FAVA 1EN4A 2GSMB 1OWAA 4JBZA 1YJ9P 1S0VA 5KAFH 4EFEA 4DRXA 4I7ZC 1NT2B 1XQ8A 2C9LY 4J7KA 3TSIA 2NPSD 4KHXA 1YI2V 4PD4F 4FLXA 5CCGA 1OW7A 3SDLA 1AI6A 1M56C 5AVTB 2IZ0A 1BCCD 3RK2C 4TLFA 2CAZC 2JRIA 3CWBG 4RWUA 4HYOA 1H38A 3KCYA 1Y74A 1GTWA 4X66B 5AVWB 3L72G 2IJHA 5IJ0A 2M7WA 1H8HG 1AP6A 1N7SD 3M9QA 2WWWA 3NTNA 3Q3DA 2R3SA 1DIPA 2AXTE 3U1CA 3PTZA 4NB5A 1JMMA 3OR7C 1VQ5P 1YJNP 1M5IA 5IWAO 2MKVA 5KAIH 1XI1A 1M4UA 1OJHA 3K5LA 2UXXA 3M99B 1VF7A 2HLOA 2N04A 4JI6O 4LF5O 2IFMA 3RYIB 2ZXEB 4B3RO 1MFZA 1B3QA 3OGIB 4DR5B 4GLXA 1XHZA 1QVGU 2M5AA 4XA4A 3RGUA 3VTPC 1F51A 2ZR2A 4OXSA 1NTKG 4U3JA 2E76B 1FZAA 1FXHA 5BU5A 4I9WA 4WY4A 1SLQA 1FFTB 2HHHO 1U7MA 3ZHSA 1YHQP 1F7YA 2J58A 3ZRVA 2IZ1A 3WU2Z 1USEA 3BRCA 4IL6X 4ZBMA 1P49A 2ZJSE 3B5NC 3JASB 2VRZA 4DV3O 1Q5OA 2WPRA 2ZIMA 3CD6P 3ZHUA 4F4LA 4LFBB 1NTME 3BRTB 1R73A 2OCCB 4DV1O 1IVSA 2O01H 1M56D 4DV6B 5GTHE 3RK2D 2QE7H 2EIJB 3CCRV 4R50A 4X1KA 5B3SB 1R6TA 4OX9O 1KORA 4GT1A 3JSLA 1BHBA 4CZZA 3BCCE 2V4DA 3HKEA 1AI7A 2ZVOB 2W6BA 4O4IB 1N33B 1B06A 1ENVA 2IM9A 4PA7A 3JSNA 3WB1A 3SPCA 4GDOA 3HKCB 1VQ7V 2WSCH 1YIJP 4GODA 4JZ2A 2HEPA 3APOA 3MUDA 4LF4B 1M1JA 4ZKUA 4JI8B 1XL4A 4LF6O 1N8RW 3ZHRA 2QTSA 5JJEB 5JH7B 1URQC 3HPLC 2G8YA 3ABVC 2OARA 2YKQA 4AI8A 4HB1A 4ASUG 1KD1Q 4O2AA 4DK0A 4AQYO 1Q81W 2PY5A 2ZXXA 2EX3A 3LDEA 1NH2B 2WA4A 1S5LH 1EN5A 1JY3O 1QBZA 1VQKV 2YO3A 1EQ7A 3HUSB 3L71E 5IDJA 2X7RB 4PD4I 1GTOA 2HFEC 2FYUE 5AVQB 1WA8B 1SESA 1T8ZA 3K0DA 3RYHA 1FKAO 2B9BA 2LFSA 3H1IG 4H0LC 2XAJA 1UFIA 1URQB 2QRXA 3B5ND 5BR8B 1JR9A 3CCMV 1J5EB 5L3CA 4AYCA 2OTJP 3JCZA 3AG1C 4GUNA 1HJ0A 3PH0A 2ZKOA 3M0DA 1D7MA 1T2KD 4DZOA 4X62B 2FTKA 3UKMA 2K37A 1NAYA 4B3TO 2B1GA 2XNDH 2OYQA 2WPVB 2ZT9B 4IHJB 1JA8A 1V9PA 2E43A 2HG5D 1FZBA 1H89A 2QSIA 3V2QA 1P7BA 3ZRXA 2FFDC 2Q73A 2UUCO 1EXIA 1V55B 2BEQD 2NLJC 2LKMA 3TDKA 3AG1B 2M6YA 1IFNA 2Q6AA 5M1BA 1JVMA 1NTMJ 1SQPE 2OYIC 3GF3A 4GKJB 2ZYAA 3L75H 1W0KG 4QPKA 3RYIA 2Y0IA 3K04A 1Y6XA 2V7QG 4AHCA 3AK3A 3E1RA 2CGNA 1S9KE 3CX5F 4Z1MG 4LH6A 2Q0OC 5LHIA 4U3FG 2KOGA 2FYNB 3F89A 3W7WA 2X0LA 2PYJA 4LFAO 1MFTA 1Q6IA 3BCCJ 4PV1C 1JMBA 3CC4V 4B7KA 4XFJA 1V54C 1S5JA 1OXZA 1QL1A 3CC7P 1EZVH 1GN4A 1PPJH 3AG4C 2HLDG 3RK3B 3FB8C 3LUTB 4X1IB 4QPJA 3ZMSA 1R5SA 2HFED 3IJ4A 5H2FH 2R9RB 3JASA 2BTQB 4QJFB 1WNSA 1FJGO 3ETDA 1JUNA 4W80A 4YXWG 4H0LD 4JTDB 4QE9A 4DR6O 4RKUJ 1IX9A 3WU2H 1JQ0A 2Y69B 5LHHA 3TXQA 1NTMK 5JCOC 4MVZA 4ABMA 4FLVA 3L71J 1IBLO 1NTMD 5AVVB 2WLNA 3HKBB 2FYUJ 4FVMA 5KHKA 2GM4A 2Y9YA 1NZ6A 5CJ0A 4O4IA 1N73B 1ZLZA 3BVHA 4O4HB 4IOIH 1K34A 4B7EA 3VQXA 5ITZA 3HKCA 2UXDO 4DV4O 2DYSC 2PI4A 3S1KA 1LT9B 4JGSA 1WT6A 1W5CE 3ASNB 2IJKA 4AQRD 5AW3B 1JNMA 2KS1B 2JIZG 3CRCA 1XOUA 5FPOA 5JH7A 3AEAC 4GCZA 1NJIQ 2RMZA 2OIEA 3CCJP 1KILB 1H2KA 3RBXA 4YY3O 1X59A 1PP9G 3B8MA 4YXDC 4LF7B 3VQWA 1NU1E 3HUSA 4PV1D 2Q9IA 4JI2O 1G1IA 1ORQC 4OGQC 4EFBA 1WA8A 1SQPJ 4H44D 2KG7B 1GL2B 4GIFA 2OIGA 3DC5A 1XL6A 1QCEA 2YDEA 1Q7YW 1BE3E 1RM1C 4TSFG 1XTCC 2YNYA 1L0NE 3L71D 5C93A 2Q7CA 2ZVNB 2FYUD 3RL0B 1KYOI 2QM4A 2RH0A 1URFA 1EC5A 1VQ8P 3KKYA 1SQXE 4JI1B 3L73E 2QKAA 1B6QA 3CX5E 3OAKA 3DGEA 5L3EA 4DV5O 4IHJA 1D5AA 3GB7C 5APYA 3U11A 1OX3A 1WB7A 3OUFA 5LGTA 2BCCG 4EIJA 5GTIE 5D5QA 1GM8A 3F5WC 3R65A 3SJCC 3ZMUA 1VQ6V 4JI4O 1KTMA 4LBEC 3H1JH 5AW6B 1QR9A 1ZL8B 4YJ2B 2PAJA 1KP3A 4CH3A 2UXBB 5H5NA 1AR5A 2CK3H 1SQVG 4GOEA 4UB6E 2DMXA 3Q2YA 2ZXWC 1KB9I 3N27A 3C3SA 4N6JA 3KQGA 3KXDA 1Q82W 3BRVB 1HR0B 1EXJA 2B5UA 4J80A 1SQPD 2FFDA 5LGUA 3N4XA 4UCVA 2B1IA 2UUBO 1D5NA 1S72P 1VQOV 5GTHH 1H2SB 4BWAA 2E74B 2YIBA 1OVUA 4JI5O 2RNBA 4D6TD 3BCCH 4X1IA 5H6QA 2ZYDA 4OGQD 4QNHB 3GW6A 2BTQA 1NH4A 1LT1A 2H94A 4CH5A 1BSMA 3UM7A 5LP6B 1KC8W 4K8XA 3HD7C 5KHIA 4DR3B 1U96A 5KLVK 4UVBA 3FWLA 3OTOB 5K1PA 1NKZB 4IT5A 1Q43A 4MW3A 2HVKC 3TCUA 5KLVD 2CTRA 4P2ZA 1SQBK 1NU1J 1AR1B 1H8EG 2WLIB 4PI0A 2N05A 3K79A 1NVOA 1K3EA 1RY3A 3K0GA 1BDDA 1AFOA 1VF6A 3E7KA 3AG2B 5J9PC 3ASOC 3ZMTA 1SQBD 3G71V 4XDJA 4CBCA 5BZBA 3U0ZA 1JM0A 1N73A 5JQGB 5IJ9B 3CCLV 2GA1A 4IL6E 1BE3J 4WFEA 4O4HA 1KQLA 2IPPA 4Y99B 3DXRB 3L71H 2A9HA 1L0NJ 2JO1A 2GV9A 3ZN1A 1H2GA 1JCDA 2FYUH 2WITA 4ZI7B 1LT9A 1IZ3A 1AI5A 2EZPA 1SQXJ 1T3JA 1KV4A 4JYBA 1QVFU 3L73J 1EFRG 2KS1A 2LGWA 2QJ1A 3LSSA 5GTIZ 4P9PA 2F4VO 1VQMV 4TV8B 1GW4A 1IFMA 5IWAB 2XNXA 4ZHQA 1KILA 4RQEA 4LF8O 2WSEJ 1SS3A 5AW4B 3WG7C 2N1TC 4JI6B 4LF5B 3H1HE 4PDRA 1G4YB 5DECA 2Q4PA 4Q20A 4UB6Z 2KG7A 1GL2A 3CCUV 1PGJA 2V4HA 3FYIB 1J1DC 3F5TA 5KLIC 3G4SV 1OIPA 1DF4A 4JF7A 1OMIA 4IYHA 1NU1D 1YJWP 3AEIA 1ZUQA 3K5NA 3L4FA 1BHAA 2JGUA 4NYKA 3P8CE 3QO5A 1FZFA 3HD7D 3OD4A 1SQPH 2AGAA 3WG7B 1RE3A 2C0XA 3NR7A 2Y0DA 3BVOA 1BE3D 2IBZE 2YIUC 2QJPC 1SQXK 2Q7EA 5LMNO 1Z56A 3O6QB 3VMXA 1J1DB 4GKKB 1OW6A 1DEEG 4D7TA 1DEBA 4MVMA 1MKMA 3KDPB 4I2LC 3L70H 2Q9LA 1SQXD 3D6ZA 3RVZA 3L73D 4LFCO 2UXNA 2KI7B 2JDIG 2O1JA 2QE7G 2QA4V 5B1AB 2HJFC 3W68A 1FS0E 3CMEV 1KFMA 1W2EA 3FD9A 2IDBA 1JO5A 1FZCC 2ZE7A 3V5BA 2QJPB 1IFPA 3Q5SA 4W7ZA 5KUMA 4JI7O 1EZJA 3FFQA 3OMIB 1M90Q 2L35A 1OCCC 3VOPA 2NZ2A 3H25A 3UT5B 2PYLA 2K88A 4X64O 4L76A 1KZUB 3ZBHA 3BPZA 1P84D 1HVVA 1R1BA 1SFCC 2H8PC 4IFMA 2YC0A 1SP4A 4UCUA 5KKZC 2N1TD 3D3QA 4UVAA 4X9QA 4LF6B 2HVJC 1YTFD 5AVZB 3IR9A 4GOFA 4Z1VA 1OCCB 4NKGB 3ZN0A 5LP6A 1BCCE 1L0LG 3AE6C 4TT3H 3CSXA 4JASA 2CUGA 1UIIA 1IDSA 4L73A 1ZW0A 2K1AA 1U57A 1DGSA 3E8GA 4GZRB 4JAVA 2RN9A 1VQ4V 1W59A 1T3UA 4JAUA 3IAYA 3H1HJ 2WLIA 1Y8AA 4UUJC 3OMNB 2A06D 5H9CA 1SQVK 1IZNB 1VEWA 2B9ZA 3BASA 1IXMA 2F95B 3CE2A 1ZP0C 5JQGA 3E22B 5FPRA 4HYTB 1NU1H 2ITAA 1TGOA 3DXRA 2NNUA 2XNDG 5IE9A 4RO0A 3CPWO 4ZI7A 4U7NA 4B3TB 1LP1B 2OYHC 1JCCA 4PA6A 4I50B 4CH6A 1BE3H 2DJVA 3ZX6A 3JD1A 3FXDA 1L0NH 2GTAA 1PL0A 1WPXA 4J10A 2UUCB 3MD0A 4BIUA 1L4AC 4TV8A 1SZXA 3SWFA 4L75A 4K0KO 1RH5B 1YTZI 5L3BA 4EI2A 2Q6QA 3SYQA 5KJ7C 3L75G 1SQXH 2ZQMA 2Q1KA 3L73H 3CX5H 1YCIA 2JS3A 5AW0B 2E42A 3D71A 1RQVA 3ML0A 1N4CA 5K1XA 2GHYA 1SFCD 1AP5A 2H8PD 3CCVP 1EBOA 5GTIH 2XTAA 2WSEH 3OEEG 4FLTA 1RHZB 4LFAB 4FPPA 2M3EA 3H1HD 2HP8A 4LC1A 5LMUO 3O9OA 1FAFA 1EZVG 1Q2NA 3SJAC 1PPJG 4K35A 1PGQA 3KHUA 1Y76B 4WFAV 4ICGA 2KB1A 2ADPA 1Q86W 4UB6H 2GBOA 1BGYE 5GONB 1ZOYC 1YYCA 2YMYA 4C7NB 5KHJA 1OVRA 2BE3A 2A45G 2R3CA 3JCUE 1J2JB 1GD2E 3O6QA 1HNXO 1AA0A 2Q68A 3QWOC 1P7GA 1RF1A 2DYRC 2FXPA 3T1YO 1KQSO 5L3DA 4DR6B 1CPYA 1QU7A 2JKVA 4N78D 2NPSB 2IBZD 3E2EA 3B71A 2QEXP 1BCCJ 3I55P 4WF9V 2AZ2A 1IFIA 2W90A 3Q1MA 3GVMA 1GMJA 2CH7B 1VQPP 1IBLB 1NHLA 1S5LZ 3X2QC 3FX0A 1EZVI 2XAFA 4KL1A 4HBNA 5CN0A 3P8MC 1YITP 2CE4A 3UT5A 3CB2A 1TVKB 2DYRB 4W4LA 1N7SB 4HNAB 1K9MW 1L4AD 1ZRTE 3ABLC 2A45I 1XMOO 2R72A 2AXCA 5CJ4A 5KJ7D 4PA4A 4WFBV 1PD3A 4IFFA 2XU6A 2LXBA 4N3YB 1JEKA 2WLLB 3K3WA 3K06A 3E83A 3P7KA 3CCQP 1PV3A 2C0WA 1QLNA 3H32B 1YEWA 2K9JB 4IL6H 1ZV8A 4PELA 3H1LE 4YY3B 3TXSA 5CA1B 5IYCO 1WP8A 3I5DA 3SPIA 2OQQA 4JI2B 5APSA 1NVPD 2RCVA 2BEZF 1BT8A 4JV5O 4OH8B 3H1KG 1PNKA 3M06A 1I08A 3T1CA 5AVSB 3OA7A 2LP7A 3N2KB 1KQGB 5EFWB 2QKSA 2PRRA 4CS3A 3M9HA 3E22A 2Q5UA 4LWSB 2O01N 4I7ZB 5F2VO 1RQUA 2P06A 2G3AA 1J1EC 2OTKE 3H1HH 2ZFCA 2W6IG 4X88A 3HKDB 4LF9O 1LP1A 3AE2C 4DV5B 2Z4EA 4I4TB 1M56B 4I50A 5CBFA 3FYEB 3JCUZ 2WLMA 3RK2B 3FKSG 3HE5B 3V2PA 3L36A 1F4NA 2WVRA 1BGYJ 2FMLA 3UCSC 4R8CA 3CCEP 1EDIA 1YTZT 2Q7GA 1L0LK 3H1JG 4JI4B 2HODA 5H2FZ 3TGUG 1X22A 4DV2B 4TUYB 3CLQA 5KUKA 3FX7A 2HODB 3ABMC 2M3BA 2X6AA 4H33A 4U7OA 4AILC 3BEHA 4H13C 4LH7A 4B3MB 3QNEA 3I56P 2EJ7A 3TF5A 3T4DA 2NN4A 2RDCA 4BR6A 2BOBC 3PJSK 1PIXA 1S5HC 4YIPA 2UUBB 3RYFB 1W0JG 2RMKB 4EKWA 2JWDA 2E5LO 4FLYA 2LXCB 4JI5B 1Y76A 3BCCG 4RO2A 1YXBA 4JYAO 3ABMB 2YXHA 1T2KC 2FKXA 2Z5IA 1GO3F 4JAAA 5GONA 1NWQA 3OUSA 4C7NA 2WQYC 2Q3EA 4P9OA 4JYYA 1PM9A 1QNMA 2B89A 1US6A 4N21A 1FXKC 2QGNA 1IBMO 2KYVA 2EILC 1K05A 2HG5C 2DQ0A 4C7UA 3B5NB 2MW2B 1I7FA 2NPSA 1NO4A 2QDOA 1BGYD 4FLWA 1DX7A 3BY6A 3JD2A 3H1LJ 4KJMA 4I55B 1ZTEA 2WA3A 2ZR3A 2CH7A 3LNNA 5LBQA 3CEIA 5BMVB 1LWUC 2WSSH 4W7YA 2AZ0A 1IO4A 2VQEO 1N8RQ 1VQNP 2N74A 3BATA 1BCCH 4BIOA 1H0TB 1SQQG 1Q6HA 4NVPA 2ZE8A 1NR1A 2EIMC 3G80A 2JVDA 3K5OA 1JY2O 4HNAA 1Q81Q 2HJDA 2Z0AA 3F7YC 3W7UA 2ZDIA 3SFEC 3GWOA 1YQ4C 2AXTZ 2B87B 3AE3C 3IFXA 1KQSU 3E35A 2H3OA 3CRQA 3E8BA 1A32A 1BMFG 5EC2C 3K58A 2WLLA 4WBNB 1LWUB 2XT9A 3T97B 2QWRB 2F4VB 1ZRTD 3H32A 3JC22 4H13D 1VQLV 2K9JA 4NXMO 3L74G 3FB6C 4MTXA 2EIMB 2PZSA 3QO7A 4LF8B 3SFDC 1XUQA 3TJTA 5CA1A 2ITCC 4DV0O 2O3JA 4WFHA 3LSQA 1KUQA 2I1KA 1KKCA 1WP7A 1AJQA 3JD0A 3S4RA 1RE4A 3P32A 1LTBC 1A02J 2POHA 4DV7O 2PUSA 4E4EA 4ZOLB 2ADQB 3T1HO 2F1MA 3H1LD 3O8ZA 1CEZA 4EEQA 1KD1W 5CA0B 3M7MX 3N2KA 4HJGH 2YXYA 4RJTA 3GHGC 2Q8VA 4IIJB 3G6EV 4DR2O 4H0LB 3KYQA 2IYPA 2JJ1G 2XASA 3HKDA 2A3QA 5LMNB 4I4TA 2YXLA 1XNQO 3JALB 2KUBA 1SERA 3HE5A 3L70G 3W67A 3ABUA 4EB6B 1IJDB 2ZM6O 2KSEA 5GTHZ 3L35A 4EYYQ 1YJ9V 4MTFA 5CCHD 4LFCB 4IYIA 2JWAA 1HNZB 3RFRA 1DH3A 3K9SA 3ABKC 2AHZA 2XUMA 5B66E 1QEXA 1LR1A 4DO2A 5L3FA 4D6TE 4TUYA 2IYOA 1R3KC 2D2CC 2VWJA 1BGYH 3PP5A 3CC2P 2QM7A 3JCUH 4DYLA 2EBOA 4NXNO 5APQA 5BVZA 1GU4A 4H44C 2OYIB 1WMKA 3CRAA 5GW7A 4DUYB 3MHSC 4O4LB 4UXNA 4X64B 1HUCA 2I8DA 2JR8A 3RYFA 2DW3A 2KSJA 3ABKB 3EFFK 3SYOA 1WB8A 5KLVE 3CWBD 5BY1A 1VQ5V 1YJNV 3L72D 1FDIA 3QH9A 4PV1B 1ZN5A 1P84F 2LW7A 3A2FA 1SQBE 1AR4A 1N0JA 2HPCB 1CP9A 1V54B 4H44B 3E8FA 3FGAD 3B8EB 4H37A 3AG4B 3R66A 2H89C 2PP6A 4GX5A 3B5NA 3CMAP 2EIKC 4U3FE 1HBWA 4JI3B 2YUAA 1QL2A 4I55A 4DR4B 3R4YA 5KHHA 1NTKK 1XMQO 1YHQV 5BMVA 1M1KW 2P4KA 1RF0C 5APVA 3V2NA 1NTKD 5LXTB 1H0TA 4LCUC 5C8YB 2P7JA 4IGGA 3H1LH 4DW1A 3K08A 1COWG 3RW0A 2OTLP 2UXCO 3CD6V 2D3OW 1MUUA 2KXPB 1MMMA 2B87A 3BHPA 3K59A 4WB4A 4XDLA 2V1DA 1FDOA 1BQ0A 3A8TA 1SKVA 3RYCB 2VQFO 3A7OA 2D2CD 1JX9A 4WBNA 1L0NG 2DN9A 1LWUA 1OCOC 3T97A 2DYSB 3L9DA 1Q7YQ 3SJQC 1N86A 4O9BA 1PGOA 2G38A 2OCHA 4K0KB 1SVFA 3AE1C 1R3LC 1NAFA 5B66Z 3KPEA 1QLED 2AXTH 1N34O 3AEFC 1M7LA 1URQA 4LLHA 4KP4A 3FWNA 4CH4A 5KA5A 3ZRSA 1VF5D 4B08A 1UPGA 1YDXA 2EJRA 1YIJV 4D6TJ 4ZOLA 1G2CB 2GDSA 2MK3A 2XHBA 1NJIW 4BIZA 1N32O 5CA0A 4OGQB 1XILA 1KP2A 3IC7A 1YBKA 1SQQK 2QVAA 4CC5A 4E2LA 5DN6G 1RM1B 1PP9E 1NTZG 5KLVJ 2P22C 3CHXA 3JD4A 1FOSE 1HNXB 3JALA 3CX5I 4BWNA 2Y9ZA 4EB6A 1SQBJ 2RQ6A 2W27A 3T1YB 4J9ZB 1FU1A 4CC6A 2QIWA 2XV5A 4W4KA 1P84E 3M9BA 4JI0B 2GUSA 1E79G 2YS8A 2ZYGA 3G9RA 2R9AA 1IBKO 1NTMH 2OTJV 1Y9BA 1AJYA 1LNQA 1KB9E 2RKLA 3V2RA 4U3FJ 4YPCA 5CMZA 3TK1A 3H1ID 3A0BE 2E75C 3CXHE 2JEUA 1JTHB 2OYIA 1ROPA 1LUWA 1NBMG 1AILA 1K8AQ 2KZJA 1MNGA 4FFBB 4O4LA 1S76D 1AQTA 4DUZO 3EQ2A 1K7DA 2W6JG 3NXSA 2ZXWB 1FXVA 4KHPO 2Q0AA 4F6RB 3AK1A 2Q7HA 2A06E 2LJ2A 5CA3A 3T2MA 3RBZA 4D7SA 2Z5UA 2HPCA 2QWNB 2YICA 5EBLC 2AEFA 1SQVE 3TNUB 4YHHO 5AVUB 1HNWO 1LTJC 1XHXA 3HKBA 2JP3A 2ZNJA 4JQ0D 3HD7B 3AE7C 4A5UB 1AVOA 2KQXA 2FL4A 4DJGA 3G67A 1OCRC 3JD3A 4ZMDA 4HAMA 3CC7V 2LR2A 2YMKA 2PFXA 5JCOA 5LXTA 3RT3C 1O9HA 5C8YA 4U3FD 4JF3A 4J9YB 4MVSA 4ZIBA 5E1AC 2AEJA 3B8NA 3B09A 2AEMA 1WN7A 2L5GB 2YEVB 3ASOB 1AVYA 2QG4A 5CBOA 3ETQA 3CJHB 3GMAA 4LF9B 2ZAEB 2YI9A 4X20B 1OFCX 1QX8A 4OWFA 4NPDA 3RYCA 5AW5B 1PP9J 1USDA 2CPSA 5B1NA 4B3RB 2KLUA 2QKCA 1IC2A 3OR6C 2E75D 1TAEA 1TU3F 3JATB 5LYJB 3TYYA 3OM3B 4DT0A 2UU9O 2ILMA 3DTUB 1R3IC 4MW8A 2KSDA 1R6NA 2HHHB 5C39A 2QJKC 2CTQA 2WTYA 2WPDG 1SF9A 1VQ9P 3A0BZ 1G2CA 2E3CA 3E86A 2N1TB 5DJTB 3BABA 3W7XA 4N78E 1YTFB 5BR8O 1K73W 1CSBA 4UCSA 5B66H 5HFLA 4MN4C 4DV3B 5AVRB 5KLIB 3PRJA 4D6TH 2E5LB 3CCJV 4Z2WA 1FYJA 3S9OA 3CCSP 4IFDK 4X62O 1T5EA 4JYAB 3QF7A 4TOIA 1HJBA 1KYOD 1QQCA 4DV1B 4OVNF 3V6IA 3VQVA 2I1JA 4DW0A 1ZL8A 4YJ2A 1IBMB 3U59A 4Y28J 1XDCA 2YO2A 4OX9B 2YIUB 1FJKA 1AROP 1PP9D 5KLVH 3N7NA 1SQVJ 4FZ0A 5TJHA 3OW2O 3RGBA 1VARA 2E5YA 5APXA 1GN6A 3UQ8A 2K9YA 4WWIA 4IL6Z 1VQ8V 1SQBH 4RUEA 2ZE6A 1BCCG 2VQEB 1SA0B 3WFVA 3AEGC 3AECC 1JTHA 4X65O 1K5SA 1FZCB 2Y0PA 4FFBA 1YQ3C 1YI2P 2H43A 2W0XA 1KFNA 1KB9D 1N36O 3LSUA 2XKMA 5CBGA 5D5PA 4F6RA 4AQYB 5AW8B 3T4ZA 3CXHD 3OFNG 2Y4TA 3A3YB 1GDTA 1DD3A 5JVDB 3RL0g 1S1CX 1NTZK 4C7RA 3U10A 3GF7A 1ZX3A 3M8AA 1ZXGA 2BCCD 5AVYB 4UVCA 1SFCB 4NXMB 5B1BC 3SR2C 2IFNA 5CCGC 4PI2A 4DR7O 1G6UA 3TNUA 5KKZB 1S4XA 1XTGB 4DV0B 1JB0J 2Q67A 1JMKC 1HGVA 3FAVB 4NTXA 3ABTA 2JJ2G 2J59M 3HD7A 2K9PA 5JJJB 2WLKA 4DR1O 4JPRA 5IJ9A 1N2DC 4DV7B 1E5WA 1SQVD 3AE8C 3MIWA 1T6AA 1S72V 3T1HB 1YF2A 3H9VA 1BSNA 4G2KA 4KFMA 1H88A 2C2AA 3ZRWB 4DR2B 1BL8A 4L74A 4G28B 3JAKB 3CP1A 1WJZA 1MSWD 1XNRO 1L0LE 1VPCA 2YEVA 1QVGO 4UCRA 4HZ3A 3D3IA 2QJYC 3LIEA 3CJHA 4J7JA 5L3GA 2X6CA 1GK6A 1VIBA 4X20A 2CPBA 2Z3YA 4GYCB 1XNQB 3B77A 4MTGA 2KP8A 2ZM6B 3HE4B 2OYHB 3VQYA 4WY4C 3JATA 5H6RA 5LYJA 1UJWB 3K9AA 1THZA 1PP9H 1YZBA 2F93B 4OPHA 1L4AB 1NI8A 2QJYB 1LTIC 3CCRP 2P1JA 3SGIA 2ZCEA 5LOVB 3A0RA 4NXNB 3FXEA 1MSDA 1JY2N 2N1TA 4GKGA 1JFFB 4FZ1A 1M57C 4Q6GA 1P84H 4MTOA 5CCGD 1A02F 2EULA 1FJGB 5KX5B 1VQ7P 1KB9H 1JY3N 4RAIA 3L75E 1NR7A 4N23A 1KU9A 3LIDA 4NTWA 2XAGA 1NVPB 2IH3C 3A0BH 2GUVA 4KUMA 3CXHH 1Q3EA 1DD4A 1FC2C 1L1FA 4RQFA 3F7VC 4TQDA 1Y4MA 2JJLA 4TV9B 5A9GA 4JPZB 3STZC 1BZKA 3M91A 2GTSA 1PGPA 2XAQA 1K9MQ 2P4VA 2WT7B 1VQKP 1OCZC 1YJWV 5DM6V 5JWPA 3MUDC 2A06H 1XMQB 4BRYB 1EZVE 1M1JC 1J95A 3JAWB 2UXDB 2A0LA 3IN6A 4DV4B 1PFIA 4K8ZA 2YXRB 1K04A 1SA0A 3M0AA 1SQVH 1Q90D 2KKWA 2L91A 2YKPA 1JPXA 1JOCA 1HR0O 2KLVA 2XDJA 1FZCA 3CCMP 2UXCB 3WUTA 4ZNCA 3K5BA 3AG7A 2PGGA 3EVKA 3X2QB 3AG3C 4WY4D 1YSCA 1SS1A 3UO3A 2Z5HA 4O2BB 1LUVA 1H2LA 1L0LJ 2VQFB 4X89A 5B1OA 4RUFA 3ABLB 2P7TC 3VOUA 2WLJA 4WFGA 2MJZA 1SFCA 1JOYA 3JSVC 1IXBA 3OJAB 5LGNA 1IFJA 3SJBC 3M0DC 5EZYB 2OGUA 1N34B 3VYIA 1IURA 1M57D 4MVUA 3S3WA 4UFZA 1FFXB 2UUAO 2ZINA 4EOTA 3STLC 5APTA 1K4CC 3RYHB 1N32B 4K3AA 2ODMA 5EBMC 2OWOA 1LTGC 4J7ZA 3WMM0 3ZRWA 4J11A 3ZDMA 3JAKA 1GRJA 3TETA 5AW9B 3CC4P 4UCOA 2BSKB 2BOCC 5CBHA 3MAQA 3P30A 4BAYA 1Z5WA 4CS2A 1NKNA 3L75J 4FM0A 1J1EB 4DOJA 3SYAA 1S3JA 2CK3G 2IBZH 5BXZA 1L0LD 2E76C 3H1KE 3HE4A 2OYHA 3CWBE 1G1XB 1NOHA 1JCHA 3ICXA 4QIWF 1NTMG 4WBAA 3L72E 3C3TA 3RN4A 1IBKB 1HWTC 4GX2A 1WLEA 2XAHA 3CPWU 1VDFA 3P3NA 1GH6A 1L4AA 1GKFA 3H6PA 4GX1A 1PKXA 3SYPA 2H88C 5LOVA 3MGNA 2NR5A 5KJ7A 4PHZA 4MVQA 3PHLA 2QWPB 4FJCC 3VN0A 1JFFA 2R5DA 1K33A 4DUZB 4FM2A 1Q8IA 4H13B 2OCCC 4KHPB 2DWDC 5LHGA 5KX5A 3MP7B 3H1JE 1ZWIC 2EIJC 2JEXA 5B3SC 3TGUE 4P30A 4LP8A 3ZHQA 1NTKE 1IK9A 3AEEC 5AW1B 4NTYA 1WAZA 1MOFA 3JAMN 4GKKO 2FB5A 1H2MA 3DC6A 3E89A 4CS4A 2VRSA 3EFGA 4YHHB 2K1EA 1HNWB 3LDCA 3OMAB 3CCVV 4KXRA 4TV9A 5CCHC 3L75D 3JARB 4R4MA 1GZLA 3GWKC 4QGPA 2ITDC 2WT7A 3EHBB 1FXKB 2HYNA 2JDIH 2EILB 1TVKA 4BRYA 3L71G 2O57A 2ATKC 1EDJA 5EBWC 1EDKA 1GM7A 3JAWA 2FYUG 5L8RJ 3AE4C 2ARHA 3OGCC 4X8AA 3ZCCA 1UIXA 1FBMA 2GUZB 4FLUA 3HRNA 3ETEA 3RK3E 2E76D 4OPAA 5ITZB 1EZVD 3HUSC 3O65A 1PPJD 1DTOA 2R44A 4ASWA 4BXLA 5LA6B 4O2BA 4PD4E 3U1AA 2IW5A 2YIAA 2QEXV 5B5EE 3HR0A 3I55V 2ZD9A 3VMZA 5AW7B 4ASVA 5IT9N 2Y0CA 1G8MA 2ZNIA 1PL4A 2P2UA 2W6AA 1HF9A 3QG5A 1Z2GA 1VQPV 2FY8A 1ZR4A 3AK2A 2FBWC 2J5UA 4NPFX 2RJZA 1ZLLA 3LW5J 1L0LH 4TWKA 3Q5PA 5EZYA 1MABG 2UU9B 3H1KJ 3PN1A 1SQQE 1YITV 1I94O 1IK7A 3AEBC 3CWBJ 5TISE 1VQ6P 2FYZA 1RSOB 1FFXA 3L72J 4I0XB 1SQPG 5J2TB 4L87A 4LWSA 2ZT9C 2L6LA 3VBBA 2ZE5A 2KZIA 1R5LA 4L8JA 3CS5A 1H8AA 2P90A 1JY2P 2CTPA 1V55C 4AUWA 1BQZA 3W7TA 4D6TG 3CCQV 1N7LA 4B3SO 3L74E 1GMGA 2BSKA 1VQOP 3H1IE 3GHGB 1RP3B 4NR1A 1XBLA 3BA8A 3OEHG 1JY3P 1KILE 2YSUB 3H1JJ 1I0HA 3N2GB 1KYOF 3TGUJ 1NTKJ 2QWOB 5KLVG 2A7WA 2FYNC 2R5BA 4RESB 1I5YA 4JI7B 1EDLA 1FD9A 4GX0A 1SQGA 3SPHA 2EZOA 4PA9A 2B88A 1NH2D 1OZHA 1SQBG 1GAXA 1FAVA 1OV9A 1QLEC 1AVMA 1ZAUA 3E8HA 2WMMA 3CI9A 3RK3C 1LJ2A 4WFFA 1D2DA 2Q3IA 3RWRD 1FOSF 2IU0A 2FKWB 3H1KD 1VF5C 3KZIE 3THOA 1KBHA 4JYCA 4X65B 1Y47A 3K03A 2D2CB 4M3LA 3G71P 1S5LX 1URQD 3L70E 2P67A 2XOKG 1N36B 3CCLP 2Y69C 3Q5RA 3D36C 4TT3G 3CCEV 3C9IA 1KB9F 1QLEB 5B5EZ 5HFMA 5K5GB 2JS5A 1X79B 5APWA 5APUA 3QVNA 3CXHF 1VF5B 1VF6C 1FE6A 1M1KQ 2ZT9D 3DSQA 2A45H 1QHTA 4DR7B 1P4RA 5J2UB 3C1LA 1N73C 1R8EA 1VQMP 3J80N 3D70A 1GW3A 3H1JD 3I56V 2JGDB 3JARA 1QVFO 2Y4UA 4FIPC 3TGUD 5TISZ 2IX7C 1LT9C 1FXKA 4DR1B 1NU1G 1DK1A 1SQQJ 2PI5A 3ASNC 1M93A 4B86A 2EIKB 1K4DC 3SSUA 1MZEA 1RFYA 3CCUP 2DE0X 2W8ZA 3Q4HB 5IYBO 3G4SP 4I9QA 1BE3G 1KILC 2GUZA 3A5TA 5AG2A 3SWKA 1K92A 1XNRB 5CCHA 2R32A 1U97A 1XEQA 1H2NA 5LA6A 3BCCD 1KQFB 2AW9A 1SQXG 5CMUA 3NMDA 1SC5B 3G6BA 3L73G 3L74J 2YIBD 1FZEA 1GL2C 5CBNA 3VP9A 4HH2A 3H1IJ 2F23A 3RK3D 3VMAA 4XDKA 1W2BO 2H7HA 4ZHQB 1KKDA 3P3PA 3RL0C 1VQNV 5CB4B 4PD4D 1OCOB 1GN3A 4UV8A 1E1QG 1RE3C 1KYOE 4TQFA 2QA4P 1RSOA 3CYOA 4I0XA 4IIJA 5J2TA 5LMUB 3CMEP 1Z5VA 5FL7G 4J41A 3IC9A 3KZIZ 3LW5H 4LNUB 3UO2A 2FYUK 2M8RA 2FFDB 4MVRA 4I1LA 3H1KH 5EYPB 3W7SA 3CWBH 4X66O 1SQQD 2KB7P 3L72H 3A2AA 3SPGA 3ZMVA 2KK7A 5EK0A 2O1KA 3L70J 5E79E 1O9GA 1Q82Q 1HP8A 4FM1A 5IYZB 3GHGA 1OHHG 1AV1A 3IGAC 1MV8A 3IF4A 5EC1C 3LNMB 2V7QJ 4MS2A 3N2GA 3FB7C 3L74D 3D8CA 3ZMZA 1FPOA 4G27B 2IH1C 2RN0A 1FZGA 4DR5O 1VL2A 2A06G 3OAAG 1KILD 2P5OA 4YIOA 5DJUB 2DQ3A 1SQFA 2E74C 1P84I 3BAAA 4YJ3B 4DV2O 1KC8Q 3TGUH 3ZHTA 1NTKH 2BCCE 2F66C 3CRRA 1SQPK 4R6ZA 4HKZH 3A0HE 1XMOB 1HDJA 1VQ4P 1WPBA 2P6JA 3C90A 1NTZE 3ITKA 2OT5A 3ETGA 5LP6C 4B3MO 1GL2D 4I6MC 1S77D 1F23A 1VP7A 2PGDA 2LQTA 1MZ9A 3CXHI 1QGKB 3WUVA 3VP8A 1SZTA 2E75B 3OE7G 3MHVA 4LFBO 3RL0D 1DF5A 3HB3B 1Y67A 1Y66A 2KNCB 1S9KD 1FDMA 2LFRA 1HTLC 3OTFA 2Q69A 4QE7A 2XZRA 3L70D 3AG2C 1K8AW 4XBFA 2R9IA 3CC2V 3GG2A 4DV6O 5J2UA 4DCKA 2WSFJ 4JV5B 3WB0A 4PJ0E 1GU5A 2OYOA 4J42A 4Y99C 1AQ5A 1ZMEC 4QMAA 2JGDA 3VMYA 3D36A 1M8OB 2AHYA 1K5QA 2UUAB 1NS1A 3S3XA 4PD4H 1CXZB 4FFKA 1N33O 5B5EH 3QO8A 3EWKA 1BS3A 4R7CA 1LTJB 2WPSA 3MDSA 3H1HG 5FLXN 4UB8E 4O4JB 2DWEC 3Q4HA 4LF4O 5EIBC 3AE5C 1OCRB 5KAFE 1EN6A 1MG1A 3KG2A 1SQQH 2R70A 4JI8O 4ZKPA 5TISH 1RF0A 4XE5B 3B2EE 2E5TA 1DLBA 1TA8A 5E79Z 4FLZA 3USSA 3J81N 3LDDA 4JZGA 5KHGA 1PNLA 3CMAV 5KMGB 1OVVA 4I5SA 3HTKB 1OW8A 2E74D 2IBZG 2QWQB 1GK9A 3RVYA 4ZKIA 1S2EA 2M0BA 4MVOA 3SYCA 4UCTA 4WCEV 2F43G 1B04A 1K73Q 5FNVB 3AE9C 3L74H 5CB4A 2QM8A 4LR3A 2ETNA 2WLHA 3H1IH 1U7JA 1N0NA 1R6KA 1J5EO 2OTLV 4WVZA 2IJIA 1FS0G 1NU1K 3CRMA 5KAIE 3A0HZ 1VMGA 4LNUA 2BCCJ 1X4TA 1QR8A 4NPEA 4JTAB 1RF1C 5EYPA 1X9VA 2QJKB 1NTZJ 2YKOA 3CL3D 1IFDA 2IBZI 1X0TA 1L0NK 4LGDE 1KN7A 5B1AC 1W2BU 1FJPA 5DEDA 5IYZA 3KZIH 1L0ND 1K97A 1LTTC 3AEDC 3ZJZA 4GKJO 3BFRA 3J7AU 1RF1B 2WSSG 2HKOA 1GM9A 3V4WA 3JYCA 4PJ0Z 1LTAC 2WZ7A 3CX5D 1HNZO 1TUEB 1CI6B 3KCXA 2P10A 1LGHB 5EIBD 2V7QH 1SETA 2Q5ZA 4YJ3A 2DOSA 1TUBB 2JEEA 4Z1MH 4U3FH 1AJNA 1HW7A 4UB8Z 3IAOA 1GN2A 3MTUE 1HGZA 2Y0EA 4DUYO 3WB2A 3WUUA 3I5CA 2YIDA 2W0FC 1M90W 1AB3A 5KAFZ 4X1YB 1BDCA 5JJNB 1MA1A 1Q6UA 1JJOA 1NTZD 2DW4A 2KNCA 1I5XA 5IY5C 3ZHVA 4YXWH 4JTCB 1KMIZ 2BTOA 1HH0A 3QTCA 2HR3A 1ZR2A 5LL6Y 4UV9A 3K5MA 3FB5C 4DRXB 1I94B 1GK4A 4MSWC 4CPGA 2FXOA 4JI3O 2LO1A 2UWJE 2JK5C 5B1BB 1OZ0A 4DR4O 2QSAA 3MHHC 1LTSC 1F4MA 1LTJA 5IY5B 1S5LE 5KAIZ 4KT0J 2WSFH 2C9NY 2FXMA 3G3ZA 4FK5C 1NQTA 1Y74B 4O4JA 2Y48A 3F5HA 1PNMA 5IJ0B 3MZWB 2WPQA 5KA6A 2YXQB 4B3SB 3CXCU 3C8VA 3H01A 2PTMA 3EXAA 3PLNA 2BASA 1KYOH 2K3RA 4BW5A 4PA3A 2N9BA 1CW5A 5BU8B 2YI8A 1ZSPA 4BW9A 5KMGA 3L37A 4C46A 3HTKA 1WRGA 1BGYG 4LF7O 3UIAA 4F6EA 1CZQA 1Q86Q 2LGQA 2A79B 5AVXB 5FNVA
chains in the Genus database with same CATH topology
3R4YA 1NYHA 3SFEC 1YQ4C 4OGQC 1VF5C 2MKVA 1YQ3C 1ZP0C 4H44D 3AE3C 2OQQA 3AEEC 3GLMA 2D2CB 2WPVB 2ZT9B 1S5LX 1VL2A 2BEZF 3T97B 2WSEJ 3IN6A 2E74C 2JP3A 1K04A 4H13D 1DD3A 2QSIA 3Q5RA 3RL0g 1S1CX 3AEDC 1Q90D 3AE7C 3GF7A 1EXIA 3SFDC 1KQGB 2BEQD 4R4MA 2O01J 5M1BA 2E76B 1FDOA 2YMKA 5KLIC 1VF5B 3GF3A 1JB0J 4I7ZB 2D2CD 2G3AA 1RQUA 2P10A 2ZT9D 3AECC 1OMIA 5L8RJ 3D6YA 3AE4C 2E75B 4IL6X 3AE2C 1R8EA 3D70A 4Z1MH 1PL5A 3AE1C 3D71A 1UIXA 3AE8C 1RQVA 3GMAA 3RK3E 3AEFC 3IAOA 1KTMA 2E76D 2WSCJ 4PV1C 2YIUC 1NGMB 2QJPC 4H0LB 1VF5D 4XFJA 4YTPC 1OW6A 3Q2YA 2E75D 2WSFJ 1MKMA 1TU3F 3D6ZA 1ZMEC 1HF9A 4OGQB 2QJYC 1EXJA 2FBWC 1KORA 4H13C 2J5UA 3EWKA 1ZOYC 3LW5J 1KMIZ 4PV1D 4H0LD 2IDBA 2QJKC 1KQFB 3Q5PA 1PIXA 3O6QA 1IK7A 3AEBC 4RKUJ 3Q5SA 2E74B 2D2CC 2FXPA 4R4LA 2NZ2A 2ZT9C 4GDOA 3H25A 3AE5C 4OGQD 3B71A 4U7JA 3Q1MA 4H44C 1WMKA 2QIWA 1GMJA 2WQYC 3S9OA 4KT0J 3G9RA 2E76C 1OW8A 2E74D 2G8YA 1Y9BA 3ABVC 5KKZC 1AJYA 1K05A 4I7ZC 3C8VA 1FDIA 4Y28J 1KILE 2E75C 4PV1B 1OW7A 1ZRTE 3AE9C 3AE6C 4TT3H 2H88C 4H44B 3FGAD 2FYNC 3AEAC 1U57A 2K9YA 4H0LC 1DD4A 2H89C 2JO1A 1DIPA 1PV3A 4YXDC 4H13B 3Q3DA 3AEGC 2V7QJ 1HJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJY C;  5KKZ C;  5L8R J;  2E75 B;  4IL6 X;  3LW5 J;  3C8V A;  2QJK C;  4Y28 J;  2D2C B;  4PV1 B;  4RKU J;  2E74 B;  2ZT9 B;  2WPV B;  1ZRT E;  1S5L X;  2WSE J;  2WSC J;  2YIU C;  2QJP C;  4H44 B;  4H0L B;  2QSI A;  2FYN C;  1Q90 D;  2K9Y A;  2O01 J;  2QIW A;  2WSF J;  2E76 B;  4KT0 J;  5KLI C;  4H13 B;  1VF5 B;  4OGQ B;  1JB0 J;  4I7Z B; 
#chains in the Genus database with same CATH topology
 2M5A B;  3II6 A;  2IU3 A;  3V4Q A;  1NYH A;  2CTW A;  5E79 H;  4U3J B;  2EIN C;  2X6B A;  4WY4 B;  3GLM A;  3B40 A;  2QTO A;  3E1I A;  1EM1 A;  1MZF A;  1AI4 A;  4PDV A;  4JI1 O;  3ZIA G;  2P58 A;  3NFQ A;  5IYD O;  1PZQ A;  3BA9 A;  1X8Y A;  5CHX A;  2O01 J;  2NPS C;  1SRY A;  2PF4 E;  2W83 C;  3SWY A;  2VWK A;  2BCC H;  1M57 B;  2EIN B;  4DK1 A;  3D6Y A;  3A0H H;  4DXW A;  3B4S A;  1NTZ H;  5KTB A;  3P8C D;  1PL5 A;  1RPO A;  4PDM A;  1KEC A;  3IFM A;  4X1K B;  1N7S C;  2UXB O;  1AJP A;  1RPR A;  4PDL A;  1VQ9 V;  1VQL P;  1PPJ E;  2WSC J;  5AW2 B;  1NGM B;  1CI6 A;  2ZDI C;  1M9N A;  1R3J C;  3HKE B;  4JI0 O;  1G1J A;  3H1L G;  5H2F E;  4A7P A;  4YTP C;  2CDY A;  1E79 H;  1HWY A;  3ZED A;  2WAM A;  4FMT A;  1TUB A;  1NKD A;  2NRG A;  1XRE A;  4EDF A;  3K57 A;  2IJJ A;  1BSH A;  2N9Y B;  1PV0 A;  3CCS V;  3WU2 E;  1N7S A;  1OCZ B;  2KIK A;  3ZS8 C;  2SPZ A;  1JJ2 U;  4PJ0 H;  1M1J B;  3R2P A;  5JVD A;  3OW2 U;  3G6E P;  2VS0 A;  1YVW A;  4X1Y A;  3SPJ A;  3APQ A;  2W6J H;  4R4L A;  4O2A B;  1RE4 C;  1L8D A;  2LW1 A;  2ZIO A;  4DR3 O;  2CGO A;  5A2Q N;  1L2P A;  3OT7 A;  1E1R G;  4UB8 H;  3AG3 B;  3OTO O;  2QR4 A;  4MT8 A;  4U7J A;  3FAV A;  1EN4 A;  2GSM B;  1OWA A;  4JBZ A;  1YJ9 P;  1S0V A;  5KAF H;  4EFE A;  4DRX A;  4I7Z C;  1NT2 B;  1XQ8 A;  2C9L Y;  4J7K A;  3TSI A;  2NPS D;  4KHX A;  1YI2 V;  4PD4 F;  4FLX A;  5CCG A;  1OW7 A;  3SDL A;  1AI6 A;  1M56 C;  5AVT B;  2IZ0 A;  1BCC D;  3RK2 C;  4TLF A;  2CAZ C;  2JRI A;  3CWB G;  4RWU A;  4HYO A;  1H38 A;  3KCY A;  1Y74 A;  1GTW A;  4X66 B;  5AVW B;  3L72 G;  2IJH A;  5IJ0 A;  2M7W A;  1H8H G;  1AP6 A;  1N7S D;  3M9Q A;  2WWW A;  3NTN A;  3Q3D A;  2R3S A;  1DIP A;  2AXT E;  3U1C A;  3PTZ A;  4NB5 A;  1JMM A;  3OR7 C;  1VQ5 P;  1YJN P;  1M5I A;  5IWA O;  2MKV A;  5KAI H;  1XI1 A;  1M4U A;  1OJH A;  3K5L A;  2UXX A;  3M99 B;  1VF7 A;  2HLO A;  2N04 A;  4JI6 O;  4LF5 O;  2IFM A;  3RYI B;  2ZXE B;  4B3R O;  1MFZ A;  1B3Q A;  3OGI B;  4DR5 B;  4GLX A;  1XHZ A;  1QVG U;  2M5A A;  4XA4 A;  3RGU A;  3VTP C;  1F51 A;  2ZR2 A;  4OXS A;  1NTK G;  4U3J A;  2E76 B;  1FZA A;  1FXH A;  5BU5 A;  4I9W A;  4WY4 A;  1SLQ A;  1FFT B;  2HHH O;  1U7M A;  3ZHS A;  1YHQ P;  1F7Y A;  2J58 A;  3ZRV A;  2IZ1 A;  3WU2 Z;  1USE A;  3BRC A;  4IL6 X;  4ZBM A;  1P49 A;  2ZJS E;  3B5N C;  3JAS B;  2VRZ A;  4DV3 O;  1Q5O A;  2WPR A;  2ZIM A;  3CD6 P;  3ZHU A;  4F4L A;  4LFB B;  1NTM E;  3BRT B;  1R73 A;  2OCC B;  4DV1 O;  1IVS A;  2O01 H;  1M56 D;  4DV6 B;  5GTH E;  3RK2 D;  2QE7 H;  2EIJ B;  3CCR V;  4R50 A;  4X1K A;  5B3S B;  1R6T A;  4OX9 O;  1KOR A;  4GT1 A;  3JSL A;  1BHB A;  4CZZ A;  3BCC E;  2V4D A;  3HKE A;  1AI7 A;  2ZVO B;  2W6B A;  4O4I B;  1N33 B;  1B06 A;  1ENV A;  2IM9 A;  4PA7 A;  3JSN A;  3WB1 A;  3SPC A;  4GDO A;  3HKC B;  1VQ7 V;  2WSC H;  1YIJ P;  4GOD A;  4JZ2 A;  2HEP A;  3APO A;  3MUD A;  4LF4 B;  1M1J A;  4ZKU A;  4JI8 B;  1XL4 A;  4LF6 O;  1N8R W;  3ZHR A;  2QTS A;  5JJE B;  5JH7 B;  1URQ C;  3HPL C;  2G8Y A;  3ABV C;  2OAR A;  2YKQ A;  4AI8 A;  4HB1 A;  4ASU G;  1KD1 Q;  4O2A A;  4DK0 A;  4AQY O;  1Q81 W;  2PY5 A;  2ZXX A;  2EX3 A;  3LDE A;  1NH2 B;  2WA4 A;  1S5L H;  1EN5 A;  1JY3 O;  1QBZ A;  1VQK V;  2YO3 A;  1EQ7 A;  3HUS B;  3L71 E;  5IDJ A;  2X7R B;  4PD4 I;  1GTO A;  2HFE C;  2FYU E;  5AVQ B;  1WA8 B;  1SES A;  1T8Z A;  3K0D A;  3RYH A;  1FKA O;  2B9B A;  2LFS A;  3H1I G;  4H0L C;  2XAJ A;  1UFI A;  1URQ B;  2QRX A;  3B5N D;  5BR8 B;  1JR9 A;  3CCM V;  1J5E B;  5L3C A;  4AYC A;  2OTJ P;  3JCZ A;  3AG1 C;  4GUN A;  1HJ0 A;  3PH0 A;  2ZKO A;  3M0D A;  1D7M A;  1T2K D;  4DZO A;  4X62 B;  2FTK A;  3UKM A;  2K37 A;  1NAY A;  4B3T O;  2B1G A;  2XND H;  2OYQ A;  2WPV B;  2ZT9 B;  4IHJ B;  1JA8 A;  1V9P A;  2E43 A;  2HG5 D;  1FZB A;  1H89 A;  2QSI A;  3V2Q A;  1P7B A;  3ZRX A;  2FFD C;  2Q73 A;  2UUC O;  1EXI A;  1V55 B;  2BEQ D;  2NLJ C;  2LKM A;  3TDK A;  3AG1 B;  2M6Y A;  1IFN A;  2Q6A A;  5M1B A;  1JVM A;  1NTM J;  1SQP E;  2OYI C;  3GF3 A;  4GKJ B;  2ZYA A;  3L75 H;  1W0K G;  4QPK A;  3RYI A;  2Y0I A;  3K04 A;  1Y6X A;  2V7Q G;  4AHC A;  3AK3 A;  3E1R A;  2CGN A;  1S9K E;  3CX5 F;  4Z1M G;  4LH6 A;  2Q0O C;  5LHI A;  4U3F G;  2KOG A;  2FYN B;  3F89 A;  3W7W A;  2X0L A;  2PYJ A;  4LFA O;  1MFT A;  1Q6I A;  3BCC J;  4PV1 C;  1JMB A;  3CC4 V;  4B7K A;  4XFJ A;  1V54 C;  1S5J A;  1OXZ A;  1QL1 A;  3CC7 P;  1EZV H;  1GN4 A;  1PPJ H;  3AG4 C;  2HLD G;  3RK3 B;  3FB8 C;  3LUT B;  4X1I B;  4QPJ A;  3ZMS A;  1R5S A;  2HFE D;  3IJ4 A;  5H2F H;  2R9R B;  3JAS A;  2BTQ B;  4QJF B;  1WNS A;  1FJG O;  3ETD A;  1JUN A;  4W80 A;  4YXW G;  4H0L D;  4JTD B;  4QE9 A;  4DR6 O;  4RKU J;  1IX9 A;  3WU2 H;  1JQ0 A;  2Y69 B;  5LHH A;  3TXQ A;  1NTM K;  5JCO C;  4MVZ A;  4ABM A;  4FLV A;  3L71 J;  1IBL O;  1NTM D;  5AVV B;  2WLN A;  3HKB B;  2FYU J;  4FVM A;  5KHK A;  2GM4 A;  2Y9Y A;  1NZ6 A;  5CJ0 A;  4O4I A;  1N73 B;  1ZLZ A;  3BVH A;  4O4H B;  4IOI H;  1K34 A;  4B7E A;  3VQX A;  5ITZ A;  3HKC A;  2UXD O;  4DV4 O;  2DYS C;  2PI4 A;  3S1K A;  1LT9 B;  4JGS A;  1WT6 A;  1W5C E;  3ASN B;  2IJK A;  4AQR D;  5AW3 B;  1JNM A;  2KS1 B;  2JIZ G;  3CRC A;  1XOU A;  5FPO A;  5JH7 A;  3AEA C;  4GCZ A;  1NJI Q;  2RMZ A;  2OIE A;  3CCJ P;  1KIL B;  1H2K A;  3RBX A;  4YY3 O;  1X59 A;  1PP9 G;  3B8M A;  4YXD C;  4LF7 B;  3VQW A;  1NU1 E;  3HUS A;  4PV1 D;  2Q9I A;  4JI2 O;  1G1I A;  1ORQ C;  4OGQ C;  4EFB A;  1WA8 A;  1SQP J;  4H44 D;  2KG7 B;  1GL2 B;  4GIF A;  2OIG A;  3DC5 A;  1XL6 A;  1QCE A;  2YDE A;  1Q7Y W;  1BE3 E;  1RM1 C;  4TSF G;  1XTC C;  2YNY A;  1L0N E;  3L71 D;  5C93 A;  2Q7C A;  2ZVN B;  2FYU D;  3RL0 B;  1KYO I;  2QM4 A;  2RH0 A;  1URF A;  1EC5 A;  1VQ8 P;  3KKY A;  1SQX E;  4JI1 B;  3L73 E;  2QKA A;  1B6Q A;  3CX5 E;  3OAK A;  3DGE A;  5L3E A;  4DV5 O;  4IHJ A;  1D5A A;  3GB7 C;  5APY A;  3U11 A;  1OX3 A;  1WB7 A;  3OUF A;  5LGT A;  2BCC G;  4EIJ A;  5GTI E;  5D5Q A;  1GM8 A;  3F5W C;  3R65 A;  3SJC C;  3ZMU A;  1VQ6 V;  4JI4 O;  1KTM A;  4LBE C;  3H1J H;  5AW6 B;  1QR9 A;  1ZL8 B;  4YJ2 B;  2PAJ A;  1KP3 A;  4CH3 A;  2UXB B;  5H5N A;  1AR5 A;  2CK3 H;  1SQV G;  4GOE A;  4UB6 E;  2DMX A;  3Q2Y A;  2ZXW C;  1KB9 I;  3N27 A;  3C3S A;  4N6J A;  3KQG A;  3KXD A;  1Q82 W;  3BRV B;  1HR0 B;  1EXJ A;  2B5U A;  4J80 A;  1SQP D;  2FFD A;  5LGU A;  3N4X A;  4UCV A;  2B1I A;  2UUB O;  1D5N A;  1S72 P;  1VQO V;  5GTH H;  1H2S B;  4BWA A;  2E74 B;  2YIB A;  1OVU A;  4JI5 O;  2RNB A;  4D6T D;  3BCC H;  4X1I A;  5H6Q A;  2ZYD A;  4OGQ D;  4QNH B;  3GW6 A;  2BTQ A;  1NH4 A;  1LT1 A;  2H94 A;  4CH5 A;  1BSM A;  3UM7 A;  5LP6 B;  1KC8 W;  4K8X A;  3HD7 C;  5KHI A;  4DR3 B;  1U96 A;  5KLV K;  4UVB A;  3FWL A;  3OTO B;  5K1P A;  1NKZ B;  4IT5 A;  1Q43 A;  4MW3 A;  2HVK C;  3TCU A;  5KLV D;  2CTR A;  4P2Z A;  1SQB K;  1NU1 J;  1AR1 B;  1H8E G;  2WLI B;  4PI0 A;  2N05 A;  3K79 A;  1NVO A;  1K3E A;  1RY3 A;  3K0G A;  1BDD A;  1AFO A;  1VF6 A;  3E7K A;  3AG2 B;  5J9P C;  3ASO C;  3ZMT A;  1SQB D;  3G71 V;  4XDJ A;  4CBC A;  5BZB A;  3U0Z A;  1JM0 A;  1N73 A;  5JQG B;  5IJ9 B;  3CCL V;  2GA1 A;  4IL6 E;  1BE3 J;  4WFE A;  4O4H A;  1KQL A;  2IPP A;  4Y99 B;  3DXR B;  3L71 H;  2A9H A;  1L0N J;  2JO1 A;  2GV9 A;  3ZN1 A;  1H2G A;  1JCD A;  2FYU H;  2WIT A;  4ZI7 B;  1LT9 A;  1IZ3 A;  1AI5 A;  2EZP A;  1SQX J;  1T3J A;  1KV4 A;  4JYB A;  1QVF U;  3L73 J;  1EFR G;  2KS1 A;  2LGW A;  2QJ1 A;  3LSS A;  5GTI Z;  4P9P A;  2F4V O;  1VQM V;  4TV8 B;  1GW4 A;  1IFM A;  5IWA B;  2XNX A;  4ZHQ A;  1KIL A;  4RQE A;  4LF8 O;  2WSE J;  1SS3 A;  5AW4 B;  3WG7 C;  2N1T C;  4JI6 B;  4LF5 B;  3H1H E;  4PDR A;  1G4Y B;  5DEC A;  2Q4P A;  4Q20 A;  4UB6 Z;  2KG7 A;  1GL2 A;  3CCU V;  1PGJ A;  2V4H A;  3FYI B;  1J1D C;  3F5T A;  5KLI C;  3G4S V;  1OIP A;  1DF4 A;  4JF7 A;  1OMI A;  4IYH A;  1NU1 D;  1YJW P;  3AEI A;  1ZUQ A;  3K5N A;  3L4F A;  1BHA A;  2JGU A;  4NYK A;  3P8C E;  3QO5 A;  1FZF A;  3HD7 D;  3OD4 A;  1SQP H;  2AGA A;  3WG7 B;  1RE3 A;  2C0X A;  3NR7 A;  2Y0D A;  3BVO A;  1BE3 D;  2IBZ E;  2YIU C;  2QJP C;  1SQX K;  2Q7E A;  5LMN O;  1Z56 A;  3O6Q B;  3VMX A;  1J1D B;  4GKK B;  1OW6 A;  1DEE G;  4D7T A;  1DEB A;  4MVM A;  1MKM A;  3KDP B;  4I2L C;  3L70 H;  2Q9L A;  1SQX D;  3D6Z A;  3RVZ A;  3L73 D;  4LFC O;  2UXN A;  2KI7 B;  2JDI G;  2O1J A;  2QE7 G;  2QA4 V;  5B1A B;  2HJF C;  3W68 A;  1FS0 E;  3CME V;  1KFM A;  1W2E A;  3FD9 A;  2IDB A;  1JO5 A;  1FZC C;  2ZE7 A;  3V5B A;  2QJP B;  1IFP A;  3Q5S A;  4W7Z A;  5KUM A;  4JI7 O;  1EZJ A;  3FFQ A;  3OMI B;  1M90 Q;  2L35 A;  1OCC C;  3VOP A;  2NZ2 A;  3H25 A;  3UT5 B;  2PYL A;  2K88 A;  4X64 O;  4L76 A;  1KZU B;  3ZBH A;  3BPZ A;  1P84 D;  1HVV A;  1R1B A;  1SFC C;  2H8P C;  4IFM A;  2YC0 A;  1SP4 A;  4UCU A;  5KKZ C;  2N1T D;  3D3Q A;  4UVA A;  4X9Q A;  4LF6 B;  2HVJ C;  1YTF D;  5AVZ B;  3IR9 A;  4GOF A;  4Z1V A;  1OCC B;  4NKG B;  3ZN0 A;  5LP6 A;  1BCC E;  1L0L G;  3AE6 C;  4TT3 H;  3CSX A;  4JAS A;  2CUG A;  1UII A;  1IDS A;  4L73 A;  1ZW0 A;  2K1A A;  1U57 A;  1DGS A;  3E8G A;  4GZR B;  4JAV A;  2RN9 A;  1VQ4 V;  1W59 A;  1T3U A;  4JAU A;  3IAY A;  3H1H J;  2WLI A;  1Y8A A;  4UUJ C;  3OMN B;  2A06 D;  5H9C A;  1SQV K;  1IZN B;  1VEW A;  2B9Z A;  3BAS A;  1IXM A;  2F95 B;  3CE2 A;  1ZP0 C;  5JQG A;  3E22 B;  5FPR A;  4HYT B;  1NU1 H;  2ITA A;  1TGO A;  3DXR A;  2NNU A;  2XND G;  5IE9 A;  4RO0 A;  3CPW O;  4ZI7 A;  4U7N A;  4B3T B;  1LP1 B;  2OYH C;  1JCC A;  4PA6 A;  4I50 B;  4CH6 A;  1BE3 H;  2DJV A;  3ZX6 A;  3JD1 A;  3FXD A;  1L0N H;  2GTA A;  1PL0 A;  1WPX A;  4J10 A;  2UUC B;  3MD0 A;  4BIU A;  1L4A C;  4TV8 A;  1SZX A;  3SWF A;  4L75 A;  4K0K O;  1RH5 B;  1YTZ I;  5L3B A;  4EI2 A;  2Q6Q A;  3SYQ A;  5KJ7 C;  3L75 G;  1SQX H;  2ZQM A;  2Q1K A;  3L73 H;  3CX5 H;  1YCI A;  2JS3 A;  5AW0 B;  2E42 A;  3D71 A;  1RQV A;  3ML0 A;  1N4C A;  5K1X A;  2GHY A;  1SFC D;  1AP5 A;  2H8P D;  3CCV P;  1EBO A;  5GTI H;  2XTA A;  2WSE H;  3OEE G;  4FLT A;  1RHZ B;  4LFA B;  4FPP A;  2M3E A;  3H1H D;  2HP8 A;  4LC1 A;  5LMU O;  3O9O A;  1FAF A;  1EZV G;  1Q2N A;  3SJA C;  1PPJ G;  4K35 A;  1PGQ A;  3KHU A;  1Y76 B;  4WFA V;  4ICG A;  2KB1 A;  2ADP A;  1Q86 W;  4UB6 H;  2GBO A;  1BGY E;  5GON B;  1ZOY C;  1YYC A;  2YMY A;  4C7N B;  5KHJ A;  1OVR A;  2BE3 A;  2A45 G;  2R3C A;  3JCU E;  1J2J B;  1GD2 E;  3O6Q A;  1HNX O;  1AA0 A;  2Q68 A;  3QWO C;  1P7G A;  1RF1 A;  2DYR C;  2FXP A;  3T1Y O;  1KQS O;  5L3D A;  4DR6 B;  1CPY A;  1QU7 A;  2JKV A;  4N78 D;  2NPS B;  2IBZ D;  3E2E A;  3B71 A;  2QEX P;  1BCC J;  3I55 P;  4WF9 V;  2AZ2 A;  1IFI A;  2W90 A;  3Q1M A;  3GVM A;  1GMJ A;  2CH7 B;  1VQP P;  1IBL B;  1NHL A;  1S5L Z;  3X2Q C;  3FX0 A;  1EZV I;  2XAF A;  4KL1 A;  4HBN A;  5CN0 A;  3P8M C;  1YIT P;  2CE4 A;  3UT5 A;  3CB2 A;  1TVK B;  2DYR B;  4W4L A;  1N7S B;  4HNA B;  1K9M W;  1L4A D;  1ZRT E;  3ABL C;  2A45 I;  1XMO O;  2R72 A;  2AXC A;  5CJ4 A;  5KJ7 D;  4PA4 A;  4WFB V;  1PD3 A;  4IFF A;  2XU6 A;  2LXB A;  4N3Y B;  1JEK A;  2WLL B;  3K3W A;  3K06 A;  3E83 A;  3P7K A;  3CCQ P;  1PV3 A;  2C0W A;  1QLN A;  3H32 B;  1YEW A;  2K9J B;  4IL6 H;  1ZV8 A;  4PEL A;  3H1L E;  4YY3 B;  3TXS A;  5CA1 B;  5IYC O;  1WP8 A;  3I5D A;  3SPI A;  2OQQ A;  4JI2 B;  5APS A;  1NVP D;  2RCV A;  2BEZ F;  1BT8 A;  4JV5 O;  4OH8 B;  3H1K G;  1PNK A;  3M06 A;  1I08 A;  3T1C A;  5AVS B;  3OA7 A;  2LP7 A;  3N2K B;  1KQG B;  5EFW B;  2QKS A;  2PRR A;  4CS3 A;  3M9H A;  3E22 A;  2Q5U A;  4LWS B;  2O01 N;  4I7Z B;  5F2V O;  1RQU A;  2P06 A;  2G3A A;  1J1E C;  2OTK E;  3H1H H;  2ZFC A;  2W6I G;  4X88 A;  3HKD B;  4LF9 O;  1LP1 A;  3AE2 C;  4DV5 B;  2Z4E A;  4I4T B;  1M56 B;  4I50 A;  5CBF A;  3FYE B;  3JCU Z;  2WLM A;  3RK2 B;  3FKS G;  3HE5 B;  3V2P A;  3L36 A;  1F4N A;  2WVR A;  1BGY J;  2FML A;  3UCS C;  4R8C A;  3CCE P;  1EDI A;  1YTZ T;  2Q7G A;  1L0L K;  3H1J G;  4JI4 B;  2HOD A;  5H2F Z;  3TGU G;  1X22 A;  4DV2 B;  4TUY B;  3CLQ A;  5KUK A;  3FX7 A;  2HOD B;  3ABM C;  2M3B A;  2X6A A;  4H33 A;  4U7O A;  4AIL C;  3BEH A;  4H13 C;  4LH7 A;  4B3M B;  3QNE A;  3I56 P;  2EJ7 A;  3TF5 A;  3T4D A;  2NN4 A;  2RDC A;  4BR6 A;  2BOB C;  3PJS K;  1PIX A;  1S5H C;  4YIP A;  2UUB B;  3RYF B;  1W0J G;  2RMK B;  4EKW A;  2JWD A;  2E5L O;  4FLY A;  2LXC B;  4JI5 B;  1Y76 A;  3BCC G;  4RO2 A;  1YXB A;  4JYA O;  3ABM B;  2YXH A;  1T2K C;  2FKX A;  2Z5I A;  1GO3 F;  4JAA A;  5GON A;  1NWQ A;  3OUS A;  4C7N A;  2WQY C;  2Q3E A;  4P9O A;  4JYY A;  1PM9 A;  1QNM A;  2B89 A;  1US6 A;  4N21 A;  1FXK C;  2QGN A;  1IBM O;  2KYV A;  2EIL C;  1K05 A;  2HG5 C;  2DQ0 A;  4C7U A;  3B5N B;  2MW2 B;  1I7F A;  2NPS A;  1NO4 A;  2QDO A;  1BGY D;  4FLW A;  1DX7 A;  3BY6 A;  3JD2 A;  3H1L J;  4KJM A;  4I55 B;  1ZTE A;  2WA3 A;  2ZR3 A;  2CH7 A;  3LNN A;  5LBQ A;  3CEI A;  5BMV B;  1LWU C;  2WSS H;  4W7Y A;  2AZ0 A;  1IO4 A;  2VQE O;  1N8R Q;  1VQN P;  2N74 A;  3BAT A;  1BCC H;  4BIO A;  1H0T B;  1SQQ G;  1Q6H A;  4NVP A;  2ZE8 A;  1NR1 A;  2EIM C;  3G80 A;  2JVD A;  3K5O A;  1JY2 O;  4HNA A;  1Q81 Q;  2HJD A;  2Z0A A;  3F7Y C;  3W7U A;  2ZDI A;  3SFE C;  3GWO A;  1YQ4 C;  2AXT Z;  2B87 B;  3AE3 C;  3IFX A;  1KQS U;  3E35 A;  2H3O A;  3CRQ A;  3E8B A;  1A32 A;  1BMF G;  5EC2 C;  3K58 A;  2WLL A;  4WBN B;  1LWU B;  2XT9 A;  3T97 B;  2QWR B;  2F4V B;  1ZRT D;  3H32 A;  3JC2 2;  4H13 D;  1VQL V;  2K9J A;  4NXM O;  3L74 G;  3FB6 C;  4MTX A;  2EIM B;  2PZS A;  3QO7 A;  4LF8 B;  3SFD C;  1XUQ A;  3TJT A;  5CA1 A;  2ITC C;  4DV0 O;  2O3J A;  4WFH A;  3LSQ A;  1KUQ A;  2I1K A;  1KKC A;  1WP7 A;  1AJQ A;  3JD0 A;  3S4R A;  1RE4 A;  3P32 A;  1LTB C;  1A02 J;  2POH A;  4DV7 O;  2PUS A;  4E4E A;  4ZOL B;  2ADQ B;  3T1H O;  2F1M A;  3H1L D;  3O8Z A;  1CEZ A;  4EEQ A;  1KD1 W;  5CA0 B;  3M7M X;  3N2K A;  4HJG H;  2YXY A;  4RJT A;  3GHG C;  2Q8V A;  4IIJ B;  3G6E V;  4DR2 O;  4H0L B;  3KYQ A;  2IYP A;  2JJ1 G;  2XAS A;  3HKD A;  2A3Q A;  5LMN B;  4I4T A;  2YXL A;  1XNQ O;  3JAL B;  2KUB A;  1SER A;  3HE5 A;  3L70 G;  3W67 A;  3ABU A;  4EB6 B;  1IJD B;  2ZM6 O;  2KSE A;  5GTH Z;  3L35 A;  4EYY Q;  1YJ9 V;  4MTF A;  5CCH D;  4LFC B;  4IYI A;  2JWA A;  1HNZ B;  3RFR A;  1DH3 A;  3K9S A;  3ABK C;  2AHZ A;  2XUM A;  5B66 E;  1QEX A;  1LR1 A;  4DO2 A;  5L3F A;  4D6T E;  4TUY A;  2IYO A;  1R3K C;  2D2C C;  2VWJ A;  1BGY H;  3PP5 A;  3CC2 P;  2QM7 A;  3JCU H;  4DYL A;  2EBO A;  4NXN O;  5APQ A;  5BVZ A;  1GU4 A;  4H44 C;  2OYI B;  1WMK A;  3CRA A;  5GW7 A;  4DUY B;  3MHS C;  4O4L B;  4UXN A;  4X64 B;  1HUC A;  2I8D A;  2JR8 A;  3RYF A;  2DW3 A;  2KSJ A;  3ABK B;  3EFF K;  3SYO A;  1WB8 A;  5KLV E;  3CWB D;  5BY1 A;  1VQ5 V;  1YJN V;  3L72 D;  1FDI A;  3QH9 A;  4PV1 B;  1ZN5 A;  1P84 F;  2LW7 A;  3A2F A;  1SQB E;  1AR4 A;  1N0J A;  2HPC B;  1CP9 A;  1V54 B;  4H44 B;  3E8F A;  3FGA D;  3B8E B;  4H37 A;  3AG4 B;  3R66 A;  2H89 C;  2PP6 A;  4GX5 A;  3B5N A;  3CMA P;  2EIK C;  4U3F E;  1HBW A;  4JI3 B;  2YUA A;  1QL2 A;  4I55 A;  4DR4 B;  3R4Y A;  5KHH A;  1NTK K;  1XMQ O;  1YHQ V;  5BMV A;  1M1K W;  2P4K A;  1RF0 C;  5APV A;  3V2N A;  1NTK D;  5LXT B;  1H0T A;  4LCU C;  5C8Y B;  2P7J A;  4IGG A;  3H1L H;  4DW1 A;  3K08 A;  1COW G;  3RW0 A;  2OTL P;  2UXC O;  3CD6 V;  2D3O W;  1MUU A;  2KXP B;  1MMM A;  2B87 A;  3BHP A;  3K59 A;  4WB4 A;  4XDL A;  2V1D A;  1FDO A;  1BQ0 A;  3A8T A;  1SKV A;  3RYC B;  2VQF O;  3A7O A;  2D2C D;  1JX9 A;  4WBN A;  1L0N G;  2DN9 A;  1LWU A;  1OCO C;  3T97 A;  2DYS B;  3L9D A;  1Q7Y Q;  3SJQ C;  1N86 A;  4O9B A;  1PGO A;  2G38 A;  2OCH A;  4K0K B;  1SVF A;  3AE1 C;  1R3L C;  1NAF A;  5B66 Z;  3KPE A;  1QLE D;  2AXT H;  1N34 O;  3AEF C;  1M7L A;  1URQ A;  4LLH A;  4KP4 A;  3FWN A;  4CH4 A;  5KA5 A;  3ZRS A;  1VF5 D;  4B08 A;  1UPG A;  1YDX A;  2EJR A;  1YIJ V;  4D6T J;  4ZOL A;  1G2C B;  2GDS A;  2MK3 A;  2XHB A;  1NJI W;  4BIZ A;  1N32 O;  5CA0 A;  4OGQ B;  1XIL A;  1KP2 A;  3IC7 A;  1YBK A;  1SQQ K;  2QVA A;  4CC5 A;  4E2L A;  5DN6 G;  1RM1 B;  1PP9 E;  1NTZ G;  5KLV J;  2P22 C;  3CHX A;  3JD4 A;  1FOS E;  1HNX B;  3JAL A;  3CX5 I;  4BWN A;  2Y9Z A;  4EB6 A;  1SQB J;  2RQ6 A;  2W27 A;  3T1Y B;  4J9Z B;  1FU1 A;  4CC6 A;  2QIW A;  2XV5 A;  4W4K A;  1P84 E;  3M9B A;  4JI0 B;  2GUS A;  1E79 G;  2YS8 A;  2ZYG A;  3G9R A;  2R9A A;  1IBK O;  1NTM H;  2OTJ V;  1Y9B A;  1AJY A;  1LNQ A;  1KB9 E;  2RKL A;  3V2R A;  4U3F J;  4YPC A;  5CMZ A;  3TK1 A;  3H1I D;  3A0B E;  2E75 C;  3CXH E;  2JEU A;  1JTH B;  2OYI A;  1ROP A;  1LUW A;  1NBM G;  1AIL A;  1K8A Q;  2KZJ A;  1MNG A;  4FFB B;  4O4L A;  1S76 D;  1AQT A;  4DUZ O;  3EQ2 A;  1K7D A;  2W6J G;  3NXS A;  2ZXW B;  1FXV A;  4KHP O;  2Q0A A;  4F6R B;  3AK1 A;  2Q7H A;  2A06 E;  2LJ2 A;  5CA3 A;  3T2M A;  3RBZ A;  4D7S A;  2Z5U A;  2HPC A;  2QWN B;  2YIC A;  5EBL C;  2AEF A;  1SQV E;  3TNU B;  4YHH O;  5AVU B;  1HNW O;  1LTJ C;  1XHX A;  3HKB A;  2JP3 A;  2ZNJ A;  4JQ0 D;  3HD7 B;  3AE7 C;  4A5U B;  1AVO A;  2KQX A;  2FL4 A;  4DJG A;  3G67 A;  1OCR C;  3JD3 A;  4ZMD A;  4HAM A;  3CC7 V;  2LR2 A;  2YMK A;  2PFX A;  5JCO A;  5LXT A;  3RT3 C;  1O9H A;  5C8Y A;  4U3F D;  4JF3 A;  4J9Y B;  4MVS A;  4ZIB A;  5E1A C;  2AEJ A;  3B8N A;  3B09 A;  2AEM A;  1WN7 A;  2L5G B;  2YEV B;  3ASO B;  1AVY A;  2QG4 A;  5CBO A;  3ETQ A;  3CJH B;  3GMA A;  4LF9 B;  2ZAE B;  2YI9 A;  4X20 B;  1OFC X;  1QX8 A;  4OWF A;  4NPD A;  3RYC A;  5AW5 B;  1PP9 J;  1USD A;  2CPS A;  5B1N A;  4B3R B;  2KLU A;  2QKC A;  1IC2 A;  3OR6 C;  2E75 D;  1TAE A;  1TU3 F;  3JAT B;  5LYJ B;  3TYY A;  3OM3 B;  4DT0 A;  2UU9 O;  2ILM A;  3DTU B;  1R3I C;  4MW8 A;  2KSD A;  1R6N A;  2HHH B;  5C39 A;  2QJK C;  2CTQ A;  2WTY A;  2WPD G;  1SF9 A;  1VQ9 P;  3A0B Z;  1G2C A;  2E3C A;  3E86 A;  2N1T B;  5DJT B;  3BAB A;  3W7X A;  4N78 E;  1YTF B;  5BR8 O;  1K73 W;  1CSB A;  4UCS A;  5B66 H;  5HFL A;  4MN4 C;  4DV3 B;  5AVR B;  5KLI B;  3PRJ A;  4D6T H;  2E5L B;  3CCJ V;  4Z2W A;  1FYJ A;  3S9O A;  3CCS P;  4IFD K;  4X62 O;  1T5E A;  4JYA B;  3QF7 A;  4TOI A;  1HJB A;  1KYO D;  1QQC A;  4DV1 B;  4OVN F;  3V6I A;  3VQV A;  2I1J A;  4DW0 A;  1ZL8 A;  4YJ2 A;  1IBM B;  3U59 A;  4Y28 J;  1XDC A;  2YO2 A;  4OX9 B;  2YIU B;  1FJK A;  1ARO P;  1PP9 D;  5KLV H;  3N7N A;  1SQV J;  4FZ0 A;  5TJH A;  3OW2 O;  3RGB A;  1VAR A;  2E5Y A;  5APX A;  1GN6 A;  3UQ8 A;  2K9Y A;  4WWI A;  4IL6 Z;  1VQ8 V;  1SQB H;  4RUE A;  2ZE6 A;  1BCC G;  2VQE B;  1SA0 B;  3WFV A;  3AEG C;  3AEC C;  1JTH A;  4X65 O;  1K5S A;  1FZC B;  2Y0P A;  4FFB A;  1YQ3 C;  1YI2 P;  2H43 A;  2W0X A;  1KFN A;  1KB9 D;  1N36 O;  3LSU A;  2XKM A;  5CBG A;  5D5P A;  4F6R A;  4AQY B;  5AW8 B;  3T4Z A;  3CXH D;  3OFN G;  2Y4T A;  3A3Y B;  1GDT A;  1DD3 A;  5JVD B;  3RL0 g;  1S1C X;  1NTZ K;  4C7R A;  3U10 A;  3GF7 A;  1ZX3 A;  3M8A A;  1ZXG A;  2BCC D;  5AVY B;  4UVC A;  1SFC B;  4NXM B;  5B1B C;  3SR2 C;  2IFN A;  5CCG C;  4PI2 A;  4DR7 O;  1G6U A;  3TNU A;  5KKZ B;  1S4X A;  1XTG B;  4DV0 B;  1JB0 J;  2Q67 A;  1JMK C;  1HGV A;  3FAV B;  4NTX A;  3ABT A;  2JJ2 G;  2J59 M;  3HD7 A;  2K9P A;  5JJJ B;  2WLK A;  4DR1 O;  4JPR A;  5IJ9 A;  1N2D C;  4DV7 B;  1E5W A;  1SQV D;  3AE8 C;  3MIW A;  1T6A A;  1S72 V;  3T1H B;  1YF2 A;  3H9V A;  1BSN A;  4G2K A;  4KFM A;  1H88 A;  2C2A A;  3ZRW B;  4DR2 B;  1BL8 A;  4L74 A;  4G28 B;  3JAK B;  3CP1 A;  1WJZ A;  1MSW D;  1XNR O;  1L0L E;  1VPC A;  2YEV A;  1QVG O;  4UCR A;  4HZ3 A;  3D3I A;  2QJY C;  3LIE A;  3CJH A;  4J7J A;  5L3G A;  2X6C A;  1GK6 A;  1VIB A;  4X20 A;  2CPB A;  2Z3Y A;  4GYC B;  1XNQ B;  3B77 A;  4MTG A;  2KP8 A;  2ZM6 B;  3HE4 B;  2OYH B;  3VQY A;  4WY4 C;  3JAT A;  5H6R A;  5LYJ A;  1UJW B;  3K9A A;  1THZ A;  1PP9 H;  1YZB A;  2F93 B;  4OPH A;  1L4A B;  1NI8 A;  2QJY B;  1LTI C;  3CCR P;  2P1J A;  3SGI A;  2ZCE A;  5LOV B;  3A0R A;  4NXN B;  3FXE A;  1MSD A;  1JY2 N;  2N1T A;  4GKG A;  1JFF B;  4FZ1 A;  1M57 C;  4Q6G A;  1P84 H;  4MTO A;  5CCG D;  1A02 F;  2EUL A;  1FJG B;  5KX5 B;  1VQ7 P;  1KB9 H;  1JY3 N;  4RAI A;  3L75 E;  1NR7 A;  4N23 A;  1KU9 A;  3LID A;  4NTW A;  2XAG A;  1NVP B;  2IH3 C;  3A0B H;  2GUV A;  4KUM A;  3CXH H;  1Q3E A;  1DD4 A;  1FC2 C;  1L1F A;  4RQF A;  3F7V C;  4TQD A;  1Y4M A;  2JJL A;  4TV9 B;  5A9G A;  4JPZ B;  3STZ C;  1BZK A;  3M91 A;  2GTS A;  1PGP A;  2XAQ A;  1K9M Q;  2P4V A;  2WT7 B;  1VQK P;  1OCZ C;  1YJW V;  5DM6 V;  5JWP A;  3MUD C;  2A06 H;  1XMQ B;  4BRY B;  1EZV E;  1M1J C;  1J95 A;  3JAW B;  2UXD B;  2A0L A;  3IN6 A;  4DV4 B;  1PFI A;  4K8Z A;  2YXR B;  1K04 A;  1SA0 A;  3M0A A;  1SQV H;  1Q90 D;  2KKW A;  2L91 A;  2YKP A;  1JPX A;  1JOC A;  1HR0 O;  2KLV A;  2XDJ A;  1FZC A;  3CCM P;  2UXC B;  3WUT A;  4ZNC A;  3K5B A;  3AG7 A;  2PGG A;  3EVK A;  3X2Q B;  3AG3 C;  4WY4 D;  1YSC A;  1SS1 A;  3UO3 A;  2Z5H A;  4O2B B;  1LUV A;  1H2L A;  1L0L J;  2VQF B;  4X89 A;  5B1O A;  4RUF A;  3ABL B;  2P7T C;  3VOU A;  2WLJ A;  4WFG A;  2MJZ A;  1SFC A;  1JOY A;  3JSV C;  1IXB A;  3OJA B;  5LGN A;  1IFJ A;  3SJB C;  3M0D C;  5EZY B;  2OGU A;  1N34 B;  3VYI A;  1IUR A;  1M57 D;  4MVU A;  3S3W A;  4UFZ A;  1FFX B;  2UUA O;  2ZIN A;  4EOT A;  3STL C;  5APT A;  1K4C C;  3RYH B;  1N32 B;  4K3A A;  2ODM A;  5EBM C;  2OWO A;  1LTG C;  4J7Z A;  3WMM 0;  3ZRW A;  4J11 A;  3ZDM A;  3JAK A;  1GRJ A;  3TET A;  5AW9 B;  3CC4 P;  4UCO A;  2BSK B;  2BOC C;  5CBH A;  3MAQ A;  3P30 A;  4BAY A;  1Z5W A;  4CS2 A;  1NKN A;  3L75 J;  4FM0 A;  1J1E B;  4DOJ A;  3SYA A;  1S3J A;  2CK3 G;  2IBZ H;  5BXZ A;  1L0L D;  2E76 C;  3H1K E;  3HE4 A;  2OYH A;  3CWB E;  1G1X B;  1NOH A;  1JCH A;  3ICX A;  4QIW F;  1NTM G;  4WBA A;  3L72 E;  3C3T A;  3RN4 A;  1IBK B;  1HWT C;  4GX2 A;  1WLE A;  2XAH A;  3CPW U;  1VDF A;  3P3N A;  1GH6 A;  1L4A A;  1GKF A;  3H6P A;  4GX1 A;  1PKX A;  3SYP A;  2H88 C;  5LOV A;  3MGN A;  2NR5 A;  5KJ7 A;  4PHZ A;  4MVQ A;  3PHL A;  2QWP B;  4FJC C;  3VN0 A;  1JFF A;  2R5D A;  1K33 A;  4DUZ B;  4FM2 A;  1Q8I A;  4H13 B;  2OCC C;  4KHP B;  2DWD C;  5LHG A;  5KX5 A;  3MP7 B;  3H1J E;  1ZWI C;  2EIJ C;  2JEX A;  5B3S C;  3TGU E;  4P30 A;  4LP8 A;  3ZHQ A;  1NTK E;  1IK9 A;  3AEE C;  5AW1 B;  4NTY A;  1WAZ A;  1MOF A;  3JAM N;  4GKK O;  2FB5 A;  1H2M A;  3DC6 A;  3E89 A;  4CS4 A;  2VRS A;  3EFG A;  4YHH B;  2K1E A;  1HNW B;  3LDC A;  3OMA B;  3CCV V;  4KXR A;  4TV9 A;  5CCH C;  3L75 D;  3JAR B;  4R4M A;  1GZL A;  3GWK C;  4QGP A;  2ITD C;  2WT7 A;  3EHB B;  1FXK B;  2HYN A;  2JDI H;  2EIL B;  1TVK A;  4BRY A;  3L71 G;  2O57 A;  2ATK C;  1EDJ A;  5EBW C;  1EDK A;  1GM7 A;  3JAW A;  2FYU G;  5L8R J;  3AE4 C;  2ARH A;  3OGC C;  4X8A A;  3ZCC A;  1UIX A;  1FBM A;  2GUZ B;  4FLU A;  3HRN A;  3ETE A;  3RK3 E;  2E76 D;  4OPA A;  5ITZ B;  1EZV D;  3HUS C;  3O65 A;  1PPJ D;  1DTO A;  2R44 A;  4ASW A;  4BXL A;  5LA6 B;  4O2B A;  4PD4 E;  3U1A A;  2IW5 A;  2YIA A;  2QEX V;  5B5E E;  3HR0 A;  3I55 V;  2ZD9 A;  3VMZ A;  5AW7 B;  4ASV A;  5IT9 N;  2Y0C A;  1G8M A;  2ZNI A;  1PL4 A;  2P2U A;  2W6A A;  1HF9 A;  3QG5 A;  1Z2G A;  1VQP V;  2FY8 A;  1ZR4 A;  3AK2 A;  2FBW C;  2J5U A;  4NPF X;  2RJZ A;  1ZLL A;  3LW5 J;  1L0L H;  4TWK A;  3Q5P A;  5EZY A;  1MAB G;  2UU9 B;  3H1K J;  3PN1 A;  1SQQ E;  1YIT V;  1I94 O;  1IK7 A;  3AEB C;  3CWB J;  5TIS E;  1VQ6 P;  2FYZ A;  1RSO B;  1FFX A;  3L72 J;  4I0X B;  1SQP G;  5J2T B;  4L87 A;  4LWS A;  2ZT9 C;  2L6L A;  3VBB A;  2ZE5 A;  2KZI A;  1R5L A;  4L8J A;  3CS5 A;  1H8A A;  2P90 A;  1JY2 P;  2CTP A;  1V55 C;  4AUW A;  1BQZ A;  3W7T A;  4D6T G;  3CCQ V;  1N7L A;  4B3S O;  3L74 E;  1GMG A;  2BSK A;  1VQO P;  3H1I E;  3GHG B;  1RP3 B;  4NR1 A;  1XBL A;  3BA8 A;  3OEH G;  1JY3 P;  1KIL E;  2YSU B;  3H1J J;  1I0H A;  3N2G B;  1KYO F;  3TGU J;  1NTK J;  2QWO B;  5KLV G;  2A7W A;  2FYN C;  2R5B A;  4RES B;  1I5Y A;  4JI7 B;  1EDL A;  1FD9 A;  4GX0 A;  1SQG A;  3SPH A;  2EZO A;  4PA9 A;  2B88 A;  1NH2 D;  1OZH A;  1SQB G;  1GAX A;  1FAV A;  1OV9 A;  1QLE C;  1AVM A;  1ZAU A;  3E8H A;  2WMM A;  3CI9 A;  3RK3 C;  1LJ2 A;  4WFF A;  1D2D A;  2Q3I A;  3RWR D;  1FOS F;  2IU0 A;  2FKW B;  3H1K D;  1VF5 C;  3KZI E;  3THO A;  1KBH A;  4JYC A;  4X65 B;  1Y47 A;  3K03 A;  2D2C B;  4M3L A;  3G71 P;  1S5L X;  1URQ D;  3L70 E;  2P67 A;  2XOK G;  1N36 B;  3CCL P;  2Y69 C;  3Q5R A;  3D36 C;  4TT3 G;  3CCE V;  3C9I A;  1KB9 F;  1QLE B;  5B5E Z;  5HFM A;  5K5G B;  2JS5 A;  1X79 B;  5APW A;  5APU A;  3QVN A;  3CXH F;  1VF5 B;  1VF6 C;  1FE6 A;  1M1K Q;  2ZT9 D;  3DSQ A;  2A45 H;  1QHT A;  4DR7 B;  1P4R A;  5J2U B;  3C1L A;  1N73 C;  1R8E A;  1VQM P;  3J80 N;  3D70 A;  1GW3 A;  3H1J D;  3I56 V;  2JGD B;  3JAR A;  1QVF O;  2Y4U A;  4FIP C;  3TGU D;  5TIS Z;  2IX7 C;  1LT9 C;  1FXK A;  4DR1 B;  1NU1 G;  1DK1 A;  1SQQ J;  2PI5 A;  3ASN C;  1M93 A;  4B86 A;  2EIK B;  1K4D C;  3SSU A;  1MZE A;  1RFY A;  3CCU P;  2DE0 X;  2W8Z A;  3Q4H B;  5IYB O;  3G4S P;  4I9Q A;  1BE3 G;  1KIL C;  2GUZ A;  3A5T A;  5AG2 A;  3SWK A;  1K92 A;  1XNR B;  5CCH A;  2R32 A;  1U97 A;  1XEQ A;  1H2N A;  5LA6 A;  3BCC D;  1KQF B;  2AW9 A;  1SQX G;  5CMU A;  3NMD A;  1SC5 B;  3G6B A;  3L73 G;  3L74 J;  2YIB D;  1FZE A;  1GL2 C;  5CBN A;  3VP9 A;  4HH2 A;  3H1I J;  2F23 A;  3RK3 D;  3VMA A;  4XDK A;  1W2B O;  2H7H A;  4ZHQ B;  1KKD A;  3P3P A;  3RL0 C;  1VQN V;  5CB4 B;  4PD4 D;  1OCO B;  1GN3 A;  4UV8 A;  1E1Q G;  1RE3 C;  1KYO E;  4TQF A;  2QA4 P;  1RSO A;  3CYO A;  4I0X A;  4IIJ A;  5J2T A;  5LMU B;  3CME P;  1Z5V A;  5FL7 G;  4J41 A;  3IC9 A;  3KZI Z;  3LW5 H;  4LNU B;  3UO2 A;  2FYU K;  2M8R A;  2FFD B;  4MVR A;  4I1L A;  3H1K H;  5EYP B;  3W7S A;  3CWB H;  4X66 O;  1SQQ D;  2KB7 P;  3L72 H;  3A2A A;  3SPG A;  3ZMV A;  2KK7 A;  5EK0 A;  2O1K A;  3L70 J;  5E79 E;  1O9G A;  1Q82 Q;  1HP8 A;  4FM1 A;  5IYZ B;  3GHG A;  1OHH G;  1AV1 A;  3IGA C;  1MV8 A;  3IF4 A;  5EC1 C;  3LNM B;  2V7Q J;  4MS2 A;  3N2G A;  3FB7 C;  3L74 D;  3D8C A;  3ZMZ A;  1FPO A;  4G27 B;  2IH1 C;  2RN0 A;  1FZG A;  4DR5 O;  1VL2 A;  2A06 G;  3OAA G;  1KIL D;  2P5O A;  4YIO A;  5DJU B;  2DQ3 A;  1SQF A;  2E74 C;  1P84 I;  3BAA A;  4YJ3 B;  4DV2 O;  1KC8 Q;  3TGU H;  3ZHT A;  1NTK H;  2BCC E;  2F66 C;  3CRR A;  1SQP K;  4R6Z A;  4HKZ H;  3A0H E;  1XMO B;  1HDJ A;  1VQ4 P;  1WPB A;  2P6J A;  3C90 A;  1NTZ E;  3ITK A;  2OT5 A;  3ETG A;  5LP6 C;  4B3M O;  1GL2 D;  4I6M C;  1S77 D;  1F23 A;  1VP7 A;  2PGD A;  2LQT A;  1MZ9 A;  3CXH I;  1QGK B;  3WUV A;  3VP8 A;  1SZT A;  2E75 B;  3OE7 G;  3MHV A;  4LFB O;  3RL0 D;  1DF5 A;  3HB3 B;  1Y67 A;  1Y66 A;  2KNC B;  1S9K D;  1FDM A;  2LFR A;  1HTL C;  3OTF A;  2Q69 A;  4QE7 A;  2XZR A;  3L70 D;  3AG2 C;  1K8A W;  4XBF A;  2R9I A;  3CC2 V;  3GG2 A;  4DV6 O;  5J2U A;  4DCK A;  2WSF J;  4JV5 B;  3WB0 A;  4PJ0 E;  1GU5 A;  2OYO A;  4J42 A;  4Y99 C;  1AQ5 A;  1ZME C;  4QMA A;  2JGD A;  3VMY A;  3D36 A;  1M8O B;  2AHY A;  1K5Q A;  2UUA B;  1NS1 A;  3S3X A;  4PD4 H;  1CXZ B;  4FFK A;  1N33 O;  5B5E H;  3QO8 A;  3EWK A;  1BS3 A;  4R7C A;  1LTJ B;  2WPS A;  3MDS A;  3H1H G;  5FLX N;  4UB8 E;  4O4J B;  2DWE C;  3Q4H A;  4LF4 O;  5EIB C;  3AE5 C;  1OCR B;  5KAF E;  1EN6 A;  1MG1 A;  3KG2 A;  1SQQ H;  2R70 A;  4JI8 O;  4ZKP A;  5TIS H;  1RF0 A;  4XE5 B;  3B2E E;  2E5T A;  1DLB A;  1TA8 A;  5E79 Z;  4FLZ A;  3USS A;  3J81 N;  3LDD A;  4JZG A;  5KHG A;  1PNL A;  3CMA V;  5KMG B;  1OVV A;  4I5S A;  3HTK B;  1OW8 A;  2E74 D;  2IBZ G;  2QWQ B;  1GK9 A;  3RVY A;  4ZKI A;  1S2E A;  2M0B A;  4MVO A;  3SYC A;  4UCT A;  4WCE V;  2F43 G;  1B04 A;  1K73 Q;  5FNV B;  3AE9 C;  3L74 H;  5CB4 A;  2QM8 A;  4LR3 A;  2ETN A;  2WLH A;  3H1I H;  1U7J A;  1N0N A;  1R6K A;  1J5E O;  2OTL V;  4WVZ A;  2IJI A;  1FS0 G;  1NU1 K;  3CRM A;  5KAI E;  3A0H Z;  1VMG A;  4LNU A;  2BCC J;  1X4T A;  1QR8 A;  4NPE A;  4JTA B;  1RF1 C;  5EYP A;  1X9V A;  2QJK B;  1NTZ J;  2YKO A;  3CL3 D;  1IFD A;  2IBZ I;  1X0T A;  1L0N K;  4LGD E;  1KN7 A;  5B1A C;  1W2B U;  1FJP A;  5DED A;  5IYZ A;  3KZI H;  1L0N D;  1K97 A;  1LTT C;  3AED C;  3ZJZ A;  4GKJ O;  3BFR A;  3J7A U;  1RF1 B;  2WSS G;  2HKO A;  1GM9 A;  3V4W A;  3JYC A;  4PJ0 Z;  1LTA C;  2WZ7 A;  3CX5 D;  1HNZ O;  1TUE B;  1CI6 B;  3KCX A;  2P10 A;  1LGH B;  5EIB D;  2V7Q H;  1SET A;  2Q5Z A;  4YJ3 A;  2DOS A;  1TUB B;  2JEE A;  4Z1M H;  4U3F H;  1AJN A;  1HW7 A;  4UB8 Z;  3IAO A;  1GN2 A;  3MTU E;  1HGZ A;  2Y0E A;  4DUY O;  3WB2 A;  3WUU A;  3I5C A;  2YID A;  2W0F C;  1M90 W;  1AB3 A;  5KAF Z;  4X1Y B;  1BDC A;  5JJN B;  1MA1 A;  1Q6U A;  1JJO A;  1NTZ D;  2DW4 A;  2KNC A;  1I5X A;  5IY5 C;  3ZHV A;  4YXW H;  4JTC B;  1KMI Z;  2BTO A;  1HH0 A;  3QTC A;  2HR3 A;  1ZR2 A;  5LL6 Y;  4UV9 A;  3K5M A;  3FB5 C;  4DRX B;  1I94 B;  1GK4 A;  4MSW C;  4CPG A;  2FXO A;  4JI3 O;  2LO1 A;  2UWJ E;  2JK5 C;  5B1B B;  1OZ0 A;  4DR4 O;  2QSA A;  3MHH C;  1LTS C;  1F4M A;  1LTJ A;  5IY5 B;  1S5L E;  5KAI Z;  4KT0 J;  2WSF H;  2C9N Y;  2FXM A;  3G3Z A;  4FK5 C;  1NQT A;  1Y74 B;  4O4J A;  2Y48 A;  3F5H A;  1PNM A;  5IJ0 B;  3MZW B;  2WPQ A;  5KA6 A;  2YXQ B;  4B3S B;  3CXC U;  3C8V A;  3H01 A;  2PTM A;  3EXA A;  3PLN A;  2BAS A;  1KYO H;  2K3R A;  4BW5 A;  4PA3 A;  2N9B A;  1CW5 A;  5BU8 B;  2YI8 A;  1ZSP A;  4BW9 A;  5KMG A;  3L37 A;  4C46 A;  3HTK A;  1WRG A;  1BGY G;  4LF7 O;  3UIA A;  4F6E A;  1CZQ A;  1Q86 Q;  2LGQ A;  2A79 B;  5AVX B;  5FNV A; 
#chains in the Genus database with same CATH homology
 3R4Y A;  1NYH A;  3SFE C;  1YQ4 C;  4OGQ C;  1VF5 C;  2MKV A;  1YQ3 C;  1ZP0 C;  4H44 D;  3AE3 C;  2OQQ A;  3AEE C;  3GLM A;  2D2C B;  2WPV B;  2ZT9 B;  1S5L X;  1VL2 A;  2BEZ F;  3T97 B;  2WSE J;  3IN6 A;  2E74 C;  2JP3 A;  1K04 A;  4H13 D;  1DD3 A;  2QSI A;  3Q5R A;  3RL0 g;  1S1C X;  3AED C;  1Q90 D;  3AE7 C;  3GF7 A;  1EXI A;  3SFD C;  1KQG B;  2BEQ D;  4R4M A;  2O01 J;  5M1B A;  2E76 B;  1FDO A;  2YMK A;  5KLI C;  1VF5 B;  3GF3 A;  1JB0 J;  4I7Z B;  2D2C D;  2G3A A;  1RQU A;  2P10 A;  2ZT9 D;  3AEC C;  1OMI A;  5L8R J;  3D6Y A;  3AE4 C;  2E75 B;  4IL6 X;  3AE2 C;  1R8E A;  3D70 A;  4Z1M H;  1PL5 A;  3AE1 C;  3D71 A;  1UIX A;  3AE8 C;  1RQV A;  3GMA A;  3RK3 E;  3AEF C;  3IAO A;  1KTM A;  2E76 D;  2WSC J;  4PV1 C;  2YIU C;  1NGM B;  2QJP C;  4H0L B;  1VF5 D;  4XFJ A;  4YTP C;  1OW6 A;  3Q2Y A;  2E75 D;  2WSF J;  1MKM A;  1TU3 F;  3D6Z A;  1ZME C;  1HF9 A;  4OGQ B;  2QJY C;  1EXJ A;  2FBW C;  1KOR A;  4H13 C;  2J5U A;  3EWK A;  1ZOY C;  3LW5 J;  1KMI Z;  4PV1 D;  4H0L D;  2IDB A;  2QJK C;  1KQF B;  3Q5P A;  1PIX A;  3O6Q A;  1IK7 A;  3AEB C;  4RKU J;  3Q5S A;  2E74 B;  2D2C C;  2FXP A;  4R4L A;  2NZ2 A;  2ZT9 C;  4GDO A;  3H25 A;  3AE5 C;  4OGQ D;  3B71 A;  4U7J A;  3Q1M A;  4H44 C;  1WMK A;  2QIW A;  1GMJ A;  2WQY C;  3S9O A;  4KT0 J;  3G9R A;  2E76 C;  1OW8 A;  2E74 D;  2G8Y A;  1Y9B A;  3ABV C;  5KKZ C;  1AJY A;  1K05 A;  4I7Z C;  3C8V A;  1FDI A;  4Y28 J;  1KIL E;  2E75 C;  4PV1 B;  1OW7 A;  1ZRT E;  3AE9 C;  3AE6 C;  4TT3 H;  2H88 C;  4H44 B;  3FGA D;  2FYN C;  3AEA C;  1U57 A;  2K9Y A;  4H0L C;  1DD4 A;  2H89 C;  2JO1 A;  1DIP A;  1PV3 A;  4YXD C;  4H13 B;  3Q3D A;  3AEG C;  2V7Q J;  1HJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...