3QH9A

Human liprin-beta2 coiled-coil
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
66
structure length
66
Chain Sequence
QEEKQRKAEELLQELRHLKIKVEELENERNQYEWKLKATKAEVAQLQEQVALKDAEIERLHSQLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Liprin-beta-2
publication title Crystal structure of the central coiled-coil domain from human liprin-beta2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 33
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2011-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1160 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Vasodilator-stimulated phosphoprotein 3qh9A00
3SSUA 3QH9A 3MUDC 3SWKA 4YPCA 1USDA 3S4RA 1USEA
chains in the Genus database with same CATH superfamily
1W2BO 3G9RA 4HKZH 3FXDA 1ZLLA 2YKPA 2GM4A 4C7NB 3KHUA 4WB4A 3WUTA 2O3JA 4IL6E 2N1TA 4H13C 1L0LJ 2K9JA 5CCHA 1Y8AA 5GTHH 2I8DA 2BCCD 2GUSA 3FWNA 1SQVE 1PIXA 1SQXD 2Y0EA 4EI2A 1ZXGA 1BE3E 4OVNF 4ZKPA 2XU6A 1BSHA 1FAVA 3P7KA 4UB8H 2WSEH 1GW3A 1E79H 1PPJG 1EZVE 2KXPB 3CC7P 2FFDB 4A7PA 1LNQA 1T3JA 1L0NE 1IFIA 3H1KG 5AW4B 1NJIQ 2XDJA 3R4YA 1KB9D 4BRYB 3GW6A 3HUSB 1LT9C 4L76A 3VMYA 3M0DA 1EDKA 1OWAA 2V7QJ 4JQ0D 1RQUA 2QRXA 5KTBA 1PGOA 3AEAC 5KAIH 1GK4A 1QEXA 2N1TD 5CCHD 1L0LE 1R5LA 3CCUP 2M8RA 3HD7A 2FYNB 1Q81Q 4W7YA 1LTJC 1IFNA 1M1JC 3CWBG 4AQRD 4NPEA 3QWOC 3CX5H 1N7SD 3KYQA 4OGQD 1VQ7P 1IK9A 1VQ5P 1GL2B 3CCJP 2ZVOB 2GA1A 1X0TA 1VQPP 3A0HE 1JM0A 2RN0A 1KQSO 1CI6B 1OZHA 3M06A 1BGYG 3CMAP 1PGQA 3AEEC 2YMKA 1NU1E 1JTHB 5AW5B 3L71G 1J1DC 4D6TJ 1FZGA 4PV1C 1UIIA 1H88A 3I56P 4U3FG 1OW8A 3AEBC 2HPCB 3AE9C 3GMAA 3L70G 3HD7D 2WVRA 2QJKB 2Z4EA 2DW3A 4EOTA 1JNMA 5L8RJ 2FYUG 2OYIA 1S2EA 2WPQA 2ZXXA 4R4MA 2WT7A 1KMIZ 5CCGA 2NZ2A 3M9QA 2YIUC 1NTME 1HWTC 3H1LG 4KT0J 3L73J 3CCVP 1RF1C 3S1KA 1ZRTD 2YMYA 1S5LE 2Y0CA 2NPSB 2YXRB 3PLNA 3AEGC 3RK3B 5CMZA 1SQVG 2ZYAA 1RF1A 3M9HA 2YKOA 4UB6H 1HTLC 4D6TE 1G2CA 1LTBC 2BEZF 2RKLA 2Z5IA 1HJ0A 1KB9I 1EDIA 3MIWA 1SQPJ 1EZVG 4JF7A 5KAFE 4YXWH 3AE2C 1M90Q 5CHXA 1JMBA 2B87A 3FGAD 1Z56A 4GKGA 1RE3C 5AVUB 3USSA 4IFMA 4JBZA 3GG2A 1PP9D 3HUSC 1FDMA 3H32A 2PFXA 3P8CD 3L73D 5CCGD 2KP8A 1N86A 3IN6A 2R3CA 3LIEA 1YJWP 1NU1K 4PD4D 1RE3A 5BU5A 3T97A 3NFQA 2N9BA 4Y99B 1KYOE 3O8ZA 4ZMDA 1U57A 3CCSP 5C39A 1BSNA 2IPPA 2KNCB 5AW8B 2JWDA 4L75A 1LTTC 3CCLP 4YXDC 1A02F 1L0LG 5AVVB 1W2EA 2A06D 1DD4A 2WSSH 3CXHE 1IFMA 2M0BA 1ZN5A 3SWFA 5KLVJ 1G1IA 1K8AQ 1N73C 1RHZB 2H7HA 1SQPD 4I2LC 5CJ0A 1NOHA 1KTMA 2QSIA 3CCQP 1AVOA 4K35A 4I7ZB 2ZT9C 4Z1MH 3CCRP 1S72P 1N73A 3D6ZA 3CCEP 1GL2C 1YQ3C 3RL0C 1OVVA 1SFCA 2A45G 2D2CD 2QJYC 2E74D 4K3AA 1FZEA 2C9LY 2OYHA 1JY2N 2FXMA 4H0LC 1QL2A 1P84E 3SSUA 1ZR2A 3CLQA 1G1JA 1S9KE 1X22A 2JWAA 2ZJSE 3AE1C 2OQQA 1WRGA 3IF4A 1SVFA 3CI9A 3L36A 4R4LA 2LR2A 5KLVE 2W8ZA 2QE7H 1N7SB 4JYBA 3CPWO 2FYZA 2IBZE 2KK7A 1X79B 1NTKK 1ZMEC 1YTZT 1LTAC 2WITA 4H44C 2ZYDA 2N9YB 3UIAA 1VDFA 4W7ZA 1GU4A 2WPSA 1RH5B 4WWIA 5KLIB 3FWLA 1SFCD 2NPSC 1DEEG 1FJPA 1FZBA 1AVYA 1PL5A 3AEDC 5KJ7A 2V4HA 4D6TG 4LLHA 3AE8C 3U59A 2HYNA 2XNXA 4PD4H 2K88A 1S4XA 2PAJA 2K9YA 4UB8E 2W6BA 4M3LA 3LIDA 3WU2E 5APVA 2C0WA 5B66H 1KV4A 1SP4A 1VF5D 2WWWA 3HTKA 4IL6X 2KLUA 1OW6A 2FXPA 1OVUA 2ZYGA 1LGHB 1BGYD 1JY2P 5APYA 2PP6A 3L73G 3TDKA 2ZFCA 1ZW0A 2WQYC 3L71D 1SQVJ 2QJPB 1WMKA 4N3YB 3L75E 1KFNA 1BE3J 4N78D 2HODA 1W5CE 2Q3EA 3U1AA 1LTSC 5M1BA 1M7LA 3D71A 3MUDC 2IZ1A 5KJ7D 1YITP 1SQQE 1JY3O 1NTZK 3V2PA 2IZ0A 4ASVA 1L0NJ 2YNYA 1YBKA 3L37A 1GW4A 1LT1A 1SQPG 4GOEA 3F5HA 3MUDA 1SQBK 3GF3A 2XZRA 2E76D 1MFTA 1GU5A 2CPSA 3TGUE 3II6A 3CL3D 1NGMB 4WY4D 2AEMA 1M1KQ 5AVYB 2P1JA 3G71P 1BCCE 4YTPC 3ZDMA 1SQVD 3M91A 1J1EB 1R8EA 2IBZI 1JMMA 3VN0A 1RE4C 1BE3D 1URQC 3B8EB 3A2AA 1T2KD 2K3RA 3B5ND 4LC1A 2FXOA 2W83C 1EC5A 1EZVD 2KIKA 4W80A 5AVSB 3TNUA 2HFED 1L0ND 1IK7A 2IFNA 1USEA 1DEBA 5KLVG 3SWYA 5B5EH 2KS1A 3H1JE 4RO0A 2IBZG 4RJTA 4I6MC 3BASA 2B87B 2LXCB 2Q3IA 3C1LA 3F89A 2O1KA 1S3JA 2D2CB 3H32B 3KZIE 2E74B 5KLIC 1NU1J 1FE6A 1JB0J 1LT9A 1FZCC 3IR9A 1L0LD 3MZWB 2M5AA 3RK2C 1IFJA 2W27A 4U7JA 3SFEC 1SLQA 1SQQK 3PTZA 2WSCH 1T6AA 4MN4C 1FZCA 3RBXA 1OMIA 2HLOA 4HYTB 1L4AB 2G8YA 3JCUH 3A0BE 2SPZA 4H13D 2ZVNB 1GZLA 1PGJA 3K5BA 1K9MQ 3M0AA 1XTGB 1AJYA 3MD0A 3V2QA 1NTMJ 1LTJA 2XV5A 3AEFC 3HRNA 1M1JA 2M3BA 3BCCJ 2FYUK 2KYVA 4PJ0H 2CPBA 1NU1D 3FXEA 1HGZA 4IFFA 1FU1A 1Q2NA 1EDLA 3L72E 1KD1Q 3NTNA 2E75C 4RKUJ 3CCMP 1KILB 3KDPB 2POHA 4HJGH 4IL6H 1VQLP 1QL1A 4L74A 4XA4A 3EFFK 1SQXK 1VL2A 1VF5B 2Q9IA 1NTMD 3HE5A 3TGUG 2BEQD 3V6IA 1RF0C 1QX8A 1GTWA 3H1IE 5E79H 3V4WA 1AA0A 4DOJA 2P2UA 2WSFJ 1FZAA 1PV3A 1GD2E 3BCCE 3CD6P 3V4QA 1RF0A 1BCCG 2E5YA 1VPCA 1IFPA 1EZVI 2Q7CA 5APUA 1NHLA 3A3YB 5GTIH 2B88A 2AEJA 4D6TD 5AW6B 5AVXB 4C7NA 1T3UA 1KB9H 2Q5UA 4DCKA 3HE4B 3GF7A 1BE3G 2P67A 1VQKP 4BXLA 2W6JH 5CBNA 1D7MA 5TJHA 1X9VA 2FFDC 1L0NG 1LP1A 2QVAA 4PV1D 3P8MC 1HJBA 2E76B 1OIPA 2JO1A 5APWA 3SWKA 3A5TA 3BRVB 4WY4B 3P32A 2UWJE 3RGUA 3O6QB 4C7RA 3WMM0 4HB1A 1NTKE 1YJ9P 3EQ2A 1KYOD 3WUVA 3CMEP 2WPRA 2C0XA 4BRYA 1KQFB 3HUSA 1N8RQ 1SS1A 2QA4P 3CXHD 2WTYA 3AE7C 5AVWB 1QVFO 3C9IA 1R5SA 3B5NB 2YO3A 3GHGB 1AFOA 2V7QH 1L4AC 2FYNC 2Q6QA 5APXA 5TISH 3LW5J 3MGNA 2A45I 5AW3B 5H2FE 1LWUB 1U7MA 3CC4P 4EDFA 1SQBJ 3H1HJ 4ZNCA 4EIJA 1PGPA 4I1LA 4XE5B 2B9BA 3IAOA 3E1RA 2QIWA 2WMMA 2KZIA 2IYOA 3VMZA 3V2RA 1MZ9A 2VRSA 1Q90D 1GL2A 1NU1G 2E5TA 1P84D 3RBZA 1FDOA 1S9KD 1CI6A 2N1TB 3KXDA 2K9JB 1KILC 1FS0E 1KQLA 2K37A 2WSEJ 4WBAA 5K5GB 3L4FA 5KLVD 1OFCX 4H13B 4NPDA 2IBZD 2QJKC 4YPCA 4JYCA 3MP7B 1NTZE 2HPCA 1M8OB 3TF5A 4IFDK 4OGQB 1GDTA 3H1HD 1K04A 3H1IG 3I5CA 1NTMG 1SQBE 1HVVA 1NYHA 3L74J 3H1HE 1KORA 3BCCG 3SFDC 1PPJE 4GIFA 1NKNA 1U7JA 2ZT9D 5CBOA 3H1KE 1M57D 2QM7A 3L75J 1FBMA 2NRGA 3RK3C 5GTHE 1LT9B 1GL2D 3RL0D 2M5AB 1SQQJ 2HR3A 2NPSA 3RL0g 1IFDA 1NWQA 2O1JA 1VQ8P 1IJDB 1H0TA 5APQA 3HD7B 1E5WA 5AVRB 3ABVC 2OTJP 5B5EE 3IFMA 2E43A 1AQTA 5BU8B 1KYOI 3TGUJ 4N6JA 4H0LD 1RQVA 2ZAEB 1MUUA 1KILE 3OA7A 4HH2A 3CXHI 1EQ7A 4GT1A 2KB7P 1BCCJ 3CWBE 2P10A 3AE6C 1Q86Q 3L74E 2Z5HA 4Y99C 1S1CX 1OX3A 3L75D 5KAIE 4B86A 2OTLP 2KSEA 4H44D 3CC2P 1DIPA 1L2PA 2AXTH 1SQQD 1H8AA 1FZFA 3PP5A 3AE5C 2KNCA 1BDCA 2JR8A 2R5DA 2NPSD 3H1JJ 4OWFA 3U1CA 2W90A 2L5GB 1J1DB 2Y9YA 2BCCJ 4EYYQ 4PV1B 3TGUD 3PH0A 4I7ZC 1MV8A 2H8PD 4QMAA 2FBWC 4CPGA 3RK3E 3CX5E 1HUCA 3D6YA 1P84I 2OYIB 3L70E 2WT7B 1YIJP 1JUNA 1BCCD 1VQMP 1QLED 2PGDA 4ASWA 2FYUE 5APSA 2JKVA 1T8ZA 4KHXA 4TT3H 1HF9A 2N1TC 5CCHC 3N4XA 3H1LE 2LKMA 1LJ2A 2GUVA 1RF1B 2IFMA 1JY2O 2Q1KA 2QM8A 1WT6A 2J58A 2MKVA 3BVHA 5EFWB 2R3SA 3Q2YA 1G2CB 3H1JD 2XKMA 1RE4A 1URQA 2WPVB 4DJGA 2E42A 2P7JA 1JOCA 1NTZG 2H88C 1N7SC 1EDJA 2JJLA 4OGQC 1ZV8A 4TLFA 1LP1B 2BCCE 2ITAA 3G4SP 3Q5RA 1SQXE 1SQBG 5E79E 3B4SA 1KN7A 3G3ZA 3H1HG 3R2PA 3V2NA 3WU2H 1N7SA 1HGVA 3M0DC 3L72J 2FKWB 2ZXEB 3D70A 3Q5SA 3T97B 5GTIE 4DT0A 1DX7A 3OW2O 1MKMA 2YO2A 3L35A 1KB9E 4UB6E 3MHVA 3KPEA 1YJNP 5KKZB 2R32A 3HD7C 1UIXA 1XTCC 1FJKA 1URQD 3VMAA 3H1IJ 1FDIA 1LTGC 1S5LX 5AVQB 1VQ9P 3A7OA 1N73B 1OW7A 1J2JB 3L74G 3Q1MA 3JC22 2ZT9B 3L72D 1NAYA 1ZOYC 5AW2B 1SFCB 2QJPC 2IX7C 3S9OA 2OYHB 3CX5I 3L75G 3RL0B 1JCCA 2R5BA 4IOIH 2P58A 2QJYB 2CK3H 1SQVK 1SQQG 3EWKA 1NAFA 2PRRA 5TISE 1NH4A 2O01H 3RK2D 1ZR4A 4H0LB 3H1ID 1NO4A 2YKQA 1QVGO 1CW5A 4BWNA 2QEXP 1L0NK 1NTKJ 2OYIC 3BCCD 1JCDA 2BASA 2OARA 1K73Q 2Y0DA 5CCGC 1Q7YQ 3W68A 2RH0A 5AW1B 4H44B 3BATA 2IYPA 1PP9J 2Y9ZA 2R44A 1J1EC 1HH0A 3G6EP 4AYCA 3KZIH 2B89A 2JP3A 1IO4A 3W67A 3N7NA 1KC8Q 1L0LK 1ZRTE 1FOSE 5DJUB 4AUWA 3JSVC 1Y47A 1H0TB 3H1JG 2E75D 3VP9A 4LGDE 2BCCG 1NKZB 3S4RA 1SQXG 3Q3DA 2KZJA 3BRTB 1NTKD 2KLVA 3AECC 3A0BH 2FFDA 3HTKB 1FC2C 4L73A 2D2CC 2E74C 1YQ4C 3VYIA 1AQ5A 2IDBA 5BVZA 5CJ4A 2YXQB 1HBWA 1IC2A 1IZNB 5AW9B 1K05A 3PJSK 1PP9E 3A0HH 1EXJA 5KKZC 1JO5A 2A45H 2WZ7A 2HODB 3P8CE 3L73E 4PD4E 1NTZJ 3B71A 1JY3N 3MTUE 1VQ4P 1KZUB 1Q82Q 1YTZI 5B66E 1DD3A 1L4AA 4KJMA 2A06E 3Q5PA 4Y28J 2RMZA 3KQGA 3TSIA 2JEEA 3H1KJ 5APTA 2KUBA 1SQPE 1NTMK 1KFMA 1USDA 1SFCC 2KOGA 2KI7B 2MJZA 3H6PA 3L72G 2OYHC 2H43A 1MFZA 3GLMA 1GK6A 1TU3F 2AXTE 1ZP0C 4ZKUA 1S5LH 3NMDA 1JTHA 5AW7B 2J59M 1GMJA 1NTZD 3AE3C 1EXIA 2C9NY 4RESB 1YI2P 1KILA 1URQB 3TNUB 1Y9BA 2L91A 2AXCA 1VF5C 2H89C 3M9BA 1SQBD 2KS1B 2OGUA 1AV1A 1VQ6P 4O9BA 1VQNP 3AE4C 1PPJD 3FX0A 3CWBJ 2I1KA 1L4AD 4GODA 2QG4A 3OJAB 3E1IA 1NVOA 3H1KD 5KAFH 3I55P 3C8VA 1VQOP 4WVZA 1QGKB 5AW0B 2WSCJ 2W6AA 4GOFA 1LTIC 3VP8A 3V5BA 1BGYJ 2WSFH 5KJ7C 1JY3P 3PHLA 2I1JA 1KYOH 3L71J 2O01N 1RY3A 1FZCB 1OXZA 3HE4A 5DJTB 4JPZB 3RK2B 4U3FJ 1YHQP 4XFJA 2OTKE 3ITKA 1N7LA 2E76C 3CXHH 1KILD 2AEFA 3L70J 2G3AA 3WUUA 1KQGB 1SQPK 3CWBD 1PZQA 3H25A 1LTJB 4WY4C 2FY8A 3L74D 3EFGA 1A02J 5H2FH 2FYUJ 1NTKG 1M1JB 4C46A 1JEKA 4PD4I 4WY4A 3TYYA 1PFIA 3O6QA 3H1LJ 4NPFX 1PP9G 1T2KC 3B5NC 2KSJA 3OAKA 3GHGC 5AVZB 3NXSA 4DZOA 3VTPC 2O01J 2JDIH 1BGYE 5AVTB 2M3EA 3JCUE 1OVRA 3B5NA 3RK3D 3CX5D 4U3FD 3GHGA 2E75B 3VMXA 3L71E 1LWUC 2XNDH 1DH3A 1P84H 3PRJA 1SQXJ 1N2DC 1CSBA 3L70D 4U3FE 2OYOA 5KLVK 4N78E 2K1AA 2A06G 1YYCA 3HE5B 1LWUA 2FYUD 1X8YA 4GDOA 2LXBA 1H89A 1M56D 4PJ0E 2J5UA 1CZQA 3LW5H 2HG5D 1FOSF 1BDDA 3VOPA 3H1LD 3QH9A 3E7KA 3TK1A 4OH8B 2YIUB
chains in the Genus database with same CATH topology
3SSUA 3QH9A 3MUDC 3SWKA 4YPCA 1USDA 3S4RA 1USEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SSU A;  3QH9 A;  3MUD C;  3SWK A;  4YPC A;  1USD A;  3S4R A;  1USE A; 
#chains in the Genus database with same CATH topology
 1W2B O;  3G9R A;  4HKZ H;  3FXD A;  1ZLL A;  2YKP A;  2GM4 A;  4C7N B;  3KHU A;  4WB4 A;  3WUT A;  2O3J A;  4IL6 E;  2N1T A;  4H13 C;  1L0L J;  2K9J A;  5CCH A;  1Y8A A;  5GTH H;  2I8D A;  2BCC D;  2GUS A;  3FWN A;  1SQV E;  1PIX A;  1SQX D;  2Y0E A;  4EI2 A;  1ZXG A;  1BE3 E;  4OVN F;  4ZKP A;  2XU6 A;  1BSH A;  1FAV A;  3P7K A;  4UB8 H;  2WSE H;  1GW3 A;  1E79 H;  1PPJ G;  1EZV E;  2KXP B;  3CC7 P;  2FFD B;  4A7P A;  1LNQ A;  1T3J A;  1L0N E;  1IFI A;  3H1K G;  5AW4 B;  1NJI Q;  2XDJ A;  3R4Y A;  1KB9 D;  4BRY B;  3GW6 A;  3HUS B;  1LT9 C;  4L76 A;  3VMY A;  3M0D A;  1EDK A;  1OWA A;  2V7Q J;  4JQ0 D;  1RQU A;  2QRX A;  5KTB A;  1PGO A;  3AEA C;  5KAI H;  1GK4 A;  1QEX A;  2N1T D;  5CCH D;  1L0L E;  1R5L A;  3CCU P;  2M8R A;  3HD7 A;  2FYN B;  1Q81 Q;  4W7Y A;  1LTJ C;  1IFN A;  1M1J C;  3CWB G;  4AQR D;  4NPE A;  3QWO C;  3CX5 H;  1N7S D;  3KYQ A;  4OGQ D;  1VQ7 P;  1IK9 A;  1VQ5 P;  1GL2 B;  3CCJ P;  2ZVO B;  2GA1 A;  1X0T A;  1VQP P;  3A0H E;  1JM0 A;  2RN0 A;  1KQS O;  1CI6 B;  1OZH A;  3M06 A;  1BGY G;  3CMA P;  1PGQ A;  3AEE C;  2YMK A;  1NU1 E;  1JTH B;  5AW5 B;  3L71 G;  1J1D C;  4D6T J;  1FZG A;  4PV1 C;  1UII A;  1H88 A;  3I56 P;  4U3F G;  1OW8 A;  3AEB C;  2HPC B;  3AE9 C;  3GMA A;  3L70 G;  3HD7 D;  2WVR A;  2QJK B;  2Z4E A;  2DW3 A;  4EOT A;  1JNM A;  5L8R J;  2FYU G;  2OYI A;  1S2E A;  2WPQ A;  2ZXX A;  4R4M A;  2WT7 A;  1KMI Z;  5CCG A;  2NZ2 A;  3M9Q A;  2YIU C;  1NTM E;  1HWT C;  3H1L G;  4KT0 J;  3L73 J;  3CCV P;  1RF1 C;  3S1K A;  1ZRT D;  2YMY A;  1S5L E;  2Y0C A;  2NPS B;  2YXR B;  3PLN A;  3AEG C;  3RK3 B;  5CMZ A;  1SQV G;  2ZYA A;  1RF1 A;  3M9H A;  2YKO A;  4UB6 H;  1HTL C;  4D6T E;  1G2C A;  1LTB C;  2BEZ F;  2RKL A;  2Z5I A;  1HJ0 A;  1KB9 I;  1EDI A;  3MIW A;  1SQP J;  1EZV G;  4JF7 A;  5KAF E;  4YXW H;  3AE2 C;  1M90 Q;  5CHX A;  1JMB A;  2B87 A;  3FGA D;  1Z56 A;  4GKG A;  1RE3 C;  5AVU B;  3USS A;  4IFM A;  4JBZ A;  3GG2 A;  1PP9 D;  3HUS C;  1FDM A;  3H32 A;  2PFX A;  3P8C D;  3L73 D;  5CCG D;  2KP8 A;  1N86 A;  3IN6 A;  2R3C A;  3LIE A;  1YJW P;  1NU1 K;  4PD4 D;  1RE3 A;  5BU5 A;  3T97 A;  3NFQ A;  2N9B A;  4Y99 B;  1KYO E;  3O8Z A;  4ZMD A;  1U57 A;  3CCS P;  5C39 A;  1BSN A;  2IPP A;  2KNC B;  5AW8 B;  2JWD A;  4L75 A;  1LTT C;  3CCL P;  4YXD C;  1A02 F;  1L0L G;  5AVV B;  1W2E A;  2A06 D;  1DD4 A;  2WSS H;  3CXH E;  1IFM A;  2M0B A;  1ZN5 A;  3SWF A;  5KLV J;  1G1I A;  1K8A Q;  1N73 C;  1RHZ B;  2H7H A;  1SQP D;  4I2L C;  5CJ0 A;  1NOH A;  1KTM A;  2QSI A;  3CCQ P;  1AVO A;  4K35 A;  4I7Z B;  2ZT9 C;  4Z1M H;  3CCR P;  1S72 P;  1N73 A;  3D6Z A;  3CCE P;  1GL2 C;  1YQ3 C;  3RL0 C;  1OVV A;  1SFC A;  2A45 G;  2D2C D;  2QJY C;  2E74 D;  4K3A A;  1FZE A;  2C9L Y;  2OYH A;  1JY2 N;  2FXM A;  4H0L C;  1QL2 A;  1P84 E;  3SSU A;  1ZR2 A;  3CLQ A;  1G1J A;  1S9K E;  1X22 A;  2JWA A;  2ZJS E;  3AE1 C;  2OQQ A;  1WRG A;  3IF4 A;  1SVF A;  3CI9 A;  3L36 A;  4R4L A;  2LR2 A;  5KLV E;  2W8Z A;  2QE7 H;  1N7S B;  4JYB A;  3CPW O;  2FYZ A;  2IBZ E;  2KK7 A;  1X79 B;  1NTK K;  1ZME C;  1YTZ T;  1LTA C;  2WIT A;  4H44 C;  2ZYD A;  2N9Y B;  3UIA A;  1VDF A;  4W7Z A;  1GU4 A;  2WPS A;  1RH5 B;  4WWI A;  5KLI B;  3FWL A;  1SFC D;  2NPS C;  1DEE G;  1FJP A;  1FZB A;  1AVY A;  1PL5 A;  3AED C;  5KJ7 A;  2V4H A;  4D6T G;  4LLH A;  3AE8 C;  3U59 A;  2HYN A;  2XNX A;  4PD4 H;  2K88 A;  1S4X A;  2PAJ A;  2K9Y A;  4UB8 E;  2W6B A;  4M3L A;  3LID A;  3WU2 E;  5APV A;  2C0W A;  5B66 H;  1KV4 A;  1SP4 A;  1VF5 D;  2WWW A;  3HTK A;  4IL6 X;  2KLU A;  1OW6 A;  2FXP A;  1OVU A;  2ZYG A;  1LGH B;  1BGY D;  1JY2 P;  5APY A;  2PP6 A;  3L73 G;  3TDK A;  2ZFC A;  1ZW0 A;  2WQY C;  3L71 D;  1SQV J;  2QJP B;  1WMK A;  4N3Y B;  3L75 E;  1KFN A;  1BE3 J;  4N78 D;  2HOD A;  1W5C E;  2Q3E A;  3U1A A;  1LTS C;  5M1B A;  1M7L A;  3D71 A;  3MUD C;  2IZ1 A;  5KJ7 D;  1YIT P;  1SQQ E;  1JY3 O;  1NTZ K;  3V2P A;  2IZ0 A;  4ASV A;  1L0N J;  2YNY A;  1YBK A;  3L37 A;  1GW4 A;  1LT1 A;  1SQP G;  4GOE A;  3F5H A;  3MUD A;  1SQB K;  3GF3 A;  2XZR A;  2E76 D;  1MFT A;  1GU5 A;  2CPS A;  3TGU E;  3II6 A;  3CL3 D;  1NGM B;  4WY4 D;  2AEM A;  1M1K Q;  5AVY B;  2P1J A;  3G71 P;  1BCC E;  4YTP C;  3ZDM A;  1SQV D;  3M91 A;  1J1E B;  1R8E A;  2IBZ I;  1JMM A;  3VN0 A;  1RE4 C;  1BE3 D;  1URQ C;  3B8E B;  3A2A A;  1T2K D;  2K3R A;  3B5N D;  4LC1 A;  2FXO A;  2W83 C;  1EC5 A;  1EZV D;  2KIK A;  4W80 A;  5AVS B;  3TNU A;  2HFE D;  1L0N D;  1IK7 A;  2IFN A;  1USE A;  1DEB A;  5KLV G;  3SWY A;  5B5E H;  2KS1 A;  3H1J E;  4RO0 A;  2IBZ G;  4RJT A;  4I6M C;  3BAS A;  2B87 B;  2LXC B;  2Q3I A;  3C1L A;  3F89 A;  2O1K A;  1S3J A;  2D2C B;  3H32 B;  3KZI E;  2E74 B;  5KLI C;  1NU1 J;  1FE6 A;  1JB0 J;  1LT9 A;  1FZC C;  3IR9 A;  1L0L D;  3MZW B;  2M5A A;  3RK2 C;  1IFJ A;  2W27 A;  4U7J A;  3SFE C;  1SLQ A;  1SQQ K;  3PTZ A;  2WSC H;  1T6A A;  4MN4 C;  1FZC A;  3RBX A;  1OMI A;  2HLO A;  4HYT B;  1L4A B;  2G8Y A;  3JCU H;  3A0B E;  2SPZ A;  4H13 D;  2ZVN B;  1GZL A;  1PGJ A;  3K5B A;  1K9M Q;  3M0A A;  1XTG B;  1AJY A;  3MD0 A;  3V2Q A;  1NTM J;  1LTJ A;  2XV5 A;  3AEF C;  3HRN A;  1M1J A;  2M3B A;  3BCC J;  2FYU K;  2KYV A;  4PJ0 H;  2CPB A;  1NU1 D;  3FXE A;  1HGZ A;  4IFF A;  1FU1 A;  1Q2N A;  1EDL A;  3L72 E;  1KD1 Q;  3NTN A;  2E75 C;  4RKU J;  3CCM P;  1KIL B;  3KDP B;  2POH A;  4HJG H;  4IL6 H;  1VQL P;  1QL1 A;  4L74 A;  4XA4 A;  3EFF K;  1SQX K;  1VL2 A;  1VF5 B;  2Q9I A;  1NTM D;  3HE5 A;  3TGU G;  2BEQ D;  3V6I A;  1RF0 C;  1QX8 A;  1GTW A;  3H1I E;  5E79 H;  3V4W A;  1AA0 A;  4DOJ A;  2P2U A;  2WSF J;  1FZA A;  1PV3 A;  1GD2 E;  3BCC E;  3CD6 P;  3V4Q A;  1RF0 A;  1BCC G;  2E5Y A;  1VPC A;  1IFP A;  1EZV I;  2Q7C A;  5APU A;  1NHL A;  3A3Y B;  5GTI H;  2B88 A;  2AEJ A;  4D6T D;  5AW6 B;  5AVX B;  4C7N A;  1T3U A;  1KB9 H;  2Q5U A;  4DCK A;  3HE4 B;  3GF7 A;  1BE3 G;  2P67 A;  1VQK P;  4BXL A;  2W6J H;  5CBN A;  1D7M A;  5TJH A;  1X9V A;  2FFD C;  1L0N G;  1LP1 A;  2QVA A;  4PV1 D;  3P8M C;  1HJB A;  2E76 B;  1OIP A;  2JO1 A;  5APW A;  3SWK A;  3A5T A;  3BRV B;  4WY4 B;  3P32 A;  2UWJ E;  3RGU A;  3O6Q B;  4C7R A;  3WMM 0;  4HB1 A;  1NTK E;  1YJ9 P;  3EQ2 A;  1KYO D;  3WUV A;  3CME P;  2WPR A;  2C0X A;  4BRY A;  1KQF B;  3HUS A;  1N8R Q;  1SS1 A;  2QA4 P;  3CXH D;  2WTY A;  3AE7 C;  5AVW B;  1QVF O;  3C9I A;  1R5S A;  3B5N B;  2YO3 A;  3GHG B;  1AFO A;  2V7Q H;  1L4A C;  2FYN C;  2Q6Q A;  5APX A;  5TIS H;  3LW5 J;  3MGN A;  2A45 I;  5AW3 B;  5H2F E;  1LWU B;  1U7M A;  3CC4 P;  4EDF A;  1SQB J;  3H1H J;  4ZNC A;  4EIJ A;  1PGP A;  4I1L A;  4XE5 B;  2B9B A;  3IAO A;  3E1R A;  2QIW A;  2WMM A;  2KZI A;  2IYO A;  3VMZ A;  3V2R A;  1MZ9 A;  2VRS A;  1Q90 D;  1GL2 A;  1NU1 G;  2E5T A;  1P84 D;  3RBZ A;  1FDO A;  1S9K D;  1CI6 A;  2N1T B;  3KXD A;  2K9J B;  1KIL C;  1FS0 E;  1KQL A;  2K37 A;  2WSE J;  4WBA A;  5K5G B;  3L4F A;  5KLV D;  1OFC X;  4H13 B;  4NPD A;  2IBZ D;  2QJK C;  4YPC A;  4JYC A;  3MP7 B;  1NTZ E;  2HPC A;  1M8O B;  3TF5 A;  4IFD K;  4OGQ B;  1GDT A;  3H1H D;  1K04 A;  3H1I G;  3I5C A;  1NTM G;  1SQB E;  1HVV A;  1NYH A;  3L74 J;  3H1H E;  1KOR A;  3BCC G;  3SFD C;  1PPJ E;  4GIF A;  1NKN A;  1U7J A;  2ZT9 D;  5CBO A;  3H1K E;  1M57 D;  2QM7 A;  3L75 J;  1FBM A;  2NRG A;  3RK3 C;  5GTH E;  1LT9 B;  1GL2 D;  3RL0 D;  2M5A B;  1SQQ J;  2HR3 A;  2NPS A;  3RL0 g;  1IFD A;  1NWQ A;  2O1J A;  1VQ8 P;  1IJD B;  1H0T A;  5APQ A;  3HD7 B;  1E5W A;  5AVR B;  3ABV C;  2OTJ P;  5B5E E;  3IFM A;  2E43 A;  1AQT A;  5BU8 B;  1KYO I;  3TGU J;  4N6J A;  4H0L D;  1RQV A;  2ZAE B;  1MUU A;  1KIL E;  3OA7 A;  4HH2 A;  3CXH I;  1EQ7 A;  4GT1 A;  2KB7 P;  1BCC J;  3CWB E;  2P10 A;  3AE6 C;  1Q86 Q;  3L74 E;  2Z5H A;  4Y99 C;  1S1C X;  1OX3 A;  3L75 D;  5KAI E;  4B86 A;  2OTL P;  2KSE A;  4H44 D;  3CC2 P;  1DIP A;  1L2P A;  2AXT H;  1SQQ D;  1H8A A;  1FZF A;  3PP5 A;  3AE5 C;  2KNC A;  1BDC A;  2JR8 A;  2R5D A;  2NPS D;  3H1J J;  4OWF A;  3U1C A;  2W90 A;  2L5G B;  1J1D B;  2Y9Y A;  2BCC J;  4EYY Q;  4PV1 B;  3TGU D;  3PH0 A;  4I7Z C;  1MV8 A;  2H8P D;  4QMA A;  2FBW C;  4CPG A;  3RK3 E;  3CX5 E;  1HUC A;  3D6Y A;  1P84 I;  2OYI B;  3L70 E;  2WT7 B;  1YIJ P;  1JUN A;  1BCC D;  1VQM P;  1QLE D;  2PGD A;  4ASW A;  2FYU E;  5APS A;  2JKV A;  1T8Z A;  4KHX A;  4TT3 H;  1HF9 A;  2N1T C;  5CCH C;  3N4X A;  3H1L E;  2LKM A;  1LJ2 A;  2GUV A;  1RF1 B;  2IFM A;  1JY2 O;  2Q1K A;  2QM8 A;  1WT6 A;  2J58 A;  2MKV A;  3BVH A;  5EFW B;  2R3S A;  3Q2Y A;  1G2C B;  3H1J D;  2XKM A;  1RE4 A;  1URQ A;  2WPV B;  4DJG A;  2E42 A;  2P7J A;  1JOC A;  1NTZ G;  2H88 C;  1N7S C;  1EDJ A;  2JJL A;  4OGQ C;  1ZV8 A;  4TLF A;  1LP1 B;  2BCC E;  2ITA A;  3G4S P;  3Q5R A;  1SQX E;  1SQB G;  5E79 E;  3B4S A;  1KN7 A;  3G3Z A;  3H1H G;  3R2P A;  3V2N A;  3WU2 H;  1N7S A;  1HGV A;  3M0D C;  3L72 J;  2FKW B;  2ZXE B;  3D70 A;  3Q5S A;  3T97 B;  5GTI E;  4DT0 A;  1DX7 A;  3OW2 O;  1MKM A;  2YO2 A;  3L35 A;  1KB9 E;  4UB6 E;  3MHV A;  3KPE A;  1YJN P;  5KKZ B;  2R32 A;  3HD7 C;  1UIX A;  1XTC C;  1FJK A;  1URQ D;  3VMA A;  3H1I J;  1FDI A;  1LTG C;  1S5L X;  5AVQ B;  1VQ9 P;  3A7O A;  1N73 B;  1OW7 A;  1J2J B;  3L74 G;  3Q1M A;  3JC2 2;  2ZT9 B;  3L72 D;  1NAY A;  1ZOY C;  5AW2 B;  1SFC B;  2QJP C;  2IX7 C;  3S9O A;  2OYH B;  3CX5 I;  3L75 G;  3RL0 B;  1JCC A;  2R5B A;  4IOI H;  2P58 A;  2QJY B;  2CK3 H;  1SQV K;  1SQQ G;  3EWK A;  1NAF A;  2PRR A;  5TIS E;  1NH4 A;  2O01 H;  3RK2 D;  1ZR4 A;  4H0L B;  3H1I D;  1NO4 A;  2YKQ A;  1QVG O;  1CW5 A;  4BWN A;  2QEX P;  1L0N K;  1NTK J;  2OYI C;  3BCC D;  1JCD A;  2BAS A;  2OAR A;  1K73 Q;  2Y0D A;  5CCG C;  1Q7Y Q;  3W68 A;  2RH0 A;  5AW1 B;  4H44 B;  3BAT A;  2IYP A;  1PP9 J;  2Y9Z A;  2R44 A;  1J1E C;  1HH0 A;  3G6E P;  4AYC A;  3KZI H;  2B89 A;  2JP3 A;  1IO4 A;  3W67 A;  3N7N A;  1KC8 Q;  1L0L K;  1ZRT E;  1FOS E;  5DJU B;  4AUW A;  3JSV C;  1Y47 A;  1H0T B;  3H1J G;  2E75 D;  3VP9 A;  4LGD E;  2BCC G;  1NKZ B;  3S4R A;  1SQX G;  3Q3D A;  2KZJ A;  3BRT B;  1NTK D;  2KLV A;  3AEC C;  3A0B H;  2FFD A;  3HTK B;  1FC2 C;  4L73 A;  2D2C C;  2E74 C;  1YQ4 C;  3VYI A;  1AQ5 A;  2IDB A;  5BVZ A;  5CJ4 A;  2YXQ B;  1HBW A;  1IC2 A;  1IZN B;  5AW9 B;  1K05 A;  3PJS K;  1PP9 E;  3A0H H;  1EXJ A;  5KKZ C;  1JO5 A;  2A45 H;  2WZ7 A;  2HOD B;  3P8C E;  3L73 E;  4PD4 E;  1NTZ J;  3B71 A;  1JY3 N;  3MTU E;  1VQ4 P;  1KZU B;  1Q82 Q;  1YTZ I;  5B66 E;  1DD3 A;  1L4A A;  4KJM A;  2A06 E;  3Q5P A;  4Y28 J;  2RMZ A;  3KQG A;  3TSI A;  2JEE A;  3H1K J;  5APT A;  2KUB A;  1SQP E;  1NTM K;  1KFM A;  1USD A;  1SFC C;  2KOG A;  2KI7 B;  2MJZ A;  3H6P A;  3L72 G;  2OYH C;  2H43 A;  1MFZ A;  3GLM A;  1GK6 A;  1TU3 F;  2AXT E;  1ZP0 C;  4ZKU A;  1S5L H;  3NMD A;  1JTH A;  5AW7 B;  2J59 M;  1GMJ A;  1NTZ D;  3AE3 C;  1EXI A;  2C9N Y;  4RES B;  1YI2 P;  1KIL A;  1URQ B;  3TNU B;  1Y9B A;  2L91 A;  2AXC A;  1VF5 C;  2H89 C;  3M9B A;  1SQB D;  2KS1 B;  2OGU A;  1AV1 A;  1VQ6 P;  4O9B A;  1VQN P;  3AE4 C;  1PPJ D;  3FX0 A;  3CWB J;  2I1K A;  1L4A D;  4GOD A;  2QG4 A;  3OJA B;  3E1I A;  1NVO A;  3H1K D;  5KAF H;  3I55 P;  3C8V A;  1VQO P;  4WVZ A;  1QGK B;  5AW0 B;  2WSC J;  2W6A A;  4GOF A;  1LTI C;  3VP8 A;  3V5B A;  1BGY J;  2WSF H;  5KJ7 C;  1JY3 P;  3PHL A;  2I1J A;  1KYO H;  3L71 J;  2O01 N;  1RY3 A;  1FZC B;  1OXZ A;  3HE4 A;  5DJT B;  4JPZ B;  3RK2 B;  4U3F J;  1YHQ P;  4XFJ A;  2OTK E;  3ITK A;  1N7L A;  2E76 C;  3CXH H;  1KIL D;  2AEF A;  3L70 J;  2G3A A;  3WUU A;  1KQG B;  1SQP K;  3CWB D;  1PZQ A;  3H25 A;  1LTJ B;  4WY4 C;  2FY8 A;  3L74 D;  3EFG A;  1A02 J;  5H2F H;  2FYU J;  1NTK G;  1M1J B;  4C46 A;  1JEK A;  4PD4 I;  4WY4 A;  3TYY A;  1PFI A;  3O6Q A;  3H1L J;  4NPF X;  1PP9 G;  1T2K C;  3B5N C;  2KSJ A;  3OAK A;  3GHG C;  5AVZ B;  3NXS A;  4DZO A;  3VTP C;  2O01 J;  2JDI H;  1BGY E;  5AVT B;  2M3E A;  3JCU E;  1OVR A;  3B5N A;  3RK3 D;  3CX5 D;  4U3F D;  3GHG A;  2E75 B;  3VMX A;  3L71 E;  1LWU C;  2XND H;  1DH3 A;  1P84 H;  3PRJ A;  1SQX J;  1N2D C;  1CSB A;  3L70 D;  4U3F E;  2OYO A;  5KLV K;  4N78 E;  2K1A A;  2A06 G;  1YYC A;  3HE5 B;  1LWU A;  2FYU D;  1X8Y A;  4GDO A;  2LXB A;  1H89 A;  1M56 D;  4PJ0 E;  2J5U A;  1CZQ A;  3LW5 H;  2HG5 D;  1FOS F;  1BDD A;  3VOP A;  3H1L D;  3QH9 A;  3E7K A;  3TK1 A;  4OH8 B;  2YIU B; 
#chains in the Genus database with same CATH homology
 3SSU A;  3QH9 A;  3MUD C;  3SWK A;  4YPC A;  1USD A;  3S4R A;  1USE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...