3QH9A

Human liprin-beta2 coiled-coil
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
66
structure length
66
Chain Sequence
QEEKQRKAEELLQELRHLKIKVEELENERNQYEWKLKATKAEVAQLQEQVALKDAEIERLHSQLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Liprin-beta-2
publication title Crystal structure of the central coiled-coil domain from human liprin-beta2
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2011-01-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1160 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Vasodilator-stimulated phosphoprotein 3qh9A00
1USDA 4YPCA 1USEA 3MUDC 3SWKA 3QH9A 3SSUA 3S4RA
chains in the Genus database with same CATH superfamily
2DW3A 1VL2A 1MV8A 2WPRA 1NYHA 1AFOA 5AVZB 3H1LD 2WMMA 2XNDH 1ZXGA 1NTZE 3M0DA 2WITA 3TNUB 1LP1A 2N1TD 5AVXB 3H1KJ 1L0NJ 1OW7A 1P84H 2HYNA 3N7NA 1T6AA 1M7LA 1DD4A 2WWWA 3I5CA 2WSEH 1JY2P 2OTKE 3C8VA 1ZR4A 3AE1C 3SWKA 5CMZA 3L4FA 4IFFA 1K04A 1FDIA 1EZVE 2QJPC 1YBKA 1PP9E 1LTJC 1LWUB 3BCCE 5CCGA 1BSNA 5TJHA 1L0NK 1KZUB 2NPSD 2H88C 3A7OA 2WT7A 2B87A 1EQ7A 3MIWA 1USEA 3GHGC 2FXMA 1OX3A 3L72D 4PJ0E 1BE3J 3I55P 2KSJA 3HUSB 4XFJA 3CCVP 1KN7A 1GZLA 2HODA 3P8CE 2BCCD 1OVUA 1NU1E 5H2FH 2P1JA 1M8OB 1MFTA 4OGQD 1IO4A 1LT9B 4Y99C 3L73D 1KC8Q 3CC2P 1NO4A 1CI6A 1FZBA 2IBZD 2KNCA 2Q1KA 5CCHC 3PLNA 1UIXA 3CX5E 1WMKA 1S5LE 2KIKA 3L36A 3LIEA 1IK7A 1Y8AA 5KLIC 1VDFA 4ZMDA 1OIPA 2HFED 3FXEA 1RHZB 3WU2H 2FYUD 3HTKB 3BATA 3KYQA 1GK4A 3A2AA 5AW4B 2IPPA 2A06E 2OYOA 1ZOYC 5CJ4A 1JOCA 1CSBA 2HG5D 2YIUC 4D6TE 1BGYG 1HUCA 1NVOA 2JP3A 1L0LE 2O3JA 3EQ2A 1Q90D 3EFFK 3VN0A 1SLQA 1KB9D 2M5AB 1LTSC 1OFCX 1ZRTD 1AVOA 4ZKPA 1D7MA 2PP6A 2XDJA 2PRRA 1PIXA 1EC5A 2A45H 1SQPG 3AEDC 1T2KD 1IFIA 1HTLC 2E76C 4PD4D 2JR8A 1ZLLA 1NJIQ 3A3YB 2QJPB 1NHLA 3S4RA 5BU8B 2W6AA 2WPQA 1LTJB 1ZW0A 2E75C 1H0TA 2E5TA 5M1BA 2ZAEB 4H0LC 3FX0A 5DJTB 1E79H 1VQ4P 3RK2C 1L4AA 3GHGB 1YJNP 3HD7A 3MP7B 3KDPB 3AEAC 4Z1MH 1R5SA 1MZ9A 1KYOI 3AE9C 4DCKA 1SQQD 5GTHH 3CWBJ 2KUBA 2LXCB 1BGYJ 3CXHI 3E7KA 4U7JA 3CCSP 2MKVA 4Y99B 1H89A 1SQBJ 3CPWO 4I6MC 3AE2C 4QMAA 2R44A 1KILD 1U57A 3L75G 2WSEJ 5KKZC 1HWTC 2AEJA 1SQPJ 4RKUJ 2C9LY 2QRXA 1G2CA 1OZHA 3CCQP 1URQB 2O01J 3L70G 3AEGC 1Y47A 1EDIA 2E76D 2Q7CA 2R32A 1SQBK 3LIDA 3M9BA 1LGHB 2YIUB 1DEBA 2E75D 3GMAA 2BCCE 3IF4A 2WT7B 5APQA 2W8ZA 4U3FD 1FBMA 1SQPK 1BCCE 1EXIA 4H0LD 3L73E 3B8EB 3VP9A 1AVYA 4UB6H 3VMXA 3VYIA 2IYPA 1HF9A 2IBZE 1AJYA 1FZFA 2A45G 1H88A 2HODB 2QM8A 4AUWA 3M0AA 1FZCA 1ZN5A 4LGDE 2QJYB 2FYUE 4JBZA 2QIWA 3LW5J 2H89C 5AVVB 1GL2D 3PP5A 3H32B 2ZYDA 2GUVA 1CI6B 1RF1A 4L76A 2KNCB 2K9YA 1JY2N 2Q3IA 3SSUA 3L75J 4O9BA 1X0TA 5AW3B 1KQSO 4W7YA 1FOSF 3FXDA 1X8YA 1YJ9P 3RK2B 3L71D 2N1TA 1L2PA 1KB9E 4UB8H 5E79E 1YITP 3Q1MA 2YO2A 4HB1A 3T97B 2KK7A 1KQGB 4GIFA 1IC2A 1S5LX 3RL0D 4PD4E 2WTYA 1GU5A 1OXZA 1PFIA 3H1IG 3H1LG 2GM4A 1FOSE 1Y9BA 3S9OA 3TGUD 2AXTE 5DJUB 1M1JC 2IFNA 2QSIA 2NPSA 1AA0A 4HYTB 5KKZB 2SPZA 2ZT9B 1LWUC 3V2RA 1IFMA 4JYBA 4WB4A 1NOHA 1N7SA 2H8PD 3TYYA 4BRYA 4WY4D 4H44D 2AEMA 1SQQE 1HH0A 3PHLA 4EYYQ 1KMIZ 2E43A 2JWDA 2Y0DA 2FYZA 3AEEC 3AEBC 2W27A 1SFCB 2YKPA 2HLOA 4N3YB 2V7QJ 1LT9C 2PGDA 1S1CX 1KILE 1PZQA 3L72G 2L91A 3IR9A 1YIJP 5B5EE 3NXSA 3KPEA 5APVA 3H1HG 3F5HA 1KYOH 2BCCG 2YMKA 2KYVA 2JDIH 3D70A 3CI9A 3H1IJ 2V4HA 3H1LJ 1KQLA 3A0BH 4GOFA 3L73G 5KAIH 3CXHH 2AXCA 1DX7A 3GF3A 2N9YB 1CW5A 3NFQA 1JUNA 4WWIA 2FXPA 1OVVA 4XE5B 4U3FE 3HE5A 1G2CB 2GUSA 2KS1A 1Q82Q 1P84E 1ZR2A 3SWFA 5GTIE 5L8RJ 4HH2A 2W90A 4WBAA 2R3CA 2Q9IA 1JY2O 4RESB 2WSCJ 3WUTA 1IFDA 1YYCA 3CCMP 3Q5PA 2WSFH 2XU6A 2Z5HA 1PGPA 2JWAA 1IJDB 1JM0A 2ZYGA 1M1JB 1NWQA 3UIAA 4I2LC 3U59A 2O01H 3L72J 2Z4EA 3U1AA 3CCRP 2KXPB 2ITAA 5AVTB 3MZWB 1FZCB 3BRVB 2OYIC 1ZV8A 3WMM0 3AE7C 3G3ZA 3H1HJ 3OAKA 2IYOA 2BCCJ 3L71E 5KAFH 4ZNCA 1HJBA 1N73A 5KLVD 4IOIH 3QH9A 1RF1B 2POHA 3L73J 1SQVG 1L0ND 5C39A 1NAFA 5AVWB 2HPCB 2BASA 3L74G 1GTWA 1EDJA 1KILA 2MJZA 3TGUE 3A5TA 3WUVA 2RMZA 1VQOP 1VQMP 1T3UA 1BCCD 3LW5H 1Q81Q 3AE5C 2W83C 3WU2E 3V2PA 2L5GB 3KQGA 3VMZA 3V2NA 3M06A 1SQQG 2R3SA 3USSA 4PJ0H 3P32A 1FDOA 2NRGA 3RK3C 3CLQA 3G71P 2K37A 3B4SA 3MD0A 5B66H 4DT0A 2P10A 1GMJA 4OH8B 3RBZA 1URQC 3AEFC 4YXWH 3SFDC 3HE4A 4GOEA 3O6QA 4TT3H 5CCGC 3E1IA 1GDTA 4L73A 3CWBG 1KQFB 1RQUA 1T3JA 1N7SB 1S5LH 4BRYB 1YTZT 2KP8A 4GDOA 2KOGA 1NTKG 4B86A 1JTHB 1SQVJ 1SQBG 2CPSA 3CMAP 1R5LA 3CC4P 3V6IA 1UIIA 1GL2A 2FFDA 3L74J 1YJWP 3AE6C 3L37A 3V5BA 1LNQA 2M3EA 4PD4I 2P58A 1SVFA 2QJYC 4U3FG 1S9KD 3CCUP 1PPJD 2FKWB 1SQVK 1NTZG 3B71A 2OYIB 1DIPA 1ZMEC 1SQQJ 2P2UA 5CCHD 1GU4A 1EDKA 5AW6B 2RKLA 1Q2NA 1N7LA 5AVQB 5AVSB 1HVVA 5EFWB 3RK3D 2HR3A 3PRJA 4TLFA 2WQYC 4JF7A 1EZVG 4I1LA 1URQD 3QWOC 1JY3P 1PP9G 3B5NA 4EI2A 2V7QH 1LTTC 5TISE 3BCCG 3TDKA 3HRNA 2I1KA 1BDCA 1QL1A 1FS0E 1SQQK 2N9BA 2PAJA 2K3RA 1NTKJ 4AQRD 1KYOD 2O1KA 2RN0A 1LP1B 2B88A 2WSFJ 1N2DC 2ZT9C 2FY8A 4EOTA 4WY4A 1K9MQ 3RK3B 1RF0A 1RE4A 4U3FJ 5KLVE 2Q6QA 1EXJA 4EDFA 2G3AA 1G1IA 1NU1G 3GF7A 1RE3A 1YTZI 1L0NE 1IFNA 2BEZF 5AW9B 1NTKK 1FJPA 1AQTA 1G1JA 1NTZJ 4C46A 1W2BO 2WSCH 3GW6A 5CHXA 1YQ3C 3ABVC 2B87B 4JYCA 2G8YA 1FC2C 1VQ6P 4H13C 3RL0g 1L4AC 3I56P 1J1EC 1P84D 3MHVA 4YXDC 4LC1A 3RK2D 1SFCC 3TNUA 1GW4A 1QGKB 1SQPD 1PP9J 1IZNB 1M57D 1JCDA 1E5WA 2A06G 3BCCJ 4NPEA 1NTZK 1T8ZA 2H7HA 2WZ7A 2FYNB 2Y9ZA 3MUDA 4D6TG 3GG2A 1A02F 3NTNA 1L0LG 2IZ0A 2LR2A 2VRSA 1QVFO 1EZVI 2QJKC 1S4XA 3GLMA 1X79B 4NPFX 5AVRB 3IFMA 5BU5A 3V4WA 3TSIA 2D2CC 1PGOA 4C7RA 1J1DB 3Q5SA 4IL6E 3AE4C 3JCUH 5AW8B 2ZT9D 2E74C 1NU1J 4KHXA 2XZRA 3KHUA 4W7ZA 3TGUJ 3R4YA 2E5YA 1LTIC 1AV1A 5APYA 3HUSA 4JQ0D 4YTPC 3BASA 1H8AA 1RQVA 2JEEA 3KZIH 1NKZB 3G4SP 3VMAA 4WVZA 2P7JA 5APWA 1S9KE 1SQXD 1GW3A 1PPJE 1OVRA 1NTMD 1NU1K 2LXBA 1FZEA 1KB9H 2J59M 1SFCD 1VQ5P 5E79H 1FZCC 3CX5I 3L70D 2B9BA 3G6EP 4OVNF 1Q7YQ 3HTKA 3A0HE 4D6TJ 4R4MA 1L0LJ 1LTGC 3H1JD 3RK3E 1IK9A 2OYHA 1RF1C 4PD4H 1DD3A 2YKOA 1H0TB 1N8RQ 2ZVNB 1TU3F 3NMDA 2AXTH 1FDMA 2ZXEB 1K8AQ 4H13B 1L4AB 1J1EB 2N1TC 1M90Q 3D71A 3HD7B 5KLVG 1KYOE 2M5AA 3P8MC 3KXDA 2IDBA 1OMIA 1LJ2A 1L0LK 2C0WA 3B5NB 1WT6A 2AEFA 4OWFA 4IFDK 1FZGA 2I8DA 2YXQB 2OTJP 3JC22 3CL3D 2Q3EA 2QJKB 1BCCG 1LTJA 3M9QA 2Y0EA 2CK3H 2NPSC 2D2CB 2WPSA 5APUA 2IBZG 3TK1A 2ZJSE 3V2QA 2KLVA 1K05A 2GA1A 3IAOA 2E74B 3GHGA 3SFEC 5B5EH 2FYUG 4DOJA 1N7SC 4IFMA 1R8EA 1SS1A 5K5GB 4R4LA 2Y9YA 2ZYAA 1SQPE 1KV4A 3W68A 3CCEP 1VF5B 2JO1A 1OWAA 2K1AA 4OGQC 4JPZB 4CPGA 1QVGO 3H1ID 1PGJA 1PL5A 3G9RA 1BE3G 2O01N 1IFJA 4HKZH 5KLVJ 1JY3N 5KAFE 5KJ7C 2C9NY 5CCHA 5GTIH 1YHQP 2ZXXA 1QLED 4PV1B 3SWYA 1NGMB 1FZAA 4GODA 3C9IA 3S1KA 1S3JA 1URQA 5AVUB 4RJTA 1VQ7P 3VP8A 1BCCJ 1VQ9P 1PPJG 3H1KD 5H2FE 5KLVK 1JB0J 1JMMA 2C0XA 4LLHA 3D6YA 5BVZA 1RY3A 3OJAB 2OTLP 1U7JA 4MN4C 1BSHA 2N1TB 1NAYA 1SQXE 3IN6A 3M9HA 4GKGA 2FYUJ 3L75E 1NTME 2K88A 3PJSK 1T2KC 1FJKA 3AE3C 1M56D 1N7SD 2IBZI 3M0DC 5B66E 2QEXP 3H1HD 5APTA 3BVHA 3U1CA 4A7PA 3L70E 1HJ0A 4DJGA 1GK6A 4IL6X 1QX8A 3H32A 3H1JE 4DZOA 4N6JA 5AW2B 1BE3D 2FYUK 2NPSB 2KLUA 4ZKUA 3TF5A 4C7NA 2WSSH 2QVAA 3H6PA 5KJ7D 3M91A 1A02J 2R5BA 1VQ8P 5AW1B 1VQKP 2W6JH 2JJLA 1FAVA 4HJGH 1RH5B 3CCLP 2KZIA 3VOPA 1USDA 2K9JA 1N73C 2M0BA 1VQLP 3CX5H 2OYHB 1KB9I 2KSEA 3T97A 4OGQB 1VQPP 1JO5A 1JEKA 3FGAD 3R2PA 3EWKA 3ZDMA 4AYCA 2XKMA 1KILC 2FYNC 2M8RA 3OW2O 1AQ5A 1OW6A 4KJMA 1SP4A 3Q2YA 5AW7B 1J1DC 3RBXA 2PFXA 1LTBC 4K35A 1SQVD 1JY3O 5GTHE 3OA7A 3PTZA 2IFMA 3L74D 2YNYA 1W5CE 1JMBA 2OGUA 1CZQA 1NH4A 2LKMA 3H1IE 3H1LE 4N78D 3HE5B 2KS1B 3E1RA 1U7MA 4ASVA 5CCGD 2FXOA 3L71G 5AVYB 1OW8A 1SFCA 5CJ0A 2QG4A 3FWNA 2WVRA 1GL2C 2FFDC 2UWJE 3Q5RA 3CXHD 1JNMA 1KORA 3MGNA 1SQXG 5TISH 2ZFCA 2YXRB 3H1KE 1KFMA 2QA4P 3TGUG 1NTMG 5KTBA 2KI7B 3C1LA 5AW0B 1YI2P 3VTPC 3BRTB 5KLIB 3CWBD 3AECC 4UB6E 1BGYD 3VMYA 2Y0CA 1LTAC 3FWLA 4Y28J 1NTKD 1N73B 1MKMA 1SQBD 2IZ1A 2BEQD 3L72E 1P84I 2IX7C 3H1JG 1X9VA 3HD7C 2OQQA 3JSVC 3RL0C 1DEEG 3RGUA 3H1HE 1N86A 3B5NC 1XTGB 4I7ZC 3MTUE 2KZJA 3EFGA 3D6ZA 3WUUA 1KILB 4K3AA 4L75A 2OARA 3L71J 1HBWA 1VPCA 1M1JA 1BE3E 3AE8C 1NTZD 1PGQA 2YMYA 2RH0A 3JCUE 1FE6A 3PH0A 3W67A 1S72P 1LWUA 1QL2A 5APSA 2WPVB 1YQ4C 3N4XA 2KB7P 2E76B 4KT0J 4UB8E 4WY4C 4H44C 1RF0C 1RE4C 1SQXJ 3KZIE 3Q3DA 2E75B 1M1KQ 1RE3C 1EZVD 2CPBA 4C7NB 1NTMJ 1PP9D 3HE4B 4EIJA 3O6QB 1HGZA 1KTMA 3BCCD 4H0LB 3H25A 2HPCA 3L35A 1W2EA 2O1JA 2ZVOB 4W80A 2H43A 1VF5C 1ZP0C 1IFPA 3L70J 2K9JB 5CBNA 1ZRTE 2W6BA 1FU1A 5APXA 4IL6H 1LT9A 2JKVA 3H1JJ 3CC7P 3II6A 5CBOA 1DH3A 3L75D 1EDLA 4H13D 1SQXK 2P67A 1L4AD 5AW5B 4GT1A 1GL2B 2M3BA 3ITKA 2FFDB 2YKQA 1NTMK 2QM7A 3HD7D 4YPCA 1HGVA 2J58A 1NKNA 2B89A 4PV1C 1LT1A 3P8CD 3V4QA 3B5ND 1NU1D 1SQVE 3MUDC 1X22A 4BWNA 1KD1Q 3O8ZA 4L74A 1XTCC 3L74E 1Z56A 2Z5IA 2I1JA 1WRGA 3CX5D 4N78E 2R5DA 2D2CD 1BDDA 2NZ2A 3F89A 1JTHA 2A45I 2XNXA 3RL0B 1PV3A 3H1KG 3A0HH 2E74D 1L0NG 2A06D 3HUSC 4I7ZB 1VQNP 1J2JB 3A0BE 4NPDA 5KAIE 3CXHE 4D6TD 2J5UA 2Q5UA 1GD2E 1L0LD 3K5BA 1VF5D 1MFZA 5KJ7A 1K73Q 4M3LA 1S2EA 1KFNA 3CWBE 4RO0A 3P7KA 4XA4A 2XV5A 2OYIA 1BGYE 2YO3A 2FBWC 4WY4B 4H44B 1NTKE 3CD6P 2E42A 1SQBE 1MUUA 4PV1D 1Q86Q 1JCCA 2QE7H 4BXLA 3CCJP 3CMEP 1QEXA 2OYHC 4ASWA
chains in the Genus database with same CATH topology
1USDA 4YPCA 1USEA 3MUDC 3SWKA 3QH9A 3SSUA 3S4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1USD A;  4YPC A;  1USE A;  3MUD C;  3SWK A;  3QH9 A;  3SSU A;  3S4R A; 
#chains in the Genus database with same CATH topology
 2DW3 A;  1VL2 A;  1MV8 A;  2WPR A;  1NYH A;  1AFO A;  5AVZ B;  3H1L D;  2WMM A;  2XND H;  1ZXG A;  1NTZ E;  3M0D A;  2WIT A;  3TNU B;  1LP1 A;  2N1T D;  5AVX B;  3H1K J;  1L0N J;  1OW7 A;  1P84 H;  2HYN A;  3N7N A;  1T6A A;  1M7L A;  1DD4 A;  2WWW A;  3I5C A;  2WSE H;  1JY2 P;  2OTK E;  3C8V A;  1ZR4 A;  3AE1 C;  3SWK A;  5CMZ A;  3L4F A;  4IFF A;  1K04 A;  1FDI A;  1EZV E;  2QJP C;  1YBK A;  1PP9 E;  1LTJ C;  1LWU B;  3BCC E;  5CCG A;  1BSN A;  5TJH A;  1L0N K;  1KZU B;  2NPS D;  2H88 C;  3A7O A;  2WT7 A;  2B87 A;  1EQ7 A;  3MIW A;  1USE A;  3GHG C;  2FXM A;  1OX3 A;  3L72 D;  4PJ0 E;  1BE3 J;  3I55 P;  2KSJ A;  3HUS B;  4XFJ A;  3CCV P;  1KN7 A;  1GZL A;  2HOD A;  3P8C E;  2BCC D;  1OVU A;  1NU1 E;  5H2F H;  2P1J A;  1M8O B;  1MFT A;  4OGQ D;  1IO4 A;  1LT9 B;  4Y99 C;  3L73 D;  1KC8 Q;  3CC2 P;  1NO4 A;  1CI6 A;  1FZB A;  2IBZ D;  2KNC A;  2Q1K A;  5CCH C;  3PLN A;  1UIX A;  3CX5 E;  1WMK A;  1S5L E;  2KIK A;  3L36 A;  3LIE A;  1IK7 A;  1Y8A A;  5KLI C;  1VDF A;  4ZMD A;  1OIP A;  2HFE D;  3FXE A;  1RHZ B;  3WU2 H;  2FYU D;  3HTK B;  3BAT A;  3KYQ A;  1GK4 A;  3A2A A;  5AW4 B;  2IPP A;  2A06 E;  2OYO A;  1ZOY C;  5CJ4 A;  1JOC A;  1CSB A;  2HG5 D;  2YIU C;  4D6T E;  1BGY G;  1HUC A;  1NVO A;  2JP3 A;  1L0L E;  2O3J A;  3EQ2 A;  1Q90 D;  3EFF K;  3VN0 A;  1SLQ A;  1KB9 D;  2M5A B;  1LTS C;  1OFC X;  1ZRT D;  1AVO A;  4ZKP A;  1D7M A;  2PP6 A;  2XDJ A;  2PRR A;  1PIX A;  1EC5 A;  2A45 H;  1SQP G;  3AED C;  1T2K D;  1IFI A;  1HTL C;  2E76 C;  4PD4 D;  2JR8 A;  1ZLL A;  1NJI Q;  3A3Y B;  2QJP B;  1NHL A;  3S4R A;  5BU8 B;  2W6A A;  2WPQ A;  1LTJ B;  1ZW0 A;  2E75 C;  1H0T A;  2E5T A;  5M1B A;  2ZAE B;  4H0L C;  3FX0 A;  5DJT B;  1E79 H;  1VQ4 P;  3RK2 C;  1L4A A;  3GHG B;  1YJN P;  3HD7 A;  3MP7 B;  3KDP B;  3AEA C;  4Z1M H;  1R5S A;  1MZ9 A;  1KYO I;  3AE9 C;  4DCK A;  1SQQ D;  5GTH H;  3CWB J;  2KUB A;  2LXC B;  1BGY J;  3CXH I;  3E7K A;  4U7J A;  3CCS P;  2MKV A;  4Y99 B;  1H89 A;  1SQB J;  3CPW O;  4I6M C;  3AE2 C;  4QMA A;  2R44 A;  1KIL D;  1U57 A;  3L75 G;  2WSE J;  5KKZ C;  1HWT C;  2AEJ A;  1SQP J;  4RKU J;  2C9L Y;  2QRX A;  1G2C A;  1OZH A;  3CCQ P;  1URQ B;  2O01 J;  3L70 G;  3AEG C;  1Y47 A;  1EDI A;  2E76 D;  2Q7C A;  2R32 A;  1SQB K;  3LID A;  3M9B A;  1LGH B;  2YIU B;  1DEB A;  2E75 D;  3GMA A;  2BCC E;  3IF4 A;  2WT7 B;  5APQ A;  2W8Z A;  4U3F D;  1FBM A;  1SQP K;  1BCC E;  1EXI A;  4H0L D;  3L73 E;  3B8E B;  3VP9 A;  1AVY A;  4UB6 H;  3VMX A;  3VYI A;  2IYP A;  1HF9 A;  2IBZ E;  1AJY A;  1FZF A;  2A45 G;  1H88 A;  2HOD B;  2QM8 A;  4AUW A;  3M0A A;  1FZC A;  1ZN5 A;  4LGD E;  2QJY B;  2FYU E;  4JBZ A;  2QIW A;  3LW5 J;  2H89 C;  5AVV B;  1GL2 D;  3PP5 A;  3H32 B;  2ZYD A;  2GUV A;  1CI6 B;  1RF1 A;  4L76 A;  2KNC B;  2K9Y A;  1JY2 N;  2Q3I A;  3SSU A;  3L75 J;  4O9B A;  1X0T A;  5AW3 B;  1KQS O;  4W7Y A;  1FOS F;  3FXD A;  1X8Y A;  1YJ9 P;  3RK2 B;  3L71 D;  2N1T A;  1L2P A;  1KB9 E;  4UB8 H;  5E79 E;  1YIT P;  3Q1M A;  2YO2 A;  4HB1 A;  3T97 B;  2KK7 A;  1KQG B;  4GIF A;  1IC2 A;  1S5L X;  3RL0 D;  4PD4 E;  2WTY A;  1GU5 A;  1OXZ A;  1PFI A;  3H1I G;  3H1L G;  2GM4 A;  1FOS E;  1Y9B A;  3S9O A;  3TGU D;  2AXT E;  5DJU B;  1M1J C;  2IFN A;  2QSI A;  2NPS A;  1AA0 A;  4HYT B;  5KKZ B;  2SPZ A;  2ZT9 B;  1LWU C;  3V2R A;  1IFM A;  4JYB A;  4WB4 A;  1NOH A;  1N7S A;  2H8P D;  3TYY A;  4BRY A;  4WY4 D;  4H44 D;  2AEM A;  1SQQ E;  1HH0 A;  3PHL A;  4EYY Q;  1KMI Z;  2E43 A;  2JWD A;  2Y0D A;  2FYZ A;  3AEE C;  3AEB C;  2W27 A;  1SFC B;  2YKP A;  2HLO A;  4N3Y B;  2V7Q J;  1LT9 C;  2PGD A;  1S1C X;  1KIL E;  1PZQ A;  3L72 G;  2L91 A;  3IR9 A;  1YIJ P;  5B5E E;  3NXS A;  3KPE A;  5APV A;  3H1H G;  3F5H A;  1KYO H;  2BCC G;  2YMK A;  2KYV A;  2JDI H;  3D70 A;  3CI9 A;  3H1I J;  2V4H A;  3H1L J;  1KQL A;  3A0B H;  4GOF A;  3L73 G;  5KAI H;  3CXH H;  2AXC A;  1DX7 A;  3GF3 A;  2N9Y B;  1CW5 A;  3NFQ A;  1JUN A;  4WWI A;  2FXP A;  1OVV A;  4XE5 B;  4U3F E;  3HE5 A;  1G2C B;  2GUS A;  2KS1 A;  1Q82 Q;  1P84 E;  1ZR2 A;  3SWF A;  5GTI E;  5L8R J;  4HH2 A;  2W90 A;  4WBA A;  2R3C A;  2Q9I A;  1JY2 O;  4RES B;  2WSC J;  3WUT A;  1IFD A;  1YYC A;  3CCM P;  3Q5P A;  2WSF H;  2XU6 A;  2Z5H A;  1PGP A;  2JWA A;  1IJD B;  1JM0 A;  2ZYG A;  1M1J B;  1NWQ A;  3UIA A;  4I2L C;  3U59 A;  2O01 H;  3L72 J;  2Z4E A;  3U1A A;  3CCR P;  2KXP B;  2ITA A;  5AVT B;  3MZW B;  1FZC B;  3BRV B;  2OYI C;  1ZV8 A;  3WMM 0;  3AE7 C;  3G3Z A;  3H1H J;  3OAK A;  2IYO A;  2BCC J;  3L71 E;  5KAF H;  4ZNC A;  1HJB A;  1N73 A;  5KLV D;  4IOI H;  3QH9 A;  1RF1 B;  2POH A;  3L73 J;  1SQV G;  1L0N D;  5C39 A;  1NAF A;  5AVW B;  2HPC B;  2BAS A;  3L74 G;  1GTW A;  1EDJ A;  1KIL A;  2MJZ A;  3TGU E;  3A5T A;  3WUV A;  2RMZ A;  1VQO P;  1VQM P;  1T3U A;  1BCC D;  3LW5 H;  1Q81 Q;  3AE5 C;  2W83 C;  3WU2 E;  3V2P A;  2L5G B;  3KQG A;  3VMZ A;  3V2N A;  3M06 A;  1SQQ G;  2R3S A;  3USS A;  4PJ0 H;  3P32 A;  1FDO A;  2NRG A;  3RK3 C;  3CLQ A;  3G71 P;  2K37 A;  3B4S A;  3MD0 A;  5B66 H;  4DT0 A;  2P10 A;  1GMJ A;  4OH8 B;  3RBZ A;  1URQ C;  3AEF C;  4YXW H;  3SFD C;  3HE4 A;  4GOE A;  3O6Q A;  4TT3 H;  5CCG C;  3E1I A;  1GDT A;  4L73 A;  3CWB G;  1KQF B;  1RQU A;  1T3J A;  1N7S B;  1S5L H;  4BRY B;  1YTZ T;  2KP8 A;  4GDO A;  2KOG A;  1NTK G;  4B86 A;  1JTH B;  1SQV J;  1SQB G;  2CPS A;  3CMA P;  1R5L A;  3CC4 P;  3V6I A;  1UII A;  1GL2 A;  2FFD A;  3L74 J;  1YJW P;  3AE6 C;  3L37 A;  3V5B A;  1LNQ A;  2M3E A;  4PD4 I;  2P58 A;  1SVF A;  2QJY C;  4U3F G;  1S9K D;  3CCU P;  1PPJ D;  2FKW B;  1SQV K;  1NTZ G;  3B71 A;  2OYI B;  1DIP A;  1ZME C;  1SQQ J;  2P2U A;  5CCH D;  1GU4 A;  1EDK A;  5AW6 B;  2RKL A;  1Q2N A;  1N7L A;  5AVQ B;  5AVS B;  1HVV A;  5EFW B;  3RK3 D;  2HR3 A;  3PRJ A;  4TLF A;  2WQY C;  4JF7 A;  1EZV G;  4I1L A;  1URQ D;  3QWO C;  1JY3 P;  1PP9 G;  3B5N A;  4EI2 A;  2V7Q H;  1LTT C;  5TIS E;  3BCC G;  3TDK A;  3HRN A;  2I1K A;  1BDC A;  1QL1 A;  1FS0 E;  1SQQ K;  2N9B A;  2PAJ A;  2K3R A;  1NTK J;  4AQR D;  1KYO D;  2O1K A;  2RN0 A;  1LP1 B;  2B88 A;  2WSF J;  1N2D C;  2ZT9 C;  2FY8 A;  4EOT A;  4WY4 A;  1K9M Q;  3RK3 B;  1RF0 A;  1RE4 A;  4U3F J;  5KLV E;  2Q6Q A;  1EXJ A;  4EDF A;  2G3A A;  1G1I A;  1NU1 G;  3GF7 A;  1RE3 A;  1YTZ I;  1L0N E;  1IFN A;  2BEZ F;  5AW9 B;  1NTK K;  1FJP A;  1AQT A;  1G1J A;  1NTZ J;  4C46 A;  1W2B O;  2WSC H;  3GW6 A;  5CHX A;  1YQ3 C;  3ABV C;  2B87 B;  4JYC A;  2G8Y A;  1FC2 C;  1VQ6 P;  4H13 C;  3RL0 g;  1L4A C;  3I56 P;  1J1E C;  1P84 D;  3MHV A;  4YXD C;  4LC1 A;  3RK2 D;  1SFC C;  3TNU A;  1GW4 A;  1QGK B;  1SQP D;  1PP9 J;  1IZN B;  1M57 D;  1JCD A;  1E5W A;  2A06 G;  3BCC J;  4NPE A;  1NTZ K;  1T8Z A;  2H7H A;  2WZ7 A;  2FYN B;  2Y9Z A;  3MUD A;  4D6T G;  3GG2 A;  1A02 F;  3NTN A;  1L0L G;  2IZ0 A;  2LR2 A;  2VRS A;  1QVF O;  1EZV I;  2QJK C;  1S4X A;  3GLM A;  1X79 B;  4NPF X;  5AVR B;  3IFM A;  5BU5 A;  3V4W A;  3TSI A;  2D2C C;  1PGO A;  4C7R A;  1J1D B;  3Q5S A;  4IL6 E;  3AE4 C;  3JCU H;  5AW8 B;  2ZT9 D;  2E74 C;  1NU1 J;  4KHX A;  2XZR A;  3KHU A;  4W7Z A;  3TGU J;  3R4Y A;  2E5Y A;  1LTI C;  1AV1 A;  5APY A;  3HUS A;  4JQ0 D;  4YTP C;  3BAS A;  1H8A A;  1RQV A;  2JEE A;  3KZI H;  1NKZ B;  3G4S P;  3VMA A;  4WVZ A;  2P7J A;  5APW A;  1S9K E;  1SQX D;  1GW3 A;  1PPJ E;  1OVR A;  1NTM D;  1NU1 K;  2LXB A;  1FZE A;  1KB9 H;  2J59 M;  1SFC D;  1VQ5 P;  5E79 H;  1FZC C;  3CX5 I;  3L70 D;  2B9B A;  3G6E P;  4OVN F;  1Q7Y Q;  3HTK A;  3A0H E;  4D6T J;  4R4M A;  1L0L J;  1LTG C;  3H1J D;  3RK3 E;  1IK9 A;  2OYH A;  1RF1 C;  4PD4 H;  1DD3 A;  2YKO A;  1H0T B;  1N8R Q;  2ZVN B;  1TU3 F;  3NMD A;  2AXT H;  1FDM A;  2ZXE B;  1K8A Q;  4H13 B;  1L4A B;  1J1E B;  2N1T C;  1M90 Q;  3D71 A;  3HD7 B;  5KLV G;  1KYO E;  2M5A A;  3P8M C;  3KXD A;  2IDB A;  1OMI A;  1LJ2 A;  1L0L K;  2C0W A;  3B5N B;  1WT6 A;  2AEF A;  4OWF A;  4IFD K;  1FZG A;  2I8D A;  2YXQ B;  2OTJ P;  3JC2 2;  3CL3 D;  2Q3E A;  2QJK B;  1BCC G;  1LTJ A;  3M9Q A;  2Y0E A;  2CK3 H;  2NPS C;  2D2C B;  2WPS A;  5APU A;  2IBZ G;  3TK1 A;  2ZJS E;  3V2Q A;  2KLV A;  1K05 A;  2GA1 A;  3IAO A;  2E74 B;  3GHG A;  3SFE C;  5B5E H;  2FYU G;  4DOJ A;  1N7S C;  4IFM A;  1R8E A;  1SS1 A;  5K5G B;  4R4L A;  2Y9Y A;  2ZYA A;  1SQP E;  1KV4 A;  3W68 A;  3CCE P;  1VF5 B;  2JO1 A;  1OWA A;  2K1A A;  4OGQ C;  4JPZ B;  4CPG A;  1QVG O;  3H1I D;  1PGJ A;  1PL5 A;  3G9R A;  1BE3 G;  2O01 N;  1IFJ A;  4HKZ H;  5KLV J;  1JY3 N;  5KAF E;  5KJ7 C;  2C9N Y;  5CCH A;  5GTI H;  1YHQ P;  2ZXX A;  1QLE D;  4PV1 B;  3SWY A;  1NGM B;  1FZA A;  4GOD A;  3C9I A;  3S1K A;  1S3J A;  1URQ A;  5AVU B;  4RJT A;  1VQ7 P;  3VP8 A;  1BCC J;  1VQ9 P;  1PPJ G;  3H1K D;  5H2F E;  5KLV K;  1JB0 J;  1JMM A;  2C0X A;  4LLH A;  3D6Y A;  5BVZ A;  1RY3 A;  3OJA B;  2OTL P;  1U7J A;  4MN4 C;  1BSH A;  2N1T B;  1NAY A;  1SQX E;  3IN6 A;  3M9H A;  4GKG A;  2FYU J;  3L75 E;  1NTM E;  2K88 A;  3PJS K;  1T2K C;  1FJK A;  3AE3 C;  1M56 D;  1N7S D;  2IBZ I;  3M0D C;  5B66 E;  2QEX P;  3H1H D;  5APT A;  3BVH A;  3U1C A;  4A7P A;  3L70 E;  1HJ0 A;  4DJG A;  1GK6 A;  4IL6 X;  1QX8 A;  3H32 A;  3H1J E;  4DZO A;  4N6J A;  5AW2 B;  1BE3 D;  2FYU K;  2NPS B;  2KLU A;  4ZKU A;  3TF5 A;  4C7N A;  2WSS H;  2QVA A;  3H6P A;  5KJ7 D;  3M91 A;  1A02 J;  2R5B A;  1VQ8 P;  5AW1 B;  1VQK P;  2W6J H;  2JJL A;  1FAV A;  4HJG H;  1RH5 B;  3CCL P;  2KZI A;  3VOP A;  1USD A;  2K9J A;  1N73 C;  2M0B A;  1VQL P;  3CX5 H;  2OYH B;  1KB9 I;  2KSE A;  3T97 A;  4OGQ B;  1VQP P;  1JO5 A;  1JEK A;  3FGA D;  3R2P A;  3EWK A;  3ZDM A;  4AYC A;  2XKM A;  1KIL C;  2FYN C;  2M8R A;  3OW2 O;  1AQ5 A;  1OW6 A;  4KJM A;  1SP4 A;  3Q2Y A;  5AW7 B;  1J1D C;  3RBX A;  2PFX A;  1LTB C;  4K35 A;  1SQV D;  1JY3 O;  5GTH E;  3OA7 A;  3PTZ A;  2IFM A;  3L74 D;  2YNY A;  1W5C E;  1JMB A;  2OGU A;  1CZQ A;  1NH4 A;  2LKM A;  3H1I E;  3H1L E;  4N78 D;  3HE5 B;  2KS1 B;  3E1R A;  1U7M A;  4ASV A;  5CCG D;  2FXO A;  3L71 G;  5AVY B;  1OW8 A;  1SFC A;  5CJ0 A;  2QG4 A;  3FWN A;  2WVR A;  1GL2 C;  2FFD C;  2UWJ E;  3Q5R A;  3CXH D;  1JNM A;  1KOR A;  3MGN A;  1SQX G;  5TIS H;  2ZFC A;  2YXR B;  3H1K E;  1KFM A;  2QA4 P;  3TGU G;  1NTM G;  5KTB A;  2KI7 B;  3C1L A;  5AW0 B;  1YI2 P;  3VTP C;  3BRT B;  5KLI B;  3CWB D;  3AEC C;  4UB6 E;  1BGY D;  3VMY A;  2Y0C A;  1LTA C;  3FWL A;  4Y28 J;  1NTK D;  1N73 B;  1MKM A;  1SQB D;  2IZ1 A;  2BEQ D;  3L72 E;  1P84 I;  2IX7 C;  3H1J G;  1X9V A;  3HD7 C;  2OQQ A;  3JSV C;  3RL0 C;  1DEE G;  3RGU A;  3H1H E;  1N86 A;  3B5N C;  1XTG B;  4I7Z C;  3MTU E;  2KZJ A;  3EFG A;  3D6Z A;  3WUU A;  1KIL B;  4K3A A;  4L75 A;  2OAR A;  3L71 J;  1HBW A;  1VPC A;  1M1J A;  1BE3 E;  3AE8 C;  1NTZ D;  1PGQ A;  2YMY A;  2RH0 A;  3JCU E;  1FE6 A;  3PH0 A;  3W67 A;  1S72 P;  1LWU A;  1QL2 A;  5APS A;  2WPV B;  1YQ4 C;  3N4X A;  2KB7 P;  2E76 B;  4KT0 J;  4UB8 E;  4WY4 C;  4H44 C;  1RF0 C;  1RE4 C;  1SQX J;  3KZI E;  3Q3D A;  2E75 B;  1M1K Q;  1RE3 C;  1EZV D;  2CPB A;  4C7N B;  1NTM J;  1PP9 D;  3HE4 B;  4EIJ A;  3O6Q B;  1HGZ A;  1KTM A;  3BCC D;  4H0L B;  3H25 A;  2HPC A;  3L35 A;  1W2E A;  2O1J A;  2ZVO B;  4W80 A;  2H43 A;  1VF5 C;  1ZP0 C;  1IFP A;  3L70 J;  2K9J B;  5CBN A;  1ZRT E;  2W6B A;  1FU1 A;  5APX A;  4IL6 H;  1LT9 A;  2JKV A;  3H1J J;  3CC7 P;  3II6 A;  5CBO A;  1DH3 A;  3L75 D;  1EDL A;  4H13 D;  1SQX K;  2P67 A;  1L4A D;  5AW5 B;  4GT1 A;  1GL2 B;  2M3B A;  3ITK A;  2FFD B;  2YKQ A;  1NTM K;  2QM7 A;  3HD7 D;  4YPC A;  1HGV A;  2J58 A;  1NKN A;  2B89 A;  4PV1 C;  1LT1 A;  3P8C D;  3V4Q A;  3B5N D;  1NU1 D;  1SQV E;  3MUD C;  1X22 A;  4BWN A;  1KD1 Q;  3O8Z A;  4L74 A;  1XTC C;  3L74 E;  1Z56 A;  2Z5I A;  2I1J A;  1WRG A;  3CX5 D;  4N78 E;  2R5D A;  2D2C D;  1BDD A;  2NZ2 A;  3F89 A;  1JTH A;  2A45 I;  2XNX A;  3RL0 B;  1PV3 A;  3H1K G;  3A0H H;  2E74 D;  1L0N G;  2A06 D;  3HUS C;  4I7Z B;  1VQN P;  1J2J B;  3A0B E;  4NPD A;  5KAI E;  3CXH E;  4D6T D;  2J5U A;  2Q5U A;  1GD2 E;  1L0L D;  3K5B A;  1VF5 D;  1MFZ A;  5KJ7 A;  1K73 Q;  4M3L A;  1S2E A;  1KFN A;  3CWB E;  4RO0 A;  3P7K A;  4XA4 A;  2XV5 A;  2OYI A;  1BGY E;  2YO3 A;  2FBW C;  4WY4 B;  4H44 B;  1NTK E;  3CD6 P;  2E42 A;  1SQB E;  1MUU A;  4PV1 D;  1Q86 Q;  1JCC A;  2QE7 H;  4BXL A;  3CCJ P;  3CME P;  1QEX A;  2OYH C;  4ASW A; 
#chains in the Genus database with same CATH homology
 1USD A;  4YPC A;  1USE A;  3MUD C;  3SWK A;  3QH9 A;  3SSU A;  3S4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...