1FZFA

Crystal structure of fragment double-d from human fibrin with the peptide ligand gly-his-arg-pro-amide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood coagulation
molecule keywords FIBRINOGEN
publication title Conformational changes in fragments D and double-D from human fibrin(ogen) upon binding the peptide ligand Gly-His-Arg-Pro-amide.
pubmed doi rcsb
total genus 20
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzfA00
1N73A 2HPCB 1LTJA 1W2EA 3E1IA 2Q9IA 1LT9B 1JY2P 1RE4A 2FFDA 1M1JC 3H32B 1FZCA 1N86A 1FZEA 1LWUA 2HLOA 1FZFA 2OYIA 1LTJB 1N73B 2OYHB 1JY2O 2A45H 1FZGA 2FFDB 1FZCB 1RF1C 3HUSC 1RF0C 1JY3N 1LWUB 2A45I 2H43A 2OYIB 3GHGC 1M1JA 1LT9C 1RE3C 2HODA 2XNXA 3BVHA 2Z4EA 1JY3P 2OYHC 1N73C 3HUSA 1RF0A 1M1JB 1LTJC 1RF1A 3GHGA 1JY3O 1T3UA 2A45G 2HODB 2HPCA 1RE4C 2FFDC 1FZAA 1FZCC 2OYIC 1LT9A 1JY2N 1RE3A 3HUSB 1LWUC 1FZBA 3H32A 1RF1B 3GHGB 2OYHA
chains in the Genus database with same CATH superfamily
1M56D 1KFMA 1S5LX 1SS1A 4I7ZB 4NPEA 3G6EP 3RK2D 4D6TG 4UB8E 2WTYA 2FYNC 4GKGA 1LJ2A 2R32A 5BU8B 2E75B 5AVYB 1VF5B 2W90A 3L74D 3RBZA 2WSFJ 2YKOA 2H7HA 1HJBA 2SPZA 1YHQP 5KKZC 1N8RQ 2MKVA 1M1KQ 1XTGB 1M7LA 1U57A 3TNUA 1YTZI 2DW3A 1CSBA 1HWTC 2K3RA 1S72P 3P8CE 4M3LA 1IK7A 2D2CB 3ZDMA 1HGZA 3H1LG 4EIJA 1YJWP 1YI2P 3U1CA 3QWOC 2WT7B 2YO3A 2QJPB 2XU6A 4HB1A 3A0HE 3HUSC 2WZ7A 1SQQG 1HUCA 2JJLA 3CC4P 4ZNCA 3AE4C 1CW5A 3H1HG 3HUSA 5TJHA 4ASVA 2E76D 2PAJA 5APVA 4Y99B 1KILA 1OMIA 3AE7C 2YKQA 2ZVOB 3Q1MA 3H1ID 1S9KE 3B4SA 1OVRA 5CJ0A 5CHXA 2Q1KA 4PD4H 3GG2A 2AXTE 1PGQA 3I55P 2GUVA 1NU1G 3CCLP 1GW3A 1AA0A 1YYCA 1DX7A 5GTIH 5AW9B 2E5TA 1VF5C 3KZIH 2I1JA 1ZXGA 1L4AD 3V2QA 3FXEA 1VQMP 5AW8B 1AV1A 3GLMA 1M90Q 2KP8A 5AVTB 1Q90D 5APTA 4LLHA 1FZBA 3FWNA 4WWIA 3WU2H 2IFNA 1PP9D 2P10A 1FJKA 1LTJB 2D2CC 4EDFA 3PH0A 1PPJE 4NPDA 3RGUA 2K9JB 4DOJA 1Q81Q 2QJPC 1DD4A 3N4XA 2YIUC 5AW5B 2A06E 3BRVB 3L73D 1PGJA 5APQA 2R5DA 2WT7A 1EQ7A 1GL2D 4EOTA 1YJNP 2O3JA 2ZVNB 1SQXK 4OWFA 2NPSB 3JCUE 1BSHA 4Y99C 2W8ZA 3A0BH 3WUTA 3B71A 2WPSA 2XZRA 1BSNA 2WSEJ 4RESB 4K35A 4GOEA 3AEBC 1DH3A 3BRTB 3CMAP 4YTPC 1RY3A 3CXHD 5DJUB 1FDIA 2CPSA 1ZN5A 2LXCB 4TT3H 1FS0E 1NAFA 1SQVK 1JCCA 5TISH 2BEQD 3OAKA 5KTBA 1NO4A 3V2NA 3PHLA 1NTKD 1KV4A 2Q3EA 3TF5A 2K9YA 1LTJC 3OJAB 1LTSC 2P1JA 3L70E 3RL0C 3L75E 2FYUK 1LTJA 1HVVA 1JY2P 1ZRTE 1GW4A 1JY2O 2K9JA 1FZCB 4TLFA 1JOCA 3R2PA 3NXSA 1K73Q 1T3JA 4WY4C 1YIJP 3L35A 1OX3A 3H1JD 2NPSC 1MFTA 1EDKA 1X9VA 2NPSA 2MJZA 3L71J 1T2KC 1ZOYC 4BXLA 1YQ4C 1LTTC 2CPBA 2A06G 1Y47A 3LW5J 1L2PA 2YXRB 1VQPP 1URQB 4W80A 3M91A 1M1JC 3CXHH 1SQXJ 2E75D 3PLNA 1NTZD 3VN0A 3RK3B 5B66E 4GIFA 1VQKP 3S1KA 1EDJA 1YJ9P 4L74A 2L91A 1SQQK 1EZVI 1OVVA 1QLED 1VQ9P 1RF1C 4H0LD 3D6ZA 2QIWA 1BCCJ 1SQVJ 3H1KD 1VQNP 1MFZA 1FZCC 1SQXE 3L74E 2Y0CA 1FZCA 1ZR2A 1VQOP 2JEEA 2QE7H 1LNQA 4ZKUA 2ZT9B 3L70G 3SWKA 1AQ5A 2FYUJ 3AECC 2P67A 3CX5E 1T8ZA 1Y8AA 1BCCE 4IL6X 1URQC 1SQPD 3VMZA 1SQVE 2WPQA 2OYHC 1URQA 4PV1C 1RQUA 2P2UA 2Q7CA 3TYYA 1L0LD 4KJMA 3R4YA 1SP4A 2FYUE 1E79H 4GDOA 2FYZA 3TSIA 3VMAA 5DJTB 3H32B 4WB4A 5H2FH 3KQGA 1PZQA 3TGUJ 2FFDB 5KJ7A 4OGQB 2V4HA 3V5BA 2QA4P 2RKLA 3B5NB 3NMDA 4BRYB 3L71G 1JMMA 1X0TA 1J1EC 3AEAC 1HH0A 3M0AA 1N7SD 3HRNA 1PP9E 5M1BA 4IL6E 3OW2O 3HD7D 2BCCJ 2PRRA 4IFFA 3BVHA 3E7KA 1RHZB 4RKUJ 1SQXG 1FZAA 2OYIC 5CCGD 3KPEA 1X22A 3NTNA 2WSCH 4XFJA 5BVZA 4GT1A 3A2AA 3CCVP 1JEKA 3Q5PA 2E43A 1QL1A 4KHXA 3TK1A 5KKZB 2M0BA 1Q2NA 5CCHD 4HH2A 3GF3A 2HR3A 1BCCG 4H13D 3O6QB 2BCCE 1SQVG 1JY3N 3KXDA 2IPPA 3KDPB 3IN6A 2FFDC 3H32A 4PJ0H 2FFDA 3BCCD 2FYUG 1Z56A 3IR9A 3B5NA 4BRYA 2KSJA 5B5EH 2HFED 3M9QA 3K5BA 3RBXA 4EYYQ 1K04A 1JB0J 1HJ0A 1NTMK 1FJPA 2ZYDA 1FBMA 4PD4D 2R44A 1JUNA 2M8RA 1FU1A 1PV3A 2NRGA 2ZJSE 1LGHB 3A5TA 3RK3D 1X79B 3A3YB 2WSEH 1CI6B 2KS1B 3CXHI 1FZGA 4JBZA 2N1TD 2KNCB 1U7JA 2IYPA 1NKNA 1OW8A 4U3FJ 3L72D 2V7QH 3H6PA 1JY3O 2IBZG 1QGKB 3CCRP 3TGUG 2KZJA 1EXIA 2POHA 1WT6A 1HF9A 2W6AA 4Z1MH 1G1JA 3SFDC 1J1DC 2YIUB 1BGYJ 1NAYA 4I6MC 1NTZE 2M5AB 4K3AA 3CC7P 2GM4A 2IFMA 5C39A 1NHLA 1BE3J 1KYOH 3AE3C 2BCCG 2ZT9D 2KUBA 1IFIA 4I2LC 4IFDK 4U3FE 3EQ2A 2JP3A 2KXPB 2H43A 1FE6A 2OGUA 1KTMA 2XNXA 3P8MC 1Q82Q 5H2FE 1A02F 2XV5A 4IFMA 2K1AA 1BGYE 3V4QA 3MUDC 5AW2B 2A45H 4WVZA 3S9OA 2IDBA 1U7MA 1G1IA 3MUDA 1OXZA 1IFNA 5APWA 3D70A 3D71A 3FWLA 3EFFK 2R3SA 1BE3E 5KLVJ 2HODB 1AFOA 3LW5H 1USDA 3P7KA 2O01H 1EC5A 1CI6A 1NTMJ 2HPCB 2KS1A 3SSUA 3E1RA 2C9LY 2KNCA 4D6TD 4B86A 5GTHE 3RL0B 1NVOA 1SQPE 1ZP0C 5KAFE 2E5YA 5L8RJ 3MZWB 2I1KA 3B5ND 1L0LE 1ZV8A 4WY4B 2QRXA 2M5AA 1H8AA 3CCJP 3CI9A 1JCDA 3MHVA 5KLVE 5APYA 4L73A 1MUUA 2QG4A 1NTME 5AVQB 2RN0A 2M3EA 3H1LD 2WMMA 3IF4A 3CWBD 3L70J 1SQBD 2O1JA 3L75J 4HYTB 5AW0B 1PGPA 1SQQD 5CMZA 2B9BA 3BASA 4H44B 1NJIQ 3H1HD 1M1JB 1OIPA 5AVZB 1KC8Q 4U3FG 2KLUA 3A7OA 1EDIA 3CCMP 3II6A 4L75A 3M06A 1P84D 3ABVC 2HODA 1VQ6P 2HPCA 3SWFA 1JTHB 2E74C 2IZ1A 1RF1B 1BGYG 1NU1D 1KB9D 1N86A 1L0NJ 1E5WA 2LKMA 5AW1B 1BE3G 1EZVE 1IFPA 4OVNF 3UIAA 1H88A 1KILD 2WPVB 4L76A 3QH9A 4WY4A 1NH4A 3FX0A 1GK4A 1OW7A 1PPJG 1D7MA 2B88A 2C9NY 1VQ4P 4AQRD 1SFCB 4N78D 3S4RA 1IK9A 4IOIH 2Y9ZA 1L0NE 1A02J 1OFCX 1AVOA 1L0LG 1NKZB 4H44C 2YO2A 1FC2C 2OYHB 3L74J 1VF5D 2C0XA 4PV1B 5KLVG 2XNDH 5APSA 3P8CD 1M1JA 1NTMG 1NOHA 1KQSO 4I1LA 3RK2B 1P84H 3GF7A 5KAIH 1DEBA 2D2CD 5E79H 4PD4E 1RF0C 4ZKPA 3ITKA 4ZMDA 2GUSA 4JF7A 1JTHA 1KB9H 1N73C 1OW6A 1RF0A 1RF1A 2J58A 5CCHC 3RL0g 5GTIE 1CZQA 3KZIE 2KZIA 1S9KD 1LT9B 2AXCA 1OZHA 3VOPA 4YXDC 2JWAA 3CCUP 3H1IJ 1J1EB 3WU2E 3V4WA 4UB8H 3L75G 1KQFB 1SFCC 2QEXP 3M0DC 1KYOI 1FZEA 1QVGO 1SFCA 2UWJE 3M0DA 2OYIB 1EZVG 2HYNA 2FXPA 1S4XA 1DIPA 4W7ZA 4PD4I 1KORA 1X8YA 2OYHA 1VQ7P 1KFNA 3GW6A 3A0BE 2QM7A 4WBAA 3RK2C 2QSIA 3H1IE 5BU5A 1WMKA 2A45I 4AUWA 3PJSK 1PP9J 1YITP 1MZ9A 4Y28J 2A06D 3A0HH 2XDJA 1L0NG 1L4AB 1PGOA 4LC1A 2WSFH 3L73J 3USSA 2W6JH 2ZFCA 3LIEA 3C1LA 1S5LH 1GK6A 1LT9C 1OVUA 2Y0EA 5TISE 4GODA 4QMAA 2LXBA 1LT9A 2NPSD 1NTZK 2I8DA 1ZR4A 2AXTH 2ZXEB 1JM0A 1S2EA 1T2KD 2KB7P 4OH8B 5AVXB 1RE3C 2W6BA 2IZ0A 3H25A 2R3CA 2WQYC 2QJYC 4EI2A 2E76C 1RE3A 1G2CB 3L74G 1M8OB 3L73E 3SFEC 2WITA 1AJYA 2QJKB 4GOFA 2Q6QA 2OYIA 2FXOA 2KSEA 4HJGH 1GZLA 1VQLP 3B8EB 1R8EA 3V2PA 1NTKJ 1ZRTD 3LIDA 1HGVA 3VTPC 1LT1A 5AVRB 1IC2A 3CWBE 3CD6P 1SQBE 1GMJA 1SVFA 1L4AC 2OQQA 1J2JB 1IZNB 3L36A 3L37A 1L4AA 4CPGA 3CXHE 3JCUH 4DJGA 2N9BA 3P32A 1J1DB 1MV8A 1SQPK 5APXA 2HG5D 3H1IG 2IYOA 1GU5A 3H1JJ 1FAVA 1N7LA 1KYOD 1NTKE 4DT0A 3MP7B 3F89A 1L0LK 1T3UA 4JPZB 1GL2C 5KLVK 1YQ3C 5AW6B 2GA1A 1PL5A 3AEDC 3Q5RA 3CC2P 1LTIC 2ZAEB 1R5LA 1Q86Q 1URQD 3Q3DA 3Q2YA 4HKZH 1UIXA 2QJKC 2ZYGA 1G2CA 2WPRA 1NTZJ 2JO1A 1DEEG 1R5SA 1KILE 3L71D 1PP9G 3H1JE 2M3BA 1KQGB 4LGDE 3CLQA 2KIKA 3AE8C 1JY3P 4N78E 3L73G 1SQXD 2P7JA 3N7NA 5APUA 2OTLP 3I56P 2QM8A 3O6QA 1P84I 5KJ7D 2KLVA 2FKWB 3H1KJ 4MN4C 2NZ2A 3JSVC 2Z5IA 1KB9I 3V6IA 2O1KA 1LTBC 2XKMA 4H0LB 3CX5D 2VRSA 3CWBG 2W27A 1BCCD 4YXWH 1SQBG 1GU4A 4U7JA 1SQVD 1XTCC 1IO4A 2Y0DA 1IJDB 4UB6H 2JWDA 1KILC 3MD0A 1H0TB 2CK3H 1SQPJ 5B66H 2WSCJ 3H1KE 1NYHA 1TU3F 1S5LE 2L5GB 1L0NK 2FYUD 1NTKG 1L0LJ 2FXMA 4I7ZC 3EFGA 5KLIB 2YKPA 3FGAD 1FOSF 2P58A 1W2EA 4NPFX 3HE5B 1LTAC 2H89C 2E75C 4KT0J 2Y9YA 1AQTA 1YTZT 2E74B 2WVRA 2K88A 5CJ4A 2YNYA 1RE4C 3H1JG 3AE2C 4OGQD 1GDTA 2AEMA 4R4LA 1OWAA 1RE4A 2AEFA 3KHUA 3BATA 4O9BA 3MIWA 4H0LC 4AYCA 3CX5H 1KZUB 3IFMA 1K9MQ 3PTZA 2IBZD 1JY2N 3HTKB 3TGUD 3U1AA 2O01N 1NWQA 3SWYA 3V2RA 3G71P 2KI7B 1EDLA 2KYVA 4JYBA 2BEZF 1NTZG 1BDDA 1H0TA 2H88C 1N7SB 4PJ0E 4A7PA 4RO0A 3HD7B 2WSSH 3MTUE 3CMEP 1GD2E 4XA4A 2RMZA 2BCCD 3CPWO 3D6YA 5KLIC 2LR2A 4RJTA 5B5EE 3G9RA 3EWKA 1FDMA 3C9IA 2V7QJ 3H1KG 1IFMA 1K8AQ 3HE5A 3CL3D 2H8PD 3AE9C 3I5CA 1N73B 1UIIA 3C8VA 4N3YB 3OA7A 2R5BA 4H13B 4JQ0D 1KN7A 3VP9A 2KK7A 4IL6H 3BCCJ 3VYIA 5AW4B 1W2BO 3AE1C 4R4MA 2PGDA 1WRGA 2C0WA 1SQPG 2Q3IA 5CBNA 3L4FA 3FXDA 3HTKA 3CCQP 1ZMEC 1QVFO 2E42A 3PRJA 3GHGB 1VPCA 4ASWA 4C46A 2IX7C 3E1IA 1IFJA 1N7SC 2YXQB 1K05A 1N7SA 3HD7C 1YBKA 3BCCE 1KYOE 2OTJP 1FDOA 3HD7A 2O01J 5CCGC 3O8ZA 2AEJA 3L72J 5CCGA 1KQLA 4W7YA 3G3ZA 4UB6E 3W68A 1JMBA 2QVAA 3IAOA 1PIXA 2Q5UA 2ZXXA 1LP1B 1SQBK 2OTKE 2N1TB 3WMM0 1LTGC 1N73A 3T97B 1VQ8P 1AVYA 3L71E 2Q9IA 3RK3E 4H13C 5CCHA 4U3FD 3VMXA 1FZFA 5K5GB 2J59M 2KOGA 3KYQA 2PFXA 3HE4B 5AVUB 5AVVB 2K37A 3JC22 3L72E 1FOSE 1GTWA 4DZOA 1S3JA 4C7RA 1BGYD 3M9HA 3WUVA 1JNMA 1NTKK 2QJYB 2E76B 5CBOA 2BASA 1ZW0A 3GHGC 4N6JA 1BE3D 1Y9BA 1NU1K 3GHGA 1RH5B 1VQ5P 5AVWB 3U59A 2ITAA 1PPJD 2OARA 2Z4EA 1W5CE 4DCKA 4C7NB 2B87B 4D6TJ 1Q7YQ 2W83C 2E74D 3AEGC 2B89A 3RK3C 1KMIZ 3RL0D 3F5HA 1PFIA 2N1TC 5KLVD 3BCCG 1LWUB 2ZYAA 1LP1A 4BWNA 1QX8A 1NTMD 2N1TA 2JKVA 4WY4D 3T97A 5EFWB 5KJ7C 3G4SP 1HTLC 3H1LJ 2G8YA 4XE5B 3HE4A 1GL2B 3CWBJ 4D6TE 3CX5I 3AE5C 3Q5SA 1SQBJ 5AW3B 2A45G 3CCSP 1RQVA 1SQQJ 3TDKA 1T6AA 3H1HJ 1BDCA 4H44D 2ZT9C 2HLOA 1H89A 1IFDA 1KD1Q 1S1CX 1USEA 1MKMA 2FY8A 3L72G 5AW7B 5GTHH 3L70D 2JR8A 3L75D 3MGNA 2IBZE 1VDFA 2JDIH 1QEXA 5KAFH 3TGUE 2FYNB 3H1LE 3CCEP 2OYOA 1EXJA 1N2DC 2FBWC 1ZLLA 1NU1J 1EZVD 4C7NA 2B87A 3TNUB 1SQQE 1HBWA 3VMYA 3H1HE 1LWUC 1QL2A 3W67A 4YPCA 2PP6A 1NGMB 2RH0A 2J5UA 4JYCA 3GMAA 1LWUA 2WWWA 2Z5HA 3AEEC 1SLQA 1DD3A 1P84E 1L0ND 4OGQC 5KAIE 3HUSB 3VP8A 5E79E 1VL2A 3WUUA 1SFCD 5AVSB 3AEFC 3PP5A 1NU1E 1KILB 3B5NC 3NFQA 1KB9E 1GL2A 3AE6C 2G3AA 1M57D 2IBZI 3M9BA 1JO5A 2N9YB 2YMYA 4PV1D 2YMKA
chains in the Genus database with same CATH topology
1KFMA 1OWAA 1NKZB 1RE4A 3H32B 4WB4A 2YO2A 2OYHB 3BATA 3KQGA 4O9BA 3MIWA 2C0XA 3RK2D 2FFDB 5KJ7A 4AYCA 5APSA 1KZUB 3P8CD 2WTYA 1M1JA 3IFMA 4GKGA 1NOHA 2R32A 3V5BA 5BU8B 5AVYB 3B5NB 3NMDA 4I1LA 3RK2B 1JY2N 3HTKB 1JMMA 2YKOA 3U1AA 2H7HA 1HJBA 1J1EC 1HH0A 3M0AA 1NWQA 1N7SD 3HRNA 3SWYA 3V2RA 1DEBA 1GDTA 1XTGB 2KYVA 4JYBA 1M7LA 3TNUA 1RF0C 4ZKPA 3HD7D 1YTZI 2GUSA 4JF7A 1CSBA 4IFFA 1HWTC 3BVHA 3P8CE 4M3LA 1JTHA 1N7SB 1N73C 1RF0A 1RF1A 2J58A 5CCHC 1FZAA 2OYIC 5CCGD 1HGZA 3KPEA 4EIJA 1CZQA 3NTNA 2WSCH 3HD7B 3MTUE 3U1CA 1S9KD 1LT9B 1GD2E 4XA4A 2WT7B 5BVZA 3VOPA 2YO3A 2XU6A 4GT1A 3A2AA 3HUSC 2WZ7A 1HUCA 2JJLA 1FDMA 2E43A 3C9IA 1J1EB 3V4WA 1QL1A 3HUSA 4KHXA 3TK1A 1CW5A 1IFMA 5CCHD 2PAJA 5APVA 3HE5A 4HH2A 3CL3D 2H8PD 4Y99B 1KILA 1SFCC 2YKQA 3M0DC 1FZEA 3I5CA 1N73B 1S9KE 1SFCA 1JY3N 3M0DA 2OYIB 5CJ0A 2HYNA 5CHXA 4N3YB 3OA7A 2R5BA 2IPPA 3VP9A 3KDPB 2FFDC 4W7ZA 3H32A 3VYIA 2GUVA 1X8YA 2OYHA 5AW4B 1KFNA 1GW3A 1YYCA 2FFDA 1DX7A 2QM7A 5AW9B 4WBAA 3RK2C 1WRGA 2C0WA 2I1JA 5BU5A 2A45I 4AUWA 1L4AD 3V2QA 5AW8B 2Q3IA 1Z56A 3IR9A 2KP8A 3B5NA 1MZ9A 3L4FA 3HTKA 2KSJA 5AVTB 2XDJA 2HFED 5APTA 3M9QA 2E42A 4LLHA 1FZBA 1L4AB 3GHGB 1VPCA 4C46A 2IX7C 3E1IA 2IFNA 4LC1A 1IFJA 2WSFH 1N7SC 1FJKA 1NTMK 1FJPA 1FBMA 1LTJB 2ZFCA 3LIEA 1N7SA 1JUNA 3HD7C 2M8RA 1GK6A 1LT9C 1FU1A 4DOJA 3HD7A 3N4XA 1LGHB 5AW5B 3BRVB 5APQA 5CCGC 1LT9A 3O8ZA 3A5TA 2R5DA 2WT7A 3RK3D 2NPSD 1EQ7A 1GL2D 1NTZK 1X79B 4EOTA 3A3YB 2WSEH 5CCGA 1KQLA 4W7YA 1ZR4A 3G3ZA 1CI6B 2ZXEB 1FZGA 1T2KD 2KB7P 1SQXK 2Q5UA 2N1TD 4OH8B 2NPSB 4Y99C 5AVXB 1RE3C 1NKNA 2W6BA 2R3CA 3H6PA 1JY3O 1SQBK 1RE3A 1G2CB 2N1TB 3WMM0 2WPSA 2XZRA 1LTGC 1N73A 4RESB 2Q9IA 2POHA 1WT6A 2WITA 5CCHA 2OYIA 3VMXA 1FZFA 1DH3A 3BRTB 2W6AA 1G1JA 2J59M 1J1DC 2KOGA 1RY3A 3KYQA 4I6MC 3HE4B 2CPSA 5AVUB 2GM4A 2IFMA 5AVVB 1GZLA 1ZN5A 1FOSE 1NAFA 1NHLA 3B8EB 1GTWA 3V2PA 4DZOA 1SQVK 1JCCA 4C7RA 3LIDA 3M9HA 1HGVA 3VTPC 1JNMA 1NTKK 3OAKA 5KTBA 5AVRB 1IC2A 1IFIA 1NO4A 4I2LC 1SVFA 4IFDK 3EQ2A 1L4AC 2H43A 2BASA 1J2JB 3GHGC 3V2NA 4N6JA 2XNXA 3P8MC 3L36A 1NU1K 3L37A 1L4AA 1LTJC 3GHGA 3OJAB 1A02F 2XV5A 1LTSC 2N9BA 2P1JA 4IFMA 3P32A 3RL0C 1J1DB 5AVWB 1MV8A 1SQPK 2FYUK 3U59A 1LTJA 5APXA 2HG5D 1HVVA 1JY2P 1GW4A 3V4QA 5AW2B 1GU5A 1JY2O 2A45H 1FZCB 1JOCA 1FAVA 1N7LA 2OARA 1G1IA 3R2PA 3NXSA 3MUDA 1OXZA 1IFNA 2Z4EA 5APWA 1T3JA 4WY4C 1L0LK 4C7NB 1T3UA 2HODB 3L35A 1AFOA 3LW5H 3P7KA 2O01H 3RK3C 2NPSC 1GL2C 1CI6A 5AW6B 3RL0D 5KLVK 2HPCB 1X9VA 2NPSA 2C9LY 1LTIC 1PFIA 2MJZA 1T2KC 2N1TC 4B86A 1URQD 1LWUB 3RL0B 1LTTC 2CPBA 1G2CA 2N1TA 4WY4D 2WPRA 3T97A 1URQB 4W80A 5KJ7C 3M91A 1M1JC 2M3BA 1HTLC 4LGDE 2I1KA 3B5ND 1ZV8A 4WY4B 4XE5B 1H8AA 3HE4A 3CI9A 1JCDA 3CLQA 3VN0A 3RK3B 1GL2B 5APYA 1JY3P 4GIFA 5AW3B 1MUUA 4N78E 5AVQB 2A45G 2P7JA 3N7NA 5APUA 1SQQK 2QM8A 5KJ7D 2KLVA 2FKWB 2O1JA 2HLOA 4HYTB 5AW0B 2Z5IA 1RF1C 1H89A 1IFDA 5CMZA 3BASA 5AW7B 1M1JB 1MFZA 2O1KA 5AVZB 3MGNA 1LTBC 2XKMA 1FZCC 1VDFA 2VRSA 2W27A 1FZCA 1ZR2A 3A7OA 1N2DC 1GU4A 1ZLLA 3II6A 1XTCC 1IO4A 3M06A 2JEEA 4C7NA 1IJDB 2HODA 3TNUB 1KILC 4ZKUA 3MD0A 1HBWA 2HPCA 1AQ5A 3VMYA 3SWFA 1JTHB 2P67A 1LWUC 1QL2A 1RF1B 2PP6A 4JYCA 1T8ZA 1N86A 1LWUA 2WWWA 1E5WA 2Z5HA 2LKMA 1SLQA 2L5GB 1URQC 1L0NK 3VMZA 5AW1B 2FXMA 2WPQA 2OYHC 3EFGA 3UIAA 1URQA 2YKPA 1H88A 1KILD 3HUSB 3VP8A 1FOSF 2P2UA 1W2EA 4WY4A 1SFCD 5AVSB 1NH4A 3PP5A 3HE5B 2Q7CA 1LTAC 3TYYA 1GK4A 1KILB 3B5NC 3NFQA 1GL2A 2C9NY 1YTZT 4AQRD 3M9BA 1SP4A 1SFCB 5CJ4A 1JO5A 4N78D 2YNYA 1IK9A 1RE4C 2YMYA 2FYZA 1A02J 3TSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N73 A;  2HPC B;  1LTJ A;  1W2E A;  3E1I A;  2Q9I A;  1LT9 B;  1JY2 P;  1RE4 A;  2FFD A;  1M1J C;  3H32 B;  1FZC A;  1N86 A;  1FZE A;  1LWU A;  2HLO A;  1FZF A;  2OYI A;  1LTJ B;  1N73 B;  2OYH B;  1JY2 O;  2A45 H;  1FZG A;  2FFD B;  1FZC B;  1RF1 C;  3HUS C;  1RF0 C;  1JY3 N;  1LWU B;  2A45 I;  2H43 A;  2OYI B;  3GHG C;  1M1J A;  1LT9 C;  1RE3 C;  2HOD A;  2XNX A;  3BVH A;  2Z4E A;  1JY3 P;  2OYH C;  1N73 C;  3HUS A;  1RF0 A;  1M1J B;  1LTJ C;  1RF1 A;  3GHG A;  1JY3 O;  1T3U A;  2A45 G;  2HOD B;  2HPC A;  1RE4 C;  2FFD C;  1FZA A;  1FZC C;  2OYI C;  1LT9 A;  1JY2 N;  1RE3 A;  3HUS B;  1LWU C;  1FZB A;  3H32 A;  1RF1 B;  3GHG B;  2OYH A; 
#chains in the Genus database with same CATH topology
 1M56 D;  1KFM A;  1S5L X;  1SS1 A;  4I7Z B;  4NPE A;  3G6E P;  3RK2 D;  4D6T G;  4UB8 E;  2WTY A;  2FYN C;  4GKG A;  1LJ2 A;  2R32 A;  5BU8 B;  2E75 B;  5AVY B;  1VF5 B;  2W90 A;  3L74 D;  3RBZ A;  2WSF J;  2YKO A;  2H7H A;  1HJB A;  2SPZ A;  1YHQ P;  5KKZ C;  1N8R Q;  2MKV A;  1M1K Q;  1XTG B;  1M7L A;  1U57 A;  3TNU A;  1YTZ I;  2DW3 A;  1CSB A;  1HWT C;  2K3R A;  1S72 P;  3P8C E;  4M3L A;  1IK7 A;  2D2C B;  3ZDM A;  1HGZ A;  3H1L G;  4EIJ A;  1YJW P;  1YI2 P;  3U1C A;  3QWO C;  2WT7 B;  2YO3 A;  2QJP B;  2XU6 A;  4HB1 A;  3A0H E;  3HUS C;  2WZ7 A;  1SQQ G;  1HUC A;  2JJL A;  3CC4 P;  4ZNC A;  3AE4 C;  1CW5 A;  3H1H G;  3HUS A;  5TJH A;  4ASV A;  2E76 D;  2PAJ A;  5APV A;  4Y99 B;  1KIL A;  1OMI A;  3AE7 C;  2YKQ A;  2ZVO B;  3Q1M A;  3H1I D;  1S9K E;  3B4S A;  1OVR A;  5CJ0 A;  5CHX A;  2Q1K A;  4PD4 H;  3GG2 A;  2AXT E;  1PGQ A;  3I55 P;  2GUV A;  1NU1 G;  3CCL P;  1GW3 A;  1AA0 A;  1YYC A;  1DX7 A;  5GTI H;  5AW9 B;  2E5T A;  1VF5 C;  3KZI H;  2I1J A;  1ZXG A;  1L4A D;  3V2Q A;  3FXE A;  1VQM P;  5AW8 B;  1AV1 A;  3GLM A;  1M90 Q;  2KP8 A;  5AVT B;  1Q90 D;  5APT A;  4LLH A;  1FZB A;  3FWN A;  4WWI A;  3WU2 H;  2IFN A;  1PP9 D;  2P10 A;  1FJK A;  1LTJ B;  2D2C C;  4EDF A;  3PH0 A;  1PPJ E;  4NPD A;  3RGU A;  2K9J B;  4DOJ A;  1Q81 Q;  2QJP C;  1DD4 A;  3N4X A;  2YIU C;  5AW5 B;  2A06 E;  3BRV B;  3L73 D;  1PGJ A;  5APQ A;  2R5D A;  2WT7 A;  1EQ7 A;  1GL2 D;  4EOT A;  1YJN P;  2O3J A;  2ZVN B;  1SQX K;  4OWF A;  2NPS B;  3JCU E;  1BSH A;  4Y99 C;  2W8Z A;  3A0B H;  3WUT A;  3B71 A;  2WPS A;  2XZR A;  1BSN A;  2WSE J;  4RES B;  4K35 A;  4GOE A;  3AEB C;  1DH3 A;  3BRT B;  3CMA P;  4YTP C;  1RY3 A;  3CXH D;  5DJU B;  1FDI A;  2CPS A;  1ZN5 A;  2LXC B;  4TT3 H;  1FS0 E;  1NAF A;  1SQV K;  1JCC A;  5TIS H;  2BEQ D;  3OAK A;  5KTB A;  1NO4 A;  3V2N A;  3PHL A;  1NTK D;  1KV4 A;  2Q3E A;  3TF5 A;  2K9Y A;  1LTJ C;  3OJA B;  1LTS C;  2P1J A;  3L70 E;  3RL0 C;  3L75 E;  2FYU K;  1LTJ A;  1HVV A;  1JY2 P;  1ZRT E;  1GW4 A;  1JY2 O;  2K9J A;  1FZC B;  4TLF A;  1JOC A;  3R2P A;  3NXS A;  1K73 Q;  1T3J A;  4WY4 C;  1YIJ P;  3L35 A;  1OX3 A;  3H1J D;  2NPS C;  1MFT A;  1EDK A;  1X9V A;  2NPS A;  2MJZ A;  3L71 J;  1T2K C;  1ZOY C;  4BXL A;  1YQ4 C;  1LTT C;  2CPB A;  2A06 G;  1Y47 A;  3LW5 J;  1L2P A;  2YXR B;  1VQP P;  1URQ B;  4W80 A;  3M91 A;  1M1J C;  3CXH H;  1SQX J;  2E75 D;  3PLN A;  1NTZ D;  3VN0 A;  3RK3 B;  5B66 E;  4GIF A;  1VQK P;  3S1K A;  1EDJ A;  1YJ9 P;  4L74 A;  2L91 A;  1SQQ K;  1EZV I;  1OVV A;  1QLE D;  1VQ9 P;  1RF1 C;  4H0L D;  3D6Z A;  2QIW A;  1BCC J;  1SQV J;  3H1K D;  1VQN P;  1MFZ A;  1FZC C;  1SQX E;  3L74 E;  2Y0C A;  1FZC A;  1ZR2 A;  1VQO P;  2JEE A;  2QE7 H;  1LNQ A;  4ZKU A;  2ZT9 B;  3L70 G;  3SWK A;  1AQ5 A;  2FYU J;  3AEC C;  2P67 A;  3CX5 E;  1T8Z A;  1Y8A A;  1BCC E;  4IL6 X;  1URQ C;  1SQP D;  3VMZ A;  1SQV E;  2WPQ A;  2OYH C;  1URQ A;  4PV1 C;  1RQU A;  2P2U A;  2Q7C A;  3TYY A;  1L0L D;  4KJM A;  3R4Y A;  1SP4 A;  2FYU E;  1E79 H;  4GDO A;  2FYZ A;  3TSI A;  3VMA A;  5DJT B;  3H32 B;  4WB4 A;  5H2F H;  3KQG A;  1PZQ A;  3TGU J;  2FFD B;  5KJ7 A;  4OGQ B;  2V4H A;  3V5B A;  2QA4 P;  2RKL A;  3B5N B;  3NMD A;  4BRY B;  3L71 G;  1JMM A;  1X0T A;  1J1E C;  3AEA C;  1HH0 A;  3M0A A;  1N7S D;  3HRN A;  1PP9 E;  5M1B A;  4IL6 E;  3OW2 O;  3HD7 D;  2BCC J;  2PRR A;  4IFF A;  3BVH A;  3E7K A;  1RHZ B;  4RKU J;  1SQX G;  1FZA A;  2OYI C;  5CCG D;  3KPE A;  1X22 A;  3NTN A;  2WSC H;  4XFJ A;  5BVZ A;  4GT1 A;  3A2A A;  3CCV P;  1JEK A;  3Q5P A;  2E43 A;  1QL1 A;  4KHX A;  3TK1 A;  5KKZ B;  2M0B A;  1Q2N A;  5CCH D;  4HH2 A;  3GF3 A;  2HR3 A;  1BCC G;  4H13 D;  3O6Q B;  2BCC E;  1SQV G;  1JY3 N;  3KXD A;  2IPP A;  3KDP B;  3IN6 A;  2FFD C;  3H32 A;  4PJ0 H;  2FFD A;  3BCC D;  2FYU G;  1Z56 A;  3IR9 A;  3B5N A;  4BRY A;  2KSJ A;  5B5E H;  2HFE D;  3M9Q A;  3K5B A;  3RBX A;  4EYY Q;  1K04 A;  1JB0 J;  1HJ0 A;  1NTM K;  1FJP A;  2ZYD A;  1FBM A;  4PD4 D;  2R44 A;  1JUN A;  2M8R A;  1FU1 A;  1PV3 A;  2NRG A;  2ZJS E;  1LGH B;  3A5T A;  3RK3 D;  1X79 B;  3A3Y B;  2WSE H;  1CI6 B;  2KS1 B;  3CXH I;  1FZG A;  4JBZ A;  2N1T D;  2KNC B;  1U7J A;  2IYP A;  1NKN A;  1OW8 A;  4U3F J;  3L72 D;  2V7Q H;  3H6P A;  1JY3 O;  2IBZ G;  1QGK B;  3CCR P;  3TGU G;  2KZJ A;  1EXI A;  2POH A;  1WT6 A;  1HF9 A;  2W6A A;  4Z1M H;  1G1J A;  3SFD C;  1J1D C;  2YIU B;  1BGY J;  1NAY A;  4I6M C;  1NTZ E;  2M5A B;  4K3A A;  3CC7 P;  2GM4 A;  2IFM A;  5C39 A;  1NHL A;  1BE3 J;  1KYO H;  3AE3 C;  2BCC G;  2ZT9 D;  2KUB A;  1IFI A;  4I2L C;  4IFD K;  4U3F E;  3EQ2 A;  2JP3 A;  2KXP B;  2H43 A;  1FE6 A;  2OGU A;  1KTM A;  2XNX A;  3P8M C;  1Q82 Q;  5H2F E;  1A02 F;  2XV5 A;  4IFM A;  2K1A A;  1BGY E;  3V4Q A;  3MUD C;  5AW2 B;  2A45 H;  4WVZ A;  3S9O A;  2IDB A;  1U7M A;  1G1I A;  3MUD A;  1OXZ A;  1IFN A;  5APW A;  3D70 A;  3D71 A;  3FWL A;  3EFF K;  2R3S A;  1BE3 E;  5KLV J;  2HOD B;  1AFO A;  3LW5 H;  1USD A;  3P7K A;  2O01 H;  1EC5 A;  1CI6 A;  1NTM J;  2HPC B;  2KS1 A;  3SSU A;  3E1R A;  2C9L Y;  2KNC A;  4D6T D;  4B86 A;  5GTH E;  3RL0 B;  1NVO A;  1SQP E;  1ZP0 C;  5KAF E;  2E5Y A;  5L8R J;  3MZW B;  2I1K A;  3B5N D;  1L0L E;  1ZV8 A;  4WY4 B;  2QRX A;  2M5A A;  1H8A A;  3CCJ P;  3CI9 A;  1JCD A;  3MHV A;  5KLV E;  5APY A;  4L73 A;  1MUU A;  2QG4 A;  1NTM E;  5AVQ B;  2RN0 A;  2M3E A;  3H1L D;  2WMM A;  3IF4 A;  3CWB D;  3L70 J;  1SQB D;  2O1J A;  3L75 J;  4HYT B;  5AW0 B;  1PGP A;  1SQQ D;  5CMZ A;  2B9B A;  3BAS A;  4H44 B;  1NJI Q;  3H1H D;  1M1J B;  1OIP A;  5AVZ B;  1KC8 Q;  4U3F G;  2KLU A;  3A7O A;  1EDI A;  3CCM P;  3II6 A;  4L75 A;  3M06 A;  1P84 D;  3ABV C;  2HOD A;  1VQ6 P;  2HPC A;  3SWF A;  1JTH B;  2E74 C;  2IZ1 A;  1RF1 B;  1BGY G;  1NU1 D;  1KB9 D;  1N86 A;  1L0N J;  1E5W A;  2LKM A;  5AW1 B;  1BE3 G;  1EZV E;  1IFP A;  4OVN F;  3UIA A;  1H88 A;  1KIL D;  2WPV B;  4L76 A;  3QH9 A;  4WY4 A;  1NH4 A;  3FX0 A;  1GK4 A;  1OW7 A;  1PPJ G;  1D7M A;  2B88 A;  2C9N Y;  1VQ4 P;  4AQR D;  1SFC B;  4N78 D;  3S4R A;  1IK9 A;  4IOI H;  2Y9Z A;  1L0N E;  1A02 J;  1OFC X;  1AVO A;  1L0L G;  1NKZ B;  4H44 C;  2YO2 A;  1FC2 C;  2OYH B;  3L74 J;  1VF5 D;  2C0X A;  4PV1 B;  5KLV G;  2XND H;  5APS A;  3P8C D;  1M1J A;  1NTM G;  1NOH A;  1KQS O;  4I1L A;  3RK2 B;  1P84 H;  3GF7 A;  5KAI H;  1DEB A;  2D2C D;  5E79 H;  4PD4 E;  1RF0 C;  4ZKP A;  3ITK A;  4ZMD A;  2GUS A;  4JF7 A;  1JTH A;  1KB9 H;  1N73 C;  1OW6 A;  1RF0 A;  1RF1 A;  2J58 A;  5CCH C;  3RL0 g;  5GTI E;  1CZQ A;  3KZI E;  2KZI A;  1S9K D;  1LT9 B;  2AXC A;  1OZH A;  3VOP A;  4YXD C;  2JWA A;  3CCU P;  3H1I J;  1J1E B;  3WU2 E;  3V4W A;  4UB8 H;  3L75 G;  1KQF B;  1SFC C;  2QEX P;  3M0D C;  1KYO I;  1FZE A;  1QVG O;  1SFC A;  2UWJ E;  3M0D A;  2OYI B;  1EZV G;  2HYN A;  2FXP A;  1S4X A;  1DIP A;  4W7Z A;  4PD4 I;  1KOR A;  1X8Y A;  2OYH A;  1VQ7 P;  1KFN A;  3GW6 A;  3A0B E;  2QM7 A;  4WBA A;  3RK2 C;  2QSI A;  3H1I E;  5BU5 A;  1WMK A;  2A45 I;  4AUW A;  3PJS K;  1PP9 J;  1YIT P;  1MZ9 A;  4Y28 J;  2A06 D;  3A0H H;  2XDJ A;  1L0N G;  1L4A B;  1PGO A;  4LC1 A;  2WSF H;  3L73 J;  3USS A;  2W6J H;  2ZFC A;  3LIE A;  3C1L A;  1S5L H;  1GK6 A;  1LT9 C;  1OVU A;  2Y0E A;  5TIS E;  4GOD A;  4QMA A;  2LXB A;  1LT9 A;  2NPS D;  1NTZ K;  2I8D A;  1ZR4 A;  2AXT H;  2ZXE B;  1JM0 A;  1S2E A;  1T2K D;  2KB7 P;  4OH8 B;  5AVX B;  1RE3 C;  2W6B A;  2IZ0 A;  3H25 A;  2R3C A;  2WQY C;  2QJY C;  4EI2 A;  2E76 C;  1RE3 A;  1G2C B;  3L74 G;  1M8O B;  3L73 E;  3SFE C;  2WIT A;  1AJY A;  2QJK B;  4GOF A;  2Q6Q A;  2OYI A;  2FXO A;  2KSE A;  4HJG H;  1GZL A;  1VQL P;  3B8E B;  1R8E A;  3V2P A;  1NTK J;  1ZRT D;  3LID A;  1HGV A;  3VTP C;  1LT1 A;  5AVR B;  1IC2 A;  3CWB E;  3CD6 P;  1SQB E;  1GMJ A;  1SVF A;  1L4A C;  2OQQ A;  1J2J B;  1IZN B;  3L36 A;  3L37 A;  1L4A A;  4CPG A;  3CXH E;  3JCU H;  4DJG A;  2N9B A;  3P32 A;  1J1D B;  1MV8 A;  1SQP K;  5APX A;  2HG5 D;  3H1I G;  2IYO A;  1GU5 A;  3H1J J;  1FAV A;  1N7L A;  1KYO D;  1NTK E;  4DT0 A;  3MP7 B;  3F89 A;  1L0L K;  1T3U A;  4JPZ B;  1GL2 C;  5KLV K;  1YQ3 C;  5AW6 B;  2GA1 A;  1PL5 A;  3AED C;  3Q5R A;  3CC2 P;  1LTI C;  2ZAE B;  1R5L A;  1Q86 Q;  1URQ D;  3Q3D A;  3Q2Y A;  4HKZ H;  1UIX A;  2QJK C;  2ZYG A;  1G2C A;  2WPR A;  1NTZ J;  2JO1 A;  1DEE G;  1R5S A;  1KIL E;  3L71 D;  1PP9 G;  3H1J E;  2M3B A;  1KQG B;  4LGD E;  3CLQ A;  2KIK A;  3AE8 C;  1JY3 P;  4N78 E;  3L73 G;  1SQX D;  2P7J A;  3N7N A;  5APU A;  2OTL P;  3I56 P;  2QM8 A;  3O6Q A;  1P84 I;  5KJ7 D;  2KLV A;  2FKW B;  3H1K J;  4MN4 C;  2NZ2 A;  3JSV C;  2Z5I A;  1KB9 I;  3V6I A;  2O1K A;  1LTB C;  2XKM A;  4H0L B;  3CX5 D;  2VRS A;  3CWB G;  2W27 A;  1BCC D;  4YXW H;  1SQB G;  1GU4 A;  4U7J A;  1SQV D;  1XTC C;  1IO4 A;  2Y0D A;  1IJD B;  4UB6 H;  2JWD A;  1KIL C;  3MD0 A;  1H0T B;  2CK3 H;  1SQP J;  5B66 H;  2WSC J;  3H1K E;  1NYH A;  1TU3 F;  1S5L E;  2L5G B;  1L0N K;  2FYU D;  1NTK G;  1L0L J;  2FXM A;  4I7Z C;  3EFG A;  5KLI B;  2YKP A;  3FGA D;  1FOS F;  2P58 A;  1W2E A;  4NPF X;  3HE5 B;  1LTA C;  2H89 C;  2E75 C;  4KT0 J;  2Y9Y A;  1AQT A;  1YTZ T;  2E74 B;  2WVR A;  2K88 A;  5CJ4 A;  2YNY A;  1RE4 C;  3H1J G;  3AE2 C;  4OGQ D;  1GDT A;  2AEM A;  4R4L A;  1OWA A;  1RE4 A;  2AEF A;  3KHU A;  3BAT A;  4O9B A;  3MIW A;  4H0L C;  4AYC A;  3CX5 H;  1KZU B;  3IFM A;  1K9M Q;  3PTZ A;  2IBZ D;  1JY2 N;  3HTK B;  3TGU D;  3U1A A;  2O01 N;  1NWQ A;  3SWY A;  3V2R A;  3G71 P;  2KI7 B;  1EDL A;  2KYV A;  4JYB A;  2BEZ F;  1NTZ G;  1BDD A;  1H0T A;  2H88 C;  1N7S B;  4PJ0 E;  4A7P A;  4RO0 A;  3HD7 B;  2WSS H;  3MTU E;  3CME P;  1GD2 E;  4XA4 A;  2RMZ A;  2BCC D;  3CPW O;  3D6Y A;  5KLI C;  2LR2 A;  4RJT A;  5B5E E;  3G9R A;  3EWK A;  1FDM A;  3C9I A;  2V7Q J;  3H1K G;  1IFM A;  1K8A Q;  3HE5 A;  3CL3 D;  2H8P D;  3AE9 C;  3I5C A;  1N73 B;  1UII A;  3C8V A;  4N3Y B;  3OA7 A;  2R5B A;  4H13 B;  4JQ0 D;  1KN7 A;  3VP9 A;  2KK7 A;  4IL6 H;  3BCC J;  3VYI A;  5AW4 B;  1W2B O;  3AE1 C;  4R4M A;  2PGD A;  1WRG A;  2C0W A;  1SQP G;  2Q3I A;  5CBN A;  3L4F A;  3FXD A;  3HTK A;  3CCQ P;  1ZME C;  1QVF O;  2E42 A;  3PRJ A;  3GHG B;  1VPC A;  4ASW A;  4C46 A;  2IX7 C;  3E1I A;  1IFJ A;  1N7S C;  2YXQ B;  1K05 A;  1N7S A;  3HD7 C;  1YBK A;  3BCC E;  1KYO E;  2OTJ P;  1FDO A;  3HD7 A;  2O01 J;  5CCG C;  3O8Z A;  2AEJ A;  3L72 J;  5CCG A;  1KQL A;  4W7Y A;  3G3Z A;  4UB6 E;  3W68 A;  1JMB A;  2QVA A;  3IAO A;  1PIX A;  2Q5U A;  2ZXX A;  1LP1 B;  1SQB K;  2OTK E;  2N1T B;  3WMM 0;  1LTG C;  1N73 A;  3T97 B;  1VQ8 P;  1AVY A;  3L71 E;  2Q9I A;  3RK3 E;  4H13 C;  5CCH A;  4U3F D;  3VMX A;  1FZF A;  5K5G B;  2J59 M;  2KOG A;  3KYQ A;  2PFX A;  3HE4 B;  5AVU B;  5AVV B;  2K37 A;  3JC2 2;  3L72 E;  1FOS E;  1GTW A;  4DZO A;  1S3J A;  4C7R A;  1BGY D;  3M9H A;  3WUV A;  1JNM A;  1NTK K;  2QJY B;  2E76 B;  5CBO A;  2BAS A;  1ZW0 A;  3GHG C;  4N6J A;  1BE3 D;  1Y9B A;  1NU1 K;  3GHG A;  1RH5 B;  1VQ5 P;  5AVW B;  3U59 A;  2ITA A;  1PPJ D;  2OAR A;  2Z4E A;  1W5C E;  4DCK A;  4C7N B;  2B87 B;  4D6T J;  1Q7Y Q;  2W83 C;  2E74 D;  3AEG C;  2B89 A;  3RK3 C;  1KMI Z;  3RL0 D;  3F5H A;  1PFI A;  2N1T C;  5KLV D;  3BCC G;  1LWU B;  2ZYA A;  1LP1 A;  4BWN A;  1QX8 A;  1NTM D;  2N1T A;  2JKV A;  4WY4 D;  3T97 A;  5EFW B;  5KJ7 C;  3G4S P;  1HTL C;  3H1L J;  2G8Y A;  4XE5 B;  3HE4 A;  1GL2 B;  3CWB J;  4D6T E;  3CX5 I;  3AE5 C;  3Q5S A;  1SQB J;  5AW3 B;  2A45 G;  3CCS P;  1RQV A;  1SQQ J;  3TDK A;  1T6A A;  3H1H J;  1BDC A;  4H44 D;  2ZT9 C;  2HLO A;  1H89 A;  1IFD A;  1KD1 Q;  1S1C X;  1USE A;  1MKM A;  2FY8 A;  3L72 G;  5AW7 B;  5GTH H;  3L70 D;  2JR8 A;  3L75 D;  3MGN A;  2IBZ E;  1VDF A;  2JDI H;  1QEX A;  5KAF H;  3TGU E;  2FYN B;  3H1L E;  3CCE P;  2OYO A;  1EXJ A;  1N2D C;  2FBW C;  1ZLL A;  1NU1 J;  1EZV D;  4C7N A;  2B87 A;  3TNU B;  1SQQ E;  1HBW A;  3VMY A;  3H1H E;  1LWU C;  1QL2 A;  3W67 A;  4YPC A;  2PP6 A;  1NGM B;  2RH0 A;  2J5U A;  4JYC A;  3GMA A;  1LWU A;  2WWW A;  2Z5H A;  3AEE C;  1SLQ A;  1DD3 A;  1P84 E;  1L0N D;  4OGQ C;  5KAI E;  3HUS B;  3VP8 A;  5E79 E;  1VL2 A;  3WUU A;  1SFC D;  5AVS B;  3AEF C;  3PP5 A;  1NU1 E;  1KIL B;  3B5N C;  3NFQ A;  1KB9 E;  1GL2 A;  3AE6 C;  2G3A A;  1M57 D;  2IBZ I;  3M9B A;  1JO5 A;  2N9Y B;  2YMY A;  4PV1 D;  2YMK A; 
#chains in the Genus database with same CATH homology
 1KFM A;  1OWA A;  1NKZ B;  1RE4 A;  3H32 B;  4WB4 A;  2YO2 A;  2OYH B;  3BAT A;  3KQG A;  4O9B A;  3MIW A;  2C0X A;  3RK2 D;  2FFD B;  5KJ7 A;  4AYC A;  5APS A;  1KZU B;  3P8C D;  2WTY A;  1M1J A;  3IFM A;  4GKG A;  1NOH A;  2R32 A;  3V5B A;  5BU8 B;  5AVY B;  3B5N B;  3NMD A;  4I1L A;  3RK2 B;  1JY2 N;  3HTK B;  1JMM A;  2YKO A;  3U1A A;  2H7H A;  1HJB A;  1J1E C;  1HH0 A;  3M0A A;  1NWQ A;  1N7S D;  3HRN A;  3SWY A;  3V2R A;  1DEB A;  1GDT A;  1XTG B;  2KYV A;  4JYB A;  1M7L A;  3TNU A;  1RF0 C;  4ZKP A;  3HD7 D;  1YTZ I;  2GUS A;  4JF7 A;  1CSB A;  4IFF A;  1HWT C;  3BVH A;  3P8C E;  4M3L A;  1JTH A;  1N7S B;  1N73 C;  1RF0 A;  1RF1 A;  2J58 A;  5CCH C;  1FZA A;  2OYI C;  5CCG D;  1HGZ A;  3KPE A;  4EIJ A;  1CZQ A;  3NTN A;  2WSC H;  3HD7 B;  3MTU E;  3U1C A;  1S9K D;  1LT9 B;  1GD2 E;  4XA4 A;  2WT7 B;  5BVZ A;  3VOP A;  2YO3 A;  2XU6 A;  4GT1 A;  3A2A A;  3HUS C;  2WZ7 A;  1HUC A;  2JJL A;  1FDM A;  2E43 A;  3C9I A;  1J1E B;  3V4W A;  1QL1 A;  3HUS A;  4KHX A;  3TK1 A;  1CW5 A;  1IFM A;  5CCH D;  2PAJ A;  5APV A;  3HE5 A;  4HH2 A;  3CL3 D;  2H8P D;  4Y99 B;  1KIL A;  1SFC C;  2YKQ A;  3M0D C;  1FZE A;  3I5C A;  1N73 B;  1S9K E;  1SFC A;  1JY3 N;  3M0D A;  2OYI B;  5CJ0 A;  2HYN A;  5CHX A;  4N3Y B;  3OA7 A;  2R5B A;  2IPP A;  3VP9 A;  3KDP B;  2FFD C;  4W7Z A;  3H32 A;  3VYI A;  2GUV A;  1X8Y A;  2OYH A;  5AW4 B;  1KFN A;  1GW3 A;  1YYC A;  2FFD A;  1DX7 A;  2QM7 A;  5AW9 B;  4WBA A;  3RK2 C;  1WRG A;  2C0W A;  2I1J A;  5BU5 A;  2A45 I;  4AUW A;  1L4A D;  3V2Q A;  5AW8 B;  2Q3I A;  1Z56 A;  3IR9 A;  2KP8 A;  3B5N A;  1MZ9 A;  3L4F A;  3HTK A;  2KSJ A;  5AVT B;  2XDJ A;  2HFE D;  5APT A;  3M9Q A;  2E42 A;  4LLH A;  1FZB A;  1L4A B;  3GHG B;  1VPC A;  4C46 A;  2IX7 C;  3E1I A;  2IFN A;  4LC1 A;  1IFJ A;  2WSF H;  1N7S C;  1FJK A;  1NTM K;  1FJP A;  1FBM A;  1LTJ B;  2ZFC A;  3LIE A;  1N7S A;  1JUN A;  3HD7 C;  2M8R A;  1GK6 A;  1LT9 C;  1FU1 A;  4DOJ A;  3HD7 A;  3N4X A;  1LGH B;  5AW5 B;  3BRV B;  5APQ A;  5CCG C;  1LT9 A;  3O8Z A;  3A5T A;  2R5D A;  2WT7 A;  3RK3 D;  2NPS D;  1EQ7 A;  1GL2 D;  1NTZ K;  1X79 B;  4EOT A;  3A3Y B;  2WSE H;  5CCG A;  1KQL A;  4W7Y A;  1ZR4 A;  3G3Z A;  1CI6 B;  2ZXE B;  1FZG A;  1T2K D;  2KB7 P;  1SQX K;  2Q5U A;  2N1T D;  4OH8 B;  2NPS B;  4Y99 C;  5AVX B;  1RE3 C;  1NKN A;  2W6B A;  2R3C A;  3H6P A;  1JY3 O;  1SQB K;  1RE3 A;  1G2C B;  2N1T B;  3WMM 0;  2WPS A;  2XZR A;  1LTG C;  1N73 A;  4RES B;  2Q9I A;  2POH A;  1WT6 A;  2WIT A;  5CCH A;  2OYI A;  3VMX A;  1FZF A;  1DH3 A;  3BRT B;  2W6A A;  1G1J A;  2J59 M;  1J1D C;  2KOG A;  1RY3 A;  3KYQ A;  4I6M C;  3HE4 B;  2CPS A;  5AVU B;  2GM4 A;  2IFM A;  5AVV B;  1GZL A;  1ZN5 A;  1FOS E;  1NAF A;  1NHL A;  3B8E B;  1GTW A;  3V2P A;  4DZO A;  1SQV K;  1JCC A;  4C7R A;  3LID A;  3M9H A;  1HGV A;  3VTP C;  1JNM A;  1NTK K;  3OAK A;  5KTB A;  5AVR B;  1IC2 A;  1IFI A;  1NO4 A;  4I2L C;  1SVF A;  4IFD K;  3EQ2 A;  1L4A C;  2H43 A;  2BAS A;  1J2J B;  3GHG C;  3V2N A;  4N6J A;  2XNX A;  3P8M C;  3L36 A;  1NU1 K;  3L37 A;  1L4A A;  1LTJ C;  3GHG A;  3OJA B;  1A02 F;  2XV5 A;  1LTS C;  2N9B A;  2P1J A;  4IFM A;  3P32 A;  3RL0 C;  1J1D B;  5AVW B;  1MV8 A;  1SQP K;  2FYU K;  3U59 A;  1LTJ A;  5APX A;  2HG5 D;  1HVV A;  1JY2 P;  1GW4 A;  3V4Q A;  5AW2 B;  1GU5 A;  1JY2 O;  2A45 H;  1FZC B;  1JOC A;  1FAV A;  1N7L A;  2OAR A;  1G1I A;  3R2P A;  3NXS A;  3MUD A;  1OXZ A;  1IFN A;  2Z4E A;  5APW A;  1T3J A;  4WY4 C;  1L0L K;  4C7N B;  1T3U A;  2HOD B;  3L35 A;  1AFO A;  3LW5 H;  3P7K A;  2O01 H;  3RK3 C;  2NPS C;  1GL2 C;  1CI6 A;  5AW6 B;  3RL0 D;  5KLV K;  2HPC B;  1X9V A;  2NPS A;  2C9L Y;  1LTI C;  1PFI A;  2MJZ A;  1T2K C;  2N1T C;  4B86 A;  1URQ D;  1LWU B;  3RL0 B;  1LTT C;  2CPB A;  1G2C A;  2N1T A;  4WY4 D;  2WPR A;  3T97 A;  1URQ B;  4W80 A;  5KJ7 C;  3M91 A;  1M1J C;  2M3B A;  1HTL C;  4LGD E;  2I1K A;  3B5N D;  1ZV8 A;  4WY4 B;  4XE5 B;  1H8A A;  3HE4 A;  3CI9 A;  1JCD A;  3CLQ A;  3VN0 A;  3RK3 B;  1GL2 B;  5APY A;  1JY3 P;  4GIF A;  5AW3 B;  1MUU A;  4N78 E;  5AVQ B;  2A45 G;  2P7J A;  3N7N A;  5APU A;  1SQQ K;  2QM8 A;  5KJ7 D;  2KLV A;  2FKW B;  2O1J A;  2HLO A;  4HYT B;  5AW0 B;  2Z5I A;  1RF1 C;  1H89 A;  1IFD A;  5CMZ A;  3BAS A;  5AW7 B;  1M1J B;  1MFZ A;  2O1K A;  5AVZ B;  3MGN A;  1LTB C;  2XKM A;  1FZC C;  1VDF A;  2VRS A;  2W27 A;  1FZC A;  1ZR2 A;  3A7O A;  1N2D C;  1GU4 A;  1ZLL A;  3II6 A;  1XTC C;  1IO4 A;  3M06 A;  2JEE A;  4C7N A;  1IJD B;  2HOD A;  3TNU B;  1KIL C;  4ZKU A;  3MD0 A;  1HBW A;  2HPC A;  1AQ5 A;  3VMY A;  3SWF A;  1JTH B;  2P67 A;  1LWU C;  1QL2 A;  1RF1 B;  2PP6 A;  4JYC A;  1T8Z A;  1N86 A;  1LWU A;  2WWW A;  1E5W A;  2Z5H A;  2LKM A;  1SLQ A;  2L5G B;  1URQ C;  1L0N K;  3VMZ A;  5AW1 B;  2FXM A;  2WPQ A;  2OYH C;  3EFG A;  3UIA A;  1URQ A;  2YKP A;  1H88 A;  1KIL D;  3HUS B;  3VP8 A;  1FOS F;  2P2U A;  1W2E A;  4WY4 A;  1SFC D;  5AVS B;  1NH4 A;  3PP5 A;  3HE5 B;  2Q7C A;  1LTA C;  3TYY A;  1GK4 A;  1KIL B;  3B5N C;  3NFQ A;  1GL2 A;  2C9N Y;  1YTZ T;  4AQR D;  3M9B A;  1SP4 A;  1SFC B;  5CJ4 A;  1JO5 A;  4N78 D;  2YNY A;  1IK9 A;  1RE4 C;  2YMY A;  2FYZ A;  1A02 J;  3TSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...