1FZFA

Crystal structure of fragment double-d from human fibrin with the peptide ligand gly-his-arg-pro-amide
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
67
structure length
67
Chain Sequence
VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FIBRINOGEN
publication title Conformational changes in fragments D and double-D from human fibrin(ogen) upon binding the peptide ligand Gly-His-Arg-Pro-amide.
pubmed doi rcsb
molecule tags Blood coagulation
total genus 20
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 1998-12-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1fzfA00
1JY2O 1LT9C 1JY3P 2OYHA 1M1JB 3E1IA 3HUSA 1RE4C 2H43A 3BVHA 1JY3O 2OYIC 1FZCB 2HPCB 1FZGA 1LTJB 3GHGB 1RF0C 2FFDC 1M1JA 1N73C 1RE3C 1RF1B 1LTJA 1LWUB 3GHGA 3H32B 1FZCA 2HODB 2HPCA 2HLOA 1LWUA 3H32A 3HUSC 1RF1A 2OYHC 1LT9B 2Z4EA 1N73A 2OYHB 2XNXA 2HODA 2Q9IA 2OYIB 1JY2N 1LT9A 2A45I 1M1JC 1FZFA 1W2EA 1N86A 2FFDB 1LTJC 1FZCC 1T3UA 1RE4A 1N73B 2OYIA 3GHGC 1JY2P 1FZAA 1FZEA 1JY3N 2A45H 1FZBA 1RF1C 1RF0A 2FFDA 1LWUC 2A45G 1RE3A 3HUSB
chains in the Genus database with same CATH superfamily
1JY2O 1ZMEC 4WY4B 3BVHA 4RO0A 2Z4EA 4I1LA 2OYIB 3KDPB 1JY2N 5BU8B 2KOGA 2YNYA 5CJ4A 3D71A 3HD7B 4LLHA 1PZQA 2NZ2A 5AVUB 4GOFA 1N7SD 1VL2A 3WU2E 5KAIH 4DJGA 2FFDC 2BEZF 3CX5I 2YXRB 1J1EB 1OW7A 1YYCA 1QVGO 1LTAC 2CPSA 3OJAB 1FZBA 1NO4A 1RF0A 4W7YA 1L4AC 1AQ5A 2Y9YA 1X8YA 1SQXK 4W7ZA 3V4QA 5KLVG 1VF5C 3GW6A 2ZT9B 4H44B 3RL0B 3NXSA 3H1JJ 1NTZE 2YMKA 3RK2B 1OXZA 1OVRA 1NTMJ 2BCCJ 4HH2A 1LTJC 2OYIA 5EFWB 3IN6A 4CPGA 3HD7A 5AVRB 2WPVB 2E42A 2E76B 3IR9A 5KTBA 4PJ0E 2KS1A 2E5TA 4W80A 2BEQD 2XDJA 3L72G 1Q82Q 1L0LK 4KJMA 1RE4A 1SQPD 3CCRP 1PGOA 1FU1A 5AW4B 2XKMA 2J5UA 3M9BA 2W8ZA 3KZIE 3QH9A 5AVTB 2QJKC 4XE5B 4U3FE 1S4XA 5K5GB 2R3CA 2ZXXA 1NGMB 4U3FD 2QVAA 1KQGB 1NKZB 4EIJA 1HJ0A 2KI7B 1ZW0A 1P84I 3CCEP 5CBNA 2XU6A 2Z5HA 2YKPA 3R4YA 3A0BE 2P10A 5APYA 5BVZA 2N1TC 1M7LA 4ZMDA 3OW2O 2FYUE 1AA0A 1EQ7A 2E75C 1SQQJ 2FYUD 1FJPA 1KMIZ 3RK3C 2P58A 2ZJSE 1EZVD 3CI9A 3B8EB 4YXDC 1LTTC 3ZDMA 4IFDK 3CC2P 3SFDC 3L72J 3H1LE 1KQSO 1N7SB 2N1TD 1AVYA 1BGYE 3H1LD 2KYVA 3M0DC 1L0NE 3CCQP 1L0ND 3BCCE 4ZKUA 2WMMA 2WPSA 1LT9C 5TISE 2OARA 1LTBC 3VOPA 3SWYA 4Z1MH 3GHGA 1NTKD 3H1HG 1SQVK 2NPSC 3CXHE 2FFDB 2M3BA 5GTIE 2H7HA 2A45H 2M5AB 3CLQA 3PLNA 3VP8A 5CCHD 1L4AB 3IF4A 1NAFA 4NPDA 5AVQB 4D6TJ 1JCCA 1VF5B 5AW5B 1Q90D 1EDLA 5APXA 1NTKJ 4RJTA 1LTSC 2ZYGA 4GOEA 1YJWP 1Y9BA 4ZNCA 5AVSB 3I56P 4BWNA 1E5WA 1AFOA 3CWBE 4I6MC 1IFNA 1BCCG 2ZXEB 3H1IG 3CMEP 3L70G 5DJUB 4GIFA 2IBZD 1YQ3C 2FFDA 2IYOA 3JSVC 3M9HA 3PTZA 4XA4A 3A5TA 5H2FE 2M5AA 2HLOA 1VQOP 1L4AA 1DEEG 2XZRA 5AW6B 5AVYB 1SQBE 1YTZT 2QJKB 2C9NY 1SQBD 4RESB 3QWOC 3WUUA 3B5NC 1LTJA 3AEEC 3HE5B 1K05A 1NTZK 5M1BA 3M91A 2OTKE 5APQA 3WU2H 3N7NA 3A3YB 3I55P 4NPFX 1Y8AA 5CHXA 3L73J 4C46A 3B5ND 1T8ZA 4GKGA 1IJDB 3Q1MA 3M06A 1ZRTE 2N1TB 5KLIC 1R8EA 1PPJG 1ZRTD 2E75B 1R5LA 1H88A 2WSCJ 4HYTB 1GL2C 3U59A 1NOHA 3RK3B 5APVA 1BCCJ 3HRNA 1SQXJ 5AW3B 1K04A 1OIPA 3MP7B 1GU4A 2WQYC 2K3RA 1IC2A 3CCJP 4PD4E 2YIUC 4JYCA 2HPCB 2HR3A 4PD4D 1NU1G 4PJ0H 2OYHC 1QGKB 1GW3A 2WPRA 5AVWB 5APTA 2QA4P 2N1TA 3TGUG 3AE3C 2NPSB 1L0LJ 4IFFA 3HTKB 1PP9E 3KZIH 1HBWA 3MUDC 4OGQC 1PP9D 1X0TA 2FYUK 5CCGC 3L74E 2O1KA 1IFIA 1GD2E 1JEKA 3L74D 3H25A 1S5LX 3VYIA 2A06G 4H44D 5AVVB 3RL0D 1MUUA 1SQVG 3RK2D 2QM7A 1ZLLA 3SWFA 2HPCA 3AE1C 4RKUJ 3A0BH 2C9LY 2I1KA 3NFQA 1LT9A 1M1JC 1QL1A 3FXEA 2L5GB 3G3ZA 2E76D 1J1DC 2HFED 1L0NK 4WVZA 2NPSA 1MV8A 3HTKA 3L35A 1HH0A 2W83C 3PRJA 3S9OA 3KYQA 5APSA 1IZNB 1A02F 1LNQA 1EXJA 5DJTB 2J58A 3W68A 3G6EP 1USDA 3TK1A 3AE4C 4EYYQ 3FX0A 3H1JG 1NAYA 3TGUJ 4OH8B 2JP3A 3B5NB 3JCUE 3GHGC 4IL6X 3TDKA 2Y0EA 4JQ0D 5TISH 1NTMG 2BCCG 3MTUE 4JF7A 1BSHA 3OAKA 4PV1C 3LIDA 3P8CE 1MZ9A 3CXHH 1H0TB 1X22A 4YXWH 5GTIH 1N2DC 2Q1KA 1VPCA 4EI2A 3D70A 1OVVA 1SQVJ 2I1JA 1BE3J 1E79H 3RBZA 4EDFA 1HUCA 5APWA 5KLIB 3KHUA 5KAFE 4L74A 1KILC 3B5NA 3II6A 3K5BA 4N78E 1JM0A 1SQBK 4H0LC 3MGNA 3U1AA 4N78D 2KS1B 3CCVP 1PV3A 1LP1B 1SQPG 4WWIA 2YIUB 1H0TA 2KSEA 3LIEA 2OYHB 3L75E 1HTLC 3IFMA 5H2FH 1M56D 3L75D 5AVZB 3V2QA 5GTHE 4MN4C 1GW4A 1NTZD 1GL2A 3BASA 1OVUA 1SQQG 2MJZA 1URQA 1L4AD 2Y9ZA 3B71A 1ZN5A 1ZXGA 1VF5D 1GTWA 1W2BO 1LP1A 1SVFA 4R4LA 2Q6QA 2KXPB 2IFNA 1NTZJ 1Q7YQ 3O6QA 3L36A 2OYHA 1M1JB 1EZVI 2KUBA 1J1DB 1IFDA 1EZVG 2AXTE 3Q5SA 1EXIA 3AE9C 1SP4A 1FZCC 1Z56A 4BXLA 3MUDA 2R32A 2G3AA 2AEJA 1BSNA 5B66E 3G71P 3CCLP 3KQGA 3GMAA 5CCGA 5KLVE 1SQPJ 2PFXA 1USEA 5KLVD 2XV5A 1KQFB 1DD4A 2YO2A 2O01H 1HGZA 1W5CE 5AW7B 2PAJA 2PRRA 4D6TG 4PD4H 1DD3A 3GF7A 2Q3EA 2WSFH 1FDOA 1NTKG 2P2UA 2QG4A 3GHGB 1M1JA 4U3FJ 2WPQA 2ZVNB 3W67A 3B4SA 4AQRD 2O3JA 3FWLA 4PV1B 1Q2NA 3L37A 1U7JA 4C7NB 1H8AA 1RQVA 2R44A 1LJ2A 1JMMA 2IZ1A 1OW8A 3FGAD 1VQLP 4N3YB 2E75D 3RK3E 1BGYD 2ZAEB 1QVFO 3RK3D 2IX7C 2FYUJ 3Q3DA 1D7MA 3BCCD 3CCSP 3Q5PA 2IBZI 1KILB 2AEFA 2FY8A 2XNDH 4KHXA 3AEGC 2IBZG 4H0LB 1CZQA 2JWAA 2R5BA 2YMYA 3H1KE 3CXHD 2Y0DA 1DEBA 1PGJA 1PFIA 3H1LJ 1CI6B 1QL2A 3H1KD 4HKZH 3UIAA 4UB6E 4C7NA 3E1IA 1BGYJ 1YJNP 2QJPC 3ABVC 1L0NJ 1N8RQ 3V4WA 3BATA 1OWAA 3BCCJ 2RMZA 3F5HA 3L71E 2M0BA 4DCKA 4IL6E 3L73G 1OW6A 2NPSD 2H8PD 3L71D 1VQ6P 3AE8C 3SSUA 1FC2C 2DW3A 2QE7H 2MKVA 1PGPA 2YXQB 1LTJB 1NKNA 1SS1A 1ZP0C 1SLQA 1CW5A 1VQNP 2QM8A 4AUWA 1KILA 2QEXP 1CSBA 2HG5D 1LGHB 3JCUH 3AE2C 3CWBD 1YIJP 1SQXG 4LC1A 1CI6A 1HF9A 3CD6P 3H1HE 3V2RA 2Q9IA 5KJ7C 2KLUA 1EDJA 3H1HD 4TLFA 1JUNA 3P7KA 4Y28J 4QMAA 2FXPA 2R5DA 3CWBJ 2YO3A 2OYOA 4HJGH 1FZCB 1RH5B 1L0LG 5KAFH 1LWUA 1LT1A 3CMAP 3PHLA 5B5EE 4PD4I 1JMBA 1AJYA 2KIKA 1IFPA 3VP9A 5CMZA 3WMM0 1YTZI 3MZWB 2WVRA 4H13C 1SQBJ 1KQLA 2FYNC 3H1IE 3L70E 3N4XA 1VQ7P 3P32A 1FS0E 3L70D 1MFTA 3ITKA 2GUSA 2OTJP 1FZCA 2NRGA 5GTHH 2K88A 2E5YA 1URQC 2KZJA 1Y47A 1U7MA 4GODA 1N7LA 4O9BA 3LW5H 1FZAA 2IDBA 3KXDA 1AVOA 2N9YB 4ASWA 2LR2A 2FXMA 1KN7A 1GL2D 3GLMA 1RQUA 5KLVK 3H6PA 1LT9B 2A45I 1URQD 1AV1A 4B86A 4I2LC 1IO4A 2SPZA 1VQPP 2A45G 3CPWO 1T6AA 4BRYB 1K73Q 2E43A 2IFMA 3V6IA 2P1JA 2FXOA 2O01J 2AXTH 3A7OA 2QJPB 2ZT9C 2WSFJ 1PPJE 1UIXA 1DH3A 5B66H 3E7KA 4L76A 3TF5A 1T3JA 1PL5A 4HB1A 1KB9E 1BE3G 3VMXA 3KPEA 1VDFA 2ZVOB 3HUSC 1VQKP 1KB9D 1FDIA 2K37A 4OGQD 1FZFA 3EFGA 3R2PA 5CCGD 2JKVA 2QIWA 2HYNA 1PP9J 2JR8A 1K8AQ 2CK3H 1EDKA 2Z5IA 1QX8A 3G4SP 3L74J 1NU1E 4BRYA 3OA7A 1DX7A 3C1LA 1NU1D 4R4MA 1G2CB 3BRTB 4YTPC 3VTPC 3AECC 3TGUE 1H89A 1BDCA 2E74C 1U57A 1SFCC 2H88C 2V7QH 1KYOE 2B87B 2H89C 1M57D 4I7ZC 2UWJE 3CC7P 1S3JA 1KYOD 3S1KA 3TSIA 2VRSA 2A06E 1ZR2A 2JJLA 4IOIH 1JO5A 5AW0B 2A06D 2E74D 1P84H 1W2EA 3P8CD 4H13B 1G2CA 3VMYA 1DIPA 4UB6H 2FYNB 3TNUB 1M8OB 1GZLA 2K9JB 5KJ7A 3P8MC 1NTZG 3A2AA 4UB8E 2W27A 4PV1D 3PH0A 1JNMA 1GL2B 4IL6H 2P7JA 1N86A 2B87A 1NJIQ 1N7SC 1FE6A 4N6JA 1URQB 3AE6C 1VQ5P 1JY3O 1G1IA 2ZYDA 1FBMA 1OX3A 2PP6A 1GU5A 3USSA 2M3EA 1PGQA 1FJKA 3M9QA 4K35A 1WT6A 4DZOA 3H1JE 2D2CC 1JY3N 3H1JD 1KILE 2Y0CA 3NMDA 3O6QB 3PJSK 1NTME 2BCCE 1KILD 2JWDA 2KNCA 3TNUA 1NTMD 2BCCD 2KK7A 2QJYC 4H0LD 4LGDE 2K9JA 3H32A 5AVXB 4WB4A 1KZUB 4U3FG 5KKZC 4C7RA 4ASVA 1LWUC 4OGQB 2D2CD 3AE7C 5L8RJ 2KZIA 4WY4A 3Q5RA 1JTHB 2B9BA 5B5EH 3L75J 1IFMA 2M8RA 3RGUA 3U1CA 3HUSB 1X79B 4OWFA 1KD1Q 2WTYA 2WSCH 2LXCB 2FYUG 1N73C 2OTLP 1OMIA 1FAVA 1HGVA 1SQPE 4GDOA 3WUVA 3LW5J 2N9BA 3FWNA 2WT7B 1Q86Q 3CX5E 4OVNF 5E79E 1VQMP 3PP5A 3CX5D 4L75A 2OGUA 1K9MQ 2O01N 3H1LG 1RE3C 5TJHA 2KLVA 1JTHA 1BGYG 2W6AA 2E74B 1S1CX 1L0NG 1SFCB 2W6BA 1SQQE 3Q2YA 3BCCG 2IYPA 1SQQD 3AEAC 4I7ZB 5BU5A 3HUSA 1NHLA 3CXHI 2KP8A 2POHA 3SWKA 5CJ0A 3L72E 1GK6A 2AEMA 1M90Q 1S5LE 3H1KG 3NTNA 4NPEA 3L72D 5KLVJ 3L4FA 2WT7A 3D6YA 2KSJA 3D6ZA 2WSEH 3CL3D 1M1KQ 3CCUP 2FKWB 1NU1K 2K9YA 2KB7P 4Y99C 3L71G 1EZVE 2WSSH 4K3AA 2BASA 3T97B 2G8YA 3A0HE 1KV4A 1SFCA 1OZHA 2Q7CA 4KT0J 2PGDA 3O8ZA 3RBXA 1WMKA 1KB9H 3V5BA 4AYCA 1YBKA 3CWBG 4JPZB 1VQ9P 3IAOA 1S72P 1P84E 1IFJA 4U7JA 1P84D 2JO1A 4D6TE 1G1JA 2FYZA 5CCHC 2IZ0A 2H43A 4D6TD 1JCDA 1NTKE 2V7QJ 2D2CB 2WWWA 1KC8Q 2C0XA 2QJYB 1T3UA 1SQBG 1NWQA 3T97A 2YKQA 1LTIC 3AE5C 5KKZB 1QLED 4TT3H 1FZGA 3I5CA 1LWUB 3S4RA 1KYOH 1N7SA 3H1KJ 1BDDA 3GF3A 2V4HA 2Q3IA 3CCMP 1LTGC 1RF1C 1JOCA 1AQTA 3TYYA 4JYBA 3AEDC 3SFEC 3C8VA 3L71J 5KAIE 2FBWC 4YPCA 1OFCX 1RHZB 3E1RA 2IBZE 4L73A 1UIIA 1GK4A 1J2JB 3JC22 1N73B 1YHQP 1YJ9P 2ITAA 2I8DA 1RY3A 1NTMK 4ZKPA 4UB8H 2HODB 1MFZA 1YITP 1HWTC 2GUVA 2QRXA 3EFFK 3L73E 3F89A 1KORA 2W6JH 5KJ7D 3L73D 4DOJA 1S2EA 3H1HJ 4M3LA 1Q81Q 2GA1A 2L91A 3RL0g 1TU3F 1GMJA 1PIXA 1BCCE 1SQXE 1BCCD 2RKLA 1N73A 4IFMA 1FDMA 3H1ID 1SQXD 1PP9G 1RF0C 3HE4B 2J59M 2WITA 1WRGA 2R3SA 3VMAA 4H13D 3MHVA 4WY4C 3L74G 2HODA 3M0AA 1SQPK 2AXCA 4XFJA 1RE3A 1KB9I 4Y99B 2OYIC 3EWKA 3HD7C 5AW1B 1L0LE 3H1IJ 1MKMA 3L70J 1L0LD 4JBZA 3HE5A 4WY4D 1VQ8P 1KFNA 2C0WA 5CBOA 1IK7A 5APUA 3MIWA 1ZR4A 1J1EC 1SQQK 1RE4C 4GT1A 5AW2B 5AW9B 1EDIA 2RN0A 2GM4A 3HE4A 3HD7D 2LKMA 3MD0A 3CC4P 3CX5H 4H44C 3RL0C 1HJBA 1XTGB 5E79H 2JEEA 2XNXA 5C39A 1KTMA 3VN0A 3RK2C 2WZ7A 1PPJD 3BRVB 1KYOI 3EQ2A 4EOTA 1ZOYC 2JDIH 1ZV8A 2K1AA 2E76C 3C9IA 3GG2A 2WSEJ 2ZT9D 1T2KC 3M0DA 4DT0A 1A02J 1RF1B 1IK9A 1S5LH 2OQQA 5CCHA 3V2NA 2ZFCA 1X9VA 1T2KD 1R5SA 1XTCC 3TGUD 1VQ4P 1NTKK 3WUTA 1FOSE 1GDTA 5AW8B 3A0HH 1HVVA 2O1JA 1JY2P 1NH4A 3FXDA 1NYHA 1NU1J 2Q5UA 2ZYAA 2LXBA 2QSIA 3V2PA 1JY3P 1KFMA 1SQVE 2RH0A 1BE3E 3G9RA 1SFCD 1SQVD 1RF1A 2CPBA 1BE3D 1YI2P 1QEXA 1L2PA 2W90A 1FZEA 2B89A 3L75G 2KNCB 1JB0J 4A7PA 3VMZA 3H32B 3AEFC 2IPPA 3AEBC 1NVOA 1S9KE 1EC5A 4WBAA 2YKOA 2P67A 1FOSF 1S9KD 2B88A 1YQ4C
chains in the Genus database with same CATH topology
1JY2O 2NPSB 4WY4B 4IFFA 5BU5A 3HTKB 1CI6A 3HUSA 3BVHA 1NHLA 1HBWA 2KP8A 2POHA 2Z4EA 2FYUK 5CCGC 5CJ0A 2O1KA 4I1LA 3V2RA 2Q9IA 2OYIB 1GK6A 3KDPB 1JY2N 1IFIA 2KOGA 5BU8B 5KJ7C 2YNYA 5CJ4A 1GD2E 3HD7B 3NTNA 4LLHA 1JUNA 3P7KA 3L4FA 2WT7A 5AVUB 3VYIA 5AVVB 3RL0D 1N7SD 2R5DA 2KSJA 2YO3A 1MUUA 2WSEH 3CL3D 1FZCB 3RK2D 2QM7A 2FFDC 1ZLLA 3SWFA 2HPCA 1LWUA 2FKWB 1NU1K 1J1EB 1YYCA 2KB7P 4Y99C 2C9LY 2I1KA 1LTAC 2CPSA 3NFQA 1LT9A 3OJAB 1M1JC 1QL1A 2BASA 2L5GB 3G3ZA 1FZBA 1NO4A 1J1DC 1SFCA 1L0NK 1RF0A 2HFED 1L4AC 4W7YA 3VP9A 1AQ5A 2Q7CA 1X8YA 5CMZA 1SQXK 4W7ZA 2NPSA 3V4QA 1MV8A 3O8ZA 3WMM0 1YTZI 3RL0B 3NXSA 3V5BA 3HTKA 3L35A 4AYCA 1HH0A 3RK2B 1OXZA 1KQLA 4HH2A 3KYQA 1IFJA 1LTJC 5APSA 3N4XA 2OYIA 1A02F 3P32A 3HD7A 2J58A 1G1JA 5AVRB 2FYZA 2E42A 5CCHC 2H43A 2GUSA 1JCDA 3IR9A 3TK1A 5KTBA 2WWWA 1FZCA 2C0XA 4W80A 2XDJA 1URQC 1N7LA 1L0LK 4OH8B 4O9BA 1T3UA 1RE4A 3B5NB 3LW5H 3GHGC 1FZAA 1FU1A 3T97A 1NWQA 2YKQA 5AW4B 1LTIC 2XKMA 3MTUE 3M9BA 4JF7A 2FXMA 1FZGA 1GL2D 3I5CA 3OAKA 1LWUB 3LIDA 5KLVK 3P8CE 1MZ9A 3H6PA 1N7SA 5AVTB 1LT9B 4XE5B 2A45I 1URQD 2Q3IA 4B86A 4I2LC 1N2DC 1IO4A 1VPCA 2R3CA 1LTGC 1RF1C 2A45G 2I1JA 1JOCA 1NKZB 4EIJA 3TYYA 1HUCA 4JYBA 5APWA 2E43A 2IFMA 2P1JA 2XU6A 2Z5HA 2YKPA 3A7OA 1GK4A 1J2JB 5APYA 1N73B 1KILC 3B5NA 1DH3A 3II6A 4N78E 5BVZA 1SQBK 3MGNA 3U1AA 4N78D 1T3JA 2N1TC 1M7LA 1RY3A 1NTMK 4ZKPA 2HODB 3VMXA 3KPEA 1EQ7A 1VDFA 1MFZA 1HWTC 3HUSC 2GUVA 1FJPA 1FZFA 3RK3C 3EFGA 3R2PA 5CCGD 5KJ7D 2HYNA 3CI9A 3LIEA 2OYHB 3B8EB 1LTTC 4DOJA 2Z5IA 1HTLC 3IFMA 4IFDK 4M3LA 3OA7A 5AVZB 1DX7A 1N7SB 2N1TD 3V2QA 1GW4A 2KYVA 1G2CB 3M0DC 3BRTB 1GL2A 3BASA 3VTPC 2MJZA 1N73A 4IFMA 4ZKUA 1FDMA 2WPSA 1H89A 1LT9C 1URQA 2OARA 1L4AD 1ZN5A 1LTBC 3VOPA 1SFCC 1RF0C 3HE4B 2J59M 3SWYA 3GHGA 2WITA 1WRGA 1GTWA 1SQVK 2NPSC 4WY4C 2HODA 3M0AA 1SVFA 1SQPK 2FFDB 2M3BA 3TSIA 2VRSA 2H7HA 2A45H 1RE3A 2IFNA 4Y99B 1ZR2A 2JJLA 3L36A 2OYHA 1M1JB 1JO5A 3CLQA 5AW0B 2OYIC 3VP8A 5CCHD 3HD7C 5AW1B 1J1DB 1L4AB 1NAFA 1IFDA 5AVQB 1JCCA 3HE5A 4WY4D 1W2EA 3P8CD 5AW5B 1SP4A 1FZCC 1Z56A 5APXA 1KFNA 1G2CA 3VMYA 2C0WA 3MUDA 1LTSC 3MIWA 5APUA 2R32A 1ZR4A 1J1EC 3TNUB 1SQQK 1RE4C 1GZLA 3KQGA 4GT1A 5AW2B 5CCGA 5AW9B 5AVSB 5KJ7A 3P8MC 1E5WA 1AFOA 2GM4A 3HE4A 3HD7D 2W27A 3A2AA 2XV5A 4I6MC 1JNMA 1IFNA 1GL2B 2P7JA 2LKMA 3MD0A 2YO2A 2ZXEB 2O01H 1N86A 1HGZA 4GIFA 3RL0C 1HJBA 1N7SC 1XTGB 5AW7B 2PAJA 2JEEA 4N6JA 2FFDA 2XNXA 1URQB 3VN0A 3RK2C 2WZ7A 3M9HA 2WSFH 4XA4A 1JY3O 3BRVB 3EQ2A 1G1IA 3A5TA 2P2UA 4EOTA 3GHGB 1FBMA 2PP6A 1M1JA 1GU5A 2WPQA 1FJKA 2HLOA 3M9QA 1WT6A 1L4AA 4DZOA 2XZRA 1ZV8A 4AQRD 5AW6B 5AVYB 3L37A 3C9IA 1JY3N 1YTZT 4C7NB 3NMDA 1T2KC 1H8AA 2C9NY 4RESB 1KILD 3M0DA 3TNUA 1A02J 3B5NC 1IK9A 1RF1B 1JMMA 1LTJA 4LGDE 3H32A 5AVXB 4WB4A 1KZUB 3HE5B 4N3YB 1NTZK 5CCHA 4C7RA 3M91A 3V2NA 1LWUC 2IX7C 5APQA 3RK3D 3N7NA 3A3YB 2ZFCA 1X9VA 4WY4A 1T2KD 1XTCC 1JTHB 5CHXA 1KILB 4C46A 1NTKK 3B5ND 4KHXA 1FOSE 1GDTA 5AW8B 1T8ZA 4GKGA 1IJDB 1CZQA 3M06A 2N1TB 1IFMA 2R5BA 1HVVA 2O1JA 2YMYA 1JY2P 1NH4A 2M8RA 1DEBA 1H88A 3U1CA 2Q5UA 1PFIA 3HUSB 1CI6B 1QL2A 4HYTB 1X79B 3UIAA 3V2PA 1GL2C 1JY3P 4C7NA 3U59A 3E1IA 1NOHA 1KFMA 2WTYA 3RK3B 5APVA 2WSCH 1N73C 3V4WA 3BATA 1FAVA 3HRNA 1SFCD 1OWAA 1RF1A 1HGVA 2CPBA 5AW3B 2N9BA 1GU4A 2NPSD 2WT7B 2H8PD 1FZEA 1IC2A 3PP5A 4JYCA 2HPCB 1LTJB 1NKNA 3VMZA 1RE3C 3H32B 1SLQA 2IPPA 1JTHA 2KLVA 1CW5A 2OYHC 2QM8A 2W6AA 1GW3A 1KILA 1S9KE 4AUWA 2WPRA 5AVWB 1CSBA 4WBAA 2YKOA 2HG5D 2P67A 1LGHB 5APTA 1FOSF 1SFCB 1S9KD 2W6BA 2N1TA 4LC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY2 O;  1LT9 C;  1JY3 P;  2OYH A;  1M1J B;  3E1I A;  3HUS A;  1RE4 C;  2H43 A;  3BVH A;  1JY3 O;  2OYI C;  1FZC B;  2HPC B;  1FZG A;  1LTJ B;  3GHG B;  1RF0 C;  2FFD C;  1M1J A;  1N73 C;  1RE3 C;  1RF1 B;  1LTJ A;  1LWU B;  3GHG A;  3H32 B;  1FZC A;  2HOD B;  2HPC A;  2HLO A;  1LWU A;  3H32 A;  3HUS C;  1RF1 A;  2OYH C;  1LT9 B;  2Z4E A;  1N73 A;  2OYH B;  2XNX A;  2HOD A;  2Q9I A;  2OYI B;  1JY2 N;  1LT9 A;  2A45 I;  1M1J C;  1FZF A;  1W2E A;  1N86 A;  2FFD B;  1LTJ C;  1FZC C;  1T3U A;  1RE4 A;  1N73 B;  2OYI A;  3GHG C;  1JY2 P;  1FZA A;  1FZE A;  1JY3 N;  2A45 H;  1FZB A;  1RF1 C;  1RF0 A;  2FFD A;  1LWU C;  2A45 G;  1RE3 A;  3HUS B; 
#chains in the Genus database with same CATH topology
 1JY2 O;  1ZME C;  4WY4 B;  3BVH A;  4RO0 A;  2Z4E A;  4I1L A;  2OYI B;  3KDP B;  1JY2 N;  5BU8 B;  2KOG A;  2YNY A;  5CJ4 A;  3D71 A;  3HD7 B;  4LLH A;  1PZQ A;  2NZ2 A;  5AVU B;  4GOF A;  1N7S D;  1VL2 A;  3WU2 E;  5KAI H;  4DJG A;  2FFD C;  2BEZ F;  3CX5 I;  2YXR B;  1J1E B;  1OW7 A;  1YYC A;  1QVG O;  1LTA C;  2CPS A;  3OJA B;  1FZB A;  1NO4 A;  1RF0 A;  4W7Y A;  1L4A C;  1AQ5 A;  2Y9Y A;  1X8Y A;  1SQX K;  4W7Z A;  3V4Q A;  5KLV G;  1VF5 C;  3GW6 A;  2ZT9 B;  4H44 B;  3RL0 B;  3NXS A;  3H1J J;  1NTZ E;  2YMK A;  3RK2 B;  1OXZ A;  1OVR A;  1NTM J;  2BCC J;  4HH2 A;  1LTJ C;  2OYI A;  5EFW B;  3IN6 A;  4CPG A;  3HD7 A;  5AVR B;  2WPV B;  2E42 A;  2E76 B;  3IR9 A;  5KTB A;  4PJ0 E;  2KS1 A;  2E5T A;  4W80 A;  2BEQ D;  2XDJ A;  3L72 G;  1Q82 Q;  1L0L K;  4KJM A;  1RE4 A;  1SQP D;  3CCR P;  1PGO A;  1FU1 A;  5AW4 B;  2XKM A;  2J5U A;  3M9B A;  2W8Z A;  3KZI E;  3QH9 A;  5AVT B;  2QJK C;  4XE5 B;  4U3F E;  1S4X A;  5K5G B;  2R3C A;  2ZXX A;  1NGM B;  4U3F D;  2QVA A;  1KQG B;  1NKZ B;  4EIJ A;  1HJ0 A;  2KI7 B;  1ZW0 A;  1P84 I;  3CCE P;  5CBN A;  2XU6 A;  2Z5H A;  2YKP A;  3R4Y A;  3A0B E;  2P10 A;  5APY A;  5BVZ A;  2N1T C;  1M7L A;  4ZMD A;  3OW2 O;  2FYU E;  1AA0 A;  1EQ7 A;  2E75 C;  1SQQ J;  2FYU D;  1FJP A;  1KMI Z;  3RK3 C;  2P58 A;  2ZJS E;  1EZV D;  3CI9 A;  3B8E B;  4YXD C;  1LTT C;  3ZDM A;  4IFD K;  3CC2 P;  3SFD C;  3L72 J;  3H1L E;  1KQS O;  1N7S B;  2N1T D;  1AVY A;  1BGY E;  3H1L D;  2KYV A;  3M0D C;  1L0N E;  3CCQ P;  1L0N D;  3BCC E;  4ZKU A;  2WMM A;  2WPS A;  1LT9 C;  5TIS E;  2OAR A;  1LTB C;  3VOP A;  3SWY A;  4Z1M H;  3GHG A;  1NTK D;  3H1H G;  1SQV K;  2NPS C;  3CXH E;  2FFD B;  2M3B A;  5GTI E;  2H7H A;  2A45 H;  2M5A B;  3CLQ A;  3PLN A;  3VP8 A;  5CCH D;  1L4A B;  3IF4 A;  1NAF A;  4NPD A;  5AVQ B;  4D6T J;  1JCC A;  1VF5 B;  5AW5 B;  1Q90 D;  1EDL A;  5APX A;  1NTK J;  4RJT A;  1LTS C;  2ZYG A;  4GOE A;  1YJW P;  1Y9B A;  4ZNC A;  5AVS B;  3I56 P;  4BWN A;  1E5W A;  1AFO A;  3CWB E;  4I6M C;  1IFN A;  1BCC G;  2ZXE B;  3H1I G;  3CME P;  3L70 G;  5DJU B;  4GIF A;  2IBZ D;  1YQ3 C;  2FFD A;  2IYO A;  3JSV C;  3M9H A;  3PTZ A;  4XA4 A;  3A5T A;  5H2F E;  2M5A A;  2HLO A;  1VQO P;  1L4A A;  1DEE G;  2XZR A;  5AW6 B;  5AVY B;  1SQB E;  1YTZ T;  2QJK B;  2C9N Y;  1SQB D;  4RES B;  3QWO C;  3WUU A;  3B5N C;  1LTJ A;  3AEE C;  3HE5 B;  1K05 A;  1NTZ K;  5M1B A;  3M91 A;  2OTK E;  5APQ A;  3WU2 H;  3N7N A;  3A3Y B;  3I55 P;  4NPF X;  1Y8A A;  5CHX A;  3L73 J;  4C46 A;  3B5N D;  1T8Z A;  4GKG A;  1IJD B;  3Q1M A;  3M06 A;  1ZRT E;  2N1T B;  5KLI C;  1R8E A;  1PPJ G;  1ZRT D;  2E75 B;  1R5L A;  1H88 A;  2WSC J;  4HYT B;  1GL2 C;  3U59 A;  1NOH A;  3RK3 B;  5APV A;  1BCC J;  3HRN A;  1SQX J;  5AW3 B;  1K04 A;  1OIP A;  3MP7 B;  1GU4 A;  2WQY C;  2K3R A;  1IC2 A;  3CCJ P;  4PD4 E;  2YIU C;  4JYC A;  2HPC B;  2HR3 A;  4PD4 D;  1NU1 G;  4PJ0 H;  2OYH C;  1QGK B;  1GW3 A;  2WPR A;  5AVW B;  5APT A;  2QA4 P;  2N1T A;  3TGU G;  3AE3 C;  2NPS B;  1L0L J;  4IFF A;  3HTK B;  1PP9 E;  3KZI H;  1HBW A;  3MUD C;  4OGQ C;  1PP9 D;  1X0T A;  2FYU K;  5CCG C;  3L74 E;  2O1K A;  1IFI A;  1GD2 E;  1JEK A;  3L74 D;  3H25 A;  1S5L X;  3VYI A;  2A06 G;  4H44 D;  5AVV B;  3RL0 D;  1MUU A;  1SQV G;  3RK2 D;  2QM7 A;  1ZLL A;  3SWF A;  2HPC A;  3AE1 C;  4RKU J;  3A0B H;  2C9L Y;  2I1K A;  3NFQ A;  1LT9 A;  1M1J C;  1QL1 A;  3FXE A;  2L5G B;  3G3Z A;  2E76 D;  1J1D C;  2HFE D;  1L0N K;  4WVZ A;  2NPS A;  1MV8 A;  3HTK A;  3L35 A;  1HH0 A;  2W83 C;  3PRJ A;  3S9O A;  3KYQ A;  5APS A;  1IZN B;  1A02 F;  1LNQ A;  1EXJ A;  5DJT B;  2J58 A;  3W68 A;  3G6E P;  1USD A;  3TK1 A;  3AE4 C;  4EYY Q;  3FX0 A;  3H1J G;  1NAY A;  3TGU J;  4OH8 B;  2JP3 A;  3B5N B;  3JCU E;  3GHG C;  4IL6 X;  3TDK A;  2Y0E A;  4JQ0 D;  5TIS H;  1NTM G;  2BCC G;  3MTU E;  4JF7 A;  1BSH A;  3OAK A;  4PV1 C;  3LID A;  3P8C E;  1MZ9 A;  3CXH H;  1H0T B;  1X22 A;  4YXW H;  5GTI H;  1N2D C;  2Q1K A;  1VPC A;  4EI2 A;  3D70 A;  1OVV A;  1SQV J;  2I1J A;  1BE3 J;  1E79 H;  3RBZ A;  4EDF A;  1HUC A;  5APW A;  5KLI B;  3KHU A;  5KAF E;  4L74 A;  1KIL C;  3B5N A;  3II6 A;  3K5B A;  4N78 E;  1JM0 A;  1SQB K;  4H0L C;  3MGN A;  3U1A A;  4N78 D;  2KS1 B;  3CCV P;  1PV3 A;  1LP1 B;  1SQP G;  4WWI A;  2YIU B;  1H0T A;  2KSE A;  3LIE A;  2OYH B;  3L75 E;  1HTL C;  3IFM A;  5H2F H;  1M56 D;  3L75 D;  5AVZ B;  3V2Q A;  5GTH E;  4MN4 C;  1GW4 A;  1NTZ D;  1GL2 A;  3BAS A;  1OVU A;  1SQQ G;  2MJZ A;  1URQ A;  1L4A D;  2Y9Z A;  3B71 A;  1ZN5 A;  1ZXG A;  1VF5 D;  1GTW A;  1W2B O;  1LP1 A;  1SVF A;  4R4L A;  2Q6Q A;  2KXP B;  2IFN A;  1NTZ J;  1Q7Y Q;  3O6Q A;  3L36 A;  2OYH A;  1M1J B;  1EZV I;  2KUB A;  1J1D B;  1IFD A;  1EZV G;  2AXT E;  3Q5S A;  1EXI A;  3AE9 C;  1SP4 A;  1FZC C;  1Z56 A;  4BXL A;  3MUD A;  2R32 A;  2G3A A;  2AEJ A;  1BSN A;  5B66 E;  3G71 P;  3CCL P;  3KQG A;  3GMA A;  5CCG A;  5KLV E;  1SQP J;  2PFX A;  1USE A;  5KLV D;  2XV5 A;  1KQF B;  1DD4 A;  2YO2 A;  2O01 H;  1HGZ A;  1W5C E;  5AW7 B;  2PAJ A;  2PRR A;  4D6T G;  4PD4 H;  1DD3 A;  3GF7 A;  2Q3E A;  2WSF H;  1FDO A;  1NTK G;  2P2U A;  2QG4 A;  3GHG B;  1M1J A;  4U3F J;  2WPQ A;  2ZVN B;  3W67 A;  3B4S A;  4AQR D;  2O3J A;  3FWL A;  4PV1 B;  1Q2N A;  3L37 A;  1U7J A;  4C7N B;  1H8A A;  1RQV A;  2R44 A;  1LJ2 A;  1JMM A;  2IZ1 A;  1OW8 A;  3FGA D;  1VQL P;  4N3Y B;  2E75 D;  3RK3 E;  1BGY D;  2ZAE B;  1QVF O;  3RK3 D;  2IX7 C;  2FYU J;  3Q3D A;  1D7M A;  3BCC D;  3CCS P;  3Q5P A;  2IBZ I;  1KIL B;  2AEF A;  2FY8 A;  2XND H;  4KHX A;  3AEG C;  2IBZ G;  4H0L B;  1CZQ A;  2JWA A;  2R5B A;  2YMY A;  3H1K E;  3CXH D;  2Y0D A;  1DEB A;  1PGJ A;  1PFI A;  3H1L J;  1CI6 B;  1QL2 A;  3H1K D;  4HKZ H;  3UIA A;  4UB6 E;  4C7N A;  3E1I A;  1BGY J;  1YJN P;  2QJP C;  3ABV C;  1L0N J;  1N8R Q;  3V4W A;  3BAT A;  1OWA A;  3BCC J;  2RMZ A;  3F5H A;  3L71 E;  2M0B A;  4DCK A;  4IL6 E;  3L73 G;  1OW6 A;  2NPS D;  2H8P D;  3L71 D;  1VQ6 P;  3AE8 C;  3SSU A;  1FC2 C;  2DW3 A;  2QE7 H;  2MKV A;  1PGP A;  2YXQ B;  1LTJ B;  1NKN A;  1SS1 A;  1ZP0 C;  1SLQ A;  1CW5 A;  1VQN P;  2QM8 A;  4AUW A;  1KIL A;  2QEX P;  1CSB A;  2HG5 D;  1LGH B;  3JCU H;  3AE2 C;  3CWB D;  1YIJ P;  1SQX G;  4LC1 A;  1CI6 A;  1HF9 A;  3CD6 P;  3H1H E;  3V2R A;  2Q9I A;  5KJ7 C;  2KLU A;  1EDJ A;  3H1H D;  4TLF A;  1JUN A;  3P7K A;  4Y28 J;  4QMA A;  2FXP A;  2R5D A;  3CWB J;  2YO3 A;  2OYO A;  4HJG H;  1FZC B;  1RH5 B;  1L0L G;  5KAF H;  1LWU A;  1LT1 A;  3CMA P;  3PHL A;  5B5E E;  4PD4 I;  1JMB A;  1AJY A;  2KIK A;  1IFP A;  3VP9 A;  5CMZ A;  3WMM 0;  1YTZ I;  3MZW B;  2WVR A;  4H13 C;  1SQB J;  1KQL A;  2FYN C;  3H1I E;  3L70 E;  3N4X A;  1VQ7 P;  3P32 A;  1FS0 E;  3L70 D;  1MFT A;  3ITK A;  2GUS A;  2OTJ P;  1FZC A;  2NRG A;  5GTH H;  2K88 A;  2E5Y A;  1URQ C;  2KZJ A;  1Y47 A;  1U7M A;  4GOD A;  1N7L A;  4O9B A;  3LW5 H;  1FZA A;  2IDB A;  3KXD A;  1AVO A;  2N9Y B;  4ASW A;  2LR2 A;  2FXM A;  1KN7 A;  1GL2 D;  3GLM A;  1RQU A;  5KLV K;  3H6P A;  1LT9 B;  2A45 I;  1URQ D;  1AV1 A;  4B86 A;  4I2L C;  1IO4 A;  2SPZ A;  1VQP P;  2A45 G;  3CPW O;  1T6A A;  4BRY B;  1K73 Q;  2E43 A;  2IFM A;  3V6I A;  2P1J A;  2FXO A;  2O01 J;  2AXT H;  3A7O A;  2QJP B;  2ZT9 C;  2WSF J;  1PPJ E;  1UIX A;  1DH3 A;  5B66 H;  3E7K A;  4L76 A;  3TF5 A;  1T3J A;  1PL5 A;  4HB1 A;  1KB9 E;  1BE3 G;  3VMX A;  3KPE A;  1VDF A;  2ZVO B;  3HUS C;  1VQK P;  1KB9 D;  1FDI A;  2K37 A;  4OGQ D;  1FZF A;  3EFG A;  3R2P A;  5CCG D;  2JKV A;  2QIW A;  2HYN A;  1PP9 J;  2JR8 A;  1K8A Q;  2CK3 H;  1EDK A;  2Z5I A;  1QX8 A;  3G4S P;  3L74 J;  1NU1 E;  4BRY A;  3OA7 A;  1DX7 A;  3C1L A;  1NU1 D;  4R4M A;  1G2C B;  3BRT B;  4YTP C;  3VTP C;  3AEC C;  3TGU E;  1H89 A;  1BDC A;  2E74 C;  1U57 A;  1SFC C;  2H88 C;  2V7Q H;  1KYO E;  2B87 B;  2H89 C;  1M57 D;  4I7Z C;  2UWJ E;  3CC7 P;  1S3J A;  1KYO D;  3S1K A;  3TSI A;  2VRS A;  2A06 E;  1ZR2 A;  2JJL A;  4IOI H;  1JO5 A;  5AW0 B;  2A06 D;  2E74 D;  1P84 H;  1W2E A;  3P8C D;  4H13 B;  1G2C A;  3VMY A;  1DIP A;  4UB6 H;  2FYN B;  3TNU B;  1M8O B;  1GZL A;  2K9J B;  5KJ7 A;  3P8M C;  1NTZ G;  3A2A A;  4UB8 E;  2W27 A;  4PV1 D;  3PH0 A;  1JNM A;  1GL2 B;  4IL6 H;  2P7J A;  1N86 A;  2B87 A;  1NJI Q;  1N7S C;  1FE6 A;  4N6J A;  1URQ B;  3AE6 C;  1VQ5 P;  1JY3 O;  1G1I A;  2ZYD A;  1FBM A;  1OX3 A;  2PP6 A;  1GU5 A;  3USS A;  2M3E A;  1PGQ A;  1FJK A;  3M9Q A;  4K35 A;  1WT6 A;  4DZO A;  3H1J E;  2D2C C;  1JY3 N;  3H1J D;  1KIL E;  2Y0C A;  3NMD A;  3O6Q B;  3PJS K;  1NTM E;  2BCC E;  1KIL D;  2JWD A;  2KNC A;  3TNU A;  1NTM D;  2BCC D;  2KK7 A;  2QJY C;  4H0L D;  4LGD E;  2K9J A;  3H32 A;  5AVX B;  4WB4 A;  1KZU B;  4U3F G;  5KKZ C;  4C7R A;  4ASV A;  1LWU C;  4OGQ B;  2D2C D;  3AE7 C;  5L8R J;  2KZI A;  4WY4 A;  3Q5R A;  1JTH B;  2B9B A;  5B5E H;  3L75 J;  1IFM A;  2M8R A;  3RGU A;  3U1C A;  3HUS B;  1X79 B;  4OWF A;  1KD1 Q;  2WTY A;  2WSC H;  2LXC B;  2FYU G;  1N73 C;  2OTL P;  1OMI A;  1FAV A;  1HGV A;  1SQP E;  4GDO A;  3WUV A;  3LW5 J;  2N9B A;  3FWN A;  2WT7 B;  1Q86 Q;  3CX5 E;  4OVN F;  5E79 E;  1VQM P;  3PP5 A;  3CX5 D;  4L75 A;  2OGU A;  1K9M Q;  2O01 N;  3H1L G;  1RE3 C;  5TJH A;  2KLV A;  1JTH A;  1BGY G;  2W6A A;  2E74 B;  1S1C X;  1L0N G;  1SFC B;  2W6B A;  1SQQ E;  3Q2Y A;  3BCC G;  2IYP A;  1SQQ D;  3AEA C;  4I7Z B;  5BU5 A;  3HUS A;  1NHL A;  3CXH I;  2KP8 A;  2POH A;  3SWK A;  5CJ0 A;  3L72 E;  1GK6 A;  2AEM A;  1M90 Q;  1S5L E;  3H1K G;  3NTN A;  4NPE A;  3L72 D;  5KLV J;  3L4F A;  2WT7 A;  3D6Y A;  2KSJ A;  3D6Z A;  2WSE H;  3CL3 D;  1M1K Q;  3CCU P;  2FKW B;  1NU1 K;  2K9Y A;  2KB7 P;  4Y99 C;  3L71 G;  1EZV E;  2WSS H;  4K3A A;  2BAS A;  3T97 B;  2G8Y A;  3A0H E;  1KV4 A;  1SFC A;  1OZH A;  2Q7C A;  4KT0 J;  2PGD A;  3O8Z A;  3RBX A;  1WMK A;  1KB9 H;  3V5B A;  4AYC A;  1YBK A;  3CWB G;  4JPZ B;  1VQ9 P;  3IAO A;  1S72 P;  1P84 E;  1IFJ A;  4U7J A;  1P84 D;  2JO1 A;  4D6T E;  1G1J A;  2FYZ A;  5CCH C;  2IZ0 A;  2H43 A;  4D6T D;  1JCD A;  1NTK E;  2V7Q J;  2D2C B;  2WWW A;  1KC8 Q;  2C0X A;  2QJY B;  1T3U A;  1SQB G;  1NWQ A;  3T97 A;  2YKQ A;  1LTI C;  3AE5 C;  5KKZ B;  1QLE D;  4TT3 H;  1FZG A;  3I5C A;  1LWU B;  3S4R A;  1KYO H;  1N7S A;  3H1K J;  1BDD A;  3GF3 A;  2V4H A;  2Q3I A;  3CCM P;  1LTG C;  1RF1 C;  1JOC A;  1AQT A;  3TYY A;  4JYB A;  3AED C;  3SFE C;  3C8V A;  3L71 J;  5KAI E;  2FBW C;  4YPC A;  1OFC X;  1RHZ B;  3E1R A;  2IBZ E;  4L73 A;  1UII A;  1GK4 A;  1J2J B;  3JC2 2;  1N73 B;  1YHQ P;  1YJ9 P;  2ITA A;  2I8D A;  1RY3 A;  1NTM K;  4ZKP A;  4UB8 H;  2HOD B;  1MFZ A;  1YIT P;  1HWT C;  2GUV A;  2QRX A;  3EFF K;  3L73 E;  3F89 A;  1KOR A;  2W6J H;  5KJ7 D;  3L73 D;  4DOJ A;  1S2E A;  3H1H J;  4M3L A;  1Q81 Q;  2GA1 A;  2L91 A;  3RL0 g;  1TU3 F;  1GMJ A;  1PIX A;  1BCC E;  1SQX E;  1BCC D;  2RKL A;  1N73 A;  4IFM A;  1FDM A;  3H1I D;  1SQX D;  1PP9 G;  1RF0 C;  3HE4 B;  2J59 M;  2WIT A;  1WRG A;  2R3S A;  3VMA A;  4H13 D;  3MHV A;  4WY4 C;  3L74 G;  2HOD A;  3M0A A;  1SQP K;  2AXC A;  4XFJ A;  1RE3 A;  1KB9 I;  4Y99 B;  2OYI C;  3EWK A;  3HD7 C;  5AW1 B;  1L0L E;  3H1I J;  1MKM A;  3L70 J;  1L0L D;  4JBZ A;  3HE5 A;  4WY4 D;  1VQ8 P;  1KFN A;  2C0W A;  5CBO A;  1IK7 A;  5APU A;  3MIW A;  1ZR4 A;  1J1E C;  1SQQ K;  1RE4 C;  4GT1 A;  5AW2 B;  5AW9 B;  1EDI A;  2RN0 A;  2GM4 A;  3HE4 A;  3HD7 D;  2LKM A;  3MD0 A;  3CC4 P;  3CX5 H;  4H44 C;  3RL0 C;  1HJB A;  1XTG B;  5E79 H;  2JEE A;  2XNX A;  5C39 A;  1KTM A;  3VN0 A;  3RK2 C;  2WZ7 A;  1PPJ D;  3BRV B;  1KYO I;  3EQ2 A;  4EOT A;  1ZOY C;  2JDI H;  1ZV8 A;  2K1A A;  2E76 C;  3C9I A;  3GG2 A;  2WSE J;  2ZT9 D;  1T2K C;  3M0D A;  4DT0 A;  1A02 J;  1RF1 B;  1IK9 A;  1S5L H;  2OQQ A;  5CCH A;  3V2N A;  2ZFC A;  1X9V A;  1T2K D;  1R5S A;  1XTC C;  3TGU D;  1VQ4 P;  1NTK K;  3WUT A;  1FOS E;  1GDT A;  5AW8 B;  3A0H H;  1HVV A;  2O1J A;  1JY2 P;  1NH4 A;  3FXD A;  1NYH A;  1NU1 J;  2Q5U A;  2ZYA A;  2LXB A;  2QSI A;  3V2P A;  1JY3 P;  1KFM A;  1SQV E;  2RH0 A;  1BE3 E;  3G9R A;  1SFC D;  1SQV D;  1RF1 A;  2CPB A;  1BE3 D;  1YI2 P;  1QEX A;  1L2P A;  2W90 A;  1FZE A;  2B89 A;  3L75 G;  2KNC B;  1JB0 J;  4A7P A;  3VMZ A;  3H32 B;  3AEF C;  2IPP A;  3AEB C;  1NVO A;  1S9K E;  1EC5 A;  4WBA A;  2YKO A;  2P67 A;  1FOS F;  1S9K D;  2B88 A;  1YQ4 C; 
#chains in the Genus database with same CATH homology
 1JY2 O;  2NPS B;  4WY4 B;  4IFF A;  5BU5 A;  3HTK B;  1CI6 A;  3HUS A;  3BVH A;  1NHL A;  1HBW A;  2KP8 A;  2POH A;  2Z4E A;  2FYU K;  5CCG C;  5CJ0 A;  2O1K A;  4I1L A;  3V2R A;  2Q9I A;  2OYI B;  1GK6 A;  3KDP B;  1JY2 N;  1IFI A;  2KOG A;  5BU8 B;  5KJ7 C;  2YNY A;  5CJ4 A;  1GD2 E;  3HD7 B;  3NTN A;  4LLH A;  1JUN A;  3P7K A;  3L4F A;  2WT7 A;  5AVU B;  3VYI A;  5AVV B;  3RL0 D;  1N7S D;  2R5D A;  2KSJ A;  2YO3 A;  1MUU A;  2WSE H;  3CL3 D;  1FZC B;  3RK2 D;  2QM7 A;  2FFD C;  1ZLL A;  3SWF A;  2HPC A;  1LWU A;  2FKW B;  1NU1 K;  1J1E B;  1YYC A;  2KB7 P;  4Y99 C;  2C9L Y;  2I1K A;  1LTA C;  2CPS A;  3NFQ A;  1LT9 A;  3OJA B;  1M1J C;  1QL1 A;  2BAS A;  2L5G B;  3G3Z A;  1FZB A;  1NO4 A;  1J1D C;  1SFC A;  1L0N K;  1RF0 A;  2HFE D;  1L4A C;  4W7Y A;  3VP9 A;  1AQ5 A;  2Q7C A;  1X8Y A;  5CMZ A;  1SQX K;  4W7Z A;  2NPS A;  3V4Q A;  1MV8 A;  3O8Z A;  3WMM 0;  1YTZ I;  3RL0 B;  3NXS A;  3V5B A;  3HTK A;  3L35 A;  4AYC A;  1HH0 A;  3RK2 B;  1OXZ A;  1KQL A;  4HH2 A;  3KYQ A;  1IFJ A;  1LTJ C;  5APS A;  3N4X A;  2OYI A;  1A02 F;  3P32 A;  3HD7 A;  2J58 A;  1G1J A;  5AVR B;  2FYZ A;  2E42 A;  5CCH C;  2H43 A;  2GUS A;  1JCD A;  3IR9 A;  3TK1 A;  5KTB A;  2WWW A;  1FZC A;  2C0X A;  4W80 A;  2XDJ A;  1URQ C;  1N7L A;  1L0L K;  4OH8 B;  4O9B A;  1T3U A;  1RE4 A;  3B5N B;  3LW5 H;  3GHG C;  1FZA A;  1FU1 A;  3T97 A;  1NWQ A;  2YKQ A;  5AW4 B;  1LTI C;  2XKM A;  3MTU E;  3M9B A;  4JF7 A;  2FXM A;  1FZG A;  1GL2 D;  3I5C A;  3OAK A;  1LWU B;  3LID A;  5KLV K;  3P8C E;  1MZ9 A;  3H6P A;  1N7S A;  5AVT B;  1LT9 B;  4XE5 B;  2A45 I;  1URQ D;  2Q3I A;  4B86 A;  4I2L C;  1N2D C;  1IO4 A;  1VPC A;  2R3C A;  1LTG C;  1RF1 C;  2A45 G;  2I1J A;  1JOC A;  1NKZ B;  4EIJ A;  3TYY A;  1HUC A;  4JYB A;  5APW A;  2E43 A;  2IFM A;  2P1J A;  2XU6 A;  2Z5H A;  2YKP A;  3A7O A;  1GK4 A;  1J2J B;  5APY A;  1N73 B;  1KIL C;  3B5N A;  1DH3 A;  3II6 A;  4N78 E;  5BVZ A;  1SQB K;  3MGN A;  3U1A A;  4N78 D;  1T3J A;  2N1T C;  1M7L A;  1RY3 A;  1NTM K;  4ZKP A;  2HOD B;  3VMX A;  3KPE A;  1EQ7 A;  1VDF A;  1MFZ A;  1HWT C;  3HUS C;  2GUV A;  1FJP A;  1FZF A;  3RK3 C;  3EFG A;  3R2P A;  5CCG D;  5KJ7 D;  2HYN A;  3CI9 A;  3LIE A;  2OYH B;  3B8E B;  1LTT C;  4DOJ A;  2Z5I A;  1HTL C;  3IFM A;  4IFD K;  4M3L A;  3OA7 A;  5AVZ B;  1DX7 A;  1N7S B;  2N1T D;  3V2Q A;  1GW4 A;  2KYV A;  1G2C B;  3M0D C;  3BRT B;  1GL2 A;  3BAS A;  3VTP C;  2MJZ A;  1N73 A;  4IFM A;  4ZKU A;  1FDM A;  2WPS A;  1H89 A;  1LT9 C;  1URQ A;  2OAR A;  1L4A D;  1ZN5 A;  1LTB C;  3VOP A;  1SFC C;  1RF0 C;  3HE4 B;  2J59 M;  3SWY A;  3GHG A;  2WIT A;  1WRG A;  1GTW A;  1SQV K;  2NPS C;  4WY4 C;  2HOD A;  3M0A A;  1SVF A;  1SQP K;  2FFD B;  2M3B A;  3TSI A;  2VRS A;  2H7H A;  2A45 H;  1RE3 A;  2IFN A;  4Y99 B;  1ZR2 A;  2JJL A;  3L36 A;  2OYH A;  1M1J B;  1JO5 A;  3CLQ A;  5AW0 B;  2OYI C;  3VP8 A;  5CCH D;  3HD7 C;  5AW1 B;  1J1D B;  1L4A B;  1NAF A;  1IFD A;  5AVQ B;  1JCC A;  3HE5 A;  4WY4 D;  1W2E A;  3P8C D;  5AW5 B;  1SP4 A;  1FZC C;  1Z56 A;  5APX A;  1KFN A;  1G2C A;  3VMY A;  2C0W A;  3MUD A;  1LTS C;  3MIW A;  5APU A;  2R32 A;  1ZR4 A;  1J1E C;  3TNU B;  1SQQ K;  1RE4 C;  1GZL A;  3KQG A;  4GT1 A;  5AW2 B;  5CCG A;  5AW9 B;  5AVS B;  5KJ7 A;  3P8M C;  1E5W A;  1AFO A;  2GM4 A;  3HE4 A;  3HD7 D;  2W27 A;  3A2A A;  2XV5 A;  4I6M C;  1JNM A;  1IFN A;  1GL2 B;  2P7J A;  2LKM A;  3MD0 A;  2YO2 A;  2ZXE B;  2O01 H;  1N86 A;  1HGZ A;  4GIF A;  3RL0 C;  1HJB A;  1N7S C;  1XTG B;  5AW7 B;  2PAJ A;  2JEE A;  4N6J A;  2FFD A;  2XNX A;  1URQ B;  3VN0 A;  3RK2 C;  2WZ7 A;  3M9H A;  2WSF H;  4XA4 A;  1JY3 O;  3BRV B;  3EQ2 A;  1G1I A;  3A5T A;  2P2U A;  4EOT A;  3GHG B;  1FBM A;  2PP6 A;  1M1J A;  1GU5 A;  2WPQ A;  1FJK A;  2HLO A;  3M9Q A;  1WT6 A;  1L4A A;  4DZO A;  2XZR A;  1ZV8 A;  4AQR D;  5AW6 B;  5AVY B;  3L37 A;  3C9I A;  1JY3 N;  1YTZ T;  4C7N B;  3NMD A;  1T2K C;  1H8A A;  2C9N Y;  4RES B;  1KIL D;  3M0D A;  3TNU A;  1A02 J;  3B5N C;  1IK9 A;  1RF1 B;  1JMM A;  1LTJ A;  4LGD E;  3H32 A;  5AVX B;  4WB4 A;  1KZU B;  3HE5 B;  4N3Y B;  1NTZ K;  5CCH A;  4C7R A;  3M91 A;  3V2N A;  1LWU C;  2IX7 C;  5APQ A;  3RK3 D;  3N7N A;  3A3Y B;  2ZFC A;  1X9V A;  4WY4 A;  1T2K D;  1XTC C;  1JTH B;  5CHX A;  1KIL B;  4C46 A;  1NTK K;  3B5N D;  4KHX A;  1FOS E;  1GDT A;  5AW8 B;  1T8Z A;  4GKG A;  1IJD B;  1CZQ A;  3M06 A;  2N1T B;  1IFM A;  2R5B A;  1HVV A;  2O1J A;  2YMY A;  1JY2 P;  1NH4 A;  2M8R A;  1DEB A;  1H88 A;  3U1C A;  2Q5U A;  1PFI A;  3HUS B;  1CI6 B;  1QL2 A;  4HYT B;  1X79 B;  3UIA A;  3V2P A;  1GL2 C;  1JY3 P;  4C7N A;  3U59 A;  3E1I A;  1NOH A;  1KFM A;  2WTY A;  3RK3 B;  5APV A;  2WSC H;  1N73 C;  3V4W A;  3BAT A;  1FAV A;  3HRN A;  1SFC D;  1OWA A;  1RF1 A;  1HGV A;  2CPB A;  5AW3 B;  2N9B A;  1GU4 A;  2NPS D;  2WT7 B;  2H8P D;  1FZE A;  1IC2 A;  3PP5 A;  4JYC A;  2HPC B;  1LTJ B;  1NKN A;  3VMZ A;  1RE3 C;  3H32 B;  1SLQ A;  2IPP A;  1JTH A;  2KLV A;  1CW5 A;  2OYH C;  2QM8 A;  2W6A A;  1GW3 A;  1KIL A;  1S9K E;  4AUW A;  2WPR A;  5AVW B;  1CSB A;  4WBA A;  2YKO A;  2HG5 D;  2P67 A;  1LGH B;  5APT A;  1FOS F;  1SFC B;  1S9K D;  2W6B A;  2N1T A;  4LC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...