1BCCJ

Cytochrome bc1 complex from chicken
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
59
structure length
59
Chain Sequence
TLTARLYSLLFRRTSTFALTIVVGALLFERAFDQGADAIYEHINEGKLWKHIKHKYENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
total genus 23
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1bccJ00
3H1KJ 3TGUJ 1SQQJ 1BGYJ 1NTZJ 3L71J 1BCCJ 1L0LJ 1SQXJ 3H1LJ 4D6TJ 1P84I 3L70J 3L72J 3L74J 3BCCJ 3H1IJ 2FYUJ 1KB9I 5KLVJ 3CX5I 3CWBJ 1BE3J 1NU1J 2IBZI 1PP9J 1SQPJ 4PD4I 1KYOI 3H1HJ 3L73J 3CXHI 3L75J 1SQBJ 2BCCJ 1EZVI 3H1JJ 4U3FJ 1SQVJ 1NTMJ 1L0NJ 1NTKJ
chains in the Genus database with same CATH superfamily
4IL6H 3BCCG 2KSJA 2A45H 1S72P 3L4FA 2WWWA 4ZKPA 5AW0B 4GIFA 2WTYA 1RF0A 2ZT9B 2KLUA 1IFJA 3MUDC 3A5TA 2I1JA 4C7RA 1X0TA 5APWA 2BCCD 2O01H 4M3LA 3I56P 1H88A 1PL5A 2XDJA 5AVSB 2N1TD 1XTCC 1PP9D 5EFWB 2FKWB 2DW3A 1FDOA 1GK6A 1EDKA 4O9BA 2Q3IA 4R4LA 5B5EH 3H1KE 2OYIC 1PGOA 1NH4A 2B9BA 2YIUC 1J1DB 2XU6A 4WBAA 2BEZF 1AV1A 2QJYB 3L70J 1RF0C 5K5GB 1JTHB 1K9MQ 3TGUD 2N1TB 4B86A 1X79B 3M9HA 5KJ7A 3NMDA 5C39A 4A7PA 2OARA 3G4SP 1JEKA 3BCCE 4N78D 3H1HD 1JTHA 3F89A 1RH5B 3WMM0 3A0BH 1GK4A 2GA1A 2Y9YA 2L5GB 1L0NK 5GTHE 1FC2C 2POHA 1E79H 1PPJE 2QE7H 1KB9I 5KLVJ 1DH3A 4LLHA 1VL2A 4N6JA 2AXTE 4RO0A 1FZCB 1QGKB 1Y8AA 1SQBJ 1OX3A 1EDIA 1FE6A 5KJ7C 5CBOA 3TSIA 3PRJA 3WU2H 1NYHA 1DD3A 1EXIA 1FZCA 3H1LD 2WSSH 3TF5A 2HYNA 1T6AA 2WPVB 1HF9A 1YJNP 1OVUA 3H1IE 3H1KJ 1EC5A 2HG5D 1VQLP 1JOCA 3VMAA 3D6YA 1ZV8A 2FYUK 3AEEC 1YTZT 2ZVOB 3GF3A 1YITP 3AE1C 3U1CA 5BU8B 1SQPD 1VPCA 2G3AA 2FY8A 1JCCA 3RK3E 2A06E 3BCCJ 5CJ0A 2IDBA 1D7MA 2PAJA 4HH2A 1SQVG 1NTKE 1AVYA 2KSEA 1KILA 3L74D 1SFCA 3NXSA 1QVFO 1OWAA 3AE8C 2K37A 1SQXG 2OTLP 4DZOA 1FZCC 3EWKA 2Y0CA 2YKPA 3Q3DA 1J2JB 3CCEP 5AVQB 1X9VA 3B71A 2FYZA 1PIXA 3AEAC 1NAFA 1SQQG 4UB6H 1LJ2A 5AVWB 1Z56A 1K8AQ 5AW7B 1SQBK 4DT0A 1GW3A 5GTIH 3CCSP 2QIWA 1LT9B 1QLED 2Z5HA 3IN6A 3CCQP 3G71P 2K88A 1NU1G 1MKMA 2P1JA 2GUSA 2R5BA 2KLVA 1KYOD 3O6QA 2M5AB 2YKOA 2E75C 2O1JA 1LT9A 3FXDA 1KILC 1SFCC 4IFFA 3EQ2A 4GOFA 4JYCA 1P84D 1DIPA 1BSNA 2O1KA 5AVYB 2QSIA 2C0WA 5AW2B 3CXHE 2AXCA 5AVTB 5CMZA 2HPCB 2E5TA 3M0DA 3H1JG 3G3ZA 1T3UA 3GLMA 4I1LA 1OFCX 4PD4E 1SQXE 4H0LD 1HBWA 3TYYA 3KPEA 2D2CD 3RBXA 1LT9C 2ZAEB 3VP9A 3HUSB 1SQQE 2H88C 1KTMA 4ZKUA 2RMZA 3OW2O 1LNQA 1RHZB 1QL1A 1VQPP 5AW9B 3VMZA 3WUUA 2JP3A 1EZVG 2M3EA 1AFOA 1NU1E 3U59A 3TDKA 4GOEA 4W80A 3RK2B 2OTJP 3BRTB 4H0LB 4H44D 3HUSA 1FZEA 1FZAA 1H89A 1WT6A 2RH0A 3M0DC 2LXBA 3NTNA 1G1IA 5H2FH 3AE3C 1N7SD 1H8AA 1MFTA 3CD6P 5APSA 1MV8A 1KC8Q 1NTMG 3L70D 1KFNA 1OVRA 2Q3EA 3MGNA 3VOPA 2FYUG 3V2RA 3VMXA 1HGVA 1N73B 4H44B 1GU5A 3V2QA 4HB1A 3G6EP 4IL6E 3SFDC 3H1JE 1JY2N 3C8VA 1S5LX 1Q2NA 3HRNA 4C7NA 1CZQA 1SQVJ 4DOJA 2W6BA 2GUVA 1YBKA 3I5CA 5APXA 3HUSC 1SQXJ 4GDOA 1N73A 1RY3A 3C9IA 2W8ZA 1VQNP 2M8RA 1FDIA 4LC1A 1L2PA 2JEEA 2V7QJ 2V4HA 2PFXA 2WSFJ 3CXHI 5KLVD 1R8EA 1BCCE 2QG4A 4WY4A 3RK2C 1SQQJ 2OYOA 1EZVE 3KQGA 3M06A 2PGDA 1SQBD 1NWQA 1CI6B 4Y99C 1NU1J 1NO4A 5CCHA 1NTZE 2JR8A 4PD4I 1ZP0C 1Q81Q 1NOHA 3HE5A 1MFZA 1N8RQ 3AE9C 4UB8H 1S3JA 5B5EE 1SVFA 1CI6A 3S9OA 3H1KD 3MHVA 2JO1A 2WT7A 3SWFA 5AVRB 1NTME 1N73C 5KAIH 2BEQD 1BGYG 3L71G 1JY3N 2KIKA 1T3JA 4H13C 1DEEG 3CC2P 2H8PD 4KJMA 4PV1D 1PZQA 2YNYA 2OYIB 4WY4C 1KYOH 1LTGC 3KZIH 2YIUB 4OWFA 1LTBC 1ZOYC 2C0XA 1PGJA 1KB9E 3BCCD 4EI2A 4XE5B 3AEBC 3H1JJ 1SQVK 1P84H 5CCHC 3SSUA 1GD2E 1SQXK 2OYIA 3CX5D 3R4YA 4EYYQ 4DJGA 4PV1B 2E5YA 3BATA 3FGAD 5CJ4A 3L72G 1L0NJ 5KJ7D 1U57A 1WMKA 1K04A 3A0HE 5AVZB 1SQQK 2YXRB 5KAFH 3CWBE 1PPJG 1IO4A 1KZUB 2C9NY 2G8YA 3JC22 3PHLA 1NU1K 2XNDH 4YXWH 2A45I 3C1LA 4JQ0D 1LP1A 2ZXXA 1YQ3C 1VQ8P 1J1EB 1QX8A 1UIIA 4D6TE 1S1CX 1M56D 1HWTC 3LW5J 1U7JA 3P32A 4W7YA 2PP6A 1BGYE 3L71E 2O01N 1EZVI 1K05A 1U7MA 1NTMJ 3H1IG 2I8DA 1IK9A 2YMKA 2FYUJ 3BVHA 1W5CE 3L75E 3Q1MA 2ZYAA 3A3YB 2IBZD 2NRGA 2IZ1A 3P8CE 1LGHB 3PH0A 1CSBA 2IX7C 4WVZA 4PV1C 2A06G 4ASVA 4JYBA 3AE6C 1R5LA 1NTKG 2FBWC 4JBZA 2KXPB 3IF4A 1EQ7A 3L72E 2KI7B 1NJIQ 3SWKA 1J1EC 4UB6E 1FAVA 3V6IA 1LTIC 3H1HG 3CL3D 5GTIE 3K5BA 4HJGH 3CLQA 5AW5B 1M1JB 1OXZA 1FJKA 2I1KA 1M90Q 2E75D 1KILD 1ZRTE 1SFCD 3H6PA 1NHLA 1M8OB 1JMMA 3M91A 1S9KE 1URQD 1M1JA 1RE4A 3MZWB 2KZJA 1RQVA 1NTMK 1PGPA 1BGYJ 5L8RJ 3JCUH 1Y9BA 3L73G 2E75B 2K9JA 3WUVA 4OGQC 3BRVB 1KILB 1SFCB 3H32A 2QJKC 1HGZA 2H89C 2JDIH 1SQVD 1URQB 1YHQP 2H7HA 1FDMA 4HKZH 1N2DC 3CCJP 1SQXD 1MUUA 1SP4A 5TISH 3Q5RA 1LWUA 2JWAA 3RK3C 4XA4A 2WQYC 1M1JC 3W67A 1RE4C 1SQPG 4OH8B 2J59M 3OA7A 4N78E 2KK7A 1URQA 3H1HE 1SQQD 1L4AA 2CPSA 2KS1B 2WITA 3O6QB 3MIWA 1YQ4C 1KQLA 1NGMB 1OIPA 4AYCA 1NU1D 3L74G 1FBMA 2Z5IA 1S4XA 3GG2A 2QM7A 3CX5H 1GL2D 2XKMA 2E42A 5AW1B 2FYNC 3G9RA 2E43A 3A7OA 2YXQB 3ZDMA 1BSHA 2LXCB 2AEMA 1OW6A 5CHXA 2Q5UA 1IJDB 1VQ7P 2KS1A 2AXTH 2P7JA 1LWUC 3H1IJ 2FXPA 3L73E 1JMBA 2BASA 4TT3H 2KZIA 1LT1A 1T2KC 1URQC 5AW3B 1GL2B 3M9QA 3AE7C 2QA4P 3H1LE 1NVOA 1L4AC 3AEGC 1OMIA 4I7ZB 3Q5SA 4YPCA 1H0TA 1HH0A 3H1JD 3Q5PA 2YMYA 1M57D 3SFEC 1KORA 5KLIC 1SS1A 2VRSA 4EDFA 1GL2A 2A45G 3RK2D 1NTKJ 5AVVB 2Y0EA 4XFJA 2KUBA 1SQPE 3IFMA 3F5HA 3BASA 4IL6X 1L0ND 1X22A 4NPEA 3V4WA 2MKVA 1HVVA 4N3YB 3PLNA 1LTTC 3OJAB 1ZXGA 2ZFCA 1BCCG 2J5UA 3L74E 1VQ6P 1BE3G 1TU3F 4PJ0H 2IBZI 1NTZG 3VTPC 4L73A 5E79E 1YJ9P 1ZLLA 4L74A 4H13D 4Y99B 1QL2A 2AEFA 1SLQA 4I2LC 2KYVA 1BDDA 2ITAA 2NPSA 5CCGC 5KAIE 2HODA 1GL2C 4WY4D 2QJPC 3D6ZA 1NTMD 1FOSE 3N7NA 4I7ZC 2JWDA 4AUWA 3RGUA 2FYUD 3L73J 1RQUA 1VQOP 1GZLA 4C7NB 2JKVA 1KYOE 2E76C 5CCHD 2QEXP 3IR9A 3NFQA 2IYPA 1KB9D 4H13B 2YO2A 1HJBA 1IFIA 2WPQA 4GT1A 2Q6QA 2IPPA 1Y47A 2Q1KA 2OYHB 4WY4B 1NTKK 3M0AA 1EXJA 1ZR4A 1AA0A 1QEXA 2KB7P 2Y9ZA 3V4QA 2FXMA 3KYQA 2NPSC 2WVRA 1KQGB 3HE5B 2KNCB 2OYHA 1FS0E 2WPSA 5APTA 3CWBG 1BE3E 1NAYA 3AEDC 1KN7A 2IYOA 1Q86Q 4Z1MH 4K3AA 1KQFB 5BVZA 2WT7B 5M1BA 3ABVC 4U7JA 1JY2P 2V7QH 2GM4A 2KNCA 2WSFH 4D6TG 5KLVG 2WZ7A 2QM8A 2LR2A 3T97A 2ZVNB 3PTZA 3LIEA 4LGDE 1BGYD 1N7LA 3L71D 2WSEJ 1PV3A 1QVGO 4IFDK 1L0LG 5B66H 3V5BA 2OYHC 4DCKA 3P8CD 1OZHA 3L75G 4U3FG 3D70A 1LTJA 2W6JH 2WSCJ 3SWYA 3S4RA 3EFGA 1EDJA 4IFMA 5AW8B 3L70E 2J58A 3FX0A 3A0BE 1IFDA 5APQA 2N9YB 4WWIA 3W68A 3TK1A 1YTZI 1SQPK 2CK3H 1KYOI 1LP1B 4TLFA 1PPJD 1ZN5A 1KD1Q 1JY3P 2XZRA 1BCCJ 2O01J 5TJHA 1P84I 1XTGB 1BE3J 2B87B 3IAOA 1ZRTD 3V2NA 4BRYA 1LTAC 3WU2E 1NTZJ 2QRXA 1KV4A 1LTJC 5KLVE 1S9KD 3UIAA 2L91A 1KFMA 1JO5A 1SQBE 2BCCG 2XNXA 4OGQD 4AQRD 2B87A 2R3CA 3H1ID 1OW8A 1VF5D 3JCUE 1PGQA 1L0LE 2M0BA 2CPBA 2FXOA 1PP9G 1MZ9A 1YYCA 3LW5H 5APUA 1G1JA 3OAKA 4U3FE 2HR3A 1YIJP 3CCRP 3RK3D 2A06D 2Y0DA 5APVA 4OGQB 5TISE 1S5LH 1NTKD 1WRGA 3QWOC 2QJKB 1VF5B 1IK7A 3TGUG 2IBZG 3N4XA 1FJPA 3RBZA 5APYA 3RL0D 1KB9H 1CW5A 1FZGA 5KTBA 2K1AA 3ITKA 2ZT9C 2B89A 2N1TA 1Q90D 3CWBJ 2K9YA 3RK3B 3CX5E 1RE3A 3B4SA 3FWNA 2IFNA 1GU4A 1NTZK 1FZFA 3E7KA 2R5DA 4D6TJ 4MN4C 3KXDA 1IZNB 3A0HH 1IFMA 2K9JB 2BCCE 1DX7A 1T2KD 3RL0B 5CBNA 1ZR2A 2FYNB 5DJTB 3PJSK 1L4AD 3H32B 3FWLA 1R5SA 2H43A 2MJZA 3L73D 3L71J 1JY2O 1L0LJ 1PP9E 4RESB 1J1DC 4W7ZA 2Q9IA 2JJLA 2P58A 3GW6A 1KQSO 2QJYC 1VQMP 3VN0A 3TNUB 3CXHD 3L75J 2N1TC 4U3FJ 3CMAP 1AVOA 1LWUB 3H1LG 1VF5C 2FFDB 3L37A 1IFNA 3CCMP 1IC2A 1OVVA 1RE3C 3CCVP 2N9BA 1L4AB 4PD4D 3FXEA 3TGUE 3TNUA 2OGUA 2IBZE 2W27A 3KHUA 2ZJSE 1RF1B 3CC4P 3Q2YA 2FFDA 5KLIB 3L72J 5BU5A 2AEJA 4NPDA 1YI2P 3USSA 1GTWA 2OQQA 3KDPB 1AJYA 1Q7YQ 4RKUJ 4PJ0E 1RF1A 3CI9A 3RL0C 1LTSC 5CCGD 2WPRA 1FU1A 5KLVK 2QVAA 1IFPA 3GHGB 1JY3O 5GTHH 3MP7B 2W83C 1USDA 5H2FE 3WUTA 2M3BA 2E74D 5AVUB 2BCCJ 2E76D 4Y28J 3CMEP 2KOGA 3HD7D 1L0LK 1H0TB 1FZBA 1KILE 3CCUP 4BWNA 3CX5I 2FFDC 3GHGA 1PP9J 2PRRA 3GMAA 1VDFA 2XV5A 1M7LA 1NKNA 1YJWP 2QJPB 1HJ0A 2HFED 2K3RA 3II6A 1USEA 2E74B 1T8ZA 1RF1C 1GDTA 2E76B 4I6MC 2NPSD 4GKGA 4HYTB 2YKQA 2M5AA 3P8MC 1KMIZ 3B8EB 5CCGA 1BDCA 3E1RA 3HD7B 5KKZB 3L35A 3E1IA 3TGUJ 1NKZB 3R2PA 3HTKB 3EFFK 2R44A 1SQVE 1BCCD 3S1KA 3H25A 4WB4A 1A02J 2IZ0A 1A02F 3H1HJ 1EZVD 3HD7A 1BE3D 1DD4A 3GHGC 4ZMDA 3AECC 1OW7A 1W2EA 2NPSB 2W90A 2HODB 1NTZD 3HTKA 4C46A 2IFMA 2HPCA 3AE5C 2ZYGA 1L0NG 4UB8E 3V2PA 4JF7A 3CC7P 2OTKE 2Q7CA 3MTUE 1UIXA 2HLOA 1JCDA 2Z4EA 5B66E 1PFIA 3VMYA 1JB0J 4CPGA 2E74C 1Q82Q 4OVNF 2D2CB 1GMJA 2ZYDA 3AEFC 1DEBA 3KZIE 1E5WA 2C9LY 4L76A 5AW6B 3CCLP 3CPWO 3H1LJ 3MD0A 3HD7C 3B5ND 1G2CB 4BXLA 5KKZC 1P84E 2SPZA 1JNMA 2W6AA 3LIDA 1AQTA 4KT0J 3P7KA 3L70G 1JM0A 1AQ5A 1ZMEC 2R3SA 4GODA 1G2CA 1HTLC 3CXHH 1SQPJ 3L36A 1N7SB 5KAFE 2ZXEB 3U1AA 4EOTA 3CWBD 1VQ9P 3B5NB 2B88A 1VQKP 1K73Q 4JPZB 4L75A 3T97B 5AW4B 3L74J 4PD4H 3PP5A 4QMAA 1X8YA 2WMMA 3VYIA 4IOIH 1L0NE 4D6TD 1N7SA 1ZW0A 5DJUB 3B5NA 4H0LC 4ZNCA 4EIJA 2R32A 1VQ4P 2UWJE 3I55P 1GW4A 2D2CC 1HUCA 4R4MA 1SQBG 1EDLA 1L0LD 3HE4B 1LTJB 1N86A 1FOSF 2P67A 3VP8A 4RJTA 1M1KQ 2RKLA 3JSVC 1VQ5P 5E79H 3L75D 4U3FD 3RL0g 2RN0A 4ASWA 2KP8A 3MUDA 2YO3A 4H44C 3H1KG 2WSEH 2P2UA 3HE4A 4YTPC 4NPFX 1S5LE 1JUNA 3A2AA 2FYUE 5AVXB 1N7SC 4K35A 3AE4C 2ZT9D 1W2BO 2O3JA 3GF7A 3QH9A 1S2EA 3D71A 3B5NC 2NZ2A 3M9BA 2LKMA 3O8ZA 3L72D 4YXDC 4KHXA 2WSCH 3AE2C 4BRYB 2P10A
chains in the Genus database with same CATH topology
3H1KJ 3TGUJ 1SQQJ 1BGYJ 1NTZJ 3L71J 1BCCJ 1L0LJ 1SQXJ 3H1LJ 4D6TJ 1P84I 3L70J 3L72J 3L74J 3BCCJ 3H1IJ 2FYUJ 1KB9I 5KLVJ 3CX5I 3CWBJ 1BE3J 1NU1J 2IBZI 1PP9J 1SQPJ 4PD4I 1KYOI 3H1HJ 3L73J 3CXHI 3L75J 1SQBJ 2BCCJ 1EZVI 3H1JJ 4U3FJ 1SQVJ 1NTMJ 1L0NJ 1NTKJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1K J;  3TGU J;  1SQQ J;  1BGY J;  1NTZ J;  3L71 J;  1BCC J;  1L0L J;  1SQX J;  3H1L J;  4D6T J;  1P84 I;  3L70 J;  3L72 J;  3L74 J;  3BCC J;  3H1I J;  2FYU J;  1KB9 I;  5KLV J;  3CX5 I;  3CWB J;  1BE3 J;  1NU1 J;  2IBZ I;  1PP9 J;  1SQP J;  4PD4 I;  1KYO I;  3H1H J;  3L73 J;  3CXH I;  3L75 J;  1SQB J;  2BCC J;  1EZV I;  3H1J J;  4U3F J;  1SQV J;  1NTM J;  1L0N J;  1NTK J; 
#chains in the Genus database with same CATH topology
 4IL6 H;  3BCC G;  2KSJ A;  2A45 H;  1S72 P;  3L4F A;  2WWW A;  4ZKP A;  5AW0 B;  4GIF A;  2WTY A;  1RF0 A;  2ZT9 B;  2KLU A;  1IFJ A;  3MUD C;  3A5T A;  2I1J A;  4C7R A;  1X0T A;  5APW A;  2BCC D;  2O01 H;  4M3L A;  3I56 P;  1H88 A;  1PL5 A;  2XDJ A;  5AVS B;  2N1T D;  1XTC C;  1PP9 D;  5EFW B;  2FKW B;  2DW3 A;  1FDO A;  1GK6 A;  1EDK A;  4O9B A;  2Q3I A;  4R4L A;  5B5E H;  3H1K E;  2OYI C;  1PGO A;  1NH4 A;  2B9B A;  2YIU C;  1J1D B;  2XU6 A;  4WBA A;  2BEZ F;  1AV1 A;  2QJY B;  3L70 J;  1RF0 C;  5K5G B;  1JTH B;  1K9M Q;  3TGU D;  2N1T B;  4B86 A;  1X79 B;  3M9H A;  5KJ7 A;  3NMD A;  5C39 A;  4A7P A;  2OAR A;  3G4S P;  1JEK A;  3BCC E;  4N78 D;  3H1H D;  1JTH A;  3F89 A;  1RH5 B;  3WMM 0;  3A0B H;  1GK4 A;  2GA1 A;  2Y9Y A;  2L5G B;  1L0N K;  5GTH E;  1FC2 C;  2POH A;  1E79 H;  1PPJ E;  2QE7 H;  1KB9 I;  5KLV J;  1DH3 A;  4LLH A;  1VL2 A;  4N6J A;  2AXT E;  4RO0 A;  1FZC B;  1QGK B;  1Y8A A;  1SQB J;  1OX3 A;  1EDI A;  1FE6 A;  5KJ7 C;  5CBO A;  3TSI A;  3PRJ A;  3WU2 H;  1NYH A;  1DD3 A;  1EXI A;  1FZC A;  3H1L D;  2WSS H;  3TF5 A;  2HYN A;  1T6A A;  2WPV B;  1HF9 A;  1YJN P;  1OVU A;  3H1I E;  3H1K J;  1EC5 A;  2HG5 D;  1VQL P;  1JOC A;  3VMA A;  3D6Y A;  1ZV8 A;  2FYU K;  3AEE C;  1YTZ T;  2ZVO B;  3GF3 A;  1YIT P;  3AE1 C;  3U1C A;  5BU8 B;  1SQP D;  1VPC A;  2G3A A;  2FY8 A;  1JCC A;  3RK3 E;  2A06 E;  3BCC J;  5CJ0 A;  2IDB A;  1D7M A;  2PAJ A;  4HH2 A;  1SQV G;  1NTK E;  1AVY A;  2KSE A;  1KIL A;  3L74 D;  1SFC A;  3NXS A;  1QVF O;  1OWA A;  3AE8 C;  2K37 A;  1SQX G;  2OTL P;  4DZO A;  1FZC C;  3EWK A;  2Y0C A;  2YKP A;  3Q3D A;  1J2J B;  3CCE P;  5AVQ B;  1X9V A;  3B71 A;  2FYZ A;  1PIX A;  3AEA C;  1NAF A;  1SQQ G;  4UB6 H;  1LJ2 A;  5AVW B;  1Z56 A;  1K8A Q;  5AW7 B;  1SQB K;  4DT0 A;  1GW3 A;  5GTI H;  3CCS P;  2QIW A;  1LT9 B;  1QLE D;  2Z5H A;  3IN6 A;  3CCQ P;  3G71 P;  2K88 A;  1NU1 G;  1MKM A;  2P1J A;  2GUS A;  2R5B A;  2KLV A;  1KYO D;  3O6Q A;  2M5A B;  2YKO A;  2E75 C;  2O1J A;  1LT9 A;  3FXD A;  1KIL C;  1SFC C;  4IFF A;  3EQ2 A;  4GOF A;  4JYC A;  1P84 D;  1DIP A;  1BSN A;  2O1K A;  5AVY B;  2QSI A;  2C0W A;  5AW2 B;  3CXH E;  2AXC A;  5AVT B;  5CMZ A;  2HPC B;  2E5T A;  3M0D A;  3H1J G;  3G3Z A;  1T3U A;  3GLM A;  4I1L A;  1OFC X;  4PD4 E;  1SQX E;  4H0L D;  1HBW A;  3TYY A;  3KPE A;  2D2C D;  3RBX A;  1LT9 C;  2ZAE B;  3VP9 A;  3HUS B;  1SQQ E;  2H88 C;  1KTM A;  4ZKU A;  2RMZ A;  3OW2 O;  1LNQ A;  1RHZ B;  1QL1 A;  1VQP P;  5AW9 B;  3VMZ A;  3WUU A;  2JP3 A;  1EZV G;  2M3E A;  1AFO A;  1NU1 E;  3U59 A;  3TDK A;  4GOE A;  4W80 A;  3RK2 B;  2OTJ P;  3BRT B;  4H0L B;  4H44 D;  3HUS A;  1FZE A;  1FZA A;  1H89 A;  1WT6 A;  2RH0 A;  3M0D C;  2LXB A;  3NTN A;  1G1I A;  5H2F H;  3AE3 C;  1N7S D;  1H8A A;  1MFT A;  3CD6 P;  5APS A;  1MV8 A;  1KC8 Q;  1NTM G;  3L70 D;  1KFN A;  1OVR A;  2Q3E A;  3MGN A;  3VOP A;  2FYU G;  3V2R A;  3VMX A;  1HGV A;  1N73 B;  4H44 B;  1GU5 A;  3V2Q A;  4HB1 A;  3G6E P;  4IL6 E;  3SFD C;  3H1J E;  1JY2 N;  3C8V A;  1S5L X;  1Q2N A;  3HRN A;  4C7N A;  1CZQ A;  1SQV J;  4DOJ A;  2W6B A;  2GUV A;  1YBK A;  3I5C A;  5APX A;  3HUS C;  1SQX J;  4GDO A;  1N73 A;  1RY3 A;  3C9I A;  2W8Z A;  1VQN P;  2M8R A;  1FDI A;  4LC1 A;  1L2P A;  2JEE A;  2V7Q J;  2V4H A;  2PFX A;  2WSF J;  3CXH I;  5KLV D;  1R8E A;  1BCC E;  2QG4 A;  4WY4 A;  3RK2 C;  1SQQ J;  2OYO A;  1EZV E;  3KQG A;  3M06 A;  2PGD A;  1SQB D;  1NWQ A;  1CI6 B;  4Y99 C;  1NU1 J;  1NO4 A;  5CCH A;  1NTZ E;  2JR8 A;  4PD4 I;  1ZP0 C;  1Q81 Q;  1NOH A;  3HE5 A;  1MFZ A;  1N8R Q;  3AE9 C;  4UB8 H;  1S3J A;  5B5E E;  1SVF A;  1CI6 A;  3S9O A;  3H1K D;  3MHV A;  2JO1 A;  2WT7 A;  3SWF A;  5AVR B;  1NTM E;  1N73 C;  5KAI H;  2BEQ D;  1BGY G;  3L71 G;  1JY3 N;  2KIK A;  1T3J A;  4H13 C;  1DEE G;  3CC2 P;  2H8P D;  4KJM A;  4PV1 D;  1PZQ A;  2YNY A;  2OYI B;  4WY4 C;  1KYO H;  1LTG C;  3KZI H;  2YIU B;  4OWF A;  1LTB C;  1ZOY C;  2C0X A;  1PGJ A;  1KB9 E;  3BCC D;  4EI2 A;  4XE5 B;  3AEB C;  3H1J J;  1SQV K;  1P84 H;  5CCH C;  3SSU A;  1GD2 E;  1SQX K;  2OYI A;  3CX5 D;  3R4Y A;  4EYY Q;  4DJG A;  4PV1 B;  2E5Y A;  3BAT A;  3FGA D;  5CJ4 A;  3L72 G;  1L0N J;  5KJ7 D;  1U57 A;  1WMK A;  1K04 A;  3A0H E;  5AVZ B;  1SQQ K;  2YXR B;  5KAF H;  3CWB E;  1PPJ G;  1IO4 A;  1KZU B;  2C9N Y;  2G8Y A;  3JC2 2;  3PHL A;  1NU1 K;  2XND H;  4YXW H;  2A45 I;  3C1L A;  4JQ0 D;  1LP1 A;  2ZXX A;  1YQ3 C;  1VQ8 P;  1J1E B;  1QX8 A;  1UII A;  4D6T E;  1S1C X;  1M56 D;  1HWT C;  3LW5 J;  1U7J A;  3P32 A;  4W7Y A;  2PP6 A;  1BGY E;  3L71 E;  2O01 N;  1EZV I;  1K05 A;  1U7M A;  1NTM J;  3H1I G;  2I8D A;  1IK9 A;  2YMK A;  2FYU J;  3BVH A;  1W5C E;  3L75 E;  3Q1M A;  2ZYA A;  3A3Y B;  2IBZ D;  2NRG A;  2IZ1 A;  3P8C E;  1LGH B;  3PH0 A;  1CSB A;  2IX7 C;  4WVZ A;  4PV1 C;  2A06 G;  4ASV A;  4JYB A;  3AE6 C;  1R5L A;  1NTK G;  2FBW C;  4JBZ A;  2KXP B;  3IF4 A;  1EQ7 A;  3L72 E;  2KI7 B;  1NJI Q;  3SWK A;  1J1E C;  4UB6 E;  1FAV A;  3V6I A;  1LTI C;  3H1H G;  3CL3 D;  5GTI E;  3K5B A;  4HJG H;  3CLQ A;  5AW5 B;  1M1J B;  1OXZ A;  1FJK A;  2I1K A;  1M90 Q;  2E75 D;  1KIL D;  1ZRT E;  1SFC D;  3H6P A;  1NHL A;  1M8O B;  1JMM A;  3M91 A;  1S9K E;  1URQ D;  1M1J A;  1RE4 A;  3MZW B;  2KZJ A;  1RQV A;  1NTM K;  1PGP A;  1BGY J;  5L8R J;  3JCU H;  1Y9B A;  3L73 G;  2E75 B;  2K9J A;  3WUV A;  4OGQ C;  3BRV B;  1KIL B;  1SFC B;  3H32 A;  2QJK C;  1HGZ A;  2H89 C;  2JDI H;  1SQV D;  1URQ B;  1YHQ P;  2H7H A;  1FDM A;  4HKZ H;  1N2D C;  3CCJ P;  1SQX D;  1MUU A;  1SP4 A;  5TIS H;  3Q5R A;  1LWU A;  2JWA A;  3RK3 C;  4XA4 A;  2WQY C;  1M1J C;  3W67 A;  1RE4 C;  1SQP G;  4OH8 B;  2J59 M;  3OA7 A;  4N78 E;  2KK7 A;  1URQ A;  3H1H E;  1SQQ D;  1L4A A;  2CPS A;  2KS1 B;  2WIT A;  3O6Q B;  3MIW A;  1YQ4 C;  1KQL A;  1NGM B;  1OIP A;  4AYC A;  1NU1 D;  3L74 G;  1FBM A;  2Z5I A;  1S4X A;  3GG2 A;  2QM7 A;  3CX5 H;  1GL2 D;  2XKM A;  2E42 A;  5AW1 B;  2FYN C;  3G9R A;  2E43 A;  3A7O A;  2YXQ B;  3ZDM A;  1BSH A;  2LXC B;  2AEM A;  1OW6 A;  5CHX A;  2Q5U A;  1IJD B;  1VQ7 P;  2KS1 A;  2AXT H;  2P7J A;  1LWU C;  3H1I J;  2FXP A;  3L73 E;  1JMB A;  2BAS A;  4TT3 H;  2KZI A;  1LT1 A;  1T2K C;  1URQ C;  5AW3 B;  1GL2 B;  3M9Q A;  3AE7 C;  2QA4 P;  3H1L E;  1NVO A;  1L4A C;  3AEG C;  1OMI A;  4I7Z B;  3Q5S A;  4YPC A;  1H0T A;  1HH0 A;  3H1J D;  3Q5P A;  2YMY A;  1M57 D;  3SFE C;  1KOR A;  5KLI C;  1SS1 A;  2VRS A;  4EDF A;  1GL2 A;  2A45 G;  3RK2 D;  1NTK J;  5AVV B;  2Y0E A;  4XFJ A;  2KUB A;  1SQP E;  3IFM A;  3F5H A;  3BAS A;  4IL6 X;  1L0N D;  1X22 A;  4NPE A;  3V4W A;  2MKV A;  1HVV A;  4N3Y B;  3PLN A;  1LTT C;  3OJA B;  1ZXG A;  2ZFC A;  1BCC G;  2J5U A;  3L74 E;  1VQ6 P;  1BE3 G;  1TU3 F;  4PJ0 H;  2IBZ I;  1NTZ G;  3VTP C;  4L73 A;  5E79 E;  1YJ9 P;  1ZLL A;  4L74 A;  4H13 D;  4Y99 B;  1QL2 A;  2AEF A;  1SLQ A;  4I2L C;  2KYV A;  1BDD A;  2ITA A;  2NPS A;  5CCG C;  5KAI E;  2HOD A;  1GL2 C;  4WY4 D;  2QJP C;  3D6Z A;  1NTM D;  1FOS E;  3N7N A;  4I7Z C;  2JWD A;  4AUW A;  3RGU A;  2FYU D;  3L73 J;  1RQU A;  1VQO P;  1GZL A;  4C7N B;  2JKV A;  1KYO E;  2E76 C;  5CCH D;  2QEX P;  3IR9 A;  3NFQ A;  2IYP A;  1KB9 D;  4H13 B;  2YO2 A;  1HJB A;  1IFI A;  2WPQ A;  4GT1 A;  2Q6Q A;  2IPP A;  1Y47 A;  2Q1K A;  2OYH B;  4WY4 B;  1NTK K;  3M0A A;  1EXJ A;  1ZR4 A;  1AA0 A;  1QEX A;  2KB7 P;  2Y9Z A;  3V4Q A;  2FXM A;  3KYQ A;  2NPS C;  2WVR A;  1KQG B;  3HE5 B;  2KNC B;  2OYH A;  1FS0 E;  2WPS A;  5APT A;  3CWB G;  1BE3 E;  1NAY A;  3AED C;  1KN7 A;  2IYO A;  1Q86 Q;  4Z1M H;  4K3A A;  1KQF B;  5BVZ A;  2WT7 B;  5M1B A;  3ABV C;  4U7J A;  1JY2 P;  2V7Q H;  2GM4 A;  2KNC A;  2WSF H;  4D6T G;  5KLV G;  2WZ7 A;  2QM8 A;  2LR2 A;  3T97 A;  2ZVN B;  3PTZ A;  3LIE A;  4LGD E;  1BGY D;  1N7L A;  3L71 D;  2WSE J;  1PV3 A;  1QVG O;  4IFD K;  1L0L G;  5B66 H;  3V5B A;  2OYH C;  4DCK A;  3P8C D;  1OZH A;  3L75 G;  4U3F G;  3D70 A;  1LTJ A;  2W6J H;  2WSC J;  3SWY A;  3S4R A;  3EFG A;  1EDJ A;  4IFM A;  5AW8 B;  3L70 E;  2J58 A;  3FX0 A;  3A0B E;  1IFD A;  5APQ A;  2N9Y B;  4WWI A;  3W68 A;  3TK1 A;  1YTZ I;  1SQP K;  2CK3 H;  1KYO I;  1LP1 B;  4TLF A;  1PPJ D;  1ZN5 A;  1KD1 Q;  1JY3 P;  2XZR A;  1BCC J;  2O01 J;  5TJH A;  1P84 I;  1XTG B;  1BE3 J;  2B87 B;  3IAO A;  1ZRT D;  3V2N A;  4BRY A;  1LTA C;  3WU2 E;  1NTZ J;  2QRX A;  1KV4 A;  1LTJ C;  5KLV E;  1S9K D;  3UIA A;  2L91 A;  1KFM A;  1JO5 A;  1SQB E;  2BCC G;  2XNX A;  4OGQ D;  4AQR D;  2B87 A;  2R3C A;  3H1I D;  1OW8 A;  1VF5 D;  3JCU E;  1PGQ A;  1L0L E;  2M0B A;  2CPB A;  2FXO A;  1PP9 G;  1MZ9 A;  1YYC A;  3LW5 H;  5APU A;  1G1J A;  3OAK A;  4U3F E;  2HR3 A;  1YIJ P;  3CCR P;  3RK3 D;  2A06 D;  2Y0D A;  5APV A;  4OGQ B;  5TIS E;  1S5L H;  1NTK D;  1WRG A;  3QWO C;  2QJK B;  1VF5 B;  1IK7 A;  3TGU G;  2IBZ G;  3N4X A;  1FJP A;  3RBZ A;  5APY A;  3RL0 D;  1KB9 H;  1CW5 A;  1FZG A;  5KTB A;  2K1A A;  3ITK A;  2ZT9 C;  2B89 A;  2N1T A;  1Q90 D;  3CWB J;  2K9Y A;  3RK3 B;  3CX5 E;  1RE3 A;  3B4S A;  3FWN A;  2IFN A;  1GU4 A;  1NTZ K;  1FZF A;  3E7K A;  2R5D A;  4D6T J;  4MN4 C;  3KXD A;  1IZN B;  3A0H H;  1IFM A;  2K9J B;  2BCC E;  1DX7 A;  1T2K D;  3RL0 B;  5CBN A;  1ZR2 A;  2FYN B;  5DJT B;  3PJS K;  1L4A D;  3H32 B;  3FWL A;  1R5S A;  2H43 A;  2MJZ A;  3L73 D;  3L71 J;  1JY2 O;  1L0L J;  1PP9 E;  4RES B;  1J1D C;  4W7Z A;  2Q9I A;  2JJL A;  2P58 A;  3GW6 A;  1KQS O;  2QJY C;  1VQM P;  3VN0 A;  3TNU B;  3CXH D;  3L75 J;  2N1T C;  4U3F J;  3CMA P;  1AVO A;  1LWU B;  3H1L G;  1VF5 C;  2FFD B;  3L37 A;  1IFN A;  3CCM P;  1IC2 A;  1OVV A;  1RE3 C;  3CCV P;  2N9B A;  1L4A B;  4PD4 D;  3FXE A;  3TGU E;  3TNU A;  2OGU A;  2IBZ E;  2W27 A;  3KHU A;  2ZJS E;  1RF1 B;  3CC4 P;  3Q2Y A;  2FFD A;  5KLI B;  3L72 J;  5BU5 A;  2AEJ A;  4NPD A;  1YI2 P;  3USS A;  1GTW A;  2OQQ A;  3KDP B;  1AJY A;  1Q7Y Q;  4RKU J;  4PJ0 E;  1RF1 A;  3CI9 A;  3RL0 C;  1LTS C;  5CCG D;  2WPR A;  1FU1 A;  5KLV K;  2QVA A;  1IFP A;  3GHG B;  1JY3 O;  5GTH H;  3MP7 B;  2W83 C;  1USD A;  5H2F E;  3WUT A;  2M3B A;  2E74 D;  5AVU B;  2BCC J;  2E76 D;  4Y28 J;  3CME P;  2KOG A;  3HD7 D;  1L0L K;  1H0T B;  1FZB A;  1KIL E;  3CCU P;  4BWN A;  3CX5 I;  2FFD C;  3GHG A;  1PP9 J;  2PRR A;  3GMA A;  1VDF A;  2XV5 A;  1M7L A;  1NKN A;  1YJW P;  2QJP B;  1HJ0 A;  2HFE D;  2K3R A;  3II6 A;  1USE A;  2E74 B;  1T8Z A;  1RF1 C;  1GDT A;  2E76 B;  4I6M C;  2NPS D;  4GKG A;  4HYT B;  2YKQ A;  2M5A A;  3P8M C;  1KMI Z;  3B8E B;  5CCG A;  1BDC A;  3E1R A;  3HD7 B;  5KKZ B;  3L35 A;  3E1I A;  3TGU J;  1NKZ B;  3R2P A;  3HTK B;  3EFF K;  2R44 A;  1SQV E;  1BCC D;  3S1K A;  3H25 A;  4WB4 A;  1A02 J;  2IZ0 A;  1A02 F;  3H1H J;  1EZV D;  3HD7 A;  1BE3 D;  1DD4 A;  3GHG C;  4ZMD A;  3AEC C;  1OW7 A;  1W2E A;  2NPS B;  2W90 A;  2HOD B;  1NTZ D;  3HTK A;  4C46 A;  2IFM A;  2HPC A;  3AE5 C;  2ZYG A;  1L0N G;  4UB8 E;  3V2P A;  4JF7 A;  3CC7 P;  2OTK E;  2Q7C A;  3MTU E;  1UIX A;  2HLO A;  1JCD A;  2Z4E A;  5B66 E;  1PFI A;  3VMY A;  1JB0 J;  4CPG A;  2E74 C;  1Q82 Q;  4OVN F;  2D2C B;  1GMJ A;  2ZYD A;  3AEF C;  1DEB A;  3KZI E;  1E5W A;  2C9L Y;  4L76 A;  5AW6 B;  3CCL P;  3CPW O;  3H1L J;  3MD0 A;  3HD7 C;  3B5N D;  1G2C B;  4BXL A;  5KKZ C;  1P84 E;  2SPZ A;  1JNM A;  2W6A A;  3LID A;  1AQT A;  4KT0 J;  3P7K A;  3L70 G;  1JM0 A;  1AQ5 A;  1ZME C;  2R3S A;  4GOD A;  1G2C A;  1HTL C;  3CXH H;  1SQP J;  3L36 A;  1N7S B;  5KAF E;  2ZXE B;  3U1A A;  4EOT A;  3CWB D;  1VQ9 P;  3B5N B;  2B88 A;  1VQK P;  1K73 Q;  4JPZ B;  4L75 A;  3T97 B;  5AW4 B;  3L74 J;  4PD4 H;  3PP5 A;  4QMA A;  1X8Y A;  2WMM A;  3VYI A;  4IOI H;  1L0N E;  4D6T D;  1N7S A;  1ZW0 A;  5DJU B;  3B5N A;  4H0L C;  4ZNC A;  4EIJ A;  2R32 A;  1VQ4 P;  2UWJ E;  3I55 P;  1GW4 A;  2D2C C;  1HUC A;  4R4M A;  1SQB G;  1EDL A;  1L0L D;  3HE4 B;  1LTJ B;  1N86 A;  1FOS F;  2P67 A;  3VP8 A;  4RJT A;  1M1K Q;  2RKL A;  3JSV C;  1VQ5 P;  5E79 H;  3L75 D;  4U3F D;  3RL0 g;  2RN0 A;  4ASW A;  2KP8 A;  3MUD A;  2YO3 A;  4H44 C;  3H1K G;  2WSE H;  2P2U A;  3HE4 A;  4YTP C;  4NPF X;  1S5L E;  1JUN A;  3A2A A;  2FYU E;  5AVX B;  1N7S C;  4K35 A;  3AE4 C;  2ZT9 D;  1W2B O;  2O3J A;  3GF7 A;  3QH9 A;  1S2E A;  3D71 A;  3B5N C;  2NZ2 A;  3M9B A;  2LKM A;  3O8Z A;  3L72 D;  4YXD C;  4KHX A;  2WSC H;  3AE2 C;  4BRY B;  2P10 A; 
#chains in the Genus database with same CATH homology
 3H1K J;  3TGU J;  1SQQ J;  1BGY J;  1NTZ J;  3L71 J;  1BCC J;  1L0L J;  1SQX J;  3H1L J;  4D6T J;  1P84 I;  3L70 J;  3L72 J;  3L74 J;  3BCC J;  3H1I J;  2FYU J;  1KB9 I;  5KLV J;  3CX5 I;  3CWB J;  1BE3 J;  1NU1 J;  2IBZ I;  1PP9 J;  1SQP J;  4PD4 I;  1KYO I;  3H1H J;  3L73 J;  3CXH I;  3L75 J;  1SQB J;  2BCC J;  1EZV I;  3H1J J;  4U3F J;  1SQV J;  1NTM J;  1L0N J;  1NTK J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...