1BCCJ

Cytochrome bc1 complex from chicken
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
59
structure length
59
Chain Sequence
TLTARLYSLLFRRTSTFALTIVVGALLFERAFDQGADAIYEHINEGKLWKHIKHKYENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
total genus 23
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1bccJ00
3CWBJ 3CXHI 1BGYJ 3L73J 1SQXJ 3CX5I 1SQVJ 3L75J 1NTZJ 2BCCJ 3L71J 1KB9I 2IBZI 1L0LJ 1NU1J 3TGUJ 4U3FJ 1SQQJ 3H1KJ 3L74J 4D6TJ 2FYUJ 1BCCJ 3H1JJ 3L70J 1BE3J 1SQBJ 1SQPJ 1L0NJ 1NTMJ 1NTKJ 1PP9J 3BCCJ 5KLVJ 3H1HJ 3H1IJ 1KYOI 1P84I 4PD4I 3H1LJ 1EZVI 3L72J
chains in the Genus database with same CATH superfamily
3HE4A 1OVRA 1L4AC 1BCCG 1T8ZA 2NZ2A 2Z5HA 2LR2A 1EDJA 3AE3C 4UB6E 3L71E 1PGOA 4H0LB 5APTA 3AEGC 2QIWA 2AXTH 5CCHA 2N1TD 1J2JB 1RF1A 2B89A 2FYNC 1AFOA 3Q5PA 1JCDA 1L0ND 1AQTA 3B5ND 3HUSA 4YTPC 3M91A 1GDTA 3C8VA 1BCCE 1MV8A 2IDBA 1M7LA 2ITAA 1PP9J 3H32B 3MZWB 1OMIA 2B87B 2J58A 1MZ9A 2HODB 1MUUA 1N73C 1QX8A 3H1IG 1PZQA 1WMKA 2W8ZA 3H1IJ 4R4LA 3RK3D 1URQB 2CK3H 1Q2NA 3NMDA 1HTLC 2HYNA 2N1TA 4GOEA 5KKZB 1LTGC 2PP6A 1GZLA 1BE3G 1J1DC 1BGYE 1OWAA 2RN0A 3MTUE 5APSA 2YKOA 4A7PA 3RK2C 2FXMA 1SQXG 1SQVG 1FZEA 3LIEA 1SQVJ 4C46A 1NTZD 2IBZG 2P58A 1A02J 5CBNA 2K3RA 3V4WA 1IO4A 1L4AA 3AE8C 1PFIA 4WB4A 2IFNA 3TSIA 1RF1B 2D2CC 4KJMA 4U3FJ 1L0NK 3PP5A 1SQQJ 1FZAA 2RH0A 3GMAA 3LW5J 4M3LA 5TISH 4ZKPA 3CCEP 2KNCB 3M0DC 3RGUA 1Q81Q 4EI2A 2FYNB 1SQPE 2WPVB 3MD0A 1USEA 2KB7P 1YIJP 3C9IA 2QJPB 3RK3B 4PJ0H 2G8YA 5GTHE 3BCCD 4LLHA 4BXLA 5B5EE 4BWNA 5TISE 2W83C 5AW3B 1VQKP 4WY4B 1GK4A 1SQBG 2B87A 2H8PD 2WT7A 1SQQK 2OYHA 3QWOC 5AW9B 2IZ1A 1M8OB 2I1KA 2NPSC 1T2KC 1VQ7P 1G2CA 3CX5I 1VQ6P 4JBZA 3L75E 1S4XA 2CPSA 3IR9A 1EC5A 3KZIE 3NFQA 5AVTB 1L0LJ 2YXQB 1L0LG 4U3FE 1SQPK 1SQBK 2ZVNB 4H44B 5APUA 1FZCA 2WQYC 1J1DB 1NTMD 1PGJA 1ZP0C 3L35A 1Z56A 2M5AB 3L70E 3CMAP 2GM4A 1K05A 4NPEA 1BCCJ 1Y9BA 3MHVA 1N7LA 2R5BA 3CL3D 2QM8A 3IFMA 4U7JA 1EDKA 5APYA 4GODA 3W67A 2KNCA 1YHQP 3RK3E 1L0LK 2ZYAA 4IL6X 3VN0A 5KLVG 2O01J 3A0BH 4RJTA 1NTKK 1JTHB 1PP9D 1LTJC 1SQPD 1P84I 1KV4A 4C7NB 3CC2P 2E76B 1KFMA 4W80A 1SQXE 1JB0J 1IZNB 3FWLA 2E76C 4L75A 4PD4D 1PPJG 2OTJP 1BGYJ 1IFIA 1ZRTD 1BGYG 3H1LD 2BEZF 3CLQA 1NTKG 3O8ZA 5BU8B 1H88A 1J1EC 3RK3C 1S2EA 1NU1E 2WVRA 5AVSB 3L73D 4ASVA 1JO5A 2LKMA 1NYHA 1YYCA 4H13B 1GL2A 1KB9I 3CCSP 1RE3C 1RE4A 2WPSA 3L75D 1DX7A 5AW6B 4HYTB 1PV3A 1RF0A 4JPZB 2YNYA 5CMZA 1IC2A 1JMMA 1LTSC 3TGUE 1NKNA 2E5YA 1DH3A 4HJGH 4Y99B 2OYIB 3RL0D 5CHXA 2Q3EA 1PL5A 3OAKA 3RBXA 4CPGA 1Q82Q 2Q7CA 2POHA 1AVYA 1ZXGA 2KI7B 3A2AA 3CXHH 5AW4B 4IL6E 4PV1B 4DCKA 2YKQA 5BVZA 3AEDC 3PH0A 1FZCB 1N86A 1NTMK 1HF9A 3AE2C 2BEQD 1QGKB 2B88A 2G3AA 2W6BA 4NPFX 3VP9A 1M1JA 2E76D 2UWJE 3JCUE 1LT9C 2P1JA 2FYUG 2H89C 4K35A 4Y28J 1K73Q 2W27A 3L72E 2MKVA 3FX0A 1KQLA 3FXEA 5AVXB 5L8RJ 5AVRB 3V2NA 3VMZA 3CCMP 1QVGO 3L73J 1GTWA 2C9LY 3L73G 4PD4E 1TU3F 1SVFA 1P84E 1RH5B 1IJDB 4IOIH 2L5GB 1IFJA 2IBZI 1IFPA 1LWUB 2Q6QA 3L70D 2BCCE 1N2DC 2E74C 2XKMA 2B9BA 2JP3A 2K9JA 1LTTC 4O9BA 4WY4C 1EZVG 4KHXA 4D6TD 1FBMA 3L70J 3RBZA 4BRYA 2FYUE 3KPEA 1VQ5P 3LW5H 1PGPA 1NTMJ 1PP9G 5KLIC 4LGDE 3TGUD 1VQOP 3VOPA 5AW8B 2HG5D 4XE5B 4RESB 4PV1D 2OARA 2Y0EA 5KLVK 4UB8H 2AEJA 3CX5D 1IFDA 2XU6A 1YITP 3P7KA 5KJ7A 2ZAEB 1T2KD 3BRVB 3QH9A 2HFED 3M06A 1HGZA 1YJ9P 3WU2H 1YTZT 2J59M 2YIUB 3CWBJ 2C9NY 3CWBG 2I8DA 1L0LD 5CCGC 1YJNP 2FYZA 3HD7D 3L73E 2M5AA 1X9VA 4JYBA 1FJKA 1NTZJ 1QL2A 2IYPA 2WSEH 2N1TB 2QRXA 4GKGA 4IL6H 2E42A 3CXHE 3HRNA 4ASWA 1GD2E 2Q9IA 1SQBD 2FXOA 3B8EB 5AVUB 1S9KD 5H2FE 3D6ZA 2FYUJ 2IPPA 2JWDA 3IN6A 1N7SC 2A06E 3L74D 1OFCX 1NTKJ 5KAFE 2IZ0A 1KB9H 3L37A 3FWNA 4WY4A 3KZIH 5K5GB 2P10A 2K9YA 3HUSB 3AE4C 1QVFO 2R3SA 1HWTC 1S3JA 1URQD 2FBWC 2E75B 2WPRA 1AVOA 1MKMA 2O01N 1ZR2A 2GUSA 3CCQP 1UIXA 1FE6A 3B5NA 3L70G 3KXDA 2C0WA 2OYOA 2YO2A 3JC22 3HE4B 1LT9A 1ZMEC 2JO1A 3MUDC 1NU1K 2IBZD 2QG4A 3A0BE 3JSVC 5APXA 3P8CE 1AQ5A 1QL1A 3H25A 1KFNA 1SQVD 2BCCD 4OVNF 1LTIC 5CCGA 2FFDC 2CPBA 2KLUA 1SQXK 1BE3D 1CI6B 1L4AD 4N3YB 4OH8B 2FYUD 1X8YA 1ZLLA 3VP8A 1FDIA 2Q1KA 5KJ7C 5GTIH 4D6TJ 1SQBE 2OGUA 4D6TG 2KLVA 1EZVD 1KILE 1JCCA 3AEBC 5CJ0A 3H1ID 5APQA 1T3JA 3E7KA 4TT3H 1EQ7A 4AYCA 1RF0C 3SWFA 3L36A 1KYOH 2WZ7A 3AE9C 5KTBA 3B71A 3H1HD 1KYOI 5KLIB 1Q7YQ 3HE5B 1WT6A 4IFFA 2WSFH 2LXCB 1E5WA 2M8RA 2Y9YA 1OXZA 3NTNA 3D70A 3GG2A 1VQ9P 3G3ZA 3PHLA 3V4QA 2Q5UA 1R5SA 4N78E 1KB9D 2ZXXA 2E5TA 1BDDA 2A45I 1SQVK 2R5DA 3H1HG 4PV1C 3TK1A 4C7NA 4H0LC 1VQPP 1GU5A 1PPJD 4GDOA 2OTLP 1L4AB 2WTYA 2ZFCA 4RO0A 1S72P 2YIUC 3H1KJ 1LT9B 1RQUA 2WSFJ 1NO4A 2FYUK 5DJTB 1VQLP 4JF7A 1SQPJ 1SQPG 2QE7H 5GTHH 1LTJB 3CCVP 1BSNA 3Q2YA 1EZVE 1KILD 5KLVD 3U59A 1LNQA 1FZCC 1YI2P 3H1IE 4KT0J 2BCCG 5E79H 2H88C 3II6A 3I55P 2W6AA 2JWAA 1LJ2A 2FKWB 3CWBE 3S4RA 1LP1A 1HGVA 2QA4P 5KJ7D 2NPSA 1M1KQ 1UIIA 1ZV8A 1RE4C 3FXDA 3JCUH 1RE3A 1FDMA 5AVZB 2IYOA 5KKZC 3AECC 1NKZB 1SQVE 2J5UA 2QJKC 2AXCA 2L91A 3ABVC 1KYOE 3OA7A 2N9BA 3H32A 4H13D 5KAIH 1HVVA 1KB9E 3M9QA 4GT1A 3SSUA 1VF5B 2HODA 3S9OA 1L2PA 3CPWO 3EWKA 5APWA 3L74G 1FC2C 4U3FD 3AEEC 3EFFK 3L74J 3U1AA 4YXDC 2JKVA 4GOFA 1JEKA 1M90Q 1NTMG 1JY3N 1LT1A 3GLMA 4WBAA 2YMKA 1ZN5A 3RL0B 1VQNP 1OIPA 3T97A 3L4FA 2LXBA 3SWYA 4L76A 3UIAA 3BCCE 1RY3A 3H1HJ 3KDPB 1OZHA 2FY8A 3NXSA 3USSA 5DJUB 3OW2O 2HPCA 3V2PA 3Q5SA 1GL2D 3WUUA 3GHGB 3CWBD 1K9MQ 3BVHA 3V5BA 3WUTA 2OYIA 3R4YA 3F89A 2QVAA 1SLQA 4XA4A 4ZKUA 3I56P 4L74A 3E1RA 1T6AA 1NTZG 3L75J 2N1TC 1T3UA 3IF4A 4TLFA 1GK6A 3O6QA 1J1EB 4I2LC 2KS1B 3GF7A 3CX5H 3MIWA 3G71P 1KQGB 3TGUJ 3TGUG 1BDCA 1LWUA 1JNMA 1JY3O 3W68A 1IK9A 2K9JB 1HUCA 3CCRP 5AVWB 1G1IA 3EQ2A 1YQ3C 1ZR4A 4HH2A 3HUSC 1AV1A 1JTHA 2ZT9C 4JYCA 5EFWB 1S5LH 1EDIA 1NTKE 3M0DA 4DZOA 4ZNCA 5BU5A 1IFNA 1FJPA 1VL2A 5CCHC 2ZVOB 4Y99C 1SQXD 2WSSH 3Q5RA 1SS1A 2P2UA 3H1KG 3LIDA 5CCGD 1Y47A 1JY3P 2PRRA 2YO3A 2OTKE 3AE7C 1ZOYC 2YMYA 3AE6C 3C1LA 3H1LE 1PIXA 3PJSK 1L0NG 1NU1D 3CXHI 3HD7B 1KYOD 4RKUJ 2WSEJ 5B66E 3KQGA 4PJ0E 2A45G 2HLOA 3S1KA 4OGQC 2BCCJ 4OWFA 2IFMA 3L71J 2JJLA 1SQQE 2M3EA 1BCCD 1U57A 4HKZH 1SFCD 3N7NA 1H0TA 1EXJA 1DEBA 1JUNA 1FOSE 3Q1MA 3HE5A 5AW0B 5AW1B 4I1LA 3TYYA 3MGNA 1DD3A 3VTPC 4AQRD 1N73A 2QM7A 1LWUC 2QJPC 1NAFA 5APVA 3L75G 1EDLA 1P84H 1XTGB 2Y9ZA 1KILA 1LGHB 3EFGA 1LP1B 1Q90D 3RL0C 2E75D 5CJ4A 5KAFH 1FZBA 2Z4EA 1NTKD 2YXRB 4K3AA 1BGYD 2IX7C 3H1LG 3H1LJ 2KP8A 3VMYA 1VDFA 4IFDK 1JOCA 2A06G 2KIKA 2KZJA 2O3JA 3L72J 4I7ZC 4YPCA 2KZIA 3U1CA 2M3BA 2JEEA 1RF1C 2FFDA 1CSBA 3CD6P 1W2BO 2OYIC 1QEXA 1DIPA 2O1JA 4NPDA 4ZMDA 3HD7A 2AEFA 1NTZK 4AUWA 1S5LE 3D6YA 2RKLA 1NOHA 2WWWA 3A3YB 2KOGA 2O1KA 3AE5C 3ITKA 2XZRA 3R2PA 3T97B 1VQ4P 3B5NB 2H7HA 1HBWA 1SFCB 1SQQD 1CW5A 1HH0A 2W90A 2ZYDA 5CBOA 2GUVA 1H8AA 1NTME 1L0NJ 2ZYGA 5M1BA 1KTMA 3V2RA 5TJHA 1NVOA 1FU1A 3P8MC 2KYVA 4H13C 5E79E 1CZQA 1YQ4C 1H0TB 1LTAC 3G9RA 1N7SA 3B4SA 3A0HH 2HR3A 1JMBA 2KSJA 3K5BA 1N7SD 1MFZA 2K88A 2OQQA 2WT7B 1NJIQ 1KZUB 1FDOA 2E74B 1OX3A 1OW6A 1OVUA 3H1JG 3I5CA 4I6MC 4DOJA 1VF5C 3A5TA 2E43A 1JY2N 1IFMA 1M56D 2E75C 3BATA 3BCCG 3G6EP 1X0TA 4HB1A 3SFEC 3D71A 1HJBA 2WSCJ 1E79H 4WVZA 1S5LX 2PFXA 2WITA 1Q86Q 2NPSD 3RK2B 2V4HA 1Y8AA 3GW6A 3L74E 2KUBA 2MJZA 3H1JE 5C39A 3L72G 2W6JH 2QSIA 3PRJA 2R3CA 4W7YA 5H2FH 1NGMB 1SFCC 5CCHD 2D2CB 2FXPA 1GU4A 3VYIA 1KILB 3GF3A 1PP9E 2XNDH 1PGQA 3FGAD 1KQFB 4OGQD 3L71G 2XNXA 3VMAA 4DJGA 1DD4A 1W2EA 3OJAB 4MN4C 3SFDC 4XFJA 3BASA 2R44A 2N9YB 4W7ZA 1LTBC 1S1CX 1N7SB 2K1AA 3AEAC 3H1HE 4BRYB 3CC4P 2P67A 1ZRTE 1X22A 1JY2O 2PGDA 4WY4D 2E74D 3VMXA 1H89A 3CC7P 4EOTA 2QJYC 1D7MA 3V6IA 5AVVB 4B86A 3H6PA 2SPZA 1SQXJ 1FZGA 2PAJA 1URQA 2JR8A 4UB8E 1M57D 1BSHA 1N73B 1EXIA 4N78D 2WSCH 1NU1G 2NPSB 3GHGA 1NU1J 1VF5D 2WMMA 2Q3IA 4H44D 4UB6H 3RK2D 4EYYQ 1M1JC 2JDIH 4N6JA 1PPJE 2XV5A 2R32A 3H1KD 1JY2P 1SFCA 2XDJA 2K37A 2D2CD 1KD1Q 4D6TE 3CCUP 2FFDB 4DT0A 1RQVA 1KC8Q 4OGQB 3CCLP 1USDA 4PD4H 5KLVE 1VQ8P 2O01H 4EIJA 4PD4I 3L72D 1MFTA 1GL2B 3MUDA 1EZVI 1RHZB 3HTKA 4R4MA 3G4SP 5AW5B 3GHGC 4JQ0D 1GL2C 2BASA 3B5NC 1X79B 1P84D 2WPQA 3KHUA 1KN7A 1URQC 5KAIE 1L0LE 2P7JA 1XTCC 3TNUA 3RL0g 2VRSA 2QEXP 1YTZI 1GW3A 2QJKB 3L71D 4IFMA 4L73A 3H1JD 3CXHD 3WUVA 1HJ0A 1L0NE 3CI9A 4WWIA 3WU2E 1LTJA 1SP4A 1IK7A 3H1JJ 1BE3J 4LC1A 3TNUB 1AJYA 1M1JB 5B5EH 3H1KE 1R8EA 3M0AA 1FS0E 2M0BA 3A0HE 3BCCJ 3CX5E 3A7OA 3M9BA 1ZW0A 1WRGA 4H44C 2C0XA 1NWQA 2ZJSE 1YJWP 2ZT9B 2AXTE 1QLED 3N4XA 2ZXEB 1OVVA 5KLVJ 1K04A 2V7QH 2HPCB 1DEEG 3TF5A 3CMEP 5AVQB 3F5HA 3P32A 2DW3A 3HD7C 2AEMA 4U3FG 1W5CE 3AEFC 1N8RQ 1SQQG 4Z1MH 4C7RA 1GMJA 1KORA 1OW8A 1JM0A 3SWKA 4QMAA 2Y0CA 2KSEA 1GW4A 3PTZA 4H0LD 2RMZA 2OYHB 1VQMP 1YBKA 1A02F 2Z5IA 1G2CB 4GIFA 3BRTB 3V2QA 2OYHC 2IBZE 3MP7B 1KILC 2A45H 1NTZE 2QJYB 3P8CD 5B66H 1S9KE 1VPCA 3IAOA 2GA1A 2KS1A 2Y0DA 2A06D 3WMM0 1FZFA 1U7JA 1BE3E 1SQBJ 1KQSO 1AA0A 3TDKA 1FAVA 1R5LA 2I1JA 3ZDMA 1FOSF 2V7QJ 1NAYA 1KMIZ 5AW7B 1NHLA 2KK7A 2ZT9D 1CI6A 1U7MA 3CCJP 1G1JA 3AE1C 4YXWH 2H43A 3KYQA 1OW7A 3PLNA 1K8AQ 2YKPA 2NRGA 3HTKB 3O6QB 3M9HA 2KXPB 5AVYB 1NH4A 3E1IA 4EDFA 5GTIE 3Q3DA 5AW2B 4I7ZB
chains in the Genus database with same CATH topology
3CWBJ 3CXHI 1BGYJ 3L73J 1SQXJ 3CX5I 1SQVJ 3L75J 1NTZJ 2BCCJ 3L71J 1KB9I 2IBZI 1L0LJ 1NU1J 3TGUJ 4U3FJ 1SQQJ 3H1KJ 3L74J 4D6TJ 2FYUJ 1BCCJ 3H1JJ 3L70J 1BE3J 1SQBJ 1SQPJ 1L0NJ 1NTMJ 1NTKJ 1PP9J 3BCCJ 5KLVJ 3H1HJ 3H1IJ 1KYOI 1P84I 4PD4I 3H1LJ 1EZVI 3L72J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWB J;  3CXH I;  1BGY J;  3L73 J;  1SQX J;  3CX5 I;  1SQV J;  3L75 J;  1NTZ J;  2BCC J;  3L71 J;  1KB9 I;  2IBZ I;  1L0L J;  1NU1 J;  3TGU J;  4U3F J;  1SQQ J;  3H1K J;  3L74 J;  4D6T J;  2FYU J;  1BCC J;  3H1J J;  3L70 J;  1BE3 J;  1SQB J;  1SQP J;  1L0N J;  1NTM J;  1NTK J;  1PP9 J;  3BCC J;  5KLV J;  3H1H J;  3H1I J;  1KYO I;  1P84 I;  4PD4 I;  3H1L J;  1EZV I;  3L72 J; 
#chains in the Genus database with same CATH topology
 3HE4 A;  1OVR A;  1L4A C;  1BCC G;  1T8Z A;  2NZ2 A;  2Z5H A;  2LR2 A;  1EDJ A;  3AE3 C;  4UB6 E;  3L71 E;  1PGO A;  4H0L B;  5APT A;  3AEG C;  2QIW A;  2AXT H;  5CCH A;  2N1T D;  1J2J B;  1RF1 A;  2B89 A;  2FYN C;  1AFO A;  3Q5P A;  1JCD A;  1L0N D;  1AQT A;  3B5N D;  3HUS A;  4YTP C;  3M91 A;  1GDT A;  3C8V A;  1BCC E;  1MV8 A;  2IDB A;  1M7L A;  2ITA A;  1PP9 J;  3H32 B;  3MZW B;  1OMI A;  2B87 B;  2J58 A;  1MZ9 A;  2HOD B;  1MUU A;  1N73 C;  1QX8 A;  3H1I G;  1PZQ A;  1WMK A;  2W8Z A;  3H1I J;  4R4L A;  3RK3 D;  1URQ B;  2CK3 H;  1Q2N A;  3NMD A;  1HTL C;  2HYN A;  2N1T A;  4GOE A;  5KKZ B;  1LTG C;  2PP6 A;  1GZL A;  1BE3 G;  1J1D C;  1BGY E;  1OWA A;  2RN0 A;  3MTU E;  5APS A;  2YKO A;  4A7P A;  3RK2 C;  2FXM A;  1SQX G;  1SQV G;  1FZE A;  3LIE A;  1SQV J;  4C46 A;  1NTZ D;  2IBZ G;  2P58 A;  1A02 J;  5CBN A;  2K3R A;  3V4W A;  1IO4 A;  1L4A A;  3AE8 C;  1PFI A;  4WB4 A;  2IFN A;  3TSI A;  1RF1 B;  2D2C C;  4KJM A;  4U3F J;  1L0N K;  3PP5 A;  1SQQ J;  1FZA A;  2RH0 A;  3GMA A;  3LW5 J;  4M3L A;  5TIS H;  4ZKP A;  3CCE P;  2KNC B;  3M0D C;  3RGU A;  1Q81 Q;  4EI2 A;  2FYN B;  1SQP E;  2WPV B;  3MD0 A;  1USE A;  2KB7 P;  1YIJ P;  3C9I A;  2QJP B;  3RK3 B;  4PJ0 H;  2G8Y A;  5GTH E;  3BCC D;  4LLH A;  4BXL A;  5B5E E;  4BWN A;  5TIS E;  2W83 C;  5AW3 B;  1VQK P;  4WY4 B;  1GK4 A;  1SQB G;  2B87 A;  2H8P D;  2WT7 A;  1SQQ K;  2OYH A;  3QWO C;  5AW9 B;  2IZ1 A;  1M8O B;  2I1K A;  2NPS C;  1T2K C;  1VQ7 P;  1G2C A;  3CX5 I;  1VQ6 P;  4JBZ A;  3L75 E;  1S4X A;  2CPS A;  3IR9 A;  1EC5 A;  3KZI E;  3NFQ A;  5AVT B;  1L0L J;  2YXQ B;  1L0L G;  4U3F E;  1SQP K;  1SQB K;  2ZVN B;  4H44 B;  5APU A;  1FZC A;  2WQY C;  1J1D B;  1NTM D;  1PGJ A;  1ZP0 C;  3L35 A;  1Z56 A;  2M5A B;  3L70 E;  3CMA P;  2GM4 A;  1K05 A;  4NPE A;  1BCC J;  1Y9B A;  3MHV A;  1N7L A;  2R5B A;  3CL3 D;  2QM8 A;  3IFM A;  4U7J A;  1EDK A;  5APY A;  4GOD A;  3W67 A;  2KNC A;  1YHQ P;  3RK3 E;  1L0L K;  2ZYA A;  4IL6 X;  3VN0 A;  5KLV G;  2O01 J;  3A0B H;  4RJT A;  1NTK K;  1JTH B;  1PP9 D;  1LTJ C;  1SQP D;  1P84 I;  1KV4 A;  4C7N B;  3CC2 P;  2E76 B;  1KFM A;  4W80 A;  1SQX E;  1JB0 J;  1IZN B;  3FWL A;  2E76 C;  4L75 A;  4PD4 D;  1PPJ G;  2OTJ P;  1BGY J;  1IFI A;  1ZRT D;  1BGY G;  3H1L D;  2BEZ F;  3CLQ A;  1NTK G;  3O8Z A;  5BU8 B;  1H88 A;  1J1E C;  3RK3 C;  1S2E A;  1NU1 E;  2WVR A;  5AVS B;  3L73 D;  4ASV A;  1JO5 A;  2LKM A;  1NYH A;  1YYC A;  4H13 B;  1GL2 A;  1KB9 I;  3CCS P;  1RE3 C;  1RE4 A;  2WPS A;  3L75 D;  1DX7 A;  5AW6 B;  4HYT B;  1PV3 A;  1RF0 A;  4JPZ B;  2YNY A;  5CMZ A;  1IC2 A;  1JMM A;  1LTS C;  3TGU E;  1NKN A;  2E5Y A;  1DH3 A;  4HJG H;  4Y99 B;  2OYI B;  3RL0 D;  5CHX A;  2Q3E A;  1PL5 A;  3OAK A;  3RBX A;  4CPG A;  1Q82 Q;  2Q7C A;  2POH A;  1AVY A;  1ZXG A;  2KI7 B;  3A2A A;  3CXH H;  5AW4 B;  4IL6 E;  4PV1 B;  4DCK A;  2YKQ A;  5BVZ A;  3AED C;  3PH0 A;  1FZC B;  1N86 A;  1NTM K;  1HF9 A;  3AE2 C;  2BEQ D;  1QGK B;  2B88 A;  2G3A A;  2W6B A;  4NPF X;  3VP9 A;  1M1J A;  2E76 D;  2UWJ E;  3JCU E;  1LT9 C;  2P1J A;  2FYU G;  2H89 C;  4K35 A;  4Y28 J;  1K73 Q;  2W27 A;  3L72 E;  2MKV A;  3FX0 A;  1KQL A;  3FXE A;  5AVX B;  5L8R J;  5AVR B;  3V2N A;  3VMZ A;  3CCM P;  1QVG O;  3L73 J;  1GTW A;  2C9L Y;  3L73 G;  4PD4 E;  1TU3 F;  1SVF A;  1P84 E;  1RH5 B;  1IJD B;  4IOI H;  2L5G B;  1IFJ A;  2IBZ I;  1IFP A;  1LWU B;  2Q6Q A;  3L70 D;  2BCC E;  1N2D C;  2E74 C;  2XKM A;  2B9B A;  2JP3 A;  2K9J A;  1LTT C;  4O9B A;  4WY4 C;  1EZV G;  4KHX A;  4D6T D;  1FBM A;  3L70 J;  3RBZ A;  4BRY A;  2FYU E;  3KPE A;  1VQ5 P;  3LW5 H;  1PGP A;  1NTM J;  1PP9 G;  5KLI C;  4LGD E;  3TGU D;  1VQO P;  3VOP A;  5AW8 B;  2HG5 D;  4XE5 B;  4RES B;  4PV1 D;  2OAR A;  2Y0E A;  5KLV K;  4UB8 H;  2AEJ A;  3CX5 D;  1IFD A;  2XU6 A;  1YIT P;  3P7K A;  5KJ7 A;  2ZAE B;  1T2K D;  3BRV B;  3QH9 A;  2HFE D;  3M06 A;  1HGZ A;  1YJ9 P;  3WU2 H;  1YTZ T;  2J59 M;  2YIU B;  3CWB J;  2C9N Y;  3CWB G;  2I8D A;  1L0L D;  5CCG C;  1YJN P;  2FYZ A;  3HD7 D;  3L73 E;  2M5A A;  1X9V A;  4JYB A;  1FJK A;  1NTZ J;  1QL2 A;  2IYP A;  2WSE H;  2N1T B;  2QRX A;  4GKG A;  4IL6 H;  2E42 A;  3CXH E;  3HRN A;  4ASW A;  1GD2 E;  2Q9I A;  1SQB D;  2FXO A;  3B8E B;  5AVU B;  1S9K D;  5H2F E;  3D6Z A;  2FYU J;  2IPP A;  2JWD A;  3IN6 A;  1N7S C;  2A06 E;  3L74 D;  1OFC X;  1NTK J;  5KAF E;  2IZ0 A;  1KB9 H;  3L37 A;  3FWN A;  4WY4 A;  3KZI H;  5K5G B;  2P10 A;  2K9Y A;  3HUS B;  3AE4 C;  1QVF O;  2R3S A;  1HWT C;  1S3J A;  1URQ D;  2FBW C;  2E75 B;  2WPR A;  1AVO A;  1MKM A;  2O01 N;  1ZR2 A;  2GUS A;  3CCQ P;  1UIX A;  1FE6 A;  3B5N A;  3L70 G;  3KXD A;  2C0W A;  2OYO A;  2YO2 A;  3JC2 2;  3HE4 B;  1LT9 A;  1ZME C;  2JO1 A;  3MUD C;  1NU1 K;  2IBZ D;  2QG4 A;  3A0B E;  3JSV C;  5APX A;  3P8C E;  1AQ5 A;  1QL1 A;  3H25 A;  1KFN A;  1SQV D;  2BCC D;  4OVN F;  1LTI C;  5CCG A;  2FFD C;  2CPB A;  2KLU A;  1SQX K;  1BE3 D;  1CI6 B;  1L4A D;  4N3Y B;  4OH8 B;  2FYU D;  1X8Y A;  1ZLL A;  3VP8 A;  1FDI A;  2Q1K A;  5KJ7 C;  5GTI H;  4D6T J;  1SQB E;  2OGU A;  4D6T G;  2KLV A;  1EZV D;  1KIL E;  1JCC A;  3AEB C;  5CJ0 A;  3H1I D;  5APQ A;  1T3J A;  3E7K A;  4TT3 H;  1EQ7 A;  4AYC A;  1RF0 C;  3SWF A;  3L36 A;  1KYO H;  2WZ7 A;  3AE9 C;  5KTB A;  3B71 A;  3H1H D;  1KYO I;  5KLI B;  1Q7Y Q;  3HE5 B;  1WT6 A;  4IFF A;  2WSF H;  2LXC B;  1E5W A;  2M8R A;  2Y9Y A;  1OXZ A;  3NTN A;  3D70 A;  3GG2 A;  1VQ9 P;  3G3Z A;  3PHL A;  3V4Q A;  2Q5U A;  1R5S A;  4N78 E;  1KB9 D;  2ZXX A;  2E5T A;  1BDD A;  2A45 I;  1SQV K;  2R5D A;  3H1H G;  4PV1 C;  3TK1 A;  4C7N A;  4H0L C;  1VQP P;  1GU5 A;  1PPJ D;  4GDO A;  2OTL P;  1L4A B;  2WTY A;  2ZFC A;  4RO0 A;  1S72 P;  2YIU C;  3H1K J;  1LT9 B;  1RQU A;  2WSF J;  1NO4 A;  2FYU K;  5DJT B;  1VQL P;  4JF7 A;  1SQP J;  1SQP G;  2QE7 H;  5GTH H;  1LTJ B;  3CCV P;  1BSN A;  3Q2Y A;  1EZV E;  1KIL D;  5KLV D;  3U59 A;  1LNQ A;  1FZC C;  1YI2 P;  3H1I E;  4KT0 J;  2BCC G;  5E79 H;  2H88 C;  3II6 A;  3I55 P;  2W6A A;  2JWA A;  1LJ2 A;  2FKW B;  3CWB E;  3S4R A;  1LP1 A;  1HGV A;  2QA4 P;  5KJ7 D;  2NPS A;  1M1K Q;  1UII A;  1ZV8 A;  1RE4 C;  3FXD A;  3JCU H;  1RE3 A;  1FDM A;  5AVZ B;  2IYO A;  5KKZ C;  3AEC C;  1NKZ B;  1SQV E;  2J5U A;  2QJK C;  2AXC A;  2L91 A;  3ABV C;  1KYO E;  3OA7 A;  2N9B A;  3H32 A;  4H13 D;  5KAI H;  1HVV A;  1KB9 E;  3M9Q A;  4GT1 A;  3SSU A;  1VF5 B;  2HOD A;  3S9O A;  1L2P A;  3CPW O;  3EWK A;  5APW A;  3L74 G;  1FC2 C;  4U3F D;  3AEE C;  3EFF K;  3L74 J;  3U1A A;  4YXD C;  2JKV A;  4GOF A;  1JEK A;  1M90 Q;  1NTM G;  1JY3 N;  1LT1 A;  3GLM A;  4WBA A;  2YMK A;  1ZN5 A;  3RL0 B;  1VQN P;  1OIP A;  3T97 A;  3L4F A;  2LXB A;  3SWY A;  4L76 A;  3UIA A;  3BCC E;  1RY3 A;  3H1H J;  3KDP B;  1OZH A;  2FY8 A;  3NXS A;  3USS A;  5DJU B;  3OW2 O;  2HPC A;  3V2P A;  3Q5S A;  1GL2 D;  3WUU A;  3GHG B;  3CWB D;  1K9M Q;  3BVH A;  3V5B A;  3WUT A;  2OYI A;  3R4Y A;  3F89 A;  2QVA A;  1SLQ A;  4XA4 A;  4ZKU A;  3I56 P;  4L74 A;  3E1R A;  1T6A A;  1NTZ G;  3L75 J;  2N1T C;  1T3U A;  3IF4 A;  4TLF A;  1GK6 A;  3O6Q A;  1J1E B;  4I2L C;  2KS1 B;  3GF7 A;  3CX5 H;  3MIW A;  3G71 P;  1KQG B;  3TGU J;  3TGU G;  1BDC A;  1LWU A;  1JNM A;  1JY3 O;  3W68 A;  1IK9 A;  2K9J B;  1HUC A;  3CCR P;  5AVW B;  1G1I A;  3EQ2 A;  1YQ3 C;  1ZR4 A;  4HH2 A;  3HUS C;  1AV1 A;  1JTH A;  2ZT9 C;  4JYC A;  5EFW B;  1S5L H;  1EDI A;  1NTK E;  3M0D A;  4DZO A;  4ZNC A;  5BU5 A;  1IFN A;  1FJP A;  1VL2 A;  5CCH C;  2ZVO B;  4Y99 C;  1SQX D;  2WSS H;  3Q5R A;  1SS1 A;  2P2U A;  3H1K G;  3LID A;  5CCG D;  1Y47 A;  1JY3 P;  2PRR A;  2YO3 A;  2OTK E;  3AE7 C;  1ZOY C;  2YMY A;  3AE6 C;  3C1L A;  3H1L E;  1PIX A;  3PJS K;  1L0N G;  1NU1 D;  3CXH I;  3HD7 B;  1KYO D;  4RKU J;  2WSE J;  5B66 E;  3KQG A;  4PJ0 E;  2A45 G;  2HLO A;  3S1K A;  4OGQ C;  2BCC J;  4OWF A;  2IFM A;  3L71 J;  2JJL A;  1SQQ E;  2M3E A;  1BCC D;  1U57 A;  4HKZ H;  1SFC D;  3N7N A;  1H0T A;  1EXJ A;  1DEB A;  1JUN A;  1FOS E;  3Q1M A;  3HE5 A;  5AW0 B;  5AW1 B;  4I1L A;  3TYY A;  3MGN A;  1DD3 A;  3VTP C;  4AQR D;  1N73 A;  2QM7 A;  1LWU C;  2QJP C;  1NAF A;  5APV A;  3L75 G;  1EDL A;  1P84 H;  1XTG B;  2Y9Z A;  1KIL A;  1LGH B;  3EFG A;  1LP1 B;  1Q90 D;  3RL0 C;  2E75 D;  5CJ4 A;  5KAF H;  1FZB A;  2Z4E A;  1NTK D;  2YXR B;  4K3A A;  1BGY D;  2IX7 C;  3H1L G;  3H1L J;  2KP8 A;  3VMY A;  1VDF A;  4IFD K;  1JOC A;  2A06 G;  2KIK A;  2KZJ A;  2O3J A;  3L72 J;  4I7Z C;  4YPC A;  2KZI A;  3U1C A;  2M3B A;  2JEE A;  1RF1 C;  2FFD A;  1CSB A;  3CD6 P;  1W2B O;  2OYI C;  1QEX A;  1DIP A;  2O1J A;  4NPD A;  4ZMD A;  3HD7 A;  2AEF A;  1NTZ K;  4AUW A;  1S5L E;  3D6Y A;  2RKL A;  1NOH A;  2WWW A;  3A3Y B;  2KOG A;  2O1K A;  3AE5 C;  3ITK A;  2XZR A;  3R2P A;  3T97 B;  1VQ4 P;  3B5N B;  2H7H A;  1HBW A;  1SFC B;  1SQQ D;  1CW5 A;  1HH0 A;  2W90 A;  2ZYD A;  5CBO A;  2GUV A;  1H8A A;  1NTM E;  1L0N J;  2ZYG A;  5M1B A;  1KTM A;  3V2R A;  5TJH A;  1NVO A;  1FU1 A;  3P8M C;  2KYV A;  4H13 C;  5E79 E;  1CZQ A;  1YQ4 C;  1H0T B;  1LTA C;  3G9R A;  1N7S A;  3B4S A;  3A0H H;  2HR3 A;  1JMB A;  2KSJ A;  3K5B A;  1N7S D;  1MFZ A;  2K88 A;  2OQQ A;  2WT7 B;  1NJI Q;  1KZU B;  1FDO A;  2E74 B;  1OX3 A;  1OW6 A;  1OVU A;  3H1J G;  3I5C A;  4I6M C;  4DOJ A;  1VF5 C;  3A5T A;  2E43 A;  1JY2 N;  1IFM A;  1M56 D;  2E75 C;  3BAT A;  3BCC G;  3G6E P;  1X0T A;  4HB1 A;  3SFE C;  3D71 A;  1HJB A;  2WSC J;  1E79 H;  4WVZ A;  1S5L X;  2PFX A;  2WIT A;  1Q86 Q;  2NPS D;  3RK2 B;  2V4H A;  1Y8A A;  3GW6 A;  3L74 E;  2KUB A;  2MJZ A;  3H1J E;  5C39 A;  3L72 G;  2W6J H;  2QSI A;  3PRJ A;  2R3C A;  4W7Y A;  5H2F H;  1NGM B;  1SFC C;  5CCH D;  2D2C B;  2FXP A;  1GU4 A;  3VYI A;  1KIL B;  3GF3 A;  1PP9 E;  2XND H;  1PGQ A;  3FGA D;  1KQF B;  4OGQ D;  3L71 G;  2XNX A;  3VMA A;  4DJG A;  1DD4 A;  1W2E A;  3OJA B;  4MN4 C;  3SFD C;  4XFJ A;  3BAS A;  2R44 A;  2N9Y B;  4W7Z A;  1LTB C;  1S1C X;  1N7S B;  2K1A A;  3AEA C;  3H1H E;  4BRY B;  3CC4 P;  2P67 A;  1ZRT E;  1X22 A;  1JY2 O;  2PGD A;  4WY4 D;  2E74 D;  3VMX A;  1H89 A;  3CC7 P;  4EOT A;  2QJY C;  1D7M A;  3V6I A;  5AVV B;  4B86 A;  3H6P A;  2SPZ A;  1SQX J;  1FZG A;  2PAJ A;  1URQ A;  2JR8 A;  4UB8 E;  1M57 D;  1BSH A;  1N73 B;  1EXI A;  4N78 D;  2WSC H;  1NU1 G;  2NPS B;  3GHG A;  1NU1 J;  1VF5 D;  2WMM A;  2Q3I A;  4H44 D;  4UB6 H;  3RK2 D;  4EYY Q;  1M1J C;  2JDI H;  4N6J A;  1PPJ E;  2XV5 A;  2R32 A;  3H1K D;  1JY2 P;  1SFC A;  2XDJ A;  2K37 A;  2D2C D;  1KD1 Q;  4D6T E;  3CCU P;  2FFD B;  4DT0 A;  1RQV A;  1KC8 Q;  4OGQ B;  3CCL P;  1USD A;  4PD4 H;  5KLV E;  1VQ8 P;  2O01 H;  4EIJ A;  4PD4 I;  3L72 D;  1MFT A;  1GL2 B;  3MUD A;  1EZV I;  1RHZ B;  3HTK A;  4R4M A;  3G4S P;  5AW5 B;  3GHG C;  4JQ0 D;  1GL2 C;  2BAS A;  3B5N C;  1X79 B;  1P84 D;  2WPQ A;  3KHU A;  1KN7 A;  1URQ C;  5KAI E;  1L0L E;  2P7J A;  1XTC C;  3TNU A;  3RL0 g;  2VRS A;  2QEX P;  1YTZ I;  1GW3 A;  2QJK B;  3L71 D;  4IFM A;  4L73 A;  3H1J D;  3CXH D;  3WUV A;  1HJ0 A;  1L0N E;  3CI9 A;  4WWI A;  3WU2 E;  1LTJ A;  1SP4 A;  1IK7 A;  3H1J J;  1BE3 J;  4LC1 A;  3TNU B;  1AJY A;  1M1J B;  5B5E H;  3H1K E;  1R8E A;  3M0A A;  1FS0 E;  2M0B A;  3A0H E;  3BCC J;  3CX5 E;  3A7O A;  3M9B A;  1ZW0 A;  1WRG A;  4H44 C;  2C0X A;  1NWQ A;  2ZJS E;  1YJW P;  2ZT9 B;  2AXT E;  1QLE D;  3N4X A;  2ZXE B;  1OVV A;  5KLV J;  1K04 A;  2V7Q H;  2HPC B;  1DEE G;  3TF5 A;  3CME P;  5AVQ B;  3F5H A;  3P32 A;  2DW3 A;  3HD7 C;  2AEM A;  4U3F G;  1W5C E;  3AEF C;  1N8R Q;  1SQQ G;  4Z1M H;  4C7R A;  1GMJ A;  1KOR A;  1OW8 A;  1JM0 A;  3SWK A;  4QMA A;  2Y0C A;  2KSE A;  1GW4 A;  3PTZ A;  4H0L D;  2RMZ A;  2OYH B;  1VQM P;  1YBK A;  1A02 F;  2Z5I A;  1G2C B;  4GIF A;  3BRT B;  3V2Q A;  2OYH C;  2IBZ E;  3MP7 B;  1KIL C;  2A45 H;  1NTZ E;  2QJY B;  3P8C D;  5B66 H;  1S9K E;  1VPC A;  3IAO A;  2GA1 A;  2KS1 A;  2Y0D A;  2A06 D;  3WMM 0;  1FZF A;  1U7J A;  1BE3 E;  1SQB J;  1KQS O;  1AA0 A;  3TDK A;  1FAV A;  1R5L A;  2I1J A;  3ZDM A;  1FOS F;  2V7Q J;  1NAY A;  1KMI Z;  5AW7 B;  1NHL A;  2KK7 A;  2ZT9 D;  1CI6 A;  1U7M A;  3CCJ P;  1G1J A;  3AE1 C;  4YXW H;  2H43 A;  3KYQ A;  1OW7 A;  3PLN A;  1K8A Q;  2YKP A;  2NRG A;  3HTK B;  3O6Q B;  3M9H A;  2KXP B;  5AVY B;  1NH4 A;  3E1I A;  4EDF A;  5GTI E;  3Q3D A;  5AW2 B;  4I7Z B; 
#chains in the Genus database with same CATH homology
 3CWB J;  3CXH I;  1BGY J;  3L73 J;  1SQX J;  3CX5 I;  1SQV J;  3L75 J;  1NTZ J;  2BCC J;  3L71 J;  1KB9 I;  2IBZ I;  1L0L J;  1NU1 J;  3TGU J;  4U3F J;  1SQQ J;  3H1K J;  3L74 J;  4D6T J;  2FYU J;  1BCC J;  3H1J J;  3L70 J;  1BE3 J;  1SQB J;  1SQP J;  1L0N J;  1NTM J;  1NTK J;  1PP9 J;  3BCC J;  5KLV J;  3H1H J;  3H1I J;  1KYO I;  1P84 I;  4PD4 I;  3H1L J;  1EZV I;  3L72 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...