1BCCJ

Cytochrome bc1 complex from chicken
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
59
structure length
59
Chain Sequence
b'TLTARLYSLLFRRTSTFALTIVVGALLFERAFDQGADAIYEHINEGKLWKHIKHKYENK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 23
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1bccJ00
1SQXJ 3CWBJ 1BCCJ 1SQVJ 1SQBJ 3BCCJ 1BGYJ 1SQQJ 4D6TJ 1BE3J 1L0NJ 3L71J 5KLVJ 1KB9I 1EZVI 3L74J 1NTZJ 4PD4I 1NU1J 3H1JJ 2IBZI 3TGUJ 1L0LJ 1P84I 1NTKJ 1SQPJ 3L75J 3CX5I 3H1HJ 3L72J 1KYOI 4U3FJ 1NTMJ 2FYUJ 3CXHI 3L70J 2BCCJ 3H1LJ 3H1IJ 3H1KJ 3L73J 1PP9J
chains in the Genus database with same CATH superfamily
1VL2A 1N7SA 5AVYB 4L74A 1EXJA 2YXRB 4PJ0H 4RO0A 1AV1A 1E5WA 1FAVA 1QVFO 1G2CA 5AW3B 4BXLA 1EDLA 3UIAA 3NTNA 3D71A 2FXMA 3V4WA 1NAYA 1YIJP 5AW5B 1JM0A 3B5NC 2K3RA 1T3UA 2AXTH 2O1KA 1N73A 2KNCA 3A0BE 3HTKB 2LXBA 2OYHB 2QM8A 4I1LA 3PRJA 5CMZA 1SQQK 1VQKP 2YIUB 2JWAA 3TNUB 1KILD 3H1LG 1IK7A 2YKOA 4K3AA 1FU1A 3L72E 1RF1B 2IX7C 1LT9C 1FS0E 1SQXK 1YBKA 4PD4I 2B89A 3TGUG 1D7MA 3A5TA 1RE4A 3WMM0 1LTBC 2E42A 2H7HA 1IFIA 1NTMK 4Y28J 3AEGC 3L71J 3HE4A 3CMEP 2Q1KA 1HJBA 1BCCE 2KI7B 2YKQA 1RF0C 1GTWA 2H88C 2KZIA 2QJYB 2M3EA 3S1KA 2M8RA 1J1DB 1JNMA 3CWBJ 4L73A 4WB4A 1K9MQ 2D2CC 1S72P 4WY4C 1QL1A 1FZAA 2N1TB 3D6YA 4UB8E 4DT0A 4IOIH 4H13D 1T3JA 2P1JA 2XKMA 1ZR2A 1PGOA 1PZQA 2K9JB 4AUWA 1JMMA 2RH0A 4RKUJ 3MP7B 3CWBD 3BRVB 3P8CD 2IZ1A 1H88A 4YXWH 3GLMA 2ZXXA 4OWFA 3CWBG 2KS1A 3KPEA 2NZ2A 1DEBA 2WT7B 1NTZJ 1NHLA 3F89A 1VQ7P 1DEEG 1N7SD 2K1AA 1NGMB 1OXZA 2B88A 2Q9IA 3JCUE 1ZR4A 4OGQB 3M06A 2C0WA 4PD4E 3U59A 4Y99C 4H0LD 3CLQA 1RE3A 4GKGA 1NU1J 1OVRA 3WUVA 2QA4P 1NTZD 3AE5C 2KK7A 1YYCA 1LJ2A 1JUNA 3H1KJ 4WVZA 2WTYA 1ZLLA 3RL0g 5M1BA 1HWTC 3RK2B 1NTZG 3IFMA 4DOJA 3L35A 1JB0J 2WSCJ 1LGHB 1NU1D 3SSUA 3AE8C 1OFCX 2NPSA 1BGYJ 3H1KD 5E79H 1ZMEC 1M1JA 4BRYB 2IBZI 4MN4C 3H1HG 1M90Q 1LWUA 2HR3A 5KLVK 2R5BA 3CCQP 5KTBA 2Y0DA 1JY3O 1CSBA 1OZHA 3H1KG 4KHXA 1SQBJ 3TSIA 3FGAD 2OYHC 2ITAA 2A45G 3FWLA 5AW7B 4ZMDA 1KQSO 2YIUC 1BGYD 1NOHA 4D6TD 3B5NA 3JSVC 5KAIH 1PPJE 4AYCA 1ZRTE 3BATA 4I6MC 3PJSK 1OW6A 1RQUA 1BGYG 1MUUA 2RN0A 1SQBD 4D6TG 1IFMA 1LTGC 2E43A 2L5GB 5CJ0A 3HUSB 1S3JA 3AEFC 3N7NA 5AW0B 3MIWA 4U3FJ 1A02J 3USSA 1JY3P 1T2KD 2IYPA 4IFDK 2IFNA 1LT9A 3RBXA 1JY2O 1URQD 1VF5D 2RMZA 1SQBG 2E74C 1J1DC 3P7KA 1LTJB 2WSFH 5GTHE 2WPVB 2FXPA 5GTIE 3L70J 1L0NK 1BE3E 1DH3A 4U3FD 1SP4A 4M3LA 2ZT9D 3VMAA 1RF0A 3AE2C 1T8ZA 3IR9A 2G3AA 4I7ZC 1MV8A 1SQVK 4XFJA 1NVOA 4WY4A 2VRSA 4U3FG 2J59M 1K05A 5AVSB 3L70D 3L75E 3V5BA 2IBZE 1OVUA 1RE4C 2WZ7A 3SWKA 3A7OA 1BDDA 1KYOI 4RJTA 2P67A 2LXCB 3L70G 1N86A 1KN7A 2FBWC 2H89C 1QVGO 3Q5PA 2B87A 3CL3D 3MTUE 4OGQC 4N78D 2NPSD 1CI6A 3CCMP 1S5LH 1Q81Q 1FZEA 1FZBA 1EXIA 2N9YB 3H1IE 3HD7B 1L0LJ 1M7LA 1SQQE 5AVWB 2K9YA 1URQC 1VF5C 3ITKA 3B5ND 5BVZA 3OW2O 3V4QA 1EC5A 2Y0EA 3G4SP 1IFPA 2FYNB 3L74J 4PV1C 1MFTA 1GW4A 4R4LA 2FYUJ 3H32B 1L0LD 2C0XA 2E75B 3K5BA 2ZT9C 1FZCB 2Y9ZA 2A45H 5APYA 1NTME 3KZIE 2KLVA 3RL0D 4XE5B 3Q1MA 1VQPP 1L0LG 2Z5HA 4DJGA 3L74D 2ZXEB 3GMAA 1XTCC 5C39A 2GM4A 2ZVOB 2FYUD 1M8OB 5CCGC 1SQXD 2QE7H 3HTKA 1KYOE 1HVVA 1KB9I 3PTZA 3CCJP 1OW7A 2JR8A 1YHQP 1ZW0A 1FDMA 3L36A 3L74G 2OYHA 2QJKB 4IFMA 1NO4A 1LTTC 3M91A 2FYUG 3TNUA 1ZN5A 2OARA 2AXCA 1SQXG 4NPFX 3Q5SA 2Z4EA 1FDOA 2D2CD 2KSEA 4WY4D 1N2DC 1Y47A 2JDIH 3LIDA 2FFDB 3AEDC 5KLIC 2C9LY 3CPWO 5AVUB 3R4YA 1JCCA 1M1JC 3H1LJ 2FXOA 4IFFA 1OMIA 1FOSF 1OW8A 3BCCG 4U7JA 3GG2A 1JOCA 1SFCC 3A0HH 3MHVA 1LWUC 2HFED 1VQNP 5TISH 1EZVI 3KHUA 3TGUJ 1IK9A 2XV5A 3FXEA 2R32A 4ASWA 2W6BA 5CCHA 3TYYA 1IFNA 2K37A 2YMYA 4UB6E 3EFFK 1E79H 3H1LD 3L37A 1AVOA 1RQVA 4IL6H 4ZNCA 1GZLA 2A06D 3IAOA 1GU5A 1KFNA 3GHGB 3TGUD 2OYIC 4H13B 4JQ0D 1KORA 3PHLA 2IFMA 2ZJSE 3MUDC 1KC8Q 2FY8A 2HPCB 3CCUP 1JY2N 1RHZB 3RL0C 5BU5A 5KJ7C 2A06G 2WSFJ 3T97A 5KAFE 3L72J 5H2FE 1HH0A 3M0AA 1AQTA 1KB9E 3CX5D 2W6JH 1NTKK 1SQPK 5BU8B 2JEEA 2P10A 4ZKPA 3L71E 2A45I 5KLVE 3L72D 3CXHH 3HD7C 1S4XA 1KMIZ 3AE1C 1KTMA 2H8PD 1GL2C 5B5EE 1G2CB 2BCCE 1Q7YQ 3RK3B 3L72G 2J5UA 3V2RA 1EZVE 1VQOP 2ZVNB 4BWNA 2E75C 5B66H 1G1JA 2ZAEB 1HUCA 4RESB 4L75A 2YO3A 3O6QA 1FZCC 3B71A 1URQA 3KYQA 2Q5UA 1USEA 1VQ5P 1EDKA 1M1KQ 2SPZA 3MZWB 2H43A 1BCCG 4HJGH 1VQMP 1OWAA 2ZFCA 1KFMA 1YI2P 1IO4A 1PGQA 1A02F 3QH9A 3RK3E 3TDKA 1L0NE 2JJLA 2QJKC 2YMKA 2GUVA 1LT1A 1FBMA 2E74D 3CCEP 3D70A 5CCHD 1UIIA 1SQVE 2WSSH 5CCGA 3H1HJ 2N1TD 4N6JA 1MZ9A 3NMDA 1NU1E 2XNDH 1NAFA 3CC7P 1IFDA 2HYNA 1U57A 2WVRA 1XTGB 3QWOC 2KUBA 4PD4D 3BASA 3H1HD 1Z56A 3G71P 3W67A 2Y0CA 4D6TJ 2QJPB 1AA0A 1LTJA 3AEEC 3L73E 1J1EB 1X79B 1SFCA 2PRRA 2WMMA 3WU2H 1LTAC 3Q5RA 1FJPA 2IYOA 2I1JA 2Q7CA 1LTIC 1SVFA 2AEFA 3CCVP 1YTZI 3VMYA 3GHGC 4LC1A 1SS1A 1PP9E 1OX3A 4OGQD 3IF4A 1RF1C 5K5GB 3VP8A 2W83C 5L8RJ 1NKNA 2V7QJ 2YO2A 4R4MA 1YQ4C 2OYIA 2RKLA 2WSEJ 1WMKA 4GIFA 3MUDA 2UWJE 3VTPC 1W2EA 4GOEA 2HODB 4H44B 4PJ0E 2FKWB 3CC2P 3A0BH 5KJ7A 3CX5H 4WBAA 1GD2E 3GW6A 2QJYC 2QM7A 1YJ9P 1K73Q 5CCHC 4ASVA 1L4AB 2AXTE 3VP9A 4TT3H 4PV1D 3P8MC 3CCSP 3AE3C 5CBOA 2N1TC 3U1CA 3G9RA 3N4XA 1NTZK 1PPJG 1QX8A 2BASA 3RK3C 1S9KD 1BE3J 2O1JA 3M9QA 1JTHA 1WT6A 3HD7A 3CC4P 2R5DA 2E76B 1GL2A 2QRXA 1NU1K 3Q3DA 2O01J 1LNQA 4WWIA 5CCGD 3B5NB 3EFGA 3O8ZA 1HBWA 3V6IA 1BE3D 5APTA 3H32A 3M9HA 1PGJA 1OVVA 4UB8H 2WPQA 1FZCA 1IJDB 3AE7C 1HGVA 1BE3G 2KZJA 2MKVA 3VMZA 3Q2YA 1FZFA 2M5AA 1Q2NA 4JYBA 1AVYA 1U7JA 4JYCA 1P84D 2Q3IA 1ZP0C 1FE6A 3CXHD 3SWYA 3VYIA 2OTJP 3II6A 1SFCD 1AJYA 1SQBK 1YJNP 3L75G 4AQRD 1X9VA 3CMAP 3RK2C 4Z1MH 1Q82Q 5AVXB 4HYTB 1SQQJ 3E7KA 1KD1Q 2JWDA 3JCUH 1G1IA 2O01N 2D2CB 2WWWA 4PD4H 2E5YA 3PH0A 1VDFA 1SQXJ 2V4HA 3M0DC 5APSA 4JPZB 5CHXA 1NTKE 1SQPE 1H0TB 1IFJA 2JKVA 2KIKA 3V2QA 1W5CE 1SQQD 4EOTA 5KJ7D 2Q3EA 1U7MA 1QEXA 1FJKA 2O3JA 3CX5I 1NTMJ 3E1IA 2KYVA 4EI2A 1AQ5A 2HLOA 1DX7A 1KV4A 3H1IG 2IPPA 2G8YA 2W8ZA 3BCCJ 1NYHA 3A2AA 3H1JE 2XZRA 5AW4B 1SQQG 3C8VA 3NXSA 2CPSA 5DJUB 2YKPA 5AVVB 1JCDA 4GOFA 2R3SA 4XA4A 3GHGA 2OTLP 3HE5B 1PGPA 1NTMD 2HPCA 3HUSC 1X0TA 2CPBA 3HD7D 3G3ZA 1KQFB 4YPCA 5APQA 1KILB 3BCCD 1RF1A 2OGUA 4QMAA 1GL2D 5APVA 2M0BA 1TU3F 2XU6A 5E79E 4Y99B 1NTMG 3AE9C 1LTJC 1S5LX 3ABVC 1L4AC 3I5CA 1JY3N 4KT0J 2V7QH 2KLUA 2PAJA 3H1LE 5TJHA 2E75D 2WSEH 2NRGA 4C7NB 2P58A 1HTLC 5KAIE 1NJIQ 3TK1A 3KXDA 3TGUE 2E76C 2ZYAA 3WUTA 2KOGA 3BVHA 1KILE 4JF7A 2N1TA 3MGNA 1DD4A 3EWKA 2E5TA 2PGDA 4C46A 4TLFA 2CK3H 5CJ4A 1FDIA 1LP1B 2K9JA 3PLNA 4LLHA 1L0LK 5GTHH 1GK6A 1S2EA 5GTIH 3CX5E 1GW3A 1IZNB 4YTPC 1Y8AA 1KQGB 2QSIA 2MJZA 3OJAB 2O01H 2R3CA 2FYUK 3AECC 3KDPB 1R5LA 4YXDC 2WT7A 2C9NY 3CI9A 1P84H 1BCCJ 3TF5A 1N7SB 1IC2A 3E1RA 2QIWA 1WRGA 5KLVJ 1BSNA 2POHA 4CPGA 2BEQD 3CWBE 1M57D 2E74B 3JC22 4H0LB 3P8CE 1KB9D 2JP3A 2BCCJ 2FYNC 2Z5IA 4JBZA 3SWFA 3AE4C 3ZDMA 1N73B 1BCCD 1VPCA 1ZV8A 2IZ0A 2KNCB 1YJWP 1JMBA 1EDJA 3L71D 1GU4A 5KLVD 1YQ3C 2P2UA 1FOSE 3BRTB 3GF3A 4I7ZB 2OYOA 3MD0A 2N9BA 4OVNF 2ZYGA 2BCCD 4IL6X 1BSHA 4BRYA 3L71G 4W7YA 5KLVG 3T97B 3M0DA 1S5LE 1ZXGA 1QLED 1VQ9P 4C7RA 1EZVD 1X22A 2BCCG 1NTZE 5DJTB 2R44A 1L0NJ 3HE4B 3I56P 4GT1A 3S4RA 1EZVG 1KILC 3LIEA 3KZIH 3OAKA 2FFDC 1SQVJ 1M56D 3H1HE 3KQGA 1OIPA 3H6PA 3RK3D 3AEBC 3H1KE 2HODA 3HUSA 1L0ND 3V2PA 1K04A 1T6AA 1L2PA 2W27A 1KYOH 2KB7P 2WPRA 3OA7A 5AW9B 1HGZA 1N8RQ 1HF9A 1Q90D 2W90A 2QEXP 1SQVD 2OTKE 4EYYQ 3O6QB 1L0NG 2LR2A 5EFWB 1URQB 1VF5B 1L4AA 3LW5H 5AVTB 1AFOA 1BGYE 3D6ZA 4D6TE 4N3YB 3L73J 3VOPA 3B4SA 3M9BA 4PV1B 1USDA 1SQVG 1N7LA 1GMJA 2KS1B 1PL5A 4H13C 2ZT9B 2WITA 1P84I 1NU1G 2HG5D 4HB1A 1SQBE 1YITP 5AW8B 1VQLP 3CXHI 3W68A 3G6EP 2FYZA 1PP9J 4EIJA 1KZUB 1VQ6P 3L73D 1PFIA 4I2LC 3CD6P 3F5HA 1GDTA 4UB6H 2WQYC 2AEJA 5AVZB 3A0HE 1UIXA 4DZOA 2M3BA 3AE6C 2I8DA 5KKZB 5TISE 4LGDE 2YXQB 3L73G 2KSJA 1PP9D 2Q6QA 1Q86Q 2PP6A 3RK2D 1PPJD 1HJ0A 4NPDA 4DCKA 4U3FE 1ZRTD 1LTSC 1MFZA 2B9BA 3EQ2A 1S9KE 1DIPA 1N7SC 4IL6E 3R2PA 5CBNA 1S1CX 5AW2B 5KLIB 3VN0A 2GA1A 1QGKB 1PP9G 1FZGA 2AEMA 2NPSB 4H0LC 3S9OA 5KAFH 3WUUA 4OH8B 5H2FH 1QL2A 3V2NA 1M1JB 3L70E 1K8AQ 2L91A 1KB9H 2WPSA 1R8EA 3SFDC 1SFCB 2K88A 1N73C 1LWUB 4HKZH 3FXDA 4HH2A 4B86A 1J2JB 1NH4A 3HRNA 1PIXA 4O9BA 3C9IA 1Y9BA 3C1LA 3L75J 1X8YA 2P7JA 1JY2P 1GK4A 5AW6B 5B5EH 4W80A 4N78E 3FWNA 1ZOYC 2GUSA 4GDOA 2QVAA 1H0TA 1P84E 2OQQA 4K35A 2OYIB 1RY3A 4H44D 1NWQA 3CXHE 5AW1B 3A3YB 1VQ4P 2YNYA 2Y9YA 1JO5A 2ZYDA 3RL0B 3L75D 2IBZD 1LT9B 1L4AD 3PP5A 1JEKA 4GODA 1EQ7A 3IN6A 1CZQA 2IBZG 5B66E 3HE5A 3H1IJ 2DW3A 4W7ZA 1L0LE 1KILA 2E76D 2I1KA 1JTHB 4ZKUA 2FFDA 2LKMA 5APXA 1BDCA 1T2KC 4WY4B 1GL2B 1SLQA 4KJMA 2QJPC 3RGUA 2QG4A 1EDIA 1W2BO 4EDFA 3L74E 1YTZT 1J1EC 3H1ID 1H89A 4L76A 1DD3A 2FYUE 2W6AA 1SQXE 1MKMA 1NTKJ 1SQPJ 5APWA 4A7PA 4C7NA 1RH5B 2JO1A 2XDJA 3GF7A 3P32A 1H8AA 2B87B 1KQLA 1FC2C 3FX0A 3CCLP 5APUA 3H1JJ 2M5AB 3AEAC 3BCCE 5AVQB 2XNXA 2KXPB 2WSCH 1NTKD 1RE3C 1SQPD 2PFXA 1LP1A 1CI6B 2BEZF 3RBZA 2J58A 1CW5A 4H44C 1VQ8P 5KKZC 2KP8A 3LW5J 1R5SA 3SFEC 3CCRP 1NTKG 1SQPG 3U1AA 3B8EB 3H1JD 3I55P 1PV3A 3NFQA 3VMXA 1KYOD 3WU2E 1NKZB 3L4FA 2IDBA 4NPEA 3H25A 5AVRB 2NPSC 3H1JG 2A06E
chains in the Genus database with same CATH topology
1SQXJ 3CWBJ 1BCCJ 1SQVJ 1SQBJ 3BCCJ 1BGYJ 1SQQJ 4D6TJ 1BE3J 1L0NJ 3L71J 5KLVJ 1KB9I 1EZVI 3L74J 1NTZJ 4PD4I 1NU1J 3H1JJ 2IBZI 3TGUJ 1L0LJ 1P84I 1NTKJ 1SQPJ 3L75J 3CX5I 3H1HJ 3L72J 1KYOI 4U3FJ 1NTMJ 2FYUJ 3CXHI 3L70J 2BCCJ 3H1LJ 3H1IJ 3H1KJ 3L73J 1PP9J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQX J;  3CWB J;  1BCC J;  1SQV J;  1SQB J;  3BCC J;  1BGY J;  1SQQ J;  4D6T J;  1BE3 J;  1L0N J;  3L71 J;  5KLV J;  1KB9 I;  1EZV I;  3L74 J;  1NTZ J;  4PD4 I;  1NU1 J;  3H1J J;  2IBZ I;  3TGU J;  1L0L J;  1P84 I;  1NTK J;  1SQP J;  3L75 J;  3CX5 I;  3H1H J;  3L72 J;  1KYO I;  4U3F J;  1NTM J;  2FYU J;  3CXH I;  3L70 J;  2BCC J;  3H1L J;  3H1I J;  3H1K J;  3L73 J;  1PP9 J; 
#chains in the Genus database with same CATH topology
 1VL2 A;  1N7S A;  5AVY B;  4L74 A;  1EXJ A;  2YXR B;  4PJ0 H;  4RO0 A;  1AV1 A;  1E5W A;  1FAV A;  1QVF O;  1G2C A;  5AW3 B;  4BXL A;  1EDL A;  3UIA A;  3NTN A;  3D71 A;  2FXM A;  3V4W A;  1NAY A;  1YIJ P;  5AW5 B;  1JM0 A;  3B5N C;  2K3R A;  1T3U A;  2AXT H;  2O1K A;  1N73 A;  2KNC A;  3A0B E;  3HTK B;  2LXB A;  2OYH B;  2QM8 A;  4I1L A;  3PRJ A;  5CMZ A;  1SQQ K;  1VQK P;  2YIU B;  2JWA A;  3TNU B;  1KIL D;  3H1L G;  1IK7 A;  2YKO A;  4K3A A;  1FU1 A;  3L72 E;  1RF1 B;  2IX7 C;  1LT9 C;  1FS0 E;  1SQX K;  1YBK A;  4PD4 I;  2B89 A;  3TGU G;  1D7M A;  3A5T A;  1RE4 A;  3WMM 0;  1LTB C;  2E42 A;  2H7H A;  1IFI A;  1NTM K;  4Y28 J;  3AEG C;  3L71 J;  3HE4 A;  3CME P;  2Q1K A;  1HJB A;  1BCC E;  2KI7 B;  2YKQ A;  1RF0 C;  1GTW A;  2H88 C;  2KZI A;  2QJY B;  2M3E A;  3S1K A;  2M8R A;  1J1D B;  1JNM A;  3CWB J;  4L73 A;  4WB4 A;  1K9M Q;  2D2C C;  1S72 P;  4WY4 C;  1QL1 A;  1FZA A;  2N1T B;  3D6Y A;  4UB8 E;  4DT0 A;  4IOI H;  4H13 D;  1T3J A;  2P1J A;  2XKM A;  1ZR2 A;  1PGO A;  1PZQ A;  2K9J B;  4AUW A;  1JMM A;  2RH0 A;  4RKU J;  3MP7 B;  3CWB D;  3BRV B;  3P8C D;  2IZ1 A;  1H88 A;  4YXW H;  3GLM A;  2ZXX A;  4OWF A;  3CWB G;  2KS1 A;  3KPE A;  2NZ2 A;  1DEB A;  2WT7 B;  1NTZ J;  1NHL A;  3F89 A;  1VQ7 P;  1DEE G;  1N7S D;  2K1A A;  1NGM B;  1OXZ A;  2B88 A;  2Q9I A;  3JCU E;  1ZR4 A;  4OGQ B;  3M06 A;  2C0W A;  4PD4 E;  3U59 A;  4Y99 C;  4H0L D;  3CLQ A;  1RE3 A;  4GKG A;  1NU1 J;  1OVR A;  3WUV A;  2QA4 P;  1NTZ D;  3AE5 C;  2KK7 A;  1YYC A;  1LJ2 A;  1JUN A;  3H1K J;  4WVZ A;  2WTY A;  1ZLL A;  3RL0 g;  5M1B A;  1HWT C;  3RK2 B;  1NTZ G;  3IFM A;  4DOJ A;  3L35 A;  1JB0 J;  2WSC J;  1LGH B;  1NU1 D;  3SSU A;  3AE8 C;  1OFC X;  2NPS A;  1BGY J;  3H1K D;  5E79 H;  1ZME C;  1M1J A;  4BRY B;  2IBZ I;  4MN4 C;  3H1H G;  1M90 Q;  1LWU A;  2HR3 A;  5KLV K;  2R5B A;  3CCQ P;  5KTB A;  2Y0D A;  1JY3 O;  1CSB A;  1OZH A;  3H1K G;  4KHX A;  1SQB J;  3TSI A;  3FGA D;  2OYH C;  2ITA A;  2A45 G;  3FWL A;  5AW7 B;  4ZMD A;  1KQS O;  2YIU C;  1BGY D;  1NOH A;  4D6T D;  3B5N A;  3JSV C;  5KAI H;  1PPJ E;  4AYC A;  1ZRT E;  3BAT A;  4I6M C;  3PJS K;  1OW6 A;  1RQU A;  1BGY G;  1MUU A;  2RN0 A;  1SQB D;  4D6T G;  1IFM A;  1LTG C;  2E43 A;  2L5G B;  5CJ0 A;  3HUS B;  1S3J A;  3AEF C;  3N7N A;  5AW0 B;  3MIW A;  4U3F J;  1A02 J;  3USS A;  1JY3 P;  1T2K D;  2IYP A;  4IFD K;  2IFN A;  1LT9 A;  3RBX A;  1JY2 O;  1URQ D;  1VF5 D;  2RMZ A;  1SQB G;  2E74 C;  1J1D C;  3P7K A;  1LTJ B;  2WSF H;  5GTH E;  2WPV B;  2FXP A;  5GTI E;  3L70 J;  1L0N K;  1BE3 E;  1DH3 A;  4U3F D;  1SP4 A;  4M3L A;  2ZT9 D;  3VMA A;  1RF0 A;  3AE2 C;  1T8Z A;  3IR9 A;  2G3A A;  4I7Z C;  1MV8 A;  1SQV K;  4XFJ A;  1NVO A;  4WY4 A;  2VRS A;  4U3F G;  2J59 M;  1K05 A;  5AVS B;  3L70 D;  3L75 E;  3V5B A;  2IBZ E;  1OVU A;  1RE4 C;  2WZ7 A;  3SWK A;  3A7O A;  1BDD A;  1KYO I;  4RJT A;  2P67 A;  2LXC B;  3L70 G;  1N86 A;  1KN7 A;  2FBW C;  2H89 C;  1QVG O;  3Q5P A;  2B87 A;  3CL3 D;  3MTU E;  4OGQ C;  4N78 D;  2NPS D;  1CI6 A;  3CCM P;  1S5L H;  1Q81 Q;  1FZE A;  1FZB A;  1EXI A;  2N9Y B;  3H1I E;  3HD7 B;  1L0L J;  1M7L A;  1SQQ E;  5AVW B;  2K9Y A;  1URQ C;  1VF5 C;  3ITK A;  3B5N D;  5BVZ A;  3OW2 O;  3V4Q A;  1EC5 A;  2Y0E A;  3G4S P;  1IFP A;  2FYN B;  3L74 J;  4PV1 C;  1MFT A;  1GW4 A;  4R4L A;  2FYU J;  3H32 B;  1L0L D;  2C0X A;  2E75 B;  3K5B A;  2ZT9 C;  1FZC B;  2Y9Z A;  2A45 H;  5APY A;  1NTM E;  3KZI E;  2KLV A;  3RL0 D;  4XE5 B;  3Q1M A;  1VQP P;  1L0L G;  2Z5H A;  4DJG A;  3L74 D;  2ZXE B;  3GMA A;  1XTC C;  5C39 A;  2GM4 A;  2ZVO B;  2FYU D;  1M8O B;  5CCG C;  1SQX D;  2QE7 H;  3HTK A;  1KYO E;  1HVV A;  1KB9 I;  3PTZ A;  3CCJ P;  1OW7 A;  2JR8 A;  1YHQ P;  1ZW0 A;  1FDM A;  3L36 A;  3L74 G;  2OYH A;  2QJK B;  4IFM A;  1NO4 A;  1LTT C;  3M91 A;  2FYU G;  3TNU A;  1ZN5 A;  2OAR A;  2AXC A;  1SQX G;  4NPF X;  3Q5S A;  2Z4E A;  1FDO A;  2D2C D;  2KSE A;  4WY4 D;  1N2D C;  1Y47 A;  2JDI H;  3LID A;  2FFD B;  3AED C;  5KLI C;  2C9L Y;  3CPW O;  5AVU B;  3R4Y A;  1JCC A;  1M1J C;  3H1L J;  2FXO A;  4IFF A;  1OMI A;  1FOS F;  1OW8 A;  3BCC G;  4U7J A;  3GG2 A;  1JOC A;  1SFC C;  3A0H H;  3MHV A;  1LWU C;  2HFE D;  1VQN P;  5TIS H;  1EZV I;  3KHU A;  3TGU J;  1IK9 A;  2XV5 A;  3FXE A;  2R32 A;  4ASW A;  2W6B A;  5CCH A;  3TYY A;  1IFN A;  2K37 A;  2YMY A;  4UB6 E;  3EFF K;  1E79 H;  3H1L D;  3L37 A;  1AVO A;  1RQV A;  4IL6 H;  4ZNC A;  1GZL A;  2A06 D;  3IAO A;  1GU5 A;  1KFN A;  3GHG B;  3TGU D;  2OYI C;  4H13 B;  4JQ0 D;  1KOR A;  3PHL A;  2IFM A;  2ZJS E;  3MUD C;  1KC8 Q;  2FY8 A;  2HPC B;  3CCU P;  1JY2 N;  1RHZ B;  3RL0 C;  5BU5 A;  5KJ7 C;  2A06 G;  2WSF J;  3T97 A;  5KAF E;  3L72 J;  5H2F E;  1HH0 A;  3M0A A;  1AQT A;  1KB9 E;  3CX5 D;  2W6J H;  1NTK K;  1SQP K;  5BU8 B;  2JEE A;  2P10 A;  4ZKP A;  3L71 E;  2A45 I;  5KLV E;  3L72 D;  3CXH H;  3HD7 C;  1S4X A;  1KMI Z;  3AE1 C;  1KTM A;  2H8P D;  1GL2 C;  5B5E E;  1G2C B;  2BCC E;  1Q7Y Q;  3RK3 B;  3L72 G;  2J5U A;  3V2R A;  1EZV E;  1VQO P;  2ZVN B;  4BWN A;  2E75 C;  5B66 H;  1G1J A;  2ZAE B;  1HUC A;  4RES B;  4L75 A;  2YO3 A;  3O6Q A;  1FZC C;  3B71 A;  1URQ A;  3KYQ A;  2Q5U A;  1USE A;  1VQ5 P;  1EDK A;  1M1K Q;  2SPZ A;  3MZW B;  2H43 A;  1BCC G;  4HJG H;  1VQM P;  1OWA A;  2ZFC A;  1KFM A;  1YI2 P;  1IO4 A;  1PGQ A;  1A02 F;  3QH9 A;  3RK3 E;  3TDK A;  1L0N E;  2JJL A;  2QJK C;  2YMK A;  2GUV A;  1LT1 A;  1FBM A;  2E74 D;  3CCE P;  3D70 A;  5CCH D;  1UII A;  1SQV E;  2WSS H;  5CCG A;  3H1H J;  2N1T D;  4N6J A;  1MZ9 A;  3NMD A;  1NU1 E;  2XND H;  1NAF A;  3CC7 P;  1IFD A;  2HYN A;  1U57 A;  2WVR A;  1XTG B;  3QWO C;  2KUB A;  4PD4 D;  3BAS A;  3H1H D;  1Z56 A;  3G71 P;  3W67 A;  2Y0C A;  4D6T J;  2QJP B;  1AA0 A;  1LTJ A;  3AEE C;  3L73 E;  1J1E B;  1X79 B;  1SFC A;  2PRR A;  2WMM A;  3WU2 H;  1LTA C;  3Q5R A;  1FJP A;  2IYO A;  2I1J A;  2Q7C A;  1LTI C;  1SVF A;  2AEF A;  3CCV P;  1YTZ I;  3VMY A;  3GHG C;  4LC1 A;  1SS1 A;  1PP9 E;  1OX3 A;  4OGQ D;  3IF4 A;  1RF1 C;  5K5G B;  3VP8 A;  2W83 C;  5L8R J;  1NKN A;  2V7Q J;  2YO2 A;  4R4M A;  1YQ4 C;  2OYI A;  2RKL A;  2WSE J;  1WMK A;  4GIF A;  3MUD A;  2UWJ E;  3VTP C;  1W2E A;  4GOE A;  2HOD B;  4H44 B;  4PJ0 E;  2FKW B;  3CC2 P;  3A0B H;  5KJ7 A;  3CX5 H;  4WBA A;  1GD2 E;  3GW6 A;  2QJY C;  2QM7 A;  1YJ9 P;  1K73 Q;  5CCH C;  4ASV A;  1L4A B;  2AXT E;  3VP9 A;  4TT3 H;  4PV1 D;  3P8M C;  3CCS P;  3AE3 C;  5CBO A;  2N1T C;  3U1C A;  3G9R A;  3N4X A;  1NTZ K;  1PPJ G;  1QX8 A;  2BAS A;  3RK3 C;  1S9K D;  1BE3 J;  2O1J A;  3M9Q A;  1JTH A;  1WT6 A;  3HD7 A;  3CC4 P;  2R5D A;  2E76 B;  1GL2 A;  2QRX A;  1NU1 K;  3Q3D A;  2O01 J;  1LNQ A;  4WWI A;  5CCG D;  3B5N B;  3EFG A;  3O8Z A;  1HBW A;  3V6I A;  1BE3 D;  5APT A;  3H32 A;  3M9H A;  1PGJ A;  1OVV A;  4UB8 H;  2WPQ A;  1FZC A;  1IJD B;  3AE7 C;  1HGV A;  1BE3 G;  2KZJ A;  2MKV A;  3VMZ A;  3Q2Y A;  1FZF A;  2M5A A;  1Q2N A;  4JYB A;  1AVY A;  1U7J A;  4JYC A;  1P84 D;  2Q3I A;  1ZP0 C;  1FE6 A;  3CXH D;  3SWY A;  3VYI A;  2OTJ P;  3II6 A;  1SFC D;  1AJY A;  1SQB K;  1YJN P;  3L75 G;  4AQR D;  1X9V A;  3CMA P;  3RK2 C;  4Z1M H;  1Q82 Q;  5AVX B;  4HYT B;  1SQQ J;  3E7K A;  1KD1 Q;  2JWD A;  3JCU H;  1G1I A;  2O01 N;  2D2C B;  2WWW A;  4PD4 H;  2E5Y A;  3PH0 A;  1VDF A;  1SQX J;  2V4H A;  3M0D C;  5APS A;  4JPZ B;  5CHX A;  1NTK E;  1SQP E;  1H0T B;  1IFJ A;  2JKV A;  2KIK A;  3V2Q A;  1W5C E;  1SQQ D;  4EOT A;  5KJ7 D;  2Q3E A;  1U7M A;  1QEX A;  1FJK A;  2O3J A;  3CX5 I;  1NTM J;  3E1I A;  2KYV A;  4EI2 A;  1AQ5 A;  2HLO A;  1DX7 A;  1KV4 A;  3H1I G;  2IPP A;  2G8Y A;  2W8Z A;  3BCC J;  1NYH A;  3A2A A;  3H1J E;  2XZR A;  5AW4 B;  1SQQ G;  3C8V A;  3NXS A;  2CPS A;  5DJU B;  2YKP A;  5AVV B;  1JCD A;  4GOF A;  2R3S A;  4XA4 A;  3GHG A;  2OTL P;  3HE5 B;  1PGP A;  1NTM D;  2HPC A;  3HUS C;  1X0T A;  2CPB A;  3HD7 D;  3G3Z A;  1KQF B;  4YPC A;  5APQ A;  1KIL B;  3BCC D;  1RF1 A;  2OGU A;  4QMA A;  1GL2 D;  5APV A;  2M0B A;  1TU3 F;  2XU6 A;  5E79 E;  4Y99 B;  1NTM G;  3AE9 C;  1LTJ C;  1S5L X;  3ABV C;  1L4A C;  3I5C A;  1JY3 N;  4KT0 J;  2V7Q H;  2KLU A;  2PAJ A;  3H1L E;  5TJH A;  2E75 D;  2WSE H;  2NRG A;  4C7N B;  2P58 A;  1HTL C;  5KAI E;  1NJI Q;  3TK1 A;  3KXD A;  3TGU E;  2E76 C;  2ZYA A;  3WUT A;  2KOG A;  3BVH A;  1KIL E;  4JF7 A;  2N1T A;  3MGN A;  1DD4 A;  3EWK A;  2E5T A;  2PGD A;  4C46 A;  4TLF A;  2CK3 H;  5CJ4 A;  1FDI A;  1LP1 B;  2K9J A;  3PLN A;  4LLH A;  1L0L K;  5GTH H;  1GK6 A;  1S2E A;  5GTI H;  3CX5 E;  1GW3 A;  1IZN B;  4YTP C;  1Y8A A;  1KQG B;  2QSI A;  2MJZ A;  3OJA B;  2O01 H;  2R3C A;  2FYU K;  3AEC C;  3KDP B;  1R5L A;  4YXD C;  2WT7 A;  2C9N Y;  3CI9 A;  1P84 H;  1BCC J;  3TF5 A;  1N7S B;  1IC2 A;  3E1R A;  2QIW A;  1WRG A;  5KLV J;  1BSN A;  2POH A;  4CPG A;  2BEQ D;  3CWB E;  1M57 D;  2E74 B;  3JC2 2;  4H0L B;  3P8C E;  1KB9 D;  2JP3 A;  2BCC J;  2FYN C;  2Z5I A;  4JBZ A;  3SWF A;  3AE4 C;  3ZDM A;  1N73 B;  1BCC D;  1VPC A;  1ZV8 A;  2IZ0 A;  2KNC B;  1YJW P;  1JMB A;  1EDJ A;  3L71 D;  1GU4 A;  5KLV D;  1YQ3 C;  2P2U A;  1FOS E;  3BRT B;  3GF3 A;  4I7Z B;  2OYO A;  3MD0 A;  2N9B A;  4OVN F;  2ZYG A;  2BCC D;  4IL6 X;  1BSH A;  4BRY A;  3L71 G;  4W7Y A;  5KLV G;  3T97 B;  3M0D A;  1S5L E;  1ZXG A;  1QLE D;  1VQ9 P;  4C7R A;  1EZV D;  1X22 A;  2BCC G;  1NTZ E;  5DJT B;  2R44 A;  1L0N J;  3HE4 B;  3I56 P;  4GT1 A;  3S4R A;  1EZV G;  1KIL C;  3LIE A;  3KZI H;  3OAK A;  2FFD C;  1SQV J;  1M56 D;  3H1H E;  3KQG A;  1OIP A;  3H6P A;  3RK3 D;  3AEB C;  3H1K E;  2HOD A;  3HUS A;  1L0N D;  3V2P A;  1K04 A;  1T6A A;  1L2P A;  2W27 A;  1KYO H;  2KB7 P;  2WPR A;  3OA7 A;  5AW9 B;  1HGZ A;  1N8R Q;  1HF9 A;  1Q90 D;  2W90 A;  2QEX P;  1SQV D;  2OTK E;  4EYY Q;  3O6Q B;  1L0N G;  2LR2 A;  5EFW B;  1URQ B;  1VF5 B;  1L4A A;  3LW5 H;  5AVT B;  1AFO A;  1BGY E;  3D6Z A;  4D6T E;  4N3Y B;  3L73 J;  3VOP A;  3B4S A;  3M9B A;  4PV1 B;  1USD A;  1SQV G;  1N7L A;  1GMJ A;  2KS1 B;  1PL5 A;  4H13 C;  2ZT9 B;  2WIT A;  1P84 I;  1NU1 G;  2HG5 D;  4HB1 A;  1SQB E;  1YIT P;  5AW8 B;  1VQL P;  3CXH I;  3W68 A;  3G6E P;  2FYZ A;  1PP9 J;  4EIJ A;  1KZU B;  1VQ6 P;  3L73 D;  1PFI A;  4I2L C;  3CD6 P;  3F5H A;  1GDT A;  4UB6 H;  2WQY C;  2AEJ A;  5AVZ B;  3A0H E;  1UIX A;  4DZO A;  2M3B A;  3AE6 C;  2I8D A;  5KKZ B;  5TIS E;  4LGD E;  2YXQ B;  3L73 G;  2KSJ A;  1PP9 D;  2Q6Q A;  1Q86 Q;  2PP6 A;  3RK2 D;  1PPJ D;  1HJ0 A;  4NPD A;  4DCK A;  4U3F E;  1ZRT D;  1LTS C;  1MFZ A;  2B9B A;  3EQ2 A;  1S9K E;  1DIP A;  1N7S C;  4IL6 E;  3R2P A;  5CBN A;  1S1C X;  5AW2 B;  5KLI B;  3VN0 A;  2GA1 A;  1QGK B;  1PP9 G;  1FZG A;  2AEM A;  2NPS B;  4H0L C;  3S9O A;  5KAF H;  3WUU A;  4OH8 B;  5H2F H;  1QL2 A;  3V2N A;  1M1J B;  3L70 E;  1K8A Q;  2L91 A;  1KB9 H;  2WPS A;  1R8E A;  3SFD C;  1SFC B;  2K88 A;  1N73 C;  1LWU B;  4HKZ H;  3FXD A;  4HH2 A;  4B86 A;  1J2J B;  1NH4 A;  3HRN A;  1PIX A;  4O9B A;  3C9I A;  1Y9B A;  3C1L A;  3L75 J;  1X8Y A;  2P7J A;  1JY2 P;  1GK4 A;  5AW6 B;  5B5E H;  4W80 A;  4N78 E;  3FWN A;  1ZOY C;  2GUS A;  4GDO A;  2QVA A;  1H0T A;  1P84 E;  2OQQ A;  4K35 A;  2OYI B;  1RY3 A;  4H44 D;  1NWQ A;  3CXH E;  5AW1 B;  3A3Y B;  1VQ4 P;  2YNY A;  2Y9Y A;  1JO5 A;  2ZYD A;  3RL0 B;  3L75 D;  2IBZ D;  1LT9 B;  1L4A D;  3PP5 A;  1JEK A;  4GOD A;  1EQ7 A;  3IN6 A;  1CZQ A;  2IBZ G;  5B66 E;  3HE5 A;  3H1I J;  2DW3 A;  4W7Z A;  1L0L E;  1KIL A;  2E76 D;  2I1K A;  1JTH B;  4ZKU A;  2FFD A;  2LKM A;  5APX A;  1BDC A;  1T2K C;  4WY4 B;  1GL2 B;  1SLQ A;  4KJM A;  2QJP C;  3RGU A;  2QG4 A;  1EDI A;  1W2B O;  4EDF A;  3L74 E;  1YTZ T;  1J1E C;  3H1I D;  1H89 A;  4L76 A;  1DD3 A;  2FYU E;  2W6A A;  1SQX E;  1MKM A;  1NTK J;  1SQP J;  5APW A;  4A7P A;  4C7N A;  1RH5 B;  2JO1 A;  2XDJ A;  3GF7 A;  3P32 A;  1H8A A;  2B87 B;  1KQL A;  1FC2 C;  3FX0 A;  3CCL P;  5APU A;  3H1J J;  2M5A B;  3AEA C;  3BCC E;  5AVQ B;  2XNX A;  2KXP B;  2WSC H;  1NTK D;  1RE3 C;  1SQP D;  2PFX A;  1LP1 A;  1CI6 B;  2BEZ F;  3RBZ A;  2J58 A;  1CW5 A;  4H44 C;  1VQ8 P;  5KKZ C;  2KP8 A;  3LW5 J;  1R5S A;  3SFE C;  3CCR P;  1NTK G;  1SQP G;  3U1A A;  3B8E B;  3H1J D;  3I55 P;  1PV3 A;  3NFQ A;  3VMX A;  1KYO D;  3WU2 E;  1NKZ B;  3L4F A;  2IDB A;  4NPE A;  3H25 A;  5AVR B;  2NPS C;  3H1J G;  2A06 E; 
#chains in the Genus database with same CATH homology
 1SQX J;  3CWB J;  1BCC J;  1SQV J;  1SQB J;  3BCC J;  1BGY J;  1SQQ J;  4D6T J;  1BE3 J;  1L0N J;  3L71 J;  5KLV J;  1KB9 I;  1EZV I;  3L74 J;  1NTZ J;  4PD4 I;  1NU1 J;  3H1J J;  2IBZ I;  3TGU J;  1L0L J;  1P84 I;  1NTK J;  1SQP J;  3L75 J;  3CX5 I;  3H1H J;  3L72 J;  1KYO I;  4U3F J;  1NTM J;  2FYU J;  3CXH I;  3L70 J;  2BCC J;  3H1L J;  3H1I J;  3H1K J;  3L73 J;  1PP9 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...