1BCCJ

Cytochrome bc1 complex from chicken
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
59
structure length
59
Chain Sequence
TLTARLYSLLFRRTSTFALTIVVGALLFERAFDQGADAIYEHINEGKLWKHIKHKYENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 23
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1bccJ00
3CWBJ 2FYUJ 3H1JJ 3CX5I 3L73J 3H1HJ 1BCCJ 3H1LJ 3TGUJ 4D6TJ 1SQBJ 1KYOI 3L71J 1NTKJ 3L72J 1NTMJ 1KB9I 2BCCJ 3L70J 3L75J 1NU1J 1BGYJ 1SQPJ 4U3FJ 1BE3J 3L74J 1PP9J 2IBZI 1P84I 4PD4I 1SQVJ 1EZVI 1SQXJ 3CXHI 1NTZJ 3H1KJ 5KLVJ 1L0LJ 1SQQJ 3BCCJ 3H1IJ 1L0NJ
chains in the Genus database with same CATH superfamily
3H1HE 1VQ5P 3N7NA 4IL6X 1GTWA 1NTMG 1YIJP 3CCUP 4C7NA 3I55P 5CCHA 3MUDC 1FZEA 4K3AA 3RBZA 1T2KD 5TJHA 1PZQA 2WPSA 1GK4A 1BGYE 2ZVNB 3L74E 4GIFA 2IFNA 3T97A 3V2RA 3RL0D 2IPPA 1KYOE 4EOTA 2LXBA 2WTYA 1NAFA 1XTCC 2WT7B 1EZVE 5EFWB 1KTMA 2HYNA 1NTKK 2UWJE 3L4FA 4QMAA 4HH2A 1SQPK 1KC8Q 5AW1B 4PJ0H 3T97B 2G8YA 3A0HE 3D6YA 4LLHA 3PJSK 1JTHA 3P7KA 2W90A 5AVQB 2YXQB 1JEKA 1HTLC 1SQQD 3VMYA 3HRNA 1H88A 1K8AQ 1JM0A 3CWBG 1JY3O 3TGUD 1Q81Q 1AQTA 4DJGA 3CCRP 1FOSE 3TF5A 4L76A 1SQXD 3A3YB 4HJGH 3AE1C 4ZKUA 2P1JA 2OTKE 2RMZA 4AUWA 4W7ZA 1S2EA 1GL2C 3RK3D 3K5BA 2Y9ZA 1NTMD 1IFPA 2IBZG 3C8VA 1IFDA 1NTKJ 1NU1G 1U7MA 2FXOA 1HBWA 1SQPJ 4TT3H 2YKQA 3V5BA 2KK7A 2Q6QA 5KLVK 1GL2B 4BWNA 1T2KC 3CMAP 1LJ2A 1KORA 1M8OB 1PIXA 1SP4A 2OYHC 2A45G 5KAIH 2A06E 1H89A 3AE6C 4RJTA 1MFTA 1LT1A 3VYIA 5CJ0A 2E42A 3VOPA 3Q5PA 1M90Q 5GTIE 3E1RA 3SFEC 3QH9A 1N73A 1L4AA 5APVA 2J59M 2KZJA 2POHA 1LTTC 5CCGA 2OYHB 1VL2A 2N1TC 1ZRTD 2WSEJ 3LIDA 2NPSD 1BSNA 2E5TA 1HH0A 1S1CX 2JP3A 4W7YA 4EYYQ 3KZIE 2FBWC 1QX8A 2Q3IA 2KS1A 1USEA 3IR9A 4GDOA 1SQBG 2M5AA 2N1TB 2OARA 2YKOA 4BRYB 2V7QJ 2BCCG 2KP8A 2ITAA 5B5EE 1MZ9A 2GUVA 1NGMB 3CWBD 2FXPA 3H25A 5KLVJ 1YJNP 1OWAA 3N4XA 2PFXA 1NTKE 5E79H 3OAKA 4UB8E 3L72G 1SQPE 3PLNA 2M3EA 2M0BA 4N6JA 3L37A 5CBOA 1S5LH 5TISH 2HG5D 2IBZD 1H0TA 1NU1D 2WZ7A 3M0DA 3L70G 2K9JA 3AE9C 3LW5H 2D2CC 2K9YA 4XA4A 5B66H 1JY2O 1G2CB 2YMKA 1D7MA 1VQ8P 2AXCA 3TSIA 2P67A 3A5TA 3HE4A 1GW3A 1W2BO 1NAYA 2D2CB 3U59A 1HGVA 3VMZA 5KJ7D 3KQGA 2KLUA 4JYBA 1CI6A 2C0XA 2QJYC 2NPSC 1LTBC 1VQ6P 1WMKA 2Z5HA 2HFED 1X79B 5KLVE 3O6QA 3MZWB 2YMYA 2Y9YA 3HE4B 1JO5A 1QVGO 3WU2H 1VQ4P 2XNDH 1YITP 3FWNA 1SQBD 2W8ZA 2CPSA 1PGPA 2BASA 2BCCD 2NPSB 1IFMA 1NYHA 1NO4A 2YIUC 3B5NA 3S4RA 3TNUA 1VQ7P 3VMAA 2W27A 2H88C 3AEBC 3L73E 1VQ9P 1L0NK 5DJUB 2Q7CA 3L72D 2R44A 3IF4A 1YTZT 1LWUA 1PFIA 2YIUB 2AXTE 1K9MQ 3L71J 1RF1C 4H13C 2CK3H 1S5LX 3TNUB 2JKVA 3G6EP 1JY3N 3HD7D 1LT9C 1PPJD 4OGQD 3F5HA 2NZ2A 1ZXGA 3AEAC 5AVUB 1T8ZA 1SLQA 3VMXA 4H13B 1HWTC 2E74C 2J58A 1VQMP 1M1JA 1M7LA 4IFMA 3GHGC 3VTPC 3H32B 3BVHA 1FAVA 1NTZK 1URQD 2KZIA 4PV1C 1N7SA 2HODA 5CHXA 2JO1A 3H1LJ 1PGOA 2E74B 4U3FE 1K05A 1FDIA 5AVZB 3VP9A 3GHGB 5KJ7C 3RGUA 1TU3F 4U7JA 1PP9J 1L0ND 3H1IG 3TYYA 4PV1B 2YKPA 3IFMA 1L0NJ 2R5BA 5CJ4A 4R4LA 5KTBA 3QWOC 1R8EA 2Z5IA 2O01J 2OYIC 1KV4A 1FDOA 5AVSB 2M8RA 2HODB 2NRGA 3V2QA 1WRGA 1VQOP 1K73Q 2E76C 2MKVA 1PL5A 3H1JE 1AVYA 3V4QA 2OYIB 4WY4C 3CX5I 3L71E 2SPZA 3CXHD 2ZXEB 1A02F 1S9KD 1OXZA 1KB9H 2WPRA 2QRXA 3U1AA 3MGNA 2E76B 3PRJA 1FZCA 1KILD 5AW5B 5AVRB 1NTZJ 4NPFX 1LTJC 1S3JA 3I56P 2I8DA 1SFCA 4WY4B 1PPJE 1OVUA 3AE7C 3HTKB 4MN4C 1GZLA 1BDDA 2KLVA 2ZVOB 3A0BH 2WSFJ 2ZFCA 1LTJB 1KB9D 4JF7A 3H1LE 4WB4A 1P84D 3CC7P 1QLED 4D6TJ 1PP9E 5APSA 1OMIA 3L75G 5CBNA 3M9BA 1URQC 5APQA 2IDBA 3FWLA 5BVZA 1OW8A 2LXCB 4NPDA 1BCCJ 3B71A 1MFZA 5KKZB 1OW7A 2Q9IA 3I5CA 1FJKA 3H1ID 1URQB 3IAOA 1UIXA 1Q82Q 3MUDA 3KPEA 1MV8A 1SQQK 1JY2N 2WT7A 3PTZA 4O9BA 1EDIA 2QSIA 1R5SA 2XU6A 2RN0A 1YJ9P 1KFNA 1NTZE 5DJTB 3CX5E 4Y99C 3W67A 1ZP0C 1SQXK 2WPQA 1QVFO 4I1LA 4LGDE 1QEXA 1MKMA 3CC4P 2RKLA 2ZJSE 1E5WA 5GTIH 1NTMK 1KILC 2K88A 1A02J 4Y99B 2Q3EA 3BCCG 2KNCB 2K37A 3L36A 1L2PA 1MUUA 3HE5B 5H2FE 3KZIH 4D6TE 2V4HA 1YQ4C 1JY3P 3SFDC 3EQ2A 3CPWO 4WVZA 1IFNA 2P7JA 1KILB 5CCGD 2HPCB 4PD4H 1FZBA 3CCVP 1LTAC 1SQQJ 2O01N 1XTGB 3NMDA 5B5EH 3SSUA 2HR3A 1BCCE 3EWKA 4IFFA 1JCCA 1J2JB 1LTIC 2K3RA 2H89C 3TGUJ 3L75D 5KLIC 3L75J 1LP1B 4UB8H 3A2AA 4XE5B 2OGUA 1GL2A 1SQXJ 1CSBA 2FXMA 1RE4C 4PD4D 4H44D 1K04A 1BE3G 1NTMJ 4YTPC 1ZN5A 1GDTA 3OA7A 3KHUA 1AA0A 1IFIA 2XZRA 2G3AA 2QA4P 2OYHA 2GA1A 3E7KA 5KAFH 2OTLP 1JCDA 3H1KG 3RL0C 2FYUG 3BRVB 4DT0A 3L35A 2C9NY 4Y28J 2N1TA 1DX7A 4BRYA 2BEZF 2ZT9D 1NHLA 3D70A 4IOIH 2V7QH 4ASWA 2MJZA 3BCCD 1NU1K 3RL0B 1SQQE 3AECC 2GUSA 1L0LG 4KT0J 3USSA 1ZMEC 4N78D 3Q2YA 3TGUE 3Q1MA 1JB0J 4I7ZC 3BRTB 1SVFA 4ZMDA 4EDFA 1SQXE 2FYZA 3BASA 3B4SA 1SQVG 1RE3C 1OIPA 4AYCA 2Z4EA 4H0LD 2QG4A 4UB6E 4OWFA 3CWBJ 1VQNP 2E75D 3RK3E 2Y0EA 1NTME 1YI2P 3GG2A 1HF9A 4CPGA 4GKGA 1AJYA 1Q2NA 3V6IA 3SWFA 1KD1Q 2B87A 3HUSC 1W5CE 2YO3A 2IBZI 3R2PA 1FZFA 2JDIH 3B5ND 3AEGC 4GOEA 3H1JG 1G2CA 3FXDA 3RK3C 1JUNA 3CCLP 4H44C 1BE3D 1JY2P 1VQLP 1RF0C 3CCQP 3HUSB 1SQBK 5AW2B 3RL0g 1NU1J 1M57D 2IYPA 2CPBA 1WT6A 1HJ0A 2B87B 2A45I 3LIEA 3RBXA 3RK3B 1N7LA 1FE6A 1DD3A 2KI7B 3AE5C 4H44B 2FFDC 3FX0A 3CCMP 3PH0A 2W83C 2QM8A 3II6A 1ZRTE 3H1KD 2M3BA 2FYUD 2JJLA 2QJPC 3Q3DA 2IZ0A 2FY8A 3KXDA 5BU5A 2NPSA 2FFDB 2ZT9C 1N7SD 3LW5J 1L0LD 2XV5A 2IYOA 1IFJA 2QJPB 2WMMA 3CWBE 2XDJA 1L0LJ 1KQLA 1QGKB 3H1HG 3RK2D 2JEEA 2QJYB 1OZHA 4RESB 1SQBJ 1G1JA 1SQVD 2BCCJ 4RO0A 1H8AA 1ZV8A 2IFMA 3FGAD 4RKUJ 1FDMA 3MTUE 4Z1MH 1JMBA 1QL1A 1RF1A 2IBZE 2LKMA 1NU1E 2O3JA 3L72J 1BGYG 3L74G 3M9QA 2O1KA 1LT9A 3H32A 1VDFA 3S9OA 1LTGC 1NOHA 4WBAA 2KUBA 3L70D 1KMIZ 3GHGA 1SFCD 1RF1B 1EZVG 2W6AA 3L70J 3P8CD 3JCUE 3WUUA 1LT9B 1Y47A 3CC2P 4WWIA 2WITA 5KJ7A 3G71P 3CD6P 3OJAB 4ASVA 3B8EB 2WPVB 5AW4B 5AW8B 2WSCH 5AW7B 4YXDC 2OYIA 2E43A 2C9LY 2ZYGA 1FC2C 4I2LC 1SQBE 2N9BA 4JBZA 3EFGA 2BCCE 1Q86Q 3GF7A 1KQFB 1BSHA 3IN6A 2IZ1A 3CXHI 4WY4A 3H1HD 1JMMA 3HTKA 3CX5H 1ZOYC 1FZAA 5K5GB 3L72E 3H1HJ 1J1EC 4I6MC 1UIIA 1KYOH 1JNMA 3WU2E 5CCHD 2B89A 1LTJA 2R32A 2GM4A 4OH8B 1IZNB 4GT1A 2W6JH 1J1EB 1J1DC 1BGYD 5BU8B 2WVRA 3L74D 3A0HH 5AW9B 1KB9I 1DEEG 2A06G 1P84I 1RQUA 3HD7C 4OGQC 1J1DB 1EZVD 2Y0DA 3ABVC 4IFDK 1AFOA 1FS0E 3D71A 3WMM0 3CI9A 1URQA 3HD7B 1LNQA 2XNXA 1L0NE 4OGQB 1YBKA 2OTJP 3P8MC 2QEXP 1VF5D 1FJPA 4NPEA 3MHVA 3SWYA 1IK7A 5AVWB 3OW2O 3CCEP 1IO4A 2YXRB 5AW3B 1S4XA 3H1IJ 1GL2D 1ZW0A 2B9BA 1NH4A 2IX7C 4IL6E 3CXHE 1NTKG 1S9KE 3CMEP 2WQYC 3E1IA 2L91A 1SQPG 3H6PA 1Q7YQ 2R5DA 2KNCA 3M9HA 4M3LA 1ZLLA 3FXEA 1KILE 3HE5A 1DEBA 2ZYAA 2W6BA 1GD2E 1KILA 2AEFA 5CCHC 1ZR4A 2HPCA 1X22A 2KIKA 1KB9E 3U1CA 4C7NB 1P84E 1LP1A 3WUVA 2A06D 2N1TD 5APXA 1NKZB 3GW6A 1VQPP 1L4AD 2J5UA 4DOJA 3O8ZA 3AE8C 1X0TA 3EFFK 1T3JA 2PAJA 5GTHE 3Q5SA 2H8PD 1G1IA 4UB6H 4C7RA 3A0BE 4PD4I 3H1IE 5KLVG 2FKWB 1Y9BA 2PGDA 1RE4A 3BATA 5AW0B 3AEEC 1VF5C 3VP8A 5KLIB 1JTHB 2QE7H 2AEMA 3MP7B 2LR2A 2P10A 2ZXXA 2R3CA 3AE2C 2P2UA 3CL3D 2QIWA 1W2EA 2I1JA 3JC22 1VF5B 2WSSH 1NTKD 4OVNF 3V2NA 3L73G 1SQPD 3S1KA 4JYCA 2I1KA 2WSEH 3M06A 2D2CD 1OVVA 1RQVA 1GK6A 2E5YA 1FU1A 2KXPB 3CLQA 3M91A 3GLMA 4YPCA 3MD0A 3NXSA 3TK1A 1USDA 2C0WA 1R5LA 2ZYDA 1GMJA 3BCCJ 1LGHB 1DD4A 4C46A 2H7HA 2K1AA 3L75E 1RE3A 1N73C 4ZKPA 1L4AC 3C1LA 2L5GB 4U3FG 4PJ0E 4BXLA 5CCGC 5APYA 1EQ7A 1OVRA 2Y0CA 2YNYA 2B88A 1HJBA 4I7ZB 1IK9A 2FYUK 5AVTB 4PD4E 2Q1KA 3HUSA 1N73B 1L4AB 1IJDB 5KLVD 5AVVB 2KYVA 4R4MA 2AXTH 1T3UA 1L0LK 4EIJA 3VN0A 1CZQA 3M0AA 1RF0A 3V4WA 2KS1B 4JQ0D 1N86A 1GU4A 3A7OA 3L71G 2M5AB 1OFCX 4H13D 1BE3J 1ZR2A 2R3SA 2A45H 4L74A 1SQVK 2OYOA 3AE3C 3L73D 2FFDA 1PPJG 3JCUH 3L73J 2ZAEB 2QJKC 3WUTA 2PRRA 5M1BA 1KN7A 3ZDMA 1EDJA 2QVAA 2E74D 5APTA 1IC2A 3BCCE 3M0DC 2BEQD 3H1KJ 5C39A 3UIAA 2JWAA 4JPZB 4TLFA 1EC5A 2JWDA 2FYUJ 5KAFE 4N78E 1OX3A 1NWQA 4PV1D 5KAIE 2QJKB 3G3ZA 3H1LG 1H0TB 5CMZA 1DIPA 2KB7P 1PP9G 2KSJA 1EXIA 2K9JB 2P58A 5AVXB 2DW3A 2PP6A 1CW5A 1HGZA 5L8RJ 1NKNA 3GMAA 1L0NG 3ITKA 3MIWA 3NFQA 2ZT9B 3R4YA 4U3FD 3PP5A 1M56D 2VRSA 4U3FJ 1GU5A 1HUCA 4KJMA 1KQSO 4DZOA 1SQVJ 2E76D 4H0LC 1YHQP 2YO2A 4GOFA 3G4SP 2E75C 1CI6B 4XFJA 4WY4D 1VPCA 1VQKP 1BE3E 1RHZB 1YQ3C 4W80A 1FBMA 4H0LB 2H43A 1NTZG 1AVOA 3B5NC 3H1JD 3O6QB 1QL2A 4KHXA 5E79E 4A7PA 2KOGA 1PGJA 2E75B 4LC1A 3H1JJ 1Q90D 3L71D 4N3YB 2WWWA 4DCKA 1S5LE 1LWUC 1YTZI 3H1KE 1E79H 3B5NB 5TISE 1N8RQ 2FYUE 1LTSC 4K35A 1NJIQ 2OQQA 1N2DC 4GODA 4HKZH 4B86A 1JOCA 1SS1A 4D6TG 2O01H 4L75A 1LWUB 1AV1A 3Q5RA 1M1KQ 3GF3A 5B66E 1U7JA 1L0LE 3CCJP 3F89A 3CCSP 1M1JC 3H1LD 1X8YA 2Q5UA 1FOSF 1BCCG 1PP9D 1RY3A 1N7SC 1DH3A 1SQVE 3TDKA 4IL6H 1U57A 3CXHH 1M1JB 1RH5B 1T6AA 5APUA 1AQ5A 4ZNCA 3KYQA 1EDLA 3RK2C 2HLOA 1N7SB 1NVOA 2FYNC 1KQGB 2AEJA 3SWKA 2WSCJ 3P32A 3PHLA 1KZUB 2WSFH 1YJWP 2QM7A 3RK2B 1Y8AA 5AVYB 3L70E 1KYOI 5H2FH 2FYNB 1NTZD 1P84H 1BGYJ 5APWA 1S72P 3L74J 3HD7A 3CX5D 1EZVI 3P8CE 1KYOD 2KSEA 4HYTB 2RH0A 3NTNA 1FZCC 3V2PA 1EXJA 1KFMA 1PGQA 1BDCA 1HVVA 1SFCC 3JSVC 2XKMA 1EDKA 1GW4A 3W68A 5GTHH 4YXWH 1SQQG 3C9IA 3AEDC 1FZCB 3KDPB 4D6TD 4AQRD 3AEFC 1PV3A 3TGUG 1SFCB 1YYCA 3G9RA 1FZGA 3D6ZA 1X9VA 2N9YB 2JR8A 2O1JA 4L73A 5KKZC 1OW6A 1SQXG 4HB1A 5AW6B 4EI2A 3AE4C 1BCCD 1Z56A
chains in the Genus database with same CATH topology
3CWBJ 2FYUJ 3H1JJ 3CX5I 3L73J 3H1HJ 1BCCJ 3H1LJ 3TGUJ 4D6TJ 1SQBJ 1KYOI 3L71J 1NTKJ 3L72J 1NTMJ 1KB9I 2BCCJ 3L70J 3L75J 1NU1J 1BGYJ 1SQPJ 4U3FJ 1BE3J 3L74J 1PP9J 2IBZI 1P84I 4PD4I 1SQVJ 1EZVI 1SQXJ 3CXHI 1NTZJ 3H1KJ 5KLVJ 1L0LJ 1SQQJ 3BCCJ 3H1IJ 1L0NJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWB J;  2FYU J;  3H1J J;  3CX5 I;  3L73 J;  3H1H J;  1BCC J;  3H1L J;  3TGU J;  4D6T J;  1SQB J;  1KYO I;  3L71 J;  1NTK J;  3L72 J;  1NTM J;  1KB9 I;  2BCC J;  3L70 J;  3L75 J;  1NU1 J;  1BGY J;  1SQP J;  4U3F J;  1BE3 J;  3L74 J;  1PP9 J;  2IBZ I;  1P84 I;  4PD4 I;  1SQV J;  1EZV I;  1SQX J;  3CXH I;  1NTZ J;  3H1K J;  5KLV J;  1L0L J;  1SQQ J;  3BCC J;  3H1I J;  1L0N J; 
#chains in the Genus database with same CATH topology
 3H1H E;  1VQ5 P;  3N7N A;  4IL6 X;  1GTW A;  1NTM G;  1YIJ P;  3CCU P;  4C7N A;  3I55 P;  5CCH A;  3MUD C;  1FZE A;  4K3A A;  3RBZ A;  1T2K D;  5TJH A;  1PZQ A;  2WPS A;  1GK4 A;  1BGY E;  2ZVN B;  3L74 E;  4GIF A;  2IFN A;  3T97 A;  3V2R A;  3RL0 D;  2IPP A;  1KYO E;  4EOT A;  2LXB A;  2WTY A;  1NAF A;  1XTC C;  2WT7 B;  1EZV E;  5EFW B;  1KTM A;  2HYN A;  1NTK K;  2UWJ E;  3L4F A;  4QMA A;  4HH2 A;  1SQP K;  1KC8 Q;  5AW1 B;  4PJ0 H;  3T97 B;  2G8Y A;  3A0H E;  3D6Y A;  4LLH A;  3PJS K;  1JTH A;  3P7K A;  2W90 A;  5AVQ B;  2YXQ B;  1JEK A;  1HTL C;  1SQQ D;  3VMY A;  3HRN A;  1H88 A;  1K8A Q;  1JM0 A;  3CWB G;  1JY3 O;  3TGU D;  1Q81 Q;  1AQT A;  4DJG A;  3CCR P;  1FOS E;  3TF5 A;  4L76 A;  1SQX D;  3A3Y B;  4HJG H;  3AE1 C;  4ZKU A;  2P1J A;  2OTK E;  2RMZ A;  4AUW A;  4W7Z A;  1S2E A;  1GL2 C;  3RK3 D;  3K5B A;  2Y9Z A;  1NTM D;  1IFP A;  2IBZ G;  3C8V A;  1IFD A;  1NTK J;  1NU1 G;  1U7M A;  2FXO A;  1HBW A;  1SQP J;  4TT3 H;  2YKQ A;  3V5B A;  2KK7 A;  2Q6Q A;  5KLV K;  1GL2 B;  4BWN A;  1T2K C;  3CMA P;  1LJ2 A;  1KOR A;  1M8O B;  1PIX A;  1SP4 A;  2OYH C;  2A45 G;  5KAI H;  2A06 E;  1H89 A;  3AE6 C;  4RJT A;  1MFT A;  1LT1 A;  3VYI A;  5CJ0 A;  2E42 A;  3VOP A;  3Q5P A;  1M90 Q;  5GTI E;  3E1R A;  3SFE C;  3QH9 A;  1N73 A;  1L4A A;  5APV A;  2J59 M;  2KZJ A;  2POH A;  1LTT C;  5CCG A;  2OYH B;  1VL2 A;  2N1T C;  1ZRT D;  2WSE J;  3LID A;  2NPS D;  1BSN A;  2E5T A;  1HH0 A;  1S1C X;  2JP3 A;  4W7Y A;  4EYY Q;  3KZI E;  2FBW C;  1QX8 A;  2Q3I A;  2KS1 A;  1USE A;  3IR9 A;  4GDO A;  1SQB G;  2M5A A;  2N1T B;  2OAR A;  2YKO A;  4BRY B;  2V7Q J;  2BCC G;  2KP8 A;  2ITA A;  5B5E E;  1MZ9 A;  2GUV A;  1NGM B;  3CWB D;  2FXP A;  3H25 A;  5KLV J;  1YJN P;  1OWA A;  3N4X A;  2PFX A;  1NTK E;  5E79 H;  3OAK A;  4UB8 E;  3L72 G;  1SQP E;  3PLN A;  2M3E A;  2M0B A;  4N6J A;  3L37 A;  5CBO A;  1S5L H;  5TIS H;  2HG5 D;  2IBZ D;  1H0T A;  1NU1 D;  2WZ7 A;  3M0D A;  3L70 G;  2K9J A;  3AE9 C;  3LW5 H;  2D2C C;  2K9Y A;  4XA4 A;  5B66 H;  1JY2 O;  1G2C B;  2YMK A;  1D7M A;  1VQ8 P;  2AXC A;  3TSI A;  2P67 A;  3A5T A;  3HE4 A;  1GW3 A;  1W2B O;  1NAY A;  2D2C B;  3U59 A;  1HGV A;  3VMZ A;  5KJ7 D;  3KQG A;  2KLU A;  4JYB A;  1CI6 A;  2C0X A;  2QJY C;  2NPS C;  1LTB C;  1VQ6 P;  1WMK A;  2Z5H A;  2HFE D;  1X79 B;  5KLV E;  3O6Q A;  3MZW B;  2YMY A;  2Y9Y A;  3HE4 B;  1JO5 A;  1QVG O;  3WU2 H;  1VQ4 P;  2XND H;  1YIT P;  3FWN A;  1SQB D;  2W8Z A;  2CPS A;  1PGP A;  2BAS A;  2BCC D;  2NPS B;  1IFM A;  1NYH A;  1NO4 A;  2YIU C;  3B5N A;  3S4R A;  3TNU A;  1VQ7 P;  3VMA A;  2W27 A;  2H88 C;  3AEB C;  3L73 E;  1VQ9 P;  1L0N K;  5DJU B;  2Q7C A;  3L72 D;  2R44 A;  3IF4 A;  1YTZ T;  1LWU A;  1PFI A;  2YIU B;  2AXT E;  1K9M Q;  3L71 J;  1RF1 C;  4H13 C;  2CK3 H;  1S5L X;  3TNU B;  2JKV A;  3G6E P;  1JY3 N;  3HD7 D;  1LT9 C;  1PPJ D;  4OGQ D;  3F5H A;  2NZ2 A;  1ZXG A;  3AEA C;  5AVU B;  1T8Z A;  1SLQ A;  3VMX A;  4H13 B;  1HWT C;  2E74 C;  2J58 A;  1VQM P;  1M1J A;  1M7L A;  4IFM A;  3GHG C;  3VTP C;  3H32 B;  3BVH A;  1FAV A;  1NTZ K;  1URQ D;  2KZI A;  4PV1 C;  1N7S A;  2HOD A;  5CHX A;  2JO1 A;  3H1L J;  1PGO A;  2E74 B;  4U3F E;  1K05 A;  1FDI A;  5AVZ B;  3VP9 A;  3GHG B;  5KJ7 C;  3RGU A;  1TU3 F;  4U7J A;  1PP9 J;  1L0N D;  3H1I G;  3TYY A;  4PV1 B;  2YKP A;  3IFM A;  1L0N J;  2R5B A;  5CJ4 A;  4R4L A;  5KTB A;  3QWO C;  1R8E A;  2Z5I A;  2O01 J;  2OYI C;  1KV4 A;  1FDO A;  5AVS B;  2M8R A;  2HOD B;  2NRG A;  3V2Q A;  1WRG A;  1VQO P;  1K73 Q;  2E76 C;  2MKV A;  1PL5 A;  3H1J E;  1AVY A;  3V4Q A;  2OYI B;  4WY4 C;  3CX5 I;  3L71 E;  2SPZ A;  3CXH D;  2ZXE B;  1A02 F;  1S9K D;  1OXZ A;  1KB9 H;  2WPR A;  2QRX A;  3U1A A;  3MGN A;  2E76 B;  3PRJ A;  1FZC A;  1KIL D;  5AW5 B;  5AVR B;  1NTZ J;  4NPF X;  1LTJ C;  1S3J A;  3I56 P;  2I8D A;  1SFC A;  4WY4 B;  1PPJ E;  1OVU A;  3AE7 C;  3HTK B;  4MN4 C;  1GZL A;  1BDD A;  2KLV A;  2ZVO B;  3A0B H;  2WSF J;  2ZFC A;  1LTJ B;  1KB9 D;  4JF7 A;  3H1L E;  4WB4 A;  1P84 D;  3CC7 P;  1QLE D;  4D6T J;  1PP9 E;  5APS A;  1OMI A;  3L75 G;  5CBN A;  3M9B A;  1URQ C;  5APQ A;  2IDB A;  3FWL A;  5BVZ A;  1OW8 A;  2LXC B;  4NPD A;  1BCC J;  3B71 A;  1MFZ A;  5KKZ B;  1OW7 A;  2Q9I A;  3I5C A;  1FJK A;  3H1I D;  1URQ B;  3IAO A;  1UIX A;  1Q82 Q;  3MUD A;  3KPE A;  1MV8 A;  1SQQ K;  1JY2 N;  2WT7 A;  3PTZ A;  4O9B A;  1EDI A;  2QSI A;  1R5S A;  2XU6 A;  2RN0 A;  1YJ9 P;  1KFN A;  1NTZ E;  5DJT B;  3CX5 E;  4Y99 C;  3W67 A;  1ZP0 C;  1SQX K;  2WPQ A;  1QVF O;  4I1L A;  4LGD E;  1QEX A;  1MKM A;  3CC4 P;  2RKL A;  2ZJS E;  1E5W A;  5GTI H;  1NTM K;  1KIL C;  2K88 A;  1A02 J;  4Y99 B;  2Q3E A;  3BCC G;  2KNC B;  2K37 A;  3L36 A;  1L2P A;  1MUU A;  3HE5 B;  5H2F E;  3KZI H;  4D6T E;  2V4H A;  1YQ4 C;  1JY3 P;  3SFD C;  3EQ2 A;  3CPW O;  4WVZ A;  1IFN A;  2P7J A;  1KIL B;  5CCG D;  2HPC B;  4PD4 H;  1FZB A;  3CCV P;  1LTA C;  1SQQ J;  2O01 N;  1XTG B;  3NMD A;  5B5E H;  3SSU A;  2HR3 A;  1BCC E;  3EWK A;  4IFF A;  1JCC A;  1J2J B;  1LTI C;  2K3R A;  2H89 C;  3TGU J;  3L75 D;  5KLI C;  3L75 J;  1LP1 B;  4UB8 H;  3A2A A;  4XE5 B;  2OGU A;  1GL2 A;  1SQX J;  1CSB A;  2FXM A;  1RE4 C;  4PD4 D;  4H44 D;  1K04 A;  1BE3 G;  1NTM J;  4YTP C;  1ZN5 A;  1GDT A;  3OA7 A;  3KHU A;  1AA0 A;  1IFI A;  2XZR A;  2G3A A;  2QA4 P;  2OYH A;  2GA1 A;  3E7K A;  5KAF H;  2OTL P;  1JCD A;  3H1K G;  3RL0 C;  2FYU G;  3BRV B;  4DT0 A;  3L35 A;  2C9N Y;  4Y28 J;  2N1T A;  1DX7 A;  4BRY A;  2BEZ F;  2ZT9 D;  1NHL A;  3D70 A;  4IOI H;  2V7Q H;  4ASW A;  2MJZ A;  3BCC D;  1NU1 K;  3RL0 B;  1SQQ E;  3AEC C;  2GUS A;  1L0L G;  4KT0 J;  3USS A;  1ZME C;  4N78 D;  3Q2Y A;  3TGU E;  3Q1M A;  1JB0 J;  4I7Z C;  3BRT B;  1SVF A;  4ZMD A;  4EDF A;  1SQX E;  2FYZ A;  3BAS A;  3B4S A;  1SQV G;  1RE3 C;  1OIP A;  4AYC A;  2Z4E A;  4H0L D;  2QG4 A;  4UB6 E;  4OWF A;  3CWB J;  1VQN P;  2E75 D;  3RK3 E;  2Y0E A;  1NTM E;  1YI2 P;  3GG2 A;  1HF9 A;  4CPG A;  4GKG A;  1AJY A;  1Q2N A;  3V6I A;  3SWF A;  1KD1 Q;  2B87 A;  3HUS C;  1W5C E;  2YO3 A;  2IBZ I;  3R2P A;  1FZF A;  2JDI H;  3B5N D;  3AEG C;  4GOE A;  3H1J G;  1G2C A;  3FXD A;  3RK3 C;  1JUN A;  3CCL P;  4H44 C;  1BE3 D;  1JY2 P;  1VQL P;  1RF0 C;  3CCQ P;  3HUS B;  1SQB K;  5AW2 B;  3RL0 g;  1NU1 J;  1M57 D;  2IYP A;  2CPB A;  1WT6 A;  1HJ0 A;  2B87 B;  2A45 I;  3LIE A;  3RBX A;  3RK3 B;  1N7L A;  1FE6 A;  1DD3 A;  2KI7 B;  3AE5 C;  4H44 B;  2FFD C;  3FX0 A;  3CCM P;  3PH0 A;  2W83 C;  2QM8 A;  3II6 A;  1ZRT E;  3H1K D;  2M3B A;  2FYU D;  2JJL A;  2QJP C;  3Q3D A;  2IZ0 A;  2FY8 A;  3KXD A;  5BU5 A;  2NPS A;  2FFD B;  2ZT9 C;  1N7S D;  3LW5 J;  1L0L D;  2XV5 A;  2IYO A;  1IFJ A;  2QJP B;  2WMM A;  3CWB E;  2XDJ A;  1L0L J;  1KQL A;  1QGK B;  3H1H G;  3RK2 D;  2JEE A;  2QJY B;  1OZH A;  4RES B;  1SQB J;  1G1J A;  1SQV D;  2BCC J;  4RO0 A;  1H8A A;  1ZV8 A;  2IFM A;  3FGA D;  4RKU J;  1FDM A;  3MTU E;  4Z1M H;  1JMB A;  1QL1 A;  1RF1 A;  2IBZ E;  2LKM A;  1NU1 E;  2O3J A;  3L72 J;  1BGY G;  3L74 G;  3M9Q A;  2O1K A;  1LT9 A;  3H32 A;  1VDF A;  3S9O A;  1LTG C;  1NOH A;  4WBA A;  2KUB A;  3L70 D;  1KMI Z;  3GHG A;  1SFC D;  1RF1 B;  1EZV G;  2W6A A;  3L70 J;  3P8C D;  3JCU E;  3WUU A;  1LT9 B;  1Y47 A;  3CC2 P;  4WWI A;  2WIT A;  5KJ7 A;  3G71 P;  3CD6 P;  3OJA B;  4ASV A;  3B8E B;  2WPV B;  5AW4 B;  5AW8 B;  2WSC H;  5AW7 B;  4YXD C;  2OYI A;  2E43 A;  2C9L Y;  2ZYG A;  1FC2 C;  4I2L C;  1SQB E;  2N9B A;  4JBZ A;  3EFG A;  2BCC E;  1Q86 Q;  3GF7 A;  1KQF B;  1BSH A;  3IN6 A;  2IZ1 A;  3CXH I;  4WY4 A;  3H1H D;  1JMM A;  3HTK A;  3CX5 H;  1ZOY C;  1FZA A;  5K5G B;  3L72 E;  3H1H J;  1J1E C;  4I6M C;  1UII A;  1KYO H;  1JNM A;  3WU2 E;  5CCH D;  2B89 A;  1LTJ A;  2R32 A;  2GM4 A;  4OH8 B;  1IZN B;  4GT1 A;  2W6J H;  1J1E B;  1J1D C;  1BGY D;  5BU8 B;  2WVR A;  3L74 D;  3A0H H;  5AW9 B;  1KB9 I;  1DEE G;  2A06 G;  1P84 I;  1RQU A;  3HD7 C;  4OGQ C;  1J1D B;  1EZV D;  2Y0D A;  3ABV C;  4IFD K;  1AFO A;  1FS0 E;  3D71 A;  3WMM 0;  3CI9 A;  1URQ A;  3HD7 B;  1LNQ A;  2XNX A;  1L0N E;  4OGQ B;  1YBK A;  2OTJ P;  3P8M C;  2QEX P;  1VF5 D;  1FJP A;  4NPE A;  3MHV A;  3SWY A;  1IK7 A;  5AVW B;  3OW2 O;  3CCE P;  1IO4 A;  2YXR B;  5AW3 B;  1S4X A;  3H1I J;  1GL2 D;  1ZW0 A;  2B9B A;  1NH4 A;  2IX7 C;  4IL6 E;  3CXH E;  1NTK G;  1S9K E;  3CME P;  2WQY C;  3E1I A;  2L91 A;  1SQP G;  3H6P A;  1Q7Y Q;  2R5D A;  2KNC A;  3M9H A;  4M3L A;  1ZLL A;  3FXE A;  1KIL E;  3HE5 A;  1DEB A;  2ZYA A;  2W6B A;  1GD2 E;  1KIL A;  2AEF A;  5CCH C;  1ZR4 A;  2HPC A;  1X22 A;  2KIK A;  1KB9 E;  3U1C A;  4C7N B;  1P84 E;  1LP1 A;  3WUV A;  2A06 D;  2N1T D;  5APX A;  1NKZ B;  3GW6 A;  1VQP P;  1L4A D;  2J5U A;  4DOJ A;  3O8Z A;  3AE8 C;  1X0T A;  3EFF K;  1T3J A;  2PAJ A;  5GTH E;  3Q5S A;  2H8P D;  1G1I A;  4UB6 H;  4C7R A;  3A0B E;  4PD4 I;  3H1I E;  5KLV G;  2FKW B;  1Y9B A;  2PGD A;  1RE4 A;  3BAT A;  5AW0 B;  3AEE C;  1VF5 C;  3VP8 A;  5KLI B;  1JTH B;  2QE7 H;  2AEM A;  3MP7 B;  2LR2 A;  2P10 A;  2ZXX A;  2R3C A;  3AE2 C;  2P2U A;  3CL3 D;  2QIW A;  1W2E A;  2I1J A;  3JC2 2;  1VF5 B;  2WSS H;  1NTK D;  4OVN F;  3V2N A;  3L73 G;  1SQP D;  3S1K A;  4JYC A;  2I1K A;  2WSE H;  3M06 A;  2D2C D;  1OVV A;  1RQV A;  1GK6 A;  2E5Y A;  1FU1 A;  2KXP B;  3CLQ A;  3M91 A;  3GLM A;  4YPC A;  3MD0 A;  3NXS A;  3TK1 A;  1USD A;  2C0W A;  1R5L A;  2ZYD A;  1GMJ A;  3BCC J;  1LGH B;  1DD4 A;  4C46 A;  2H7H A;  2K1A A;  3L75 E;  1RE3 A;  1N73 C;  4ZKP A;  1L4A C;  3C1L A;  2L5G B;  4U3F G;  4PJ0 E;  4BXL A;  5CCG C;  5APY A;  1EQ7 A;  1OVR A;  2Y0C A;  2YNY A;  2B88 A;  1HJB A;  4I7Z B;  1IK9 A;  2FYU K;  5AVT B;  4PD4 E;  2Q1K A;  3HUS A;  1N73 B;  1L4A B;  1IJD B;  5KLV D;  5AVV B;  2KYV A;  4R4M A;  2AXT H;  1T3U A;  1L0L K;  4EIJ A;  3VN0 A;  1CZQ A;  3M0A A;  1RF0 A;  3V4W A;  2KS1 B;  4JQ0 D;  1N86 A;  1GU4 A;  3A7O A;  3L71 G;  2M5A B;  1OFC X;  4H13 D;  1BE3 J;  1ZR2 A;  2R3S A;  2A45 H;  4L74 A;  1SQV K;  2OYO A;  3AE3 C;  3L73 D;  2FFD A;  1PPJ G;  3JCU H;  3L73 J;  2ZAE B;  2QJK C;  3WUT A;  2PRR A;  5M1B A;  1KN7 A;  3ZDM A;  1EDJ A;  2QVA A;  2E74 D;  5APT A;  1IC2 A;  3BCC E;  3M0D C;  2BEQ D;  3H1K J;  5C39 A;  3UIA A;  2JWA A;  4JPZ B;  4TLF A;  1EC5 A;  2JWD A;  2FYU J;  5KAF E;  4N78 E;  1OX3 A;  1NWQ A;  4PV1 D;  5KAI E;  2QJK B;  3G3Z A;  3H1L G;  1H0T B;  5CMZ A;  1DIP A;  2KB7 P;  1PP9 G;  2KSJ A;  1EXI A;  2K9J B;  2P58 A;  5AVX B;  2DW3 A;  2PP6 A;  1CW5 A;  1HGZ A;  5L8R J;  1NKN A;  3GMA A;  1L0N G;  3ITK A;  3MIW A;  3NFQ A;  2ZT9 B;  3R4Y A;  4U3F D;  3PP5 A;  1M56 D;  2VRS A;  4U3F J;  1GU5 A;  1HUC A;  4KJM A;  1KQS O;  4DZO A;  1SQV J;  2E76 D;  4H0L C;  1YHQ P;  2YO2 A;  4GOF A;  3G4S P;  2E75 C;  1CI6 B;  4XFJ A;  4WY4 D;  1VPC A;  1VQK P;  1BE3 E;  1RHZ B;  1YQ3 C;  4W80 A;  1FBM A;  4H0L B;  2H43 A;  1NTZ G;  1AVO A;  3B5N C;  3H1J D;  3O6Q B;  1QL2 A;  4KHX A;  5E79 E;  4A7P A;  2KOG A;  1PGJ A;  2E75 B;  4LC1 A;  3H1J J;  1Q90 D;  3L71 D;  4N3Y B;  2WWW A;  4DCK A;  1S5L E;  1LWU C;  1YTZ I;  3H1K E;  1E79 H;  3B5N B;  5TIS E;  1N8R Q;  2FYU E;  1LTS C;  4K35 A;  1NJI Q;  2OQQ A;  1N2D C;  4GOD A;  4HKZ H;  4B86 A;  1JOC A;  1SS1 A;  4D6T G;  2O01 H;  4L75 A;  1LWU B;  1AV1 A;  3Q5R A;  1M1K Q;  3GF3 A;  5B66 E;  1U7J A;  1L0L E;  3CCJ P;  3F89 A;  3CCS P;  1M1J C;  3H1L D;  1X8Y A;  2Q5U A;  1FOS F;  1BCC G;  1PP9 D;  1RY3 A;  1N7S C;  1DH3 A;  1SQV E;  3TDK A;  4IL6 H;  1U57 A;  3CXH H;  1M1J B;  1RH5 B;  1T6A A;  5APU A;  1AQ5 A;  4ZNC A;  3KYQ A;  1EDL A;  3RK2 C;  2HLO A;  1N7S B;  1NVO A;  2FYN C;  1KQG B;  2AEJ A;  3SWK A;  2WSC J;  3P32 A;  3PHL A;  1KZU B;  2WSF H;  1YJW P;  2QM7 A;  3RK2 B;  1Y8A A;  5AVY B;  3L70 E;  1KYO I;  5H2F H;  2FYN B;  1NTZ D;  1P84 H;  1BGY J;  5APW A;  1S72 P;  3L74 J;  3HD7 A;  3CX5 D;  1EZV I;  3P8C E;  1KYO D;  2KSE A;  4HYT B;  2RH0 A;  3NTN A;  1FZC C;  3V2P A;  1EXJ A;  1KFM A;  1PGQ A;  1BDC A;  1HVV A;  1SFC C;  3JSV C;  2XKM A;  1EDK A;  1GW4 A;  3W68 A;  5GTH H;  4YXW H;  1SQQ G;  3C9I A;  3AED C;  1FZC B;  3KDP B;  4D6T D;  4AQR D;  3AEF C;  1PV3 A;  3TGU G;  1SFC B;  1YYC A;  3G9R A;  1FZG A;  3D6Z A;  1X9V A;  2N9Y B;  2JR8 A;  2O1J A;  4L73 A;  5KKZ C;  1OW6 A;  1SQX G;  4HB1 A;  5AW6 B;  4EI2 A;  3AE4 C;  1BCC D;  1Z56 A; 
#chains in the Genus database with same CATH homology
 3CWB J;  2FYU J;  3H1J J;  3CX5 I;  3L73 J;  3H1H J;  1BCC J;  3H1L J;  3TGU J;  4D6T J;  1SQB J;  1KYO I;  3L71 J;  1NTK J;  3L72 J;  1NTM J;  1KB9 I;  2BCC J;  3L70 J;  3L75 J;  1NU1 J;  1BGY J;  1SQP J;  4U3F J;  1BE3 J;  3L74 J;  1PP9 J;  2IBZ I;  1P84 I;  4PD4 I;  1SQV J;  1EZV I;  1SQX J;  3CXH I;  1NTZ J;  3H1K J;  5KLV J;  1L0L J;  1SQQ J;  3BCC J;  3H1I J;  1L0N J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...