1BCCJ

Cytochrome bc1 complex from chicken
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
59
structure length
59
Chain Sequence
TLTARLYSLLFRRTSTFALTIVVGALLFERAFDQGADAIYEHINEGKLWKHIKHKYENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 23
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1bccJ00
1NTMJ 1KYOI 3L70J 1BE3J 3H1KJ 3TGUJ 2BCCJ 3H1HJ 3L75J 1KB9I 1PP9J 1SQPJ 1EZVI 3L73J 5KLVJ 3CWBJ 3H1IJ 1BGYJ 2FYUJ 1NU1J 1SQVJ 3BCCJ 1SQXJ 1BCCJ 3L74J 1NTZJ 1SQQJ 3CX5I 2IBZI 4D6TJ 1L0NJ 4PD4I 3H1LJ 1SQBJ 3L71J 1P84I 3CXHI 1NTKJ 3L72J 3H1JJ 4U3FJ 1L0LJ
chains in the Genus database with same CATH superfamily
3N7NA 3CX5D 4PD4D 1R5SA 3H1JE 1K73Q 2Z5IA 3L75G 4QMAA 4TLFA 1PP9E 3S4RA 3FXDA 1EXIA 1VQ7P 2Y9YA 3NXSA 2N1TC 1RF1B 3AE4C 2R44A 1JY3N 1ZR4A 1GL2B 1IFPA 1Q82Q 2OTJP 3RBZA 3KXDA 4L76A 1KILD 2O01J 3CCEP 2JWDA 4AQRD 3FWLA 2YKQA 2LXBA 1OW6A 4WWIA 3L74D 5CCHA 1L0LG 1M56D 1ZP0C 3EWKA 3CLQA 1NU1J 4IL6X 2K9JA 2IX7C 1HUCA 1GL2A 1SQQK 2QA4P 4RJTA 1S9KD 2Y0CA 1LT9B 2Y0DA 3BASA 2IFMA 3FWNA 5K5GB 2KK7A 4CPGA 2QIWA 1KFMA 2WSEH 1W2BO 2Y0EA 5APYA 1KD1Q 5KLVG 1NTMD 3V2NA 1H89A 5KKZB 1SQVE 4XA4A 3TNUA 4WB4A 1YYCA 1D7MA 1VQPP 2O3JA 1JY3P 4L75A 2P2UA 3SSUA 3PH0A 1NTKD 5KTBA 4EOTA 1KB9E 1NTZK 1NJIQ 3GMAA 1IO4A 1DD3A 1YHQP 2K1AA 4KHXA 3H1HJ 3I5CA 3G71P 1L4AB 1JCDA 2KP8A 4ASVA 2RMZA 2QM8A 3H1KG 1T8ZA 2XU6A 3A3YB 1OVVA 1YTZT 1AFOA 1JUNA 1NAYA 1LP1B 3PLNA 1S4XA 1FZCC 5AVUB 3R2PA 2FXOA 2WSEJ 4RKUJ 4HH2A 2IBZD 1SQXD 1HJBA 2E75C 3GF7A 3PJSK 1CZQA 5KAFE 2Q3EA 1SQBJ 5AW3B 5AW4B 3AEDC 2E76C 1LP1A 1NHLA 5GTIE 1SQPD 2KSEA 2KOGA 5CBOA 4EIJA 2QJKB 3BATA 5B5EE 3GF3A 3CPWO 3GHGB 5KJ7A 2NPSB 2O01N 5CCGC 3U1AA 5H2FE 2FXPA 1NH4A 2D2CC 4ASWA 1BE3J 3LIDA 1P84E 4N3YB 1L2PA 3KZIH 1SFCC 3TGUG 1FJKA 1EDIA 2WPVB 5AW6B 3P8CD 3GHGA 1WRGA 4Y99C 1GMJA 1S3JA 4LLHA 2Z5HA 3H1LE 1NU1D 1KB9I 1BCCD 1G1JA 2B87B 4HB1A 1KILC 2IZ1A 4HKZH 1VF5B 1SQPG 4GOEA 1SQVK 2FKWB 2E5YA 2M3EA 2A06D 3CX5E 4A7PA 4PD4E 3L70J 3CWBD 4OVNF 1LJ2A 4TT3H 2WPRA 2Q5UA 3A0BH 5KLIC 3U1CA 1IK9A 2KIKA 2CK3H 2FFDC 2BCCD 3HTKB 2I8DA 1HJ0A 3L36A 1OW7A 3M0AA 1KYOH 3WUTA 1KILE 3L73G 3HUSB 1KTMA 3H1JD 3CC2P 1BCCG 1BGYE 2ZVOB 1L0NG 4BRYA 3H1HD 3CCMP 2PP6A 3L74E 2W6JH 4HJGH 4I7ZC 3MIWA 1PP9D 1IFNA 1PGJA 2QVAA 1NOHA 4ZKPA 2R3CA 1EDKA 1Y47A 1VQLP 1AVOA 1S9KE 1P84I 3HUSA 4RESB 4D6TG 3CCQP 1OVRA 1FJPA 3M0DC 2J5UA 1J1DC 4N6JA 1QLED 1NTME 1DD4A 1ZN5A 3BCCJ 2BCCG 2QG4A 4H13C 1RF0A 4YXDC 1MV8A 2HODB 2W83C 5BVZA 3V6IA 1LTSC 3H6PA 2C9NY 3GLMA 3H1JG 1S5LH 1LTGC 2KLVA 1NTKE 3IF4A 1M90Q 3Q5RA 3CC4P 2ZYGA 2WWWA 2N9BA 3CX5I 3N4XA 1PP9G 4PD4I 4LC1A 2N1TD 1FU1A 1JTHB 1HWTC 3RK2B 1BE3D 3AE6C 2ITAA 5APSA 2Z4EA 4U3FJ 2KZJA 1EZVD 2FYZA 2VRSA 4GODA 5EFWB 1BDCA 1GK4A 1FE6A 1L0LK 2W6BA 3H25A 1M1JA 1DH3A 1T6AA 2W90A 2QE7H 3JSVC 4GOFA 1OX3A 3CC7P 2OQQA 1N7SC 1FOSE 3G9RA 1JTHA 1U7JA 1ZRTD 2HFED 3B71A 1UIXA 2IBZE 1KB9D 1SQXE 4XFJA 5KLVJ 2P67A 2OYIB 4AUWA 5GTHE 1T2KC 1KMIZ 1NWQA 1W5CE 3L70D 2I1JA 4H0LC 3SWFA 1OIPA 3O8ZA 4JBZA 1VQMP 1USEA 3F89A 5TISE 1FBMA 1X79B 3OJAB 3P8MC 1RE3C 3QH9A 1SQVG 5E79H 3BRTB 2KI7B 3H1KJ 1PGPA 4OWFA 3CI9A 5AVWB 3V2QA 3H1IJ 1U57A 3P8CE 1URQD 2HR3A 3L35A 5C39A 2WSSH 4PJ0H 1R8EA 1QGKB 2HPCA 1NU1E 5AVTB 3MHVA 1BCCE 1VDFA 1XTCC 3EQ2A 1X0TA 1DIPA 4C7RA 4H44B 3R4YA 1MKMA 3VN0A 2P58A 2AXCA 1QL2A 3CD6P 2A06E 1LTJA 2B88A 1EQ7A 1LT1A 2E75D 3CWBE 4IL6H 2WPSA 1WMKA 1NTKK 5APTA 3FGAD 2E76D 1S2EA 1PGOA 1YJ9P 1JMBA 2IBZI 1EDLA 1KZUB 4XE5B 1K04A 1G1IA 1S1CX 1JB0J 3RL0C 3CMAP 1CW5A 2E74C 2RKLA 3TGUJ 3NFQA 3AE9C 1VQOP 5CCGD 1GW3A 1KFNA 2D2CD 2WTYA 4OGQC 3OA7A 3H1HE 3B4SA 4WY4D 1SQXK 1PPJE 1SFCD 1J1EB 4ZKUA 2OTKE 4ZNCA 2C0XA 2V7QH 3Q2YA 2XZRA 1AQTA 3ABVC 3CXHH 3WU2H 1VQ8P 1JY2O 1FZBA 3TF5A 2AEMA 2P7JA 3JCUH 5AVZB 1SQPK 2K9JB 3Q5SA 2XDJA 2N1TA 3CCRP 1LTIC 3H1LG 1GK6A 2K3RA 3RK3C 2H88C 3IFMA 1SQBE 1BGYD 2H43A 3V4QA 3MP7B 2WSCH 2NZ2A 1NKZB 3E1IA 1SQQJ 1YJWP 5CJ0A 5AVRB 2R5BA 2WSFH 2ZJSE 1RF1C 2LKMA 3TNUB 1UIIA 2V4HA 1JMMA 2FBWC 2OYHC 2SPZA 2R32A 4Y28J 3HE4B 1X22A 4GKGA 1ZV8A 3AEGC 1Q90D 2V7QJ 1BE3E 2OTLP 1N8RQ 2MJZA 2P1JA 1EZVE 2KB7P 4C7NA 3L72J 1L0NK 3P7KA 4L74A 1OZHA 3JC22 3AEEC 2WT7B 3LW5H 3RK3E 2O1JA 2FYUD 1VQKP 1SVFA 1MFZA 3HE4A 1NTZJ 4YXWH 1ZRTE 1BGYG 1DEBA 3TK1A 3V4WA 3L74G 2WSCJ 1PFIA 1HF9A 5CJ4A 1N7LA 2MKVA 1URQC 2WT7A 1RHZB 2WSFJ 2ZT9D 1FZCB 4PV1B 2ZYAA 3D71A 2HLOA 3L70E 3RL0g 4NPEA 3I56P 2PRRA 1YIJP 2E75B 4H13D 2OARA 1YJNP 1FDIA 1NTMG 3M9QA 3KZIE 1PL5A 1FZCA 2KLUA 3AEFC 2Q7CA 3MUDC 3LW5J 2KNCA 1L4AC 1LTBC 1H8AA 2LXCB 2Y9ZA 3G4SP 1K05A 2XNXA 4EYYQ 1NTKG 4YTPC 1M7LA 2W8ZA 1K9MQ 1J2JB 1Q86Q 1T3UA 5AW8B 5APUA 3VMZA 3OW2O 1N73C 1FZFA 2HYNA 2WZ7A 1N7SD 3G6EP 4Y99B 2H8PD 1EZVI 4WY4C 5CCGA 2ZAEB 3GW6A 2QJKC 3A0BE 4IFDK 2IBZG 1SQXG 1YI2P 1CSBA 1KQLA 1SFCA 3PP5A 1T2KD 5KAIH 1KILB 3SWKA 1PZQA 2YIUB 2G3AA 2NPSC 3CCUP 1SLQA 1SQQD 4H0LD 4GT1A 1KYOE 2OYOA 1E79H 1EDJA 4YPCA 5KAFH 2R3SA 3L71J 1YQ4C 2B89A 4BWNA 4R4MA 4WVZA 1KILA 5TJHA 2Q6QA 5B5EH 2FXMA 3CXHD 3L72D 3A7OA 5H2FH 4BRYB 2AEJA 1VF5C 3VP8A 5DJUB 1P84H 1EXJA 1S72P 2IPPA 2OGUA 2QM7A 1IC2A 3C9IA 4UB6H 3CL3D 4I7ZB 2FFDA 2IYPA 1M57D 1NU1G 2WQYC 1PPJD 3O6QB 1S5LE 4MN4C 5BU5A 1ZOYC 2A06G 1GW4A 4W80A 1GD2E 3AECC 3M91A 3CWBG 3CMEP 2O1KA 2WPQA 5AVYB 1J1DB 3T97A 4DJGA 1X8YA 2ZT9C 4PD4H 4W7YA 1Q7YQ 2J59M 3L75J 3O6QA 3RL0D 1SQBD 2E74D 1AQ5A 3B8EB 4KJMA 3M0DA 1FOSF 2JO1A 3H1IE 4OGQD 2FYUE 3MTUE 1E5WA 1KYOI 4JQ0D 2C0WA 2WITA 2JWAA 3B5ND 3IR9A 1IZNB 2JP3A 1M1JB 2W27A 1QEXA 2ZFCA 3H1HG 2QJPB 1PPJG 3H1LJ 2AXTH 1L0LJ 3VMAA 4C46A 3E1RA 1HGVA 1Q2NA 2JDIH 3KYQA 3HD7C 1KQFB 1N7SB 3VOPA 2YO2A 1W2EA 2ZVNB 2E42A 2A45I 3RK3D 3OAKA 2M5AB 1XTGB 3W67A 1NGMB 4UB8E 1NYHA 1SQBG 2YNYA 3RK2C 1VQ4P 1N7SA 1ZW0A 1Y9BA 3KDPB 3L71D 1GL2D 1OW8A 3CCJP 4DZOA 1GU4A 2M5AA 3V5BA 4PJ0E 3S1KA 3AEAC 3U59A 4IFMA 3PHLA 2KSJA 3II6A 4W7ZA 4N78D 2K9YA 1BE3G 1JY2N 3A0HE 1EZVG 4GDOA 3AE2C 5AVSB 2OYIC 1YQ3C 2HPCB 5AVXB 3VP9A 1RE3A 3RBXA 1BDDA 3IN6A 2YXQB 3FX0A 3K5BA 3F5HA 1AA0A 4DT0A 1EC5A 4KT0J 1LTJB 1NAFA 1MUUA 3VMXA 1KV4A 1SQQE 1LWUC 2GUSA 2B9BA 2WVRA 1NTMK 3L70G 2FYNB 5AVQB 2FYUK 5B66H 5APWA 1NTKJ 1YTZI 3L75D 4IOIH 1KN7A 1FZEA 1L4AD 1JY2P 3CXHE 3Q1MA 3BCCD 3L72E 1FDOA 3RL0B 5AW5B 1RQUA 1QX8A 2JJLA 3CCLP 1RE4C 4H44C 1KYOD 4IFFA 4OGQB 1NTZE 1X9VA 1U7MA 4Z1MH 1YBKA 2QJYC 2PAJA 1SQXJ 1KQSO 2FY8A 4U3FD 2N1TB 2BEZF 3B5NC 3WUVA 3MD0A 3P32A 2H89C 2I1KA 2M8RA 1SQPJ 1VQ6P 1H88A 4NPDA 1M1KQ 4L73A 3B5NA 3KHUA 3RK3B 2NPSD 3BVHA 1IK7A 3BCCG 4OH8B 2QRXA 4R4LA 1IFDA 2QSIA 5KLVD 4RO0A 1J1EC 2XV5A 4LGDE 2XNDH 1PV3A 3HE5B 5CBNA 3M9BA 2CPSA 4JPZB 2OYHB 5CCHC 4M3LA 4C7NB 3MGNA 3AE1C 1GL2C 3C1LA 4U3FG 3QWOC 1USDA 2RH0A 3L73J 1RF1A 1VF5D 1BCCJ 3HE5A 1L0NJ 2A45G 1HVVA 3KPEA 1NU1K 1RY3A 3CXHI 2OYHA 3H1KD 3MZWB 1VQNP 4BXLA 1KQGB 2POHA 3H1ID 1FZAA 3CWBJ 3IAOA 4HYTB 1LT9C 4D6TJ 1URQB 1AJYA 3ZDMA 3AEBC 1JM0A 3UIAA 4K35A 1QL1A 1LT9A 3WUUA 3L71E 3E7KA 2BCCJ 2ZYDA 3CCVP 4I6MC 4ZMDA 5KKZC 2KNCB 1HTLC 1URQA 1N2DC 1HH0A 1JNMA 3H1JJ 2Q9IA 3A5TA 1KORA 1AV1A 4N78E 2IZ0A 3G3ZA 3BRVB 1PP9J 2E76B 2QEXP 2W6AA 4O9BA 3H1IG 1FDMA 2FYUG 2BASA 4GIFA 4PV1C 1OFCX 3TGUD 5KAIE 1JOCA 2UWJE 1YITP 3MUDA 2R5DA 5CHXA 4WBAA 3SFDC 1L4AA 1N73B 2JKVA 4EDFA 2D2CB 2AEFA 1JY3O 3EFFK 5APVA 3HD7D 1RQVA 2J58A 3AE7C 4DOJA 1KB9H 2Q3IA 4WY4B 5AW0B 1SFCB 1SQBK 4JYCA 3VMYA 5KJ7C 1JCCA 2KUBA 2E5TA 3HRNA 1N73A 1PGQA 3RK2D 3L75E 3SWYA 2IYOA 1IJDB 1IFIA 4WY4A 1TU3F 2Q1KA 3BCCE 1FAVA 2KZIA 1R5LA 3GHGC 1BSNA 4AYCA 3S9OA 1SQVJ 2LR2A 4UB6E 3A2AA 2NPSA 1FC2C 3L73D 5GTIH 3AE5C 1FZGA 1N86A 2YMYA 3M9HA 4B86A 5KLIB 1L0ND 1MZ9A 1L0LE 4U3FE 2FFDB 2YIUC 1Z56A 3RGUA 2HG5D 3PRJA 2M3BA 2KYVA 2ZXXA 5AVVB 5M1BA 2YXRB 5AW1B 1Q81Q 3PTZA 3GG2A 1ZR2A 4D6TD 1NTZD 1HGZA 2GM4A 2B87A 4JF7A 1PIXA 3SFEC 1BSHA 1CI6B 3T97B 5KLVE 3CCSP 1SQQG 2L91A 3D6YA 3VTPC 1LTTC 5AW7B 1HBWA 2GA1A 3L37A 2ZT9B 5AW2B 1AVYA 1IFJA 1GDTA 2G8YA 2AXTE 1QVFO 5DJTB 1QVGO 1LGHB 2RN0A 1A02F 1CI6A 1DEEG 1LTAC 3USSA 1VQ5P 3CX5H 3Q3DA 4H13B 3HTKA 1LNQA 4H44D 3HUSC 3L72G 1DX7A 3TYYA 2JEEA 5APXA 1OWAA 1GZLA 3V2PA 1M8OB 5AW9B 1GU5A 1SS1A 3H1KE 2IDBA 2KXPB 2A45H 2H7HA 1NTZG 1RF0C 3NTNA 2M0BA 1H0TB 3EFGA 2JR8A 4K3AA 2C9LY 1GTWA 4U7JA 2XKMA 2GUVA 2N9YB 5APQA 1SP4A 3HD7B 1IFMA 3ITKA 4I1LA 1WT6A 4NPFX 2YKOA 1H0TA 1ZXGA 2KS1B 2CPBA 2YKPA 1JO5A 2HODA 1K8AQ 3HD7A 1M1JC 3L4FA 3W68A 1KC8Q 3M06A 5E79E 3I55P 2QJPC 5CCHD 3TSIA 1SQVD 1OMIA 2K88A 4H0LB 1ZLLA 2KS1A 3TGUE 1OVUA 1VQ9P 1JEKA 3NMDA 1VL2A 1OXZA 3FXEA 1BGYJ 3L74J 5KLVK 5B66E 1SQPE 5CMZA 4DCKA 1RH5B 4IL6E 3KQGA 3D70A 2PGDA 1Y8AA 4JYBA 2OYIA 1MFTA 3TDKA 1LWUB 1G2CB 2PFXA 3H32B 1FS0E 2K37A 4UB8H 1S5LX 1ZMEC 4EI2A 1NVOA 3L71G 1NTMJ 2L5GB 3LIEA 2WMMA 2NRGA 5L8RJ 2P10A 5GTHH 2FYUJ 2YMKA 2IFNA 1LWUA 1G2CA 3AE3C 3VYIA 3L73E 3H32A 1L0NE 1LTJC 4PV1D 1A02J 3WU2E 2YO3A 3C8VA 3A0HH 2BEQD 1P84D 5TISH 3JCUE 2E74B 3D6ZA 4I2LC 2DW3A 3WMM0 2FYNC 2QJYB 4D6TE 1T3JA 1NKNA 5BU8B 3AE8C 1RE4A 3V2RA 1VPCA 3B5NB 2O01H 3H1LD 2ZXEB 5KJ7D 3Q5PA 1NO4A 2BCCE 1L0LD 2E43A
chains in the Genus database with same CATH topology
1NTMJ 1KYOI 3L70J 1BE3J 3H1KJ 3TGUJ 2BCCJ 3H1HJ 3L75J 1KB9I 1PP9J 1SQPJ 1EZVI 3L73J 5KLVJ 3CWBJ 3H1IJ 1BGYJ 2FYUJ 1NU1J 1SQVJ 3BCCJ 1SQXJ 1BCCJ 3L74J 1NTZJ 1SQQJ 3CX5I 2IBZI 4D6TJ 1L0NJ 4PD4I 3H1LJ 1SQBJ 3L71J 1P84I 3CXHI 1NTKJ 3L72J 3H1JJ 4U3FJ 1L0LJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTM J;  1KYO I;  3L70 J;  1BE3 J;  3H1K J;  3TGU J;  2BCC J;  3H1H J;  3L75 J;  1KB9 I;  1PP9 J;  1SQP J;  1EZV I;  3L73 J;  5KLV J;  3CWB J;  3H1I J;  1BGY J;  2FYU J;  1NU1 J;  1SQV J;  3BCC J;  1SQX J;  1BCC J;  3L74 J;  1NTZ J;  1SQQ J;  3CX5 I;  2IBZ I;  4D6T J;  1L0N J;  4PD4 I;  3H1L J;  1SQB J;  3L71 J;  1P84 I;  3CXH I;  1NTK J;  3L72 J;  3H1J J;  4U3F J;  1L0L J; 
#chains in the Genus database with same CATH topology
 3N7N A;  3CX5 D;  4PD4 D;  1R5S A;  3H1J E;  1K73 Q;  2Z5I A;  3L75 G;  4QMA A;  4TLF A;  1PP9 E;  3S4R A;  3FXD A;  1EXI A;  1VQ7 P;  2Y9Y A;  3NXS A;  2N1T C;  1RF1 B;  3AE4 C;  2R44 A;  1JY3 N;  1ZR4 A;  1GL2 B;  1IFP A;  1Q82 Q;  2OTJ P;  3RBZ A;  3KXD A;  4L76 A;  1KIL D;  2O01 J;  3CCE P;  2JWD A;  4AQR D;  3FWL A;  2YKQ A;  2LXB A;  1OW6 A;  4WWI A;  3L74 D;  5CCH A;  1L0L G;  1M56 D;  1ZP0 C;  3EWK A;  3CLQ A;  1NU1 J;  4IL6 X;  2K9J A;  2IX7 C;  1HUC A;  1GL2 A;  1SQQ K;  2QA4 P;  4RJT A;  1S9K D;  2Y0C A;  1LT9 B;  2Y0D A;  3BAS A;  2IFM A;  3FWN A;  5K5G B;  2KK7 A;  4CPG A;  2QIW A;  1KFM A;  2WSE H;  1W2B O;  2Y0E A;  5APY A;  1KD1 Q;  5KLV G;  1NTM D;  3V2N A;  1H89 A;  5KKZ B;  1SQV E;  4XA4 A;  3TNU A;  4WB4 A;  1YYC A;  1D7M A;  1VQP P;  2O3J A;  1JY3 P;  4L75 A;  2P2U A;  3SSU A;  3PH0 A;  1NTK D;  5KTB A;  4EOT A;  1KB9 E;  1NTZ K;  1NJI Q;  3GMA A;  1IO4 A;  1DD3 A;  1YHQ P;  2K1A A;  4KHX A;  3H1H J;  3I5C A;  3G71 P;  1L4A B;  1JCD A;  2KP8 A;  4ASV A;  2RMZ A;  2QM8 A;  3H1K G;  1T8Z A;  2XU6 A;  3A3Y B;  1OVV A;  1YTZ T;  1AFO A;  1JUN A;  1NAY A;  1LP1 B;  3PLN A;  1S4X A;  1FZC C;  5AVU B;  3R2P A;  2FXO A;  2WSE J;  4RKU J;  4HH2 A;  2IBZ D;  1SQX D;  1HJB A;  2E75 C;  3GF7 A;  3PJS K;  1CZQ A;  5KAF E;  2Q3E A;  1SQB J;  5AW3 B;  5AW4 B;  3AED C;  2E76 C;  1LP1 A;  1NHL A;  5GTI E;  1SQP D;  2KSE A;  2KOG A;  5CBO A;  4EIJ A;  2QJK B;  3BAT A;  5B5E E;  3GF3 A;  3CPW O;  3GHG B;  5KJ7 A;  2NPS B;  2O01 N;  5CCG C;  3U1A A;  5H2F E;  2FXP A;  1NH4 A;  2D2C C;  4ASW A;  1BE3 J;  3LID A;  1P84 E;  4N3Y B;  1L2P A;  3KZI H;  1SFC C;  3TGU G;  1FJK A;  1EDI A;  2WPV B;  5AW6 B;  3P8C D;  3GHG A;  1WRG A;  4Y99 C;  1GMJ A;  1S3J A;  4LLH A;  2Z5H A;  3H1L E;  1NU1 D;  1KB9 I;  1BCC D;  1G1J A;  2B87 B;  4HB1 A;  1KIL C;  2IZ1 A;  4HKZ H;  1VF5 B;  1SQP G;  4GOE A;  1SQV K;  2FKW B;  2E5Y A;  2M3E A;  2A06 D;  3CX5 E;  4A7P A;  4PD4 E;  3L70 J;  3CWB D;  4OVN F;  1LJ2 A;  4TT3 H;  2WPR A;  2Q5U A;  3A0B H;  5KLI C;  3U1C A;  1IK9 A;  2KIK A;  2CK3 H;  2FFD C;  2BCC D;  3HTK B;  2I8D A;  1HJ0 A;  3L36 A;  1OW7 A;  3M0A A;  1KYO H;  3WUT A;  1KIL E;  3L73 G;  3HUS B;  1KTM A;  3H1J D;  3CC2 P;  1BCC G;  1BGY E;  2ZVO B;  1L0N G;  4BRY A;  3H1H D;  3CCM P;  2PP6 A;  3L74 E;  2W6J H;  4HJG H;  4I7Z C;  3MIW A;  1PP9 D;  1IFN A;  1PGJ A;  2QVA A;  1NOH A;  4ZKP A;  2R3C A;  1EDK A;  1Y47 A;  1VQL P;  1AVO A;  1S9K E;  1P84 I;  3HUS A;  4RES B;  4D6T G;  3CCQ P;  1OVR A;  1FJP A;  3M0D C;  2J5U A;  1J1D C;  4N6J A;  1QLE D;  1NTM E;  1DD4 A;  1ZN5 A;  3BCC J;  2BCC G;  2QG4 A;  4H13 C;  1RF0 A;  4YXD C;  1MV8 A;  2HOD B;  2W83 C;  5BVZ A;  3V6I A;  1LTS C;  3H6P A;  2C9N Y;  3GLM A;  3H1J G;  1S5L H;  1LTG C;  2KLV A;  1NTK E;  3IF4 A;  1M90 Q;  3Q5R A;  3CC4 P;  2ZYG A;  2WWW A;  2N9B A;  3CX5 I;  3N4X A;  1PP9 G;  4PD4 I;  4LC1 A;  2N1T D;  1FU1 A;  1JTH B;  1HWT C;  3RK2 B;  1BE3 D;  3AE6 C;  2ITA A;  5APS A;  2Z4E A;  4U3F J;  2KZJ A;  1EZV D;  2FYZ A;  2VRS A;  4GOD A;  5EFW B;  1BDC A;  1GK4 A;  1FE6 A;  1L0L K;  2W6B A;  3H25 A;  1M1J A;  1DH3 A;  1T6A A;  2W90 A;  2QE7 H;  3JSV C;  4GOF A;  1OX3 A;  3CC7 P;  2OQQ A;  1N7S C;  1FOS E;  3G9R A;  1JTH A;  1U7J A;  1ZRT D;  2HFE D;  3B71 A;  1UIX A;  2IBZ E;  1KB9 D;  1SQX E;  4XFJ A;  5KLV J;  2P67 A;  2OYI B;  4AUW A;  5GTH E;  1T2K C;  1KMI Z;  1NWQ A;  1W5C E;  3L70 D;  2I1J A;  4H0L C;  3SWF A;  1OIP A;  3O8Z A;  4JBZ A;  1VQM P;  1USE A;  3F89 A;  5TIS E;  1FBM A;  1X79 B;  3OJA B;  3P8M C;  1RE3 C;  3QH9 A;  1SQV G;  5E79 H;  3BRT B;  2KI7 B;  3H1K J;  1PGP A;  4OWF A;  3CI9 A;  5AVW B;  3V2Q A;  3H1I J;  1U57 A;  3P8C E;  1URQ D;  2HR3 A;  3L35 A;  5C39 A;  2WSS H;  4PJ0 H;  1R8E A;  1QGK B;  2HPC A;  1NU1 E;  5AVT B;  3MHV A;  1BCC E;  1VDF A;  1XTC C;  3EQ2 A;  1X0T A;  1DIP A;  4C7R A;  4H44 B;  3R4Y A;  1MKM A;  3VN0 A;  2P58 A;  2AXC A;  1QL2 A;  3CD6 P;  2A06 E;  1LTJ A;  2B88 A;  1EQ7 A;  1LT1 A;  2E75 D;  3CWB E;  4IL6 H;  2WPS A;  1WMK A;  1NTK K;  5APT A;  3FGA D;  2E76 D;  1S2E A;  1PGO A;  1YJ9 P;  1JMB A;  2IBZ I;  1EDL A;  1KZU B;  4XE5 B;  1K04 A;  1G1I A;  1S1C X;  1JB0 J;  3RL0 C;  3CMA P;  1CW5 A;  2E74 C;  2RKL A;  3TGU J;  3NFQ A;  3AE9 C;  1VQO P;  5CCG D;  1GW3 A;  1KFN A;  2D2C D;  2WTY A;  4OGQ C;  3OA7 A;  3H1H E;  3B4S A;  4WY4 D;  1SQX K;  1PPJ E;  1SFC D;  1J1E B;  4ZKU A;  2OTK E;  4ZNC A;  2C0X A;  2V7Q H;  3Q2Y A;  2XZR A;  1AQT A;  3ABV C;  3CXH H;  3WU2 H;  1VQ8 P;  1JY2 O;  1FZB A;  3TF5 A;  2AEM A;  2P7J A;  3JCU H;  5AVZ B;  1SQP K;  2K9J B;  3Q5S A;  2XDJ A;  2N1T A;  3CCR P;  1LTI C;  3H1L G;  1GK6 A;  2K3R A;  3RK3 C;  2H88 C;  3IFM A;  1SQB E;  1BGY D;  2H43 A;  3V4Q A;  3MP7 B;  2WSC H;  2NZ2 A;  1NKZ B;  3E1I A;  1SQQ J;  1YJW P;  5CJ0 A;  5AVR B;  2R5B A;  2WSF H;  2ZJS E;  1RF1 C;  2LKM A;  3TNU B;  1UII A;  2V4H A;  1JMM A;  2FBW C;  2OYH C;  2SPZ A;  2R32 A;  4Y28 J;  3HE4 B;  1X22 A;  4GKG A;  1ZV8 A;  3AEG C;  1Q90 D;  2V7Q J;  1BE3 E;  2OTL P;  1N8R Q;  2MJZ A;  2P1J A;  1EZV E;  2KB7 P;  4C7N A;  3L72 J;  1L0N K;  3P7K A;  4L74 A;  1OZH A;  3JC2 2;  3AEE C;  2WT7 B;  3LW5 H;  3RK3 E;  2O1J A;  2FYU D;  1VQK P;  1SVF A;  1MFZ A;  3HE4 A;  1NTZ J;  4YXW H;  1ZRT E;  1BGY G;  1DEB A;  3TK1 A;  3V4W A;  3L74 G;  2WSC J;  1PFI A;  1HF9 A;  5CJ4 A;  1N7L A;  2MKV A;  1URQ C;  2WT7 A;  1RHZ B;  2WSF J;  2ZT9 D;  1FZC B;  4PV1 B;  2ZYA A;  3D71 A;  2HLO A;  3L70 E;  3RL0 g;  4NPE A;  3I56 P;  2PRR A;  1YIJ P;  2E75 B;  4H13 D;  2OAR A;  1YJN P;  1FDI A;  1NTM G;  3M9Q A;  3KZI E;  1PL5 A;  1FZC A;  2KLU A;  3AEF C;  2Q7C A;  3MUD C;  3LW5 J;  2KNC A;  1L4A C;  1LTB C;  1H8A A;  2LXC B;  2Y9Z A;  3G4S P;  1K05 A;  2XNX A;  4EYY Q;  1NTK G;  4YTP C;  1M7L A;  2W8Z A;  1K9M Q;  1J2J B;  1Q86 Q;  1T3U A;  5AW8 B;  5APU A;  3VMZ A;  3OW2 O;  1N73 C;  1FZF A;  2HYN A;  2WZ7 A;  1N7S D;  3G6E P;  4Y99 B;  2H8P D;  1EZV I;  4WY4 C;  5CCG A;  2ZAE B;  3GW6 A;  2QJK C;  3A0B E;  4IFD K;  2IBZ G;  1SQX G;  1YI2 P;  1CSB A;  1KQL A;  1SFC A;  3PP5 A;  1T2K D;  5KAI H;  1KIL B;  3SWK A;  1PZQ A;  2YIU B;  2G3A A;  2NPS C;  3CCU P;  1SLQ A;  1SQQ D;  4H0L D;  4GT1 A;  1KYO E;  2OYO A;  1E79 H;  1EDJ A;  4YPC A;  5KAF H;  2R3S A;  3L71 J;  1YQ4 C;  2B89 A;  4BWN A;  4R4M A;  4WVZ A;  1KIL A;  5TJH A;  2Q6Q A;  5B5E H;  2FXM A;  3CXH D;  3L72 D;  3A7O A;  5H2F H;  4BRY B;  2AEJ A;  1VF5 C;  3VP8 A;  5DJU B;  1P84 H;  1EXJ A;  1S72 P;  2IPP A;  2OGU A;  2QM7 A;  1IC2 A;  3C9I A;  4UB6 H;  3CL3 D;  4I7Z B;  2FFD A;  2IYP A;  1M57 D;  1NU1 G;  2WQY C;  1PPJ D;  3O6Q B;  1S5L E;  4MN4 C;  5BU5 A;  1ZOY C;  2A06 G;  1GW4 A;  4W80 A;  1GD2 E;  3AEC C;  3M91 A;  3CWB G;  3CME P;  2O1K A;  2WPQ A;  5AVY B;  1J1D B;  3T97 A;  4DJG A;  1X8Y A;  2ZT9 C;  4PD4 H;  4W7Y A;  1Q7Y Q;  2J59 M;  3L75 J;  3O6Q A;  3RL0 D;  1SQB D;  2E74 D;  1AQ5 A;  3B8E B;  4KJM A;  3M0D A;  1FOS F;  2JO1 A;  3H1I E;  4OGQ D;  2FYU E;  3MTU E;  1E5W A;  1KYO I;  4JQ0 D;  2C0W A;  2WIT A;  2JWA A;  3B5N D;  3IR9 A;  1IZN B;  2JP3 A;  1M1J B;  2W27 A;  1QEX A;  2ZFC A;  3H1H G;  2QJP B;  1PPJ G;  3H1L J;  2AXT H;  1L0L J;  3VMA A;  4C46 A;  3E1R A;  1HGV A;  1Q2N A;  2JDI H;  3KYQ A;  3HD7 C;  1KQF B;  1N7S B;  3VOP A;  2YO2 A;  1W2E A;  2ZVN B;  2E42 A;  2A45 I;  3RK3 D;  3OAK A;  2M5A B;  1XTG B;  3W67 A;  1NGM B;  4UB8 E;  1NYH A;  1SQB G;  2YNY A;  3RK2 C;  1VQ4 P;  1N7S A;  1ZW0 A;  1Y9B A;  3KDP B;  3L71 D;  1GL2 D;  1OW8 A;  3CCJ P;  4DZO A;  1GU4 A;  2M5A A;  3V5B A;  4PJ0 E;  3S1K A;  3AEA C;  3U59 A;  4IFM A;  3PHL A;  2KSJ A;  3II6 A;  4W7Z A;  4N78 D;  2K9Y A;  1BE3 G;  1JY2 N;  3A0H E;  1EZV G;  4GDO A;  3AE2 C;  5AVS B;  2OYI C;  1YQ3 C;  2HPC B;  5AVX B;  3VP9 A;  1RE3 A;  3RBX A;  1BDD A;  3IN6 A;  2YXQ B;  3FX0 A;  3K5B A;  3F5H A;  1AA0 A;  4DT0 A;  1EC5 A;  4KT0 J;  1LTJ B;  1NAF A;  1MUU A;  3VMX A;  1KV4 A;  1SQQ E;  1LWU C;  2GUS A;  2B9B A;  2WVR A;  1NTM K;  3L70 G;  2FYN B;  5AVQ B;  2FYU K;  5B66 H;  5APW A;  1NTK J;  1YTZ I;  3L75 D;  4IOI H;  1KN7 A;  1FZE A;  1L4A D;  1JY2 P;  3CXH E;  3Q1M A;  3BCC D;  3L72 E;  1FDO A;  3RL0 B;  5AW5 B;  1RQU A;  1QX8 A;  2JJL A;  3CCL P;  1RE4 C;  4H44 C;  1KYO D;  4IFF A;  4OGQ B;  1NTZ E;  1X9V A;  1U7M A;  4Z1M H;  1YBK A;  2QJY C;  2PAJ A;  1SQX J;  1KQS O;  2FY8 A;  4U3F D;  2N1T B;  2BEZ F;  3B5N C;  3WUV A;  3MD0 A;  3P32 A;  2H89 C;  2I1K A;  2M8R A;  1SQP J;  1VQ6 P;  1H88 A;  4NPD A;  1M1K Q;  4L73 A;  3B5N A;  3KHU A;  3RK3 B;  2NPS D;  3BVH A;  1IK7 A;  3BCC G;  4OH8 B;  2QRX A;  4R4L A;  1IFD A;  2QSI A;  5KLV D;  4RO0 A;  1J1E C;  2XV5 A;  4LGD E;  2XND H;  1PV3 A;  3HE5 B;  5CBN A;  3M9B A;  2CPS A;  4JPZ B;  2OYH B;  5CCH C;  4M3L A;  4C7N B;  3MGN A;  3AE1 C;  1GL2 C;  3C1L A;  4U3F G;  3QWO C;  1USD A;  2RH0 A;  3L73 J;  1RF1 A;  1VF5 D;  1BCC J;  3HE5 A;  1L0N J;  2A45 G;  1HVV A;  3KPE A;  1NU1 K;  1RY3 A;  3CXH I;  2OYH A;  3H1K D;  3MZW B;  1VQN P;  4BXL A;  1KQG B;  2POH A;  3H1I D;  1FZA A;  3CWB J;  3IAO A;  4HYT B;  1LT9 C;  4D6T J;  1URQ B;  1AJY A;  3ZDM A;  3AEB C;  1JM0 A;  3UIA A;  4K35 A;  1QL1 A;  1LT9 A;  3WUU A;  3L71 E;  3E7K A;  2BCC J;  2ZYD A;  3CCV P;  4I6M C;  4ZMD A;  5KKZ C;  2KNC B;  1HTL C;  1URQ A;  1N2D C;  1HH0 A;  1JNM A;  3H1J J;  2Q9I A;  3A5T A;  1KOR A;  1AV1 A;  4N78 E;  2IZ0 A;  3G3Z A;  3BRV B;  1PP9 J;  2E76 B;  2QEX P;  2W6A A;  4O9B A;  3H1I G;  1FDM A;  2FYU G;  2BAS A;  4GIF A;  4PV1 C;  1OFC X;  3TGU D;  5KAI E;  1JOC A;  2UWJ E;  1YIT P;  3MUD A;  2R5D A;  5CHX A;  4WBA A;  3SFD C;  1L4A A;  1N73 B;  2JKV A;  4EDF A;  2D2C B;  2AEF A;  1JY3 O;  3EFF K;  5APV A;  3HD7 D;  1RQV A;  2J58 A;  3AE7 C;  4DOJ A;  1KB9 H;  2Q3I A;  4WY4 B;  5AW0 B;  1SFC B;  1SQB K;  4JYC A;  3VMY A;  5KJ7 C;  1JCC A;  2KUB A;  2E5T A;  3HRN A;  1N73 A;  1PGQ A;  3RK2 D;  3L75 E;  3SWY A;  2IYO A;  1IJD B;  1IFI A;  4WY4 A;  1TU3 F;  2Q1K A;  3BCC E;  1FAV A;  2KZI A;  1R5L A;  3GHG C;  1BSN A;  4AYC A;  3S9O A;  1SQV J;  2LR2 A;  4UB6 E;  3A2A A;  2NPS A;  1FC2 C;  3L73 D;  5GTI H;  3AE5 C;  1FZG A;  1N86 A;  2YMY A;  3M9H A;  4B86 A;  5KLI B;  1L0N D;  1MZ9 A;  1L0L E;  4U3F E;  2FFD B;  2YIU C;  1Z56 A;  3RGU A;  2HG5 D;  3PRJ A;  2M3B A;  2KYV A;  2ZXX A;  5AVV B;  5M1B A;  2YXR B;  5AW1 B;  1Q81 Q;  3PTZ A;  3GG2 A;  1ZR2 A;  4D6T D;  1NTZ D;  1HGZ A;  2GM4 A;  2B87 A;  4JF7 A;  1PIX A;  3SFE C;  1BSH A;  1CI6 B;  3T97 B;  5KLV E;  3CCS P;  1SQQ G;  2L91 A;  3D6Y A;  3VTP C;  1LTT C;  5AW7 B;  1HBW A;  2GA1 A;  3L37 A;  2ZT9 B;  5AW2 B;  1AVY A;  1IFJ A;  1GDT A;  2G8Y A;  2AXT E;  1QVF O;  5DJT B;  1QVG O;  1LGH B;  2RN0 A;  1A02 F;  1CI6 A;  1DEE G;  1LTA C;  3USS A;  1VQ5 P;  3CX5 H;  3Q3D A;  4H13 B;  3HTK A;  1LNQ A;  4H44 D;  3HUS C;  3L72 G;  1DX7 A;  3TYY A;  2JEE A;  5APX A;  1OWA A;  1GZL A;  3V2P A;  1M8O B;  5AW9 B;  1GU5 A;  1SS1 A;  3H1K E;  2IDB A;  2KXP B;  2A45 H;  2H7H A;  1NTZ G;  1RF0 C;  3NTN A;  2M0B A;  1H0T B;  3EFG A;  2JR8 A;  4K3A A;  2C9L Y;  1GTW A;  4U7J A;  2XKM A;  2GUV A;  2N9Y B;  5APQ A;  1SP4 A;  3HD7 B;  1IFM A;  3ITK A;  4I1L A;  1WT6 A;  4NPF X;  2YKO A;  1H0T A;  1ZXG A;  2KS1 B;  2CPB A;  2YKP A;  1JO5 A;  2HOD A;  1K8A Q;  3HD7 A;  1M1J C;  3L4F A;  3W68 A;  1KC8 Q;  3M06 A;  5E79 E;  3I55 P;  2QJP C;  5CCH D;  3TSI A;  1SQV D;  1OMI A;  2K88 A;  4H0L B;  1ZLL A;  2KS1 A;  3TGU E;  1OVU A;  1VQ9 P;  1JEK A;  3NMD A;  1VL2 A;  1OXZ A;  3FXE A;  1BGY J;  3L74 J;  5KLV K;  5B66 E;  1SQP E;  5CMZ A;  4DCK A;  1RH5 B;  4IL6 E;  3KQG A;  3D70 A;  2PGD A;  1Y8A A;  4JYB A;  2OYI A;  1MFT A;  3TDK A;  1LWU B;  1G2C B;  2PFX A;  3H32 B;  1FS0 E;  2K37 A;  4UB8 H;  1S5L X;  1ZME C;  4EI2 A;  1NVO A;  3L71 G;  1NTM J;  2L5G B;  3LIE A;  2WMM A;  2NRG A;  5L8R J;  2P10 A;  5GTH H;  2FYU J;  2YMK A;  2IFN A;  1LWU A;  1G2C A;  3AE3 C;  3VYI A;  3L73 E;  3H32 A;  1L0N E;  1LTJ C;  4PV1 D;  1A02 J;  3WU2 E;  2YO3 A;  3C8V A;  3A0H H;  2BEQ D;  1P84 D;  5TIS H;  3JCU E;  2E74 B;  3D6Z A;  4I2L C;  2DW3 A;  3WMM 0;  2FYN C;  2QJY B;  4D6T E;  1T3J A;  1NKN A;  5BU8 B;  3AE8 C;  1RE4 A;  3V2R A;  1VPC A;  3B5N B;  2O01 H;  3H1L D;  2ZXE B;  5KJ7 D;  3Q5P A;  1NO4 A;  2BCC E;  1L0L D;  2E43 A; 
#chains in the Genus database with same CATH homology
 1NTM J;  1KYO I;  3L70 J;  1BE3 J;  3H1K J;  3TGU J;  2BCC J;  3H1H J;  3L75 J;  1KB9 I;  1PP9 J;  1SQP J;  1EZV I;  3L73 J;  5KLV J;  3CWB J;  3H1I J;  1BGY J;  2FYU J;  1NU1 J;  1SQV J;  3BCC J;  1SQX J;  1BCC J;  3L74 J;  1NTZ J;  1SQQ J;  3CX5 I;  2IBZ I;  4D6T J;  1L0N J;  4PD4 I;  3H1L J;  1SQB J;  3L71 J;  1P84 I;  3CXH I;  1NTK J;  3L72 J;  3H1J J;  4U3F J;  1L0L J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...