2J5UA

Mrec lysteria monocytogenes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
210
structure length
210
Chain Sequence
b'TENQHLKERLEELAQLESEVADLKKENKDLKESLDITDSIRDYDPLNASVISRNPTNWNDQVEIDKGSSDGVKPDMAVTTPSGLIGKVTTTGAKSATVELLTSSDVKNRVSAKVQGKENAFGIINGYDSDTKLLELKQLPYDMKFKKGQKVVTSGLGGKFPAGIFIGTIEKVETDKMGLSQTAFIKPGADMYDLNHVTVLKRSAEAGTTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MREC PROTEIN
molecule tags Cell shape regulation
source organism Listeria monocytogenes
publication title Dimeric Structure of the Cell Shape Protein Mrec and its Functional Implications.
pubmed doi rcsb
total genus 47
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04085 MreC rod shape-determining protein MreC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2j5uA01
2.40.10.340 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2j5uA02
2.40.10.350 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2j5uA03
3Q5PA 1DIPA 1EXJA 3D6YA 2QF5A 3G9RA 2OQQA 3Q3DA 3Q1MA 3D6ZA 3Q5SA 3T97B 1EXIA 3Q2YA 4R4MA 2J5UA 3IAOA 3D71A 3Q5RA 1R8EA 3D70A 4R4LA 2QF4A
chains in the Genus database with same CATH superfamily
1C5MD 1SB1H 3SQEE 2BXTH 2ZU1A 4XD7D 3UR9A 1O3BA 4BXWA 1SGYE 3BF6H 1BQYA 1NRNH 2R3SA 1Q2NA 3L72J 2KLVA 1DOJA 4WMDA 2ZPSA 3RDZA 2THFB 1TBZH 3SV9A 1P2NA 1NTZD 5APSA 1NTZG 2SNVA 3TIUA 1FV9A 4D6TD 2RCEA 1J14A 4JZEH 3RK3B 1QLED 1QEXA 4EOTA 1C5NH 1K04A 3A8DA 3OW2O 2WV9A 3GW6A 5JB8S 2A7CA 4X6NA 1Y3XA 1C1MA 3DCLA 2ITAA 1EDJA 4Z6AH 2G8TA 2K0QA 2P3TB 2FX6A 1AD8H 3KGPA 1NVOA 4Y7BA 3SV8A 4ISLA 3ZVEA 3RXCA 3GG2A 2NPSC 2OYIA 2A06D 5L2YH 1DD4A 3SNCA 2KM0A 2GZ9A 1FZGA 3OAKA 5KKZC 3BCCG 1AY6H 2Y5GA 3BSQA 1PGJA 3B8JA 2H2ZA 4ZKSU 3KZIE 3F6UH 2FBWC 3LIDA 1NTKK 5JBCS 2C0WA 2O8LA 3ZV8A 2WSEH 1ZSJA 2O8WA 3OY6U 1MAXA 2CF9H 3MH5A 2O1JA 4DT4A 3HD7B 2NU2E 1ETRH 1R8EA 3R2PA 3VMYA 1YPHC 4AG2A 3V0XA 4CH8B 1RGQA 1RTLA 3P6ZB 1L0ND 2M5AB 3BN9A 2GCTB 1RE4A 2AEJA 1AKSB 1ARCA 1K1OA 1O30A 2ZCHP 3EGKH 3CXHE 1L4AC 2ZDAH 4Y99B 4ZKPA 3B71A 1NKNA 4ESTE 2KAIA 1S9KE 1XUJA 3BVHA 1BTZA 3H6PA 3U98H 4A92A 2IPPA 3AE3C 4JYVH 2R0LA 3FANA 5AFZH 1KLTA 4ZXYH 1DSTA 5EQRA 5HYOA 1VITH 3GY5A 2R5BA 1JCCA 2BCCD 2EI7A 5KLIC 2DE8A 2JP3A 1IQLA 1GMDF 1QTFA 1W0YH 1M7LA 1KQGB 5F8TA 4BTIB 3CCRP 1NWQA 1OX1A 3O8DA 1XMNB 3L75G 4F55A 1IFIA 2JR8A 3L75D 2WZQA 2L74A 3H1KD 4LZ1H 1TLDA 1L4AD 3PM3A 1W0JD 4Z0KA 3AE5C 1O39A 4WXIA 3LJJA 4Q4LA 2BDHA 2F9NA 3KPEA 5KLVD 1O2UA 2VVVA 5CMXH 4CR9A 1O2OA 1GZLA 1ZV8A 1AZZA 4OS5A 1NTMK 2K1AA 2ANMH 1FIWA 4GSOA 1CHGA 1VQ5P 1C1WH 3OYPA 3A0BE 1T4VH 2GCHG 1ELDE 2W3IA 4UFGH 3HKJB 3CCMP 1AU8A 5EFWB 1JRSA 1T31A 3HD7A 4FUBA 3VB5A 2I6SA 3QTOH 1RQUA 1CGHA 3AE7C 3RM0H 3VN0A 1P2JA 2Z9LA 1EC5A 1SQVE 2FYZA 2WQYC 5L30H 4YXWH 2ZYAA 1W7XH 2HODA 1AVXA 3WWFA 2J97A 1NBME 2VGCB 1PP9D 1RE3A 3PLKA 1GHVH 1MTNB 1OKXA 1PYTD 5C17A 2D1JA 1HUCA 2KCAA 3ZZ9A 2Y0DA 3I78A 2QF3A 2Z6BD 2WT7A 2ZQ1A 3DHKH 4RKJB 1M1KQ 5FHTA 4BAQB 2G3AA 3L35A 4IL6H 1DLEA 2FYRA 1DX7A 4IGDA 4I7ZC 1S83A 1ID5H 1IFNA 3AE6C 1ELBA 1SGFA 2Q6FA 3K2UA 1A3EH 3H1LE 3SU3A 2GUVA 1GHBF 3OEED 5FCRA 2PGBB 1O3MA 1SQPG 1KYOD 1Y47A 2IX7C 4MNVA 3RLYH 5A8YA 4YTPC 3LGIA 1OZHA 1IFDA 2R5DA 2OTJP 3BCCJ 2WVRA 1FN6A 4A1XA 2I6QA 5LPFA 3CCJP 1S72P 1LO6A 2V3MA 1OP2A 4FVBA 4TT3H 5JPMH 2W7SA 3T28A 2E75D 1O5AB 4W7ZA 3ENSB 2OC7A 1LHCH 2LKMA 5HGGA 1T3UA 3KQEA 3P8FA 4Q7YA 1GG6B 1U6QA 1O32A 2BCCE 1V2JT 4DCDA 4I8HA 1BTUA 4NA7A 1TMBH 3LIEA 1P03A 4HYTB 1W5CE 3W94A 1T8OA 1N73C 1D3DB 1UTJA 1LTOA 4I8GA 3RXRA 3SJIA 2TIOA 3T26A 5KAFE 4RSPA 3M06A 2C0XA 1DEBA 3B5NB 2ZDLA 1B0EA 1JXPA 4BRYB 2WSCH 4H0LB 3L74J 3RK3D 1ESBA 1V2KT 1WYKA 2F4LA 4H44D 1CT2E 2ZG0H 1JY2O 3GDUA 2ZO3H 1A1RA 1IQEA 1NU1J 2YKOA 3VB4A 1FAXA 2BD9A 4ZKUA 5GTHH 5KECA 3N99A 2OK5A 3L75J 2JWAA 3GHGB 1EZXC 2BY6X 3UB0A 3L72E 1F0TA 1BZXE 4DW2U 1BGYE 4JCNA 2AYWA 2HLOA 4FVDA 3EDXB 1X7AC 4IC6A 1PPZA 3UIRA 2E5YA 1AGJA 2A45I 2GMTB 2Y82A 3GLMA 1ABIH 1RE3C 3MO9A 5CCGC 1C4U2 1USDA 3RK2D 1AFQC 2XBXA 4PROA 4OS4A 3HUSC 5IDKA 3MD0A 1MQ6A 2W8ZA 1UVPA 1HBTH 4MG3A 4UE7H 1GL2C 2Q6DA 3S9OA 2Z4EA 1LDTT 1NESE 5DP9A 4K60A 3O6QB 1MKXK 2STBE 1VR1H 2OTKE 1GMHG 2BEZF 1SFCA 1TGTA 1O3LA 2WPIS 9ESTA 1IQMA 1ZJKA 1AJYA 3D23A 1YITP 1F5RA 2A5KA 3TNTA 3SU2A 4Q7XA 3TK9A 3P8OA 3M3TA 1MTWA 1PP9J 4M3LA 1P2QA 1HVVA 1LVBA 3OSYA 3LONA 1LCYA 3TGUG 3LGUA 2BY9X 5FXLA 1GHAG 4TWWA 3P17H 3KEEA 2IJOB 4XA4A 2QA4P 5FPYA 2HNTE 3A8BA 3LH1A 1C2IA 5K7RA 4NPFX 1NTME 4BOHA 1S5LE 2FXMA 3GY6A 1A7SA 1S0RA 5EJLA 3UQOA 2A7HA 2RA0A 3BEFB 3DD2H 2FWWA 1VKYA 1GBHA 3Q5SA 1GI8B 1OHHD 2BYAX 2JDID 2XC4A 2ZGHA 3NK8A 4LGDE 1S6LA 1Z8IB 2BVSH 1EB1H 3V12A 2FMJA 5JDUB 1RF1C 4X1PU 2FYUD 5EODA 4HGCA 3MTUE 1UMAH 4JZDH 1OWEA 1C1QA 1YQ4C 1RQVA 2FYUK 5APVA 2JJ2D 2YNAA 4Y0YE 3CX5D 3E7KA 1LTGC 2G5NA 1AI8H 4IL6X 3A88A 4NPDA 5CCGD 4YT6H 1K28D 1W11U 3UWJH 4AFUA 5AVDA 1HIAB 2BASA 1S9KD 1L0ZA 1XVOA 3TK6A 4U01A 1C2EA 4WY3A 3HKIB 2YO3A 1PPEE 1TGCA 1YPJH 4NSYA 5J4QA 1KXEA 2ZVOB 2D2DA 1S1CX 2KSJA 1AQ5A 1TALA 2BY7X 3T97B 1YCPK 3ELAH 2ZDNA 1LHEH 4AB8A 1C2KA 2GM4A 1Q2WA 3BV9B 1THPB 1LKAA 1BBRK 1WBGB 2BD2A 2CHAB 1Z6EA 3F9HA 5HM9A 1HWTC 3KL6A 5EGMA 1QVGO 2FIRH 1O2IA 2GD4B 1F7ZA 2YKQA 4ZCNA 2HVXA 4D7GA 1TMTH 1Z7KA 2N1TD 4H13D 5DG6A 2WPMS 1K1JA 5APTA 3QO6A 5CHXA 3AE2C 2R32A 1DPOA 1H4WA 3S9CA 1NU1G 1ZOYC 3U59A 1GHXH 1GJ5H 2K9JA 4E7NA 2AXTE 2HNTC 4MLFB 1IFMA 1N2DC 3LW5H 1XUKA 1VQLP 4RO0A 1DLKB 3BG4C 4AFZA 5GCHF 2XU6A 3NMDA 2WV5A 2Y0EA 2Y7XA 2Y7ZA 4X1QU 3STJA 5DP3A 3H1JD 1DY8A 2KYVA 4Y99C 3PV2A 3PTBA 2OC0A 2Z3CA 2W6BA 1W0KD 3QK1A 2H43A 2A4GA 2ZJSE 1CGIE 1M1JC 4C7RA 2ODQA 1L0LE 2GV6A 1J16A 1H9LB 3GMAA 2ZEBA 4PD4E 2SGDE 4AZ2B 4U7JA 2QA9E 1Y3WA 1C5WB 2W6AA 3AVZA 4I7ZB 4BAOB 3CWBD 3E8LA 1TPPA 3TGKE 1O3CA 1ZRKA 5HMAA 1FDOA 3RUOA 1BBRE 3RK2C 1W3CA 3RXUA 1TFXA 3RXIA 4JK5A 2E42A 1YJWP 3II6A 4I32A 3E3TA 5ESBA 2JKVA 4OH8B 1NT1A 3SHAH 1LMWB 2QXJA 4UONA 4XBCA 1JY3P 3D71A 1BITA 4O3UA 1O2RA 5CHAC 1UVSH 2AGEX 4IMZA 3HGNA 4ASWA 1BRCE 1GI6A 4ZUHA 1EZVI 4IN1A 4YO9A 2D8WA 1SR5C 2BXUH 3PLNA 2V7QH 4DOJA 2A45B 1KILD 3Q76A 2W5EA 3SHCH 1FY4A 1WSSH 1UIIA 2E75B 2PUXB 4JF7A 1URQD 2WSCJ 1T7CA 2BX4A 3GOVB 3AECC 1CVWH 1AUJA 3AE8C 1NN6A 3H1IJ 1A0LA 3A7XA 1GHBG 2JH6D 2VNTA 1Q3XA 7KMEH 1EJNA 5EXNA 1XUFA 2E76D 2GJGA 3SZEA 1V2TT 1SQQD 1YQ3C 4QMAA 4UB8E 1EAXA 3NXPA 2VBCA 3P8CD 1XUIA 3W1EA 1O3PB 1G3CA 3U8TH 2VVCA 3FZDA 3E1IA 5AVSB 1X22A 1VJAU 2QIWA 1ZRBA 3SW2B 1W2KH 3P8CE 2GZ8A 2NU3E 2SPZA 1ZZZA 4LXBH 1KILC 3L73D 2UUYA 1UVTH 1FY8E 1CO7E 3A7TA 3OU0A 2ZFQH 4K8YA 1NH4A 1LWUC 3S69A 7GCHF 2VJ1A 3P32A 1HYLA 4GHTA 1O5EH 2V6NA 2V0BA 2R3CA 4ZHLU 4CRDA 3OTJE 1NROH 1HJ8A 1G1IA 1UTPA 1HAXB 3M7TA 4PD4I 4N6JA 2LR2A 1GI0A 3TK5A 3MZWB 6LPRA 3SUEA 1AFQB 3MH4A 3SU1A 4K1TA 1NTMD 2A4RA 1OOKB 7ESTE 3RK2B 1G2LA 1Z1JA 1TQ7B 3FKSD 3V2QA 2LNCA 1FMGA 3V5BA 1HXEH 1BB0B 4B74A 2AGIX 2AXCA 2A45H 5CHBA 2EI6A 1HB0B 3EE0B 2V3OH 1SMFE 1F5KU 1GJBB 4NZLA 1GGDB 4WH6A 3NKKA 3MO3A 1CHOG 1J15A 2ZA5A 4DJGA 3BIVH 3MNSA 1EZVE 3MO6A 1UTMA 4YLUA 5KTBA 3QDZB 5JBAS 3A87A 1SFCC 1U7MA 1YI2P 2A7JA 1AO5A 1BOQA 1PFIA 2XW9A 1SQBD 2WUBA 2SNWA 2KCOA 5APUA 5A8XA 2ZP0H 2SGEE 4HJGH 3A2AA 3H1HD 4X8UH 1EUFA 2B9BA 2P8OC 2LELA 1KILB 1BMMH 2RDLA 1YJNP 1P84E 1BGYG 3MP7B 1FZCB 1KQLA 1Y3YA 2A4OA 4I8LA 4UFEH 4MPVA 2GUSA 1ZJDA 3PLPA 1X9VA 3F2HA 4KHXA 2GKVE 3BEUA 4E7RG 4PV1C 4L76A 3GY2A 1HAOH 2K9JB 3RXLA 3GYMA 4CHAB 2PSXA 1O2WA 1HUTH 1C4Y2 1V2WT 1Z1IA 1P11E 2GP9B 2YO2A 2YXRB 1AE8H 1YPHE 3E90B 3UUZA 3S9BA 2HGTH 1PQAA 3TDKA 2BQ7B 4Q80A 2ZDKA 3A80A 3QN7A 1L0NE 1O33A 5DJUB 2BCCG 1BHXB 1UHBB 1URQC 1WT6A 1K1LA 3HTKA 2FO9A 1PQ8A 2QJYC 3P92A 1TWXB 1EXFA 3OA7A 4F49A 2WTYA 3SGBE 1S5LX 3L3TA 2CK3H 1DWBH 1S84A 2JH5D 4Y7AA 3H1KJ 1SI5H 2XNXA 1P9SA 1NGMB 2BQWB 2OBOA 3ZVCA 1ZTLA 1HIAA 1SQBK 3OEHD 4YLQH 5FBIA 1SQPK 4DG4A 1WTGH 3E0NB 1CSOE 2XNDH 2VIDA 2FOMB 2ZCKP 1IQIA 2XBWA 1IQHA 1O2ZA 3MU5A 1C9PA 1DS2E 4VGCC 4Y71A 4AG1A 2FY8A 3E0PB 1MKWK 4H42U 4BAHB 2F9VA 2M3BA 3H32A 1DWEH 1K21H 4YESB 1E79H 3WUTA 4X1SU 4A1TA 1SGTA 1AV1A 1P84D 2BOKA 4TPYA 5C1UA 2E43A 5EPNA 1CT0E 1HGVA 3IF4A 1QGFA 2C9NY 3FN8A 1GI4A 2OQUA 2Y6TA 1AB9B 5DO4H 1P05A 5C0UA 7GCHG 4F48B 3MU0A 1SVFA 4Y79A 5FPSA 2PGQB 1QVFO 3MNBA 4WVPE 3VXFH 5GXPA 5B66E 2WSFH 1P84I 2FESH 2QF0A 1SS1A 3VMAA 1BRBE 3GF7A 1PP9G 3SV2H 1V2RT 3PWCA 3ZZCA 1LPGB 2ZFRH 4AGJA 1QJ1B 1DUEA 1PGPA 3A8CA 5KLIB 1C4V2 1KIGH 1O3AA 2VB0A 3KHVA 2F83A 2ZTYA 5E2OA 2KNCA 2O8TA 1S6FA 1ETTH 1TRMA 2QYIA 3N7DA 3QLPH 1T8ZA 2ZHEH 2ZFTA 4UFFH 4Z1MH 1A4WH 2HLCA 1BE3J 1RY3A 2J34A 2E74C 1W0ZU 1GCDA 3D65E 3GCHC 6GCHG 1SLWB 1ANDA 5B6LA 3UOPA 4GIFA 4ASVA 5C67A 3G4SP 1O36A 4X8VH 3ZVFA 3ODFA 3L71G 3RL0g 1OIPA 1NM6A 4LZ4B 8GCHF 1GBJA 1O2MA 1GW4A 4DT0A 4HG6A 3LGVA 3URDA 1FAVA 3L75E 1SSXA 3U1IB 3SNBA 4I33A 2LXCB 1URQA 3GHGA 4IW4E 2VIWA 2KFWA 3PTNA 2JEEA 1GBBA 3CX5I 1DSUA 3I29A 2IZ1A 1KFNA 1T2KD 1K2I1 5LH8A 4X8TH 5C1YA 1FDPA 1P12E 2VINA 5KKZB 2F9BH 2MJZA 3AEFC 2KR7A 4HKZH 1PPJE 1HJAB 5EJ1A 2ZT9C 4MNWA 4XRNA 5SGAE 1TNKA 1LWUB 1ZN5A 1J2JB 1OWDA 1W2EA 1MKXH 1V2MT 3VB7A 2UUKB 2Y9ZA 2XRCA 4E05H 2QJKB 1O5DH 1NU1D 1UK4A 5AVTB 3RBXA 1P9UA 2IPHA 2H9EH 4K1SA 5ETXA 5CCHD 1MABB 3ZZ6A 2OTVA 5AHGH 3MOCA 5HXFA 3CCLP 2JWDA 4HFPB 4SGAE 4Y8XA 1SP4A 5AW5B 2XWBI 2ZXEB 1BE3G 3B5ND 1LTJA 3OTPA 1VQKP 1P2IA 1L1GA 3K6ZA 3RC5A 3SU0A 3H1HE 3N4XA 2M2AA 3STIA 1ETSH 3EFGA 3VGCC 2EQNA 2JIZD 2C8ZB 1NRPH 2FLRH 2OINA 1UCYE 1C5TA 3PTZA 3D49H 4JPZB 6CHAB 2XBVA 2QJKC 1H0TB 1TQ0B 5AVXB 1LP1A 1IK7A 1S5LH 2R3UA 4M7GA 1XKAC 2XBYA 1DUAA 1EB2A 1GJ9B 1TGBA 4OS7A 4Y6DA 3RXKA 3HUSB 2OQ5A 3TJNA 1MKWH 1Y8TA 1ZXGA 3WMM0 1O3NA 5CCHC 2FOGA 1SGRE 1BCCE 2WZ7A 1S0QA 3EFFK 2DE9A 4X1NU 3RMMH 1ELFA 5LPEA 1TX8A 4HH2A 5E0GA 1P0SH 1K0HA 2FTMA 1FZAA 1N7SB 4A7PA 1GMCG 3GY7A 2PAJA 1V2QT 4EI2A 1QCPA 1RXPA 3ZZDA 1CZQA 1T8MA 3EA7A 3RU4E 3P8NA 2A5AA 1L0LK 1GBFA 1ANEA 1P02A 3GCTF 1LHFH 1LT1A 4UD9H 1LTAC 1SQVD 1ACBE 1Y3UA 1IC2A 4BRYA 1PFXC 1CBWC 1L2EA 5FAHA 1OS8A 2HVYB 3CX5E 4ABHA 3GHGC 1MTVA 5C5OA 2EEKA 1E5WA 3CMEP 1GI7B 1SQVK 3L72G 3MI4A 1AVGH 4AB9A 1A61H 5AVRB 2FYUG 2VRSA 1NRQH 2G4TA 2PTNA 5BRRE 4UB6E 1W2BO 3KCGH 4Q63A 1YIJP 1AWFH 1C5QA 4E06H 1GI5A 3KNXA 1SQXJ 5TISH 4BAKB 1EX3A 3FZZA 1QRZA 2EY4C 1S6HA 1O2YA 1QL9A 1L2PA 1KYOH 3V2PA 2QM7A 5B6OA 2QXGA 2ALPA 2R9PA 1VDFA 4H44C 3L71J 3FVFB 2BD8A 1O2TA 2J92A 4W80A 4J1YA 1KLJH 1O3HA 5K5GB 3AE9C 1KDQA 5F03A 4CBNA 2W26A 1RHZB 2ZVNB 2FOHA 2RDEA 4XE5B 1TGSZ 2TGAA 3HK6B 2QF4A 1BCCG 1NHLA 3H1ID 1ZR2A 4X6OA 2QCYA 3SORA 1BDDA 1E35B 1YPKH 3ZVDA 1V2VT 1OWAA 1GJCB 3SBKA 1RRKA 5HM2A 4DCKA 1XKBC 8KME2 4JZ1A 1BHXF 4WY4B 1TBQH 2Z9KA 4GVUA 4BNRA 2NPSA 3H1HG 2OYIC 3A0HH 2DUCA 1PP9E 3TH3H 1FY1A 2HODB 4FUJA 1JMMA 1QBVH 4KJMA 4VGCB 1BTHH 2CN0H 2HPCA 3F5HA 3W67A 2HPCB 3RXTA 1JY2P 1QNJA 1OWJA 1V2ST 3QZRA 4QT8C 5KAIE 1X0TA 1SLXB 2STAE 2UUJB 1VITG 3A85A 4XE4A 3VTPC 3PMBB 4XSKU 1UCYH 3BASA 4ZMAH 5I46H 2ZFPH 3GYLB 4EDFA 1FJKA 2P67A 2XCFA 1Q82Q 2OYIB 3E16B 4JYCA 4GDOA 2J5UA 1EPTA 1G1JA 3RL0D 1O2LA 1NFXA 1AVOA 2H9HA 1XXFA 4TYDA 4OS2A 1C1RA 1QRWA 2GDDA 4RKUJ 1BRAA 1HAGE 3F3BA 1Z71A 2A2XH 1YKTA 4Y28J 4K69A 1SGDE 2OD3B 4B2BA 4PV1B 1KB9I 2AIQA 1GBEA 2QN5T 1ZTJA 1ZYOA 1SQRA 1UJ1A 4ISNA 1M9UA 1MBQA 5H4IB 4D6TG 3MQKC 2FEQH 2KK7A 2XNIA 2FLBH 1LT9B 3CX5H 3HRNA 1SGIB 3UFAA 2P16A 2YIUC 2Z5HA 4L75A 3L71E 3FP8E 1GI1A 2O3JA 1NZQH 1LTBC 3E6PH 4U32A 2ODYB 1WMKA 1MCVA 5C3NA 4CR5A 2ZPRA 1KORA 3O8ZA 3EQ0H 1V2LT 3AE1C 1KXDA 3TNUB 2KXPB 2OTLP 2ZHWH 4FUHA 1GBKA 1UTKA 1GVLA 1O2VA 3V7TA 1XM1A 2BY8X 1HAIH 3L36A 1BA8B 1O2NA 4HI3A 3RXFA 3UIAA 1ARBA 1KYOE 2FFDC 4B86A 3Q3YA 9LPRA 1VQPP 2EC9H 4JZFH 1NFYA 1FX0B 1K9MQ 2CGAA 1GGDC 3V2RA 4B75A 4GODA 3K65B 1S2EA 3HD7C 2PKAB 2K88A 4N3YB 2O8MA 2KUBA 3RL0C 3RXHA 5EQQA 2V7QJ 3ZVGA 2E74B 3CCEP 4Q2KA 3SGAE 3E91A 1TX7A 1JMOH 3ZZAA 3RXAA 3LGTA 2ZYGA 1THRH 1ZPZA 4MNYA 4YTAA 3BG8A 1ZPCA 5BU8B 3LDXH 2WPRA 1WDIA 5DKMA 3OX7U 5KLVG 4X6PA 3NPSA 3PROA 5TCCA 1C1PA 1ZSLA 3VP9A 1BCCJ 3SU4A 1FJPA 1M8OB 1C2HA 1GG6C 1QHRB 2ZGCA 1GDTA 4AOQA 1X8YA 1CA0C 1LP1B 2Y0CA 2B5TB 1Y59T 5EXMA 2WINI 1HAVB 1PYTC 4RKOB 1OW7A 1FS0E 2ZU5A 2KI7B 3AE4C 5M1BA 5DP5A 4DJZB 1ZR4A 2QXIA 5DP6A 5BPEA 3TJVA 2YIUB 1WQVH 1J1EC 1LTJB 2D2CC 1TNIA 2P95A 1RIWB 1BTYA 1JOUB 1SQXE 1K1MA 1O35A 3RXOA 4FU7A 1XUGA 2H5DA 4AX9H 4B6FA 3GISB 5APYA 3ATIA 5CDFE 1SGFG 1VQNP 4JYUH 2EI8A 3BRVB 4FUGA 1Y9BA 4JBZA 1TABE 2BB4A 2H9TH 1MUEB 1PPFE 2FOEA 3MHWU 3N7EA 4OGQC 4NWLA 3DT0H 2ZECA 1KTMA 3JZ2B 1CBWB 3M7UA 4XFQA 2WPDD 1LHDH 1QY6A 3Q1MA 1WU1A 2G55A 1SVPA 3T29A 2ASUB 1D3PB 2H88C 1C2MA 1OW8A 2Z5IA 1FONA 1HPGA 2BDYA 4LOYH 3CXHD 3ZZ3A 5GNDA 1MZ9A 3RXEA 2XDJA 2P10A 1S82A 1KYOI 3ATLA 2QJYB 3FWLA 2KSEA 5CBOA 5GTHE 4OWFA 2IOTA 4ABEA 1EOLA 3QGNB 3IN6A 1FJSA 1FDIA 2FOBA 2QE7H 2UWOA 3VP8A 3H7TA 2IPQX 5FX5A 3TJOA 1BJVA 2M3EA 1VJ9U 1KSNA 4KELA 1ZHPA 1TRYA 3F9GA 3PO1B 5C20A 1WOFA 2FS8A 1RD3B 1TOCB 3SJ9A 3ZZBA 2RMZA 3S9AA 2O1KA 3M5LA 3PMJA 3TGJE 1ANBA 1JO5A 3ODDA 1RS0A 3SNAA 3GCNA 3UNRA 2SFAA 3BTME 3HE4B 3LW5J 1LNQA 1FZFA 1IAUA 1SGCA 2XXLA 4ZKRU 2YNYA 5DP8A 4GHQA 3QWCH 1EP5A 1BDAA 1MZAA 2ZYDA 2QSIA 1VITF 4PJ0H 3TYYA 5JBBS 1RF0A 3QWOC 3K5BA 4ISHH 1SFCB 3HE4A 3AEAC 1GTWA 1DIPA 5AVYB 1OXGA 3A7VA 3LGWA 4YPCA 5T6FA 3A81A 2AERH 2AH4X 1L0NK 3TJUA 4GT1A 1NFUA 3EA9A 1O38A 4ZKOU 3LGYA 2OYHB 3JZ1B 1HAVA 1SG8B 2G51A 3CXHH 1FAKH 1JY2N 1LVOA 1FZBA 2P3UB 1DX5M 4Q7ZA 1NO9H 2AMPA 4RJTA 5CJ4A 2Q3EA 1JBUH 1GI2A 1KD1Q 1AN1E 3WY8A 1MTSA 1R5LA 1LPZB 1Z8JB 1LTIC 3S4RA 1ZHMA 1SL3A 2KOGA 2A32A 1FDMA 3EYDA 4NFEA 4ZAEA 2V3HH 3CPWO 4AGKA 2J59M 4R0IA 3BTTE 2FZZA 3KQCA 1YJ9P 2K8IA 1SQQG 3KZIH 2SGAA 3GICB 3MWIU 4K8BA 3RMLH 1EXJA 3M36A 4M9FA 2IDBA 2IYPA 2DW3A 1FY3A 1WV7H 3HE5B 3V4QA 4AORA 5EXLA 4ACBA 5LPRA 1L0LJ 1G2CB 4OGQD 3ZZ5A 1IHSH 5FBEA 4KTUA 1L1JA 2JJLA 1TPSA 4AYYB 2JKHA 5GIBA 3KYFA 3RU4D 1GBCA 3KIDU 3TGUJ 5DGJA 4I31A 1F0UA 4NIVA 1U7JA 3A0BH 1ELTA 3M9BA 2P7JA 2ZU3A 1DEEG 3TLOA 3DSOA 1J17T 1LT9C 2TBSA 2ZFSA 1BUIA 1QIXB 1GU5A 5AW3B 4FXGH 1GMJA 2OGUA 3CL3D 1AB9C 1QL7A 1B0FA 2NZ2A 3O8BA 4TPIZ 3G01A 4HTCH 3V13A 3L4FA 3NFQA 1UCYK 1SC8U 4K2YA 2J9NA 4PD4D 1G3DA 1UVOA 3AAUA 1BMAA 1HJ9A 2AMDA 1MD7A 1FZCA 1WXRA 3CMAP 1CA8B 3RXMA 2XOKD 1GL0E 2P59A 1L0NG 3SN8A 2P1JA 5FCKA 1KXBA 1SQXD 3CP7A 2P8OB 1YLDA 3H1JE 1SQQJ 1P04A 2A1DB 4CRCA 3L70J 1GL2D 3HATH 2BMGB 2B7DH 2R3YA 5ABWA 1L0LG 2XC0A 1AFOA 2FI4E 1NU7B 3P8MC 2FOAA 2L6OA 3SWYA 5F6MA 1C1SA 1BSNA 1HJBA 3H1KE 2HALA 2UWLA 4FUDA 4WWIA 2HG5D 1VF5C 4PJ0E 3CD6P 1HH0A 2QG4A 1ELEE 1A3BH 2KP8A 3AEEC 1GWAA 2AFQB 1KQSO 2PKAA 3K9XB 4NSVA 2UWPA 3H1HJ 1YLCA 3PYHA 2IFNA 4IFFA 2NWNA 1FY5A 3R3GB 4WY4C 5E8EH 5CMZA 1AMHA 1VCPA 2LPRA 2RG3A 3E1RA 1L4DA 1MBMA 1P09A 1SLVB 4H4FA 4INLA 2WMMA 5EW2H 1WQSA 3F9EA 4PV1D 3IFMA 2GT8A 3L73E 4CRGA 1C5YB 2QXHA 2CPSA 3SFDC 1EAWA 4BXLA 5TJXA 2C9LY 3UAIC 2CJIA 4INHA 2WSSH 4K3JA 3GCOA 3OJAB 4IFDK 1Q86Q 1EZVG 5HIZA 3TU7H 3MNXA 1CT4E 2HFED 2G5VA 4OGYA 4HZHA 2R44A 4K3AA 4B76A 4CH2B 1HJ0A 1JM0A 1PZQA 1ZHRA 1T2KC 4AN7A 1OWIA 4JYTA 2C90B 3ZIAD 2FYUE 3FGAD 1QB1A 4X2VA 3C9IA 1VZQH 2H5CA 4ZROA 2BDAA 4B71A 2A31A 1Y5AT 2F9UA 3RXJA 1YYCA 3BTKE 1SLUB 2BM2A 1R5SA 2WPLS 3C27B 1PPBH 1SQXK 2FM2A 1HGZA 3SWKA 2J4IA 4WJG2 3ESTA 4HB1A 2ANWA 3QZQA 1TX6A 5AFYH 2ZPQA 3PMAB 2HLDD 3Q2YA 1AQ7A 3KF2A 3RMOH 1SGPE 1GI3A 1AKSA 1HDTH 5AVZB 1O5BB 2KIKA 1EZVD 2M5AA 3WU2H 4DIHH 1OWKA 2SGQE 4UB6H 2BEQD 1YTZI 2BLVA 3ZZ8A 3S7HB 2E5TA 3L37A 1CHOF 2QGRA 3TVJB 1FU1A 1SQAA 2IZ0A 2V35A 3LJOA 2RN0A 4RI0A 2OCVB 4TSFD 3SUFA 3MMGA 3ZZ7A 1B5GH 2D2CD 1BMLA 5B5EE 3Q3KA 2FTLE 2TGPZ 1KMIZ 4Y0ZE 3PMHB 1RF1B 1F0RA 1QJ6B 1OP8A 4YOJA 1YP9A 1OFCX 4C7NB 4FUFA 2AHME 1ZW0A 3U8OH 1AIXH 2ALVA 1JRTA 4WMEA 1GJ7B 4DVAU 4B1TA 2PRRA 4PD4H 1VGCB 5C94A 3GY4A 4BTTB 1MMJN 1ZLRA 4F4OC 1O3GA 3FWNA 3CC4P 4A7IB 1BGYJ 4X2XA 3A86A 2ZDMA 2YXQB 2CV3A 1MAYA 4U2WA 6CHAC 1PQ7A 1SBWA 3FP7E 5E79E 1TNJA 3LC5A 1JNMA 1EPTC 2ZGXH 2WPHS 1GHWH 1Y8AA 5DSFA 1JTHA 5B66H 2KB7P 3VG8A 2WSFJ 3D6ZA 1ZR0A 1YBKA 3F89A 1GL2B 3VMXA 1VQOP 1SFQB 1Z8GA 2QJPC 5JBTA 3ATKA 3UNSA 2C8YB 5K0HA 3LOXA 1SQQE 4GCHG 2JJ1D 1DD3A 3TH4H 4H0LD 2BDIA 5EW1H 3ZVBA 1O2KA 1E1RD 2BLQA 3DA9B 2GDEH 2C8WB 2G52A 1GK6A 1SQXG 3U8RH 1SQVJ 1H8AA 1EASA 5L6NH 1AFEH 2BD4A 2A06G 2F9PA 5EIYA 2Z7FE 4GPGA 1EQ9A 1HAPH 1IK9A 1C2LA 1C5RA 1MQ5A 1L4AB 1S85A 4TY6A 2A4QA 2ZTXA 1W13U 4XDEA 3L73J 2XV5A 1H9IE 4WF8A 2QVAA 1JMBA 3GDSA 3USSA 4D6TE 1S5SA 2BX3A 1J8AA 5CBNA 5J4SA 1VCQA 2BLWA 5DJ7A 2ZFFH 2Q6QA 4WXVA 5AW4B 2Q9IA 1AVWA 1SGQE 4RN6A 2FFDA 1N7SA 2YMSC 4U3FD 5KLVE 3CC2P 1D3QB 3BTQE 4MDSA 2LP6A 1IQFA 1ELVA 3GY8A 3AEBC 2XWAA 4FU9A 4RESB 3D70A 2BVXH 3DFJA 1GMCF 1QX8A 3HUSA 1BRUP 1FPCH 2GZ7A 3LC3A 3PRJA 1Q90D 2Y5HA 3SO3A 2RH0A 3M5MA 1MCTA 3H1LJ 4CRBA 3T27A 1NTKG 5IK2D 2C4FH 1Q31A 1DANH 2WWWA 4WH8A 4GCHF 4YOIA 3C8VA 3WU2E 3L70E 3U1AA 3UOUA 4IN2A 3F68H 2PLXA 1SQPD 3F1SB 1KQFB 1Y5UT 5B5EH 2QJPB 2PW8H 3VB3A 1ZGIA 3L74D 1AWHB 1SFIA 2FYNC 1SQBE 3WUUA 1A5GH 1RJXB 4W7YA 1YCPM 3BTDE 1FNIA 2P2UA 3VYIA 3SSUA 2CXVA 2ZHDA 1KTTB 5KLVK 2YNBA 2NU1E 7LPRA 2KCYA 2OXSA 5EOKA 1VPCA 2IJD1 3R4YA 1CE5A 2FYNB 4IL6E 3RXQA 1WAYB 4MVNA 3PRBA 2YOLA 5T6DA 2E76B 1IQNA 1C5VA 4FUCA 1NOHA 1DM4B 2OBQA 3H32B 1QZ8A 2D26C 3T2NA 1JCDA 1EAIA 1C1OA 1CGJE 1FI8A 1K1NA 1YPEH 1ZSKA 1UW7A 4A1VA 2XTTB 1O2SA 3M91A 2ZHFH 1PPGE 3HK3B 1E1QD 3OFND 2PSYA 1SQPJ 1P84H 2CPBA 3KDPB 1IFJA 4UB8H 2FKWB 2FI3E 2ZT9B 2J95A 2KCPA 4NCYA 2Q6GA 1BCUH 2YKPA 4NIWA 3AW0A 4I86A 3GCTG 2GTBA 3ZVAA 1GCTC 3M3VA 4D9RA 3SFEC 1B7XB 1MZDA 3SWFA 3Q3DA 1YLNA 5AF9H 1C5OH 4AFSA 2BDCA 1NRSH 2QEXP 4DT7B 3LKWA 5E2PA 2E76C 3KQDA 4P02A 1QURH 3P95A 1AZ8A 5L2ZH 1A46H 2QAAA 3L70D 1SQTA 4I1LA 3SI3H 1P3CA 3B5NA 1DVAH 2PKSB 4CPGA 3L74E 3IG6B 3GCHB 4CHAC 2K3RA 1QJ7B 5AW7B 5ESTE 5GTIH 1NTKD 2P94A 1N8OB 1O5FH 2BLOA 2FI5E 2V7QD 1AUTC 4O3TA 3TGIE 4ABFA 1V3XA 2A45G 5TISE 5APXA 2KS1B 1TMUH 2BY5X 1BTPA 4THNH 2YMKA 1IQJA 1G36A 5AW0B 3JC22 4I6MC 1D4PB 3V4WA 1FZEA 2B88A 1GHAF 3L74G 2BZ6H 2R0KA 4K1EA 1C9TA 2ULLA 3PP5A 3U1JB 1DY9A 3L73G 4JZIA 5HKKD 3G3ZA 1P57B 1GDNA 1BMNH 2ZNKH 1MU6B 1OVRA 2G8YA 1GD2E 1JTHB 1NRRH 4BANB 1RF0C 1NPMA 2L5GB 3GF3A 1K1IA 4AFQA 1D6WA 4N78E 1J1DB 3S0NA 2Y5FA 3MU4A 1OPHB 3ZZ4A 1NTZK 1YC0A 4RT1A 5A2MH 2VIPA 2VIOA 4KTSA 4RT0A 1ZRTE 5AW6B 2ZTZA 2PP6A 3JCUH 3N7NA 1FOSF 1GDUA 1LQEA 1MUUA 5AW1B 3F2GA 3HGPA 3AAVA 1KTSB 1YGCH 1GJ6A 1NS3A 5A8ZA 4WWYA 1SQBJ 1ZLLA 3FO8D 1MV8A 4ZNCA 3A0HE 3F0OA 4D76A 1O2QA 1QL1A 2JETB 4IS5A 3M35A 2VGCC 4X2YA 1PIXA 2OYOA 3H1JG 1YYY1 2Q3IA 3HTKB 1TU3F 4C7NA 1NYHA 1KXFA 2BZAA 1G37A 4GAWA 1JY3N 1GCTB 2BD3A 2B9LA 3C1LA 2FXRA 1MTNC 3SUDA 2RFKC 1DDJA 2G4UA 3SJ8A 1N73B 5C5NA 5FX6A 2FOFA 1C2GA 3TNUA 1LGHB 3AEGC 2BOHB 2GA1A 4P00A 6GCHF 4MN4C 2J94A 3Q5PA 1DH3A 1UO6A 1RE4C 5CJ0A 2GCHF 2ZZUH 4ISIH 3PHLA 2P3FH 3A82A 3EA8A 4MNXA 1QFKH 1DXWA 2ZKSA 4ABJA 4ABGA 2WYGA 3RXDA 1IFPA 1C5SA 4AUWA 3CI9A 2F91A 4FOUC 1YF4A 2WV4A 3PRDA 1QB6A 5CE1A 2H89C 2P58A 3SU6A 1BIOA 1VL2A 1IJDB 5FPTA 1KILA 3SNEA 1GL1A 1MH0A 1J9CH 5DK1A 2J98A 5BVZA 4JYBA 3DFLA 3W95A 4ABIA 1PPCE 2N9YB 3LH3A 4ABAA 3SQHE 3FXEA 5G4BA 1L4ZA 3FP6E 1FZZA 1C2JA 1H9HE 4Y8ZA 1DT2A 1U57A 1AA0A 3BRTB 3U28C 1SQOA 3T62A 2FP7B 2J38A 1CA0B 3TNSA 3PWBA 2ANYA 1F5LA 4MTBA 3M5OA 2KAIB 1K1PA 1IQGA 3GS9A 1VQ6P 3U9AH 5T6GA 1HRTH 1GBIA 3CCVP 3MU1A 3Q5RA 4FUIA 3I77A 2ZCLP 3QX5H 4DY7B 3UREA 2A06E 5GCHG 1EP6A 1D3TB 2HPPH 1MU8B 1CSBA 1EDIA 1RTFB 1X79B 2ESTE 4KTCA 2WSSD 4CBOA 1GVKB 1F92A 2WSEJ 1N1LA 1FQ3A 1K22H 1S81A 3BTEE 4YOGA 1V2OT 4AYVB 1S4XA 1NU1K 5DJTB 3A5TA 1ZMLA 2O01H 3A83A 3H5CB 2Y81A 4KKDA 2XKMA 1FXYA 4ZH8A 3SJOA 1PQ5A 1VQ8P 4WB4A 3S1KA 2ZHQH 2FX4A 2W7UA 1LHGH 3OAAD 2J58A 3ABVC 3TF5A 1W14U 5KGOA 2OYHC 1YM0A 1Z8RA 1WTHD 3P7KA 1O31A 1DWDH 4IMQA 4I7YH 1HF9A 1JIMA 1GJ4H 1TAWA 3BG4B 1GBDA 1XX9A 3RM2H 3H25A 1ESTA 6ESTA 3PH0A 1INCA 3U1CA 5GJ4B 1S3JA 2OP9A 1WRGA 4XBBA 2Y80A 3M0DC 2J98B 1TPOA 3PV4A 1QA7A 1C1TA 2YMSD 2W83C 3ZYEA 2Q5UA 1Y5BT 1GMDG 3RK3C 2HYNA 4INKA 1SKYE 4ABDA 1TNGA 2CHAC 2ZIQH 3ZYDA 1TONA 2VIQA 1MKMA 1ANCA 3AASA 4O9VA 1N8OC 1Z56A 3WWBA 1PGOA 1FE6A 2HR3A 2ZT9D 1VQMP 1KY9A 3CC7P 1O3FA 1HFDA 4MPUA 1COWD 1P2MA 3O8RA 1MFZA 3E1XB 3U69H 2PKSC 4X6MA 5EU8A 1CW5A 3CS7A 1C5UA 1V2PT 1H8IH 4ZKNU 5A0AE 1EJAA 2E75C 3L71D 3VOPA 1OYTH 1HGTH 1O2HA 1G9IE 1NTPA 4L73A 2PTCE 3IR9A 1SPJA 3H1IE 1QQ4A 3IITA 1BDCA 1NFWA 2ZU2A 3EAJA 1HAHH 3VEQB 3JSVC 4ABBA 2VWOA 2VU8E 4ASUD 4GOEA 1LVYA 2GGVB 4NZQA 5E0JA 5H2FH 1EXIA 1LKBA 2XCNA 1PL5A 5AVQB 4OVNF 1HBWA 1A0JA 2IYOA 1N7LA 2ZGBH 3SJKA 2R2WU 3CCSP 2G00A 1IQKA 1N8RQ 4GUXA 4LK4A 1PPHE 2LXBA 1KC8Q 2C3SA 3NZIA 1OX3A 2ANKH 1NBMD 1HLTH 1EFRD 4I8KA 1GMHF 1GHYH 1ZTKA 2J2UA 2Q7CA 1T8NA 3SZNA 1NTZJ 4LC1A 1H0TA 1A02F 2JETC 2KX4A 2PWXA 2AEMA 4D6TJ 2Z9JA 2B0FA 1BTXA 3B4SA 3HD7D 2K1QA 2RA3A 1UTLM 1TE0A 1K73Q 1KB9E 2P93A 3DSPA 3MH7A 1DITH 4JQ0D 5AW2B 2OYHA 2B8OH 1FZCC 2Z3DA 1K9OE 3CCUP 3SU5A 5EPYA 1J1DC 3NTNA 1GBLA 3LU9B 1IZNB 1HCGA 3RU4T 2HPQH 2SGPE 3UWIA 1SHYA 3ITKA 1YTZT 1EOJA 1O5GH 3UNQA 2OUAA 3MH6A 3MTYA 1GW3A 1C5LH 4O97A 1GBAA 4O9BA 1BJUA 2QF5A 3F0PA 1KLIH 4NPEA 2HNTF 3H09A 5C2ZA 3MU8A 3G9RA 4H44B 1K8AQ 2BCCJ 3BTGE 1QBNA 4BXSA 1HXFH 5C0TA 1UK3A 1HJAC 1TNLA 1C2DA 1YPGH 1OYQA 1TB6H 2YMSB 3V2NA 2Z94A 4TT3D 2TRMA 1T4UH 4TWYA 1O2GH 1N6XA 2QE7D 4IBLH 4YT7H 2B87B 2N1TA 1G32B 4AC9A 2PHBA 1HAZB 2QC2A 2Z3EA 3NWUA 4Y11E 1C1UH 1FPHH 5IYTA 3RXSA 1KZUB 1EZSC 2W3KA 5A0CA 1XTGB 2F3CE 3L33A 2BDBA 4TY7A 1NAYA 3RXGA 5A0BA 1KILE 5A09A 2WPKS 2FFDB 5LGOA 3A7YA 3O8CA 2TPIZ 2WUCA 2B87A 2N1TB 4H13B 4U3FG 4IFMA 3ZDMA 4BWNA 3W68A 1AE5A 1QR3E 1XXDA 4ACAA 4L74A 1OSSA 4BTUB 1V2UT 2M5TA 4BAMB 3TPIZ 2AS9A 2F9OA 3VPKA 1ELGA 2L91A 4R4MA 2C8XB 4YXWD 3WW7A 3SV7A 3RXBA 2MKVA 1K05A 4OGQB 1D9IA 3GY3A 1QB9A 1ORFA 3UPEA 4N78D 1NY22 3P8GA 5DP4A 5KJ7A 2ZDVH 1D6RA 4R4LA 3M3SA 4H6TA 2WPSA 1PPJD 2IFMA 1RIWC 5H2FE 2QV1A 4OS1A 4X0WU 2O01J 1YPLH 2OQQA 3OY5U 3RXVA 2VWLA 1TIOA 2I1KA 2FXOA 1DICA 3VGCB 3O6QA 1BCCD 3H1IG 3VMZA 1BT7A 4DURA 1HAYB 3CWBE 3H1KG 1P06A 4WY4D 1J1EB 1LTJC 2D2CB 1E0FD 1C2FA 5F53A 3KQ5A 1YCPH 5DPAA 3BTWE 1THSH 1M1JA 2FYQA 3FFGA 1FUJA 5CCHA 4NA9H 1LQDB 1H8HD 1E37B 2H8PD 1SQBG 3P70B 1YWUA 1VGCC 2BD7A 2XYAA 2IN2A 3MUDC 1Z6JH 3RXPA 3AK5A 3URCA 3R0FA 3FAOA 1L1NA 1XTCC 4NIXA 1RTKA 4TLFA 1GPZA 4MQAA 3A7OA 1BGYD 1C1VH 1OVUA 2FPZA 3SNDA 2I1JA 3G71P 4GOFA 4JK6A 4H6SB 1IOEA 2WHXA 3M9HA 1UHBA 1WCZA 2GMTC 3KQGA 1O3KA 2JO1A 3T25A 1FBMA 1NU1E 3NRLA 3EQ2A 3TK1A 1L4AA 4MPXA 4IC5A 3PV5A 5EG4A 1P2OA 1H8ED 5AVWB 2N9BA 1G3BA 1JWTA 1LTSC 2FDAA 1PGQA 2H6MA 2NRGA 2ZXXA 4ASHA 1YHQP 2GX4A 1NO4A 5L8RJ 3A8AA 1Q7YQ 4YXDC 1VCWA 1A5IA 3Q3XA 4X2WA 5GTIE 3SGQE 1LTTC 3KXDA 2A2QH 5FL7D 4ZHMU 5CCGA 1QL8A 2TGDA 3Q00A 3SUGA 1TOMH 1ZOMA 3NXSA 1FOSE 1HTLC 4NFFA 2WYJA 4CREA 1FC2C 3IWMA 1L0NJ 1GL2A 2OC1A 1V2NT 2JH0D 3RLWH 1LT9A 1G3EA 3LPRA 1ELAA 2OLGA 4XOJA 3F9FA 4X8SH 1D7MA 1JIRA 2BTCE 4DGJA 1VF5D 1EAUA 3MHVA 1KB9D 2HRVA 1T6AA 1GHZA 3UR6A 1ABJH 2KZJA 2ILNA 3A89A 4U3FJ 3BIUH 2H7HA 5APQA 1EPTB 2O01N 1H1BA 2WT7B 2ZF0H 3BCCE 2YMYA 3KYGA 1PV3A 3PLBA 3T5FH 3CWBG 2VWMA 2ZWLH 2CF8H 2Z9IA 4Y76A 1VF5B 4YZUA 1GDQA 1EQ7A 3BCCD 1ZP0C 1RF1A 3A3YB 3TGUE 3HPTB 3QUMP 3MUDA 4NGAH 8ESTE 2VIVA 3CCQP 1SGEE 1FIZA 2FS9A 1EDLA 5DP7A 2IBZD 1VQ9P 3ATMA 3LT3A 2AEFA 1FN8A 4XFJA 4ISOA 2FYUJ 4I2LC 2XZRA 2W6JD 4XBDA 5HIYA 1P01A 2GVFA 4FU8A 4YM9A 2NPSB 3NUMA 4ZXXH 1QGKB 4WY4A 2WPVB 3MIWA 1NTMJ 1RFNA 1DWCH 1P8VC 2GT7A 2W6ID 1KFMA 2NU4E 3A7ZA 3JCUE 1DE7H 1TA6A 1L0LD 4K35A 2NPSD 1JOCA 5KLVJ 1H89A 4WBAA 1BBRH 1IO4A 1CU1A 4X1RU 1LJ2A 4U3FE 1AHTH 2AGGX 1ZPBA 3F2FA 5JB9S 1Y3VA 5KEDA 5T1VA 1EKBB 1MTUA 1TA2A 1KV4A 3RMNH 1AQTA 5TCAA 1Q81Q 3KN2A 1PPJG 1F0SA 1G30B 1KDQB 3A84A 8LPRA 4Z1MD 4WMFA 4B2AA 4AQRD 2WPQA 2QM8A 1O3OA 3TGUD 1ZGVA 2UUFB 2XNDD 3QTVH 4Y10E 1N7SD 3RK3E 3MFJA 5BU5A 3SYJA 1M90Q 1H8DH 3V3MA 3OE7D 4OGXA 4A6LA 1C5XB 3PB1E 2IBZE 2VH6A 3MGNA 3B9FH 4R8TB 1W8BH 2W90A 5KAFH 1O3EA 3V6IA 1VQ7P 1NAFA 1KXAA 3L72D 2Q1JA 4U30A 1E36B 2C93B 1SOZA 3KQBA 3B23B 5EJZA 1N73A 3QH9A 1UVUH 4NWKA 3ITIA 3UQVA 1V6DA 1YPMH 3H1JJ 3M61U 3MNCA 1SFCD 3BTHE 1EDKA 1NC6A 2UWJE 4SGBE 3I56P 4JMYA 3N7OA 2W27A 5CHAB 1O3JA 3KYQA 1NKZB 3D6YA 2A5IA 2ZU4A 5C1XA 2M8RA 2FODA 1OW6A 1O2PA 1HV7A 2HOBA 2FOCA 1G2CA 4K5ZA 3VB6A 3VXEH 1G2MA 3RL0B 3HE5A 1BSHA 2O9QA 2SGFE 1ESAA 2VVUA 1JUNA 1MFTA 4DOQA 2ZI2H 2KZIA 1H88A 2PFEA 2ZQ2A 4KGAA 4UDWH 2B89A 3WUVA 1OP0A 3M9QA 2RKLA 1XVMA 1LPKB 3BATA 1RH5B 1JY3O 3CLQA 1LVMA 1GBTA 3RP2A 2ZFCA 1SQQK 3CNRA 2POHA 4D9QA 3H7OA 3C1KA 4GKGA 1DFPA 3VFEA 1KMHB 1SGNE 1KN7A 3RC4A 2A0QB 2ODPA 4NA8A 1KB9H 1M1JB 3CENA 1TNHA 3M0DA 1ZMJA 2W6JH 1P2KA 1O2XA 3AW1A 1C5ZB 4FETA 1QBOA 3L6PA 2FXPA 5AW8B 1JEKA 1QA0A 4D7FA 2Q1KA 1P3EA 1UK2A 2H1UA 3PJSK 3CWBJ 1OWHA 1SQVG 2KS1A 1UTOA 1UIXA 2AIPA 3H1LD 2K9YA 1UTNA 1SOTA 2CMYA 2PV9B 3NCLA 3I55P 1O34A 1EZUC 3TITA 4ZMDA 5KAIH 4AYCA 3S7KB 1EATA 3RBZA 1M57D 4O03A 1XUHA 1ZMEC 2BDGA 5GDSH 5C39A 3SOSA 4B6EA 2IBZI 2M0BA 3UTUH 5TJHA 2PR3A 1LWUA 2K37A 3T97A 1ZMNA 3M0AA 4GLYA 5F8XA 1NTMG 1CI6B 1FLEE 1QQUA 5T3HA 1ZRTD 1VQ4P 3EE7A 5KJ7D 1SQPE 1N7SC 1BE3E 2F43B 4A5TS 2Y9YA 5F8ZA 5AVVB 2JDIH 3H1LG 1NU9A 2EA3A 1QL2A 1O5CB 2AEIH 3M7QA 1URQB 1M56D 1O37A 4EYYQ 1YY3A 2ZGJA 1TBRH 3EWKA 1F2SE 3G6EP 1BE3D 2G81E 2QIQA 3RC6A 1GVZA 3BEIB 1O0DH 4ZHAA 1GJAB 5JYIA 3L70G 3FOAA 5AVUB 2XC5A 1MD8A 1SHHB 5GWZA 2O8UA 2WITA 1CI6A 1NTKE 4LLHA 1TRNA 3SV6A 2AMQA 4NG9H 5APWA 2QY0B 4B2CA 4H0LC 5DN6D 1C5PA 3M5NA 1E38B 1USEA 4OS6A 2E74D 5E0HA 3DSGA 4D8NA 2OC8A 2ZAEB 1OMIA 4KP0A 1NJIQ 2KNCB 1CQQA 1TYNA 1UTQA 3I5CA 2AXTH 1GU4A 1QRXA 1W7GH 3SI4H 1W12U 3ATWA 1KYNA 1E34B 3B8EB 4IOIH 1KXCA 2R2MB 1YBWA 1JB0J 1IHTH 2KZ4A 5I25A 1A5HA 3TSIA 4Y8YA 8GCHG 3DUXH 2PFXA 1SLQA 3KHUA 1TGNA 4DZOA 1N86A 3M37A 3BTFE 4I8JA 1TPAE 5EQSA 2TGTA 1O3DA 3IAOA 1GI9B 3RGUA 2Z9GA 2GCTC 1O3IA 5E79H 1P10A 2N1TC 4H13C 3GDVA 2WPJS 5AW9B 1BMFD 3PO1C 2HWLB 1GJ8B 4CRFA 4C46A 1A02J 2QRXA 4NIYA 5PTPA 1N6YA 4WVZA 1NTZE 2BQ6B 3FXDA 2ZC9H 1GBMA 2BHGA 4MPWA 1OXZA 2BD5A 2GV7A 4UEHH 3TH2H 1GJDB 3UY9A 1E79D 1NTKJ 1O2JA 1PJPA 1HNEE 1W10U 1WUNH 4OM9A 1A0HB 4B73A 1C1NA 1T32A 4DIIH 2VH0A 3CS0A 2IBZG 3MYWA 3CXHI 3LIWA 3D62A 4EIJA 2KLUA 3FX0A 2BVRH 3AEDC 1A2CH 3Q77A 3QGJA 3ZV9A 3B5NC 4CRAA 3A7WA 3K6YA 1ELCA 4J2YB 4FUEA 4KT0J 2PUQH 2V4HA 1AVYA 1GK4A 1T3JA 1EJMA 1T8LA 2NU0E 2PGDA 2I8DA 4UFDH 1DXPA 1OVVA 2CK3D 1BTWA 1EZQA 5KJ7C 5GPIB 2VWNA 2OARA
chains in the Genus database with same CATH topology
3DSOA 4XD7D 1GMJA 3O8BA 4ASUD 2QJYC 2NZ2A 2GGVB 1EXIA 1S5LX 2XCNA 1PL5A 3SV9A 1NGMB 2OBOA 3OEHD 1WXRA 1K04A 2XOKD 2P59A 1NBMD 2WV9A 1EFRD 2FOMB 3DCLA 2K0QA 3SV8A 2F9VA 4A1TA 2K1QA 1DD4A 5EPNA 2L6OA 2KM0A 3DSPA 5KKZC 3FN8A 1VF5C 5C0UA 2FBWC 3AEEC 3SU5A 5EPYA 5FPSA 4DT4A 3GF7A 1R8EA 1RGQA 1RTLA 4PV1D 3N7DA 2QF5A 3F0PA 3H09A 3SFDC 3G9RA 4H44B 4Z1MH 2E74C 5C0TA 3B71A 2YMSB 5B6LA 4TT3D 4A92A 3AE3C 2QE7D 5EQRA 3RL0g 4B76A 1HJ0A 3ZIAD 5KLIC 3FGAD 2JP3A 3U1IB 4I33A 1KQGB 3O8DA 1KILE 4B71A 4F55A 2F9UA 3O8CA 2KFWA 2WZQA 4H13B 1W0JD 2FM2A 3AE5C 4Q4LA 2KR7A 3AEFC 2HLDD 3Q2YA 2ZT9C 4R4MA 3KF2A 4YXWD 3WW7A 3SV7A 2MKVA 1K05A 3OYPA 4OGQB 2BEQD 4RI0A 1RQUA 4TSFD 3AE7C 5ETXA 4R4LA 1MABB 3SUFA 2D2CD 2WQYC 1KMIZ 2QV1A 2O01J 3WWFA 2OQQA 1NBME 3OTPA 2AHME 3SU0A 5C17A 3RC5A 2KCAA 3O6QA 2M2AA 1BT7A 2JIZD 2D2CB 5F53A 2OINA 2G3AA 2QJKC 4I7ZC 1IK7A 3AE6C 3SU3A 1H8HD 3OEED 4YTPC 3AK5A 4A1XA 5DSFA 3VG8A 4TT3H 2WSFJ 3D6ZA 3P8NA 2E75D 2WHXA 2OC7A 2QJPC 2JO1A 3LOXA 3NRLA 3PV5A 2JJ1D 1DD3A 4H0LD 1H8ED 1E1RD 5L8RJ 4YXDC 5FL7D 1JXPA 4Q63A 4H0LB 2A4QA 3SUGA 2F4LA 3KNXA 4H44D 4WF8A 1A1RA 2OC1A 3N99A 4H44C 2OK5A 3UB0A 2YMSC 3AE9C 1VF5D 3AEBC 3D70A 2QF4A 3GLMA 1Q90D 3M5MA 5IK2D 4WH8A 3S9OA 3C8VA 1PV3A 1KQFB 2BEZF 1VF5B 1ZP0C 1AJYA 3SU2A 2FYNC 3P8OA 3LONA 4XFJA 3KEEA 2IJOB 5FPYA 2KCYA 2W6JD 2GVFA 2IJD1 3R4YA 2WPVB 2JDID 3Q5SA 1OHHD 3PRBA 2YOLA 2E76B 2XCFA 1S6LA 2OBQA 2W6ID 4GDOA 2J5UA 4TYDA 4RKUJ 1YQ4C 1RQVA 3F3BA 4A1VA 2JJ2D 1CU1A 1E1QD 3OFND 4IL6X 4Y28J 3F2FA 5T1VA 2ZT9B 2KCPA 4PV1B 3KN2A 4U01A 5H4IB 3SFEC 4Z1MD 2XNIA 3Q3DA 2XNDD 3RK3E 1S1CX 3SYJA 2YIUC 3OE7D 3LKWA 2E76C 3T97B 4R8TB 1WMKA 1KORA 3AE1C 4ZCNA 4NWKA 4H13D 2V7QD 3AE2C 1ZOYC 4JMYA 3D6YA 2YMKA 1FX0B 1OW6A 4B75A 3U1JB 2O8MA 1DY9A 2V7QJ 1DY8A 5EQQA 2E74B 3PV2A 5HKKD 2OC0A 1W0KD 2A4GA 2G8YA 3GF3A 3GMAA 4U7JA 3SU4A 1ZRTE 4I7ZB 1KMHB 3F2GA 3RC4A 1NS3A 1FDOA 1W3CA 1OW7A 4FETA 3FO8D 3L6PA 2FXPA 3AE4C 5M1BA 3F0OA 4I32A 5ESBA 1PIXA 2D2CC 3D71A 1TU3F 1UIXA 1NYHA 4B6FA 2K9YA 3SUDA 5CDFE 1Y9BA 3AEGC 3N7EA 4NWLA 1ZMEC 4OGQC 4B6EA 2E75B 3Q5PA 1KTMA 2WPDD 2WSCJ 3AECC 3Q1MA 3AE8C 1DXWA 2H88C 1OW8A 5GNDA 2E76D 3SZEA 1YQ3C 3PRDA 2P10A 2VBCA 2H89C 2F43B 3SU6A 3W1EA 1VL2A 5FPTA 2QIWA 3EWKA 3RC6A 3IN6A 1FDIA 3FOAA 1U57A 2FP7B 3SV6A 4H0LC 3M5OA 5DN6D 3M5LA 3GS9A 3M5NA 2E74D 3Q5RA 3SUEA 3SU1A 2OC8A 1OMIA 2A4RA 3LW5J 3FKSD 2QSIA 4B74A 4KTCA 2WSSD 5CHBA 5IDKA 2WSEJ 3AEAC 1DIPA 1N1LA 1JB0J 2KZ4A 4WH6A 5EQSA 3OAAD 3IAOA 3ABVC 4H13C 3EYDA 1BMFD 1HF9A 2KCOA 3H25A 5GJ4B 2K8IA 4K8BA 2LELA 1EXJA 4M9FA 2IDBA 1E79D 2YMSD 4B73A 4OM9A 1SKYE 4OGQD 3F2HA 4PV1C 1MKMA 3WWBA 3AEDC 2ZT9D 1COWD 3O8RA 4KT0J 3E90B 4I31A 1DXPA 5GPIB 2CK3D 2E75C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q5P A;  1DIP A;  1EXJ A;  3D6Y A;  2QF5 A;  3G9R A;  2OQQ A;  3Q3D A;  3Q1M A;  3D6Z A;  3Q5S A;  3T97 B;  1EXI A;  3Q2Y A;  4R4M A;  2J5U A;  3IAO A;  3D71 A;  3Q5R A;  1R8E A;  3D70 A;  4R4L A;  2QF4 A; 
#chains in the Genus database with same CATH topology
 1C5M D;  1SB1 H;  3SQE E;  2BXT H;  2ZU1 A;  4XD7 D;  3UR9 A;  1O3B A;  4BXW A;  1SGY E;  3BF6 H;  1BQY A;  1NRN H;  2R3S A;  1Q2N A;  3L72 J;  2KLV A;  1DOJ A;  4WMD A;  2ZPS A;  3RDZ A;  2THF B;  1TBZ H;  3SV9 A;  1P2N A;  1NTZ D;  5APS A;  1NTZ G;  2SNV A;  3TIU A;  1FV9 A;  4D6T D;  2RCE A;  1J14 A;  4JZE H;  3RK3 B;  1QLE D;  1QEX A;  4EOT A;  1C5N H;  1K04 A;  3A8D A;  3OW2 O;  2WV9 A;  3GW6 A;  5JB8 S;  2A7C A;  4X6N A;  1Y3X A;  1C1M A;  3DCL A;  2ITA A;  1EDJ A;  4Z6A H;  2G8T A;  2K0Q A;  2P3T B;  2FX6 A;  1AD8 H;  3KGP A;  1NVO A;  4Y7B A;  3SV8 A;  4ISL A;  3ZVE A;  3RXC A;  3GG2 A;  2NPS C;  2OYI A;  2A06 D;  5L2Y H;  1DD4 A;  3SNC A;  2KM0 A;  2GZ9 A;  1FZG A;  3OAK A;  5KKZ C;  3BCC G;  1AY6 H;  2Y5G A;  3BSQ A;  1PGJ A;  3B8J A;  2H2Z A;  4ZKS U;  3KZI E;  3F6U H;  2FBW C;  3LID A;  1NTK K;  5JBC S;  2C0W A;  2O8L A;  3ZV8 A;  2WSE H;  1ZSJ A;  2O8W A;  3OY6 U;  1MAX A;  2CF9 H;  3MH5 A;  2O1J A;  4DT4 A;  3HD7 B;  2NU2 E;  1ETR H;  1R8E A;  3R2P A;  3VMY A;  1YPH C;  4AG2 A;  3V0X A;  4CH8 B;  1RGQ A;  1RTL A;  3P6Z B;  1L0N D;  2M5A B;  3BN9 A;  2GCT B;  1RE4 A;  2AEJ A;  1AKS B;  1ARC A;  1K1O A;  1O30 A;  2ZCH P;  3EGK H;  3CXH E;  1L4A C;  2ZDA H;  4Y99 B;  4ZKP A;  3B71 A;  1NKN A;  4EST E;  2KAI A;  1S9K E;  1XUJ A;  3BVH A;  1BTZ A;  3H6P A;  3U98 H;  4A92 A;  2IPP A;  3AE3 C;  4JYV H;  2R0L A;  3FAN A;  5AFZ H;  1KLT A;  4ZXY H;  1DST A;  5EQR A;  5HYO A;  1VIT H;  3GY5 A;  2R5B A;  1JCC A;  2BCC D;  2EI7 A;  5KLI C;  2DE8 A;  2JP3 A;  1IQL A;  1GMD F;  1QTF A;  1W0Y H;  1M7L A;  1KQG B;  5F8T A;  4BTI B;  3CCR P;  1NWQ A;  1OX1 A;  3O8D A;  1XMN B;  3L75 G;  4F55 A;  1IFI A;  2JR8 A;  3L75 D;  2WZQ A;  2L74 A;  3H1K D;  4LZ1 H;  1TLD A;  1L4A D;  3PM3 A;  1W0J D;  4Z0K A;  3AE5 C;  1O39 A;  4WXI A;  3LJJ A;  4Q4L A;  2BDH A;  2F9N A;  3KPE A;  5KLV D;  1O2U A;  2VVV A;  5CMX H;  4CR9 A;  1O2O A;  1GZL A;  1ZV8 A;  1AZZ A;  4OS5 A;  1NTM K;  2K1A A;  2ANM H;  1FIW A;  4GSO A;  1CHG A;  1VQ5 P;  1C1W H;  3OYP A;  3A0B E;  1T4V H;  2GCH G;  1ELD E;  2W3I A;  4UFG H;  3HKJ B;  3CCM P;  1AU8 A;  5EFW B;  1JRS A;  1T31 A;  3HD7 A;  4FUB A;  3VB5 A;  2I6S A;  3QTO H;  1RQU A;  1CGH A;  3AE7 C;  3RM0 H;  3VN0 A;  1P2J A;  2Z9L A;  1EC5 A;  1SQV E;  2FYZ A;  2WQY C;  5L30 H;  4YXW H;  2ZYA A;  1W7X H;  2HOD A;  1AVX A;  3WWF A;  2J97 A;  1NBM E;  2VGC B;  1PP9 D;  1RE3 A;  3PLK A;  1GHV H;  1MTN B;  1OKX A;  1PYT D;  5C17 A;  2D1J A;  1HUC A;  2KCA A;  3ZZ9 A;  2Y0D A;  3I78 A;  2QF3 A;  2Z6B D;  2WT7 A;  2ZQ1 A;  3DHK H;  4RKJ B;  1M1K Q;  5FHT A;  4BAQ B;  2G3A A;  3L35 A;  4IL6 H;  1DLE A;  2FYR A;  1DX7 A;  4IGD A;  4I7Z C;  1S83 A;  1ID5 H;  1IFN A;  3AE6 C;  1ELB A;  1SGF A;  2Q6F A;  3K2U A;  1A3E H;  3H1L E;  3SU3 A;  2GUV A;  1GHB F;  3OEE D;  5FCR A;  2PGB B;  1O3M A;  1SQP G;  1KYO D;  1Y47 A;  2IX7 C;  4MNV A;  3RLY H;  5A8Y A;  4YTP C;  3LGI A;  1OZH A;  1IFD A;  2R5D A;  2OTJ P;  3BCC J;  2WVR A;  1FN6 A;  4A1X A;  2I6Q A;  5LPF A;  3CCJ P;  1S72 P;  1LO6 A;  2V3M A;  1OP2 A;  4FVB A;  4TT3 H;  5JPM H;  2W7S A;  3T28 A;  2E75 D;  1O5A B;  4W7Z A;  3ENS B;  2OC7 A;  1LHC H;  2LKM A;  5HGG A;  1T3U A;  3KQE A;  3P8F A;  4Q7Y A;  1GG6 B;  1U6Q A;  1O32 A;  2BCC E;  1V2J T;  4DCD A;  4I8H A;  1BTU A;  4NA7 A;  1TMB H;  3LIE A;  1P03 A;  4HYT B;  1W5C E;  3W94 A;  1T8O A;  1N73 C;  1D3D B;  1UTJ A;  1LTO A;  4I8G A;  3RXR A;  3SJI A;  2TIO A;  3T26 A;  5KAF E;  4RSP A;  3M06 A;  2C0X A;  1DEB A;  3B5N B;  2ZDL A;  1B0E A;  1JXP A;  4BRY B;  2WSC H;  4H0L B;  3L74 J;  3RK3 D;  1ESB A;  1V2K T;  1WYK A;  2F4L A;  4H44 D;  1CT2 E;  2ZG0 H;  1JY2 O;  3GDU A;  2ZO3 H;  1A1R A;  1IQE A;  1NU1 J;  2YKO A;  3VB4 A;  1FAX A;  2BD9 A;  4ZKU A;  5GTH H;  5KEC A;  3N99 A;  2OK5 A;  3L75 J;  2JWA A;  3GHG B;  1EZX C;  2BY6 X;  3UB0 A;  3L72 E;  1F0T A;  1BZX E;  4DW2 U;  1BGY E;  4JCN A;  2AYW A;  2HLO A;  4FVD A;  3EDX B;  1X7A C;  4IC6 A;  1PPZ A;  3UIR A;  2E5Y A;  1AGJ A;  2A45 I;  2GMT B;  2Y82 A;  3GLM A;  1ABI H;  1RE3 C;  3MO9 A;  5CCG C;  1C4U 2;  1USD A;  3RK2 D;  1AFQ C;  2XBX A;  4PRO A;  4OS4 A;  3HUS C;  5IDK A;  3MD0 A;  1MQ6 A;  2W8Z A;  1UVP A;  1HBT H;  4MG3 A;  4UE7 H;  1GL2 C;  2Q6D A;  3S9O A;  2Z4E A;  1LDT T;  1NES E;  5DP9 A;  4K60 A;  3O6Q B;  1MKX K;  2STB E;  1VR1 H;  2OTK E;  1GMH G;  2BEZ F;  1SFC A;  1TGT A;  1O3L A;  2WPI S;  9EST A;  1IQM A;  1ZJK A;  1AJY A;  3D23 A;  1YIT P;  1F5R A;  2A5K A;  3TNT A;  3SU2 A;  4Q7X A;  3TK9 A;  3P8O A;  3M3T A;  1MTW A;  1PP9 J;  4M3L A;  1P2Q A;  1HVV A;  1LVB A;  3OSY A;  3LON A;  1LCY A;  3TGU G;  3LGU A;  2BY9 X;  5FXL A;  1GHA G;  4TWW A;  3P17 H;  3KEE A;  2IJO B;  4XA4 A;  2QA4 P;  5FPY A;  2HNT E;  3A8B A;  3LH1 A;  1C2I A;  5K7R A;  4NPF X;  1NTM E;  4BOH A;  1S5L E;  2FXM A;  3GY6 A;  1A7S A;  1S0R A;  5EJL A;  3UQO A;  2A7H A;  2RA0 A;  3BEF B;  3DD2 H;  2FWW A;  1VKY A;  1GBH A;  3Q5S A;  1GI8 B;  1OHH D;  2BYA X;  2JDI D;  2XC4 A;  2ZGH A;  3NK8 A;  4LGD E;  1S6L A;  1Z8I B;  2BVS H;  1EB1 H;  3V12 A;  2FMJ A;  5JDU B;  1RF1 C;  4X1P U;  2FYU D;  5EOD A;  4HGC A;  3MTU E;  1UMA H;  4JZD H;  1OWE A;  1C1Q A;  1YQ4 C;  1RQV A;  2FYU K;  5APV A;  2JJ2 D;  2YNA A;  4Y0Y E;  3CX5 D;  3E7K A;  1LTG C;  2G5N A;  1AI8 H;  4IL6 X;  3A88 A;  4NPD A;  5CCG D;  4YT6 H;  1K28 D;  1W11 U;  3UWJ H;  4AFU A;  5AVD A;  1HIA B;  2BAS A;  1S9K D;  1L0Z A;  1XVO A;  3TK6 A;  4U01 A;  1C2E A;  4WY3 A;  3HKI B;  2YO3 A;  1PPE E;  1TGC A;  1YPJ H;  4NSY A;  5J4Q A;  1KXE A;  2ZVO B;  2D2D A;  1S1C X;  2KSJ A;  1AQ5 A;  1TAL A;  2BY7 X;  3T97 B;  1YCP K;  3ELA H;  2ZDN A;  1LHE H;  4AB8 A;  1C2K A;  2GM4 A;  1Q2W A;  3BV9 B;  1THP B;  1LKA A;  1BBR K;  1WBG B;  2BD2 A;  2CHA B;  1Z6E A;  3F9H A;  5HM9 A;  1HWT C;  3KL6 A;  5EGM A;  1QVG O;  2FIR H;  1O2I A;  2GD4 B;  1F7Z A;  2YKQ A;  4ZCN A;  2HVX A;  4D7G A;  1TMT H;  1Z7K A;  2N1T D;  4H13 D;  5DG6 A;  2WPM S;  1K1J A;  5APT A;  3QO6 A;  5CHX A;  3AE2 C;  2R32 A;  1DPO A;  1H4W A;  3S9C A;  1NU1 G;  1ZOY C;  3U59 A;  1GHX H;  1GJ5 H;  2K9J A;  4E7N A;  2AXT E;  2HNT C;  4MLF B;  1IFM A;  1N2D C;  3LW5 H;  1XUK A;  1VQL P;  4RO0 A;  1DLK B;  3BG4 C;  4AFZ A;  5GCH F;  2XU6 A;  3NMD A;  2WV5 A;  2Y0E A;  2Y7X A;  2Y7Z A;  4X1Q U;  3STJ A;  5DP3 A;  3H1J D;  1DY8 A;  2KYV A;  4Y99 C;  3PV2 A;  3PTB A;  2OC0 A;  2Z3C A;  2W6B A;  1W0K D;  3QK1 A;  2H43 A;  2A4G A;  2ZJS E;  1CGI E;  1M1J C;  4C7R A;  2ODQ A;  1L0L E;  2GV6 A;  1J16 A;  1H9L B;  3GMA A;  2ZEB A;  4PD4 E;  2SGD E;  4AZ2 B;  4U7J A;  2QA9 E;  1Y3W A;  1C5W B;  2W6A A;  3AVZ A;  4I7Z B;  4BAO B;  3CWB D;  3E8L A;  1TPP A;  3TGK E;  1O3C A;  1ZRK A;  5HMA A;  1FDO A;  3RUO A;  1BBR E;  3RK2 C;  1W3C A;  3RXU A;  1TFX A;  3RXI A;  4JK5 A;  2E42 A;  1YJW P;  3II6 A;  4I32 A;  3E3T A;  5ESB A;  2JKV A;  4OH8 B;  1NT1 A;  3SHA H;  1LMW B;  2QXJ A;  4UON A;  4XBC A;  1JY3 P;  3D71 A;  1BIT A;  4O3U A;  1O2R A;  5CHA C;  1UVS H;  2AGE X;  4IMZ A;  3HGN A;  4ASW A;  1BRC E;  1GI6 A;  4ZUH A;  1EZV I;  4IN1 A;  4YO9 A;  2D8W A;  1SR5 C;  2BXU H;  3PLN A;  2V7Q H;  4DOJ A;  2A45 B;  1KIL D;  3Q76 A;  2W5E A;  3SHC H;  1FY4 A;  1WSS H;  1UII A;  2E75 B;  2PUX B;  4JF7 A;  1URQ D;  2WSC J;  1T7C A;  2BX4 A;  3GOV B;  3AEC C;  1CVW H;  1AUJ A;  3AE8 C;  1NN6 A;  3H1I J;  1A0L A;  3A7X A;  1GHB G;  2JH6 D;  2VNT A;  1Q3X A;  7KME H;  1EJN A;  5EXN A;  1XUF A;  2E76 D;  2GJG A;  3SZE A;  1V2T T;  1SQQ D;  1YQ3 C;  4QMA A;  4UB8 E;  1EAX A;  3NXP A;  2VBC A;  3P8C D;  1XUI A;  3W1E A;  1O3P B;  1G3C A;  3U8T H;  2VVC A;  3FZD A;  3E1I A;  5AVS B;  1X22 A;  1VJA U;  2QIW A;  1ZRB A;  3SW2 B;  1W2K H;  3P8C E;  2GZ8 A;  2NU3 E;  2SPZ A;  1ZZZ A;  4LXB H;  1KIL C;  3L73 D;  2UUY A;  1UVT H;  1FY8 E;  1CO7 E;  3A7T A;  3OU0 A;  2ZFQ H;  4K8Y A;  1NH4 A;  1LWU C;  3S69 A;  7GCH F;  2VJ1 A;  3P32 A;  1HYL A;  4GHT A;  1O5E H;  2V6N A;  2V0B A;  2R3C A;  4ZHL U;  4CRD A;  3OTJ E;  1NRO H;  1HJ8 A;  1G1I A;  1UTP A;  1HAX B;  3M7T A;  4PD4 I;  4N6J A;  2LR2 A;  1GI0 A;  3TK5 A;  3MZW B;  6LPR A;  3SUE A;  1AFQ B;  3MH4 A;  3SU1 A;  4K1T A;  1NTM D;  2A4R A;  1OOK B;  7EST E;  3RK2 B;  1G2L A;  1Z1J A;  1TQ7 B;  3FKS D;  3V2Q A;  2LNC A;  1FMG A;  3V5B A;  1HXE H;  1BB0 B;  4B74 A;  2AGI X;  2AXC A;  2A45 H;  5CHB A;  2EI6 A;  1HB0 B;  3EE0 B;  2V3O H;  1SMF E;  1F5K U;  1GJB B;  4NZL A;  1GGD B;  4WH6 A;  3NKK A;  3MO3 A;  1CHO G;  1J15 A;  2ZA5 A;  4DJG A;  3BIV H;  3MNS A;  1EZV E;  3MO6 A;  1UTM A;  4YLU A;  5KTB A;  3QDZ B;  5JBA S;  3A87 A;  1SFC C;  1U7M A;  1YI2 P;  2A7J A;  1AO5 A;  1BOQ A;  1PFI A;  2XW9 A;  1SQB D;  2WUB A;  2SNW A;  2KCO A;  5APU A;  5A8X A;  2ZP0 H;  2SGE E;  4HJG H;  3A2A A;  3H1H D;  4X8U H;  1EUF A;  2B9B A;  2P8O C;  2LEL A;  1KIL B;  1BMM H;  2RDL A;  1YJN P;  1P84 E;  1BGY G;  3MP7 B;  1FZC B;  1KQL A;  1Y3Y A;  2A4O A;  4I8L A;  4UFE H;  4MPV A;  2GUS A;  1ZJD A;  3PLP A;  1X9V A;  3F2H A;  4KHX A;  2GKV E;  3BEU A;  4E7R G;  4PV1 C;  4L76 A;  3GY2 A;  1HAO H;  2K9J B;  3RXL A;  3GYM A;  4CHA B;  2PSX A;  1O2W A;  1HUT H;  1C4Y 2;  1V2W T;  1Z1I A;  1P11 E;  2GP9 B;  2YO2 A;  2YXR B;  1AE8 H;  1YPH E;  3E90 B;  3UUZ A;  3S9B A;  2HGT H;  1PQA A;  3TDK A;  2BQ7 B;  4Q80 A;  2ZDK A;  3A80 A;  3QN7 A;  1L0N E;  1O33 A;  5DJU B;  2BCC G;  1BHX B;  1UHB B;  1URQ C;  1WT6 A;  1K1L A;  3HTK A;  2FO9 A;  1PQ8 A;  2QJY C;  3P92 A;  1TWX B;  1EXF A;  3OA7 A;  4F49 A;  2WTY A;  3SGB E;  1S5L X;  3L3T A;  2CK3 H;  1DWB H;  1S84 A;  2JH5 D;  4Y7A A;  3H1K J;  1SI5 H;  2XNX A;  1P9S A;  1NGM B;  2BQW B;  2OBO A;  3ZVC A;  1ZTL A;  1HIA A;  1SQB K;  3OEH D;  4YLQ H;  5FBI A;  1SQP K;  4DG4 A;  1WTG H;  3E0N B;  1CSO E;  2XND H;  2VID A;  2FOM B;  2ZCK P;  1IQI A;  2XBW A;  1IQH A;  1O2Z A;  3MU5 A;  1C9P A;  1DS2 E;  4VGC C;  4Y71 A;  4AG1 A;  2FY8 A;  3E0P B;  1MKW K;  4H42 U;  4BAH B;  2F9V A;  2M3B A;  3H32 A;  1DWE H;  1K21 H;  4YES B;  1E79 H;  3WUT A;  4X1S U;  4A1T A;  1SGT A;  1AV1 A;  1P84 D;  2BOK A;  4TPY A;  5C1U A;  2E43 A;  5EPN A;  1CT0 E;  1HGV A;  3IF4 A;  1QGF A;  2C9N Y;  3FN8 A;  1GI4 A;  2OQU A;  2Y6T A;  1AB9 B;  5DO4 H;  1P05 A;  5C0U A;  7GCH G;  4F48 B;  3MU0 A;  1SVF A;  4Y79 A;  5FPS A;  2PGQ B;  1QVF O;  3MNB A;  4WVP E;  3VXF H;  5GXP A;  5B66 E;  2WSF H;  1P84 I;  2FES H;  2QF0 A;  1SS1 A;  3VMA A;  1BRB E;  3GF7 A;  1PP9 G;  3SV2 H;  1V2R T;  3PWC A;  3ZZC A;  1LPG B;  2ZFR H;  4AGJ A;  1QJ1 B;  1DUE A;  1PGP A;  3A8C A;  5KLI B;  1C4V 2;  1KIG H;  1O3A A;  2VB0 A;  3KHV A;  2F83 A;  2ZTY A;  5E2O A;  2KNC A;  2O8T A;  1S6F A;  1ETT H;  1TRM A;  2QYI A;  3N7D A;  3QLP H;  1T8Z A;  2ZHE H;  2ZFT A;  4UFF H;  4Z1M H;  1A4W H;  2HLC A;  1BE3 J;  1RY3 A;  2J34 A;  2E74 C;  1W0Z U;  1GCD A;  3D65 E;  3GCH C;  6GCH G;  1SLW B;  1AND A;  5B6L A;  3UOP A;  4GIF A;  4ASV A;  5C67 A;  3G4S P;  1O36 A;  4X8V H;  3ZVF A;  3ODF A;  3L71 G;  3RL0 g;  1OIP A;  1NM6 A;  4LZ4 B;  8GCH F;  1GBJ A;  1O2M A;  1GW4 A;  4DT0 A;  4HG6 A;  3LGV A;  3URD A;  1FAV A;  3L75 E;  1SSX A;  3U1I B;  3SNB A;  4I33 A;  2LXC B;  1URQ A;  3GHG A;  4IW4 E;  2VIW A;  2KFW A;  3PTN A;  2JEE A;  1GBB A;  3CX5 I;  1DSU A;  3I29 A;  2IZ1 A;  1KFN A;  1T2K D;  1K2I 1;  5LH8 A;  4X8T H;  5C1Y A;  1FDP A;  1P12 E;  2VIN A;  5KKZ B;  2F9B H;  2MJZ A;  3AEF C;  2KR7 A;  4HKZ H;  1PPJ E;  1HJA B;  5EJ1 A;  2ZT9 C;  4MNW A;  4XRN A;  5SGA E;  1TNK A;  1LWU B;  1ZN5 A;  1J2J B;  1OWD A;  1W2E A;  1MKX H;  1V2M T;  3VB7 A;  2UUK B;  2Y9Z A;  2XRC A;  4E05 H;  2QJK B;  1O5D H;  1NU1 D;  1UK4 A;  5AVT B;  3RBX A;  1P9U A;  2IPH A;  2H9E H;  4K1S A;  5ETX A;  5CCH D;  1MAB B;  3ZZ6 A;  2OTV A;  5AHG H;  3MOC A;  5HXF A;  3CCL P;  2JWD A;  4HFP B;  4SGA E;  4Y8X A;  1SP4 A;  5AW5 B;  2XWB I;  2ZXE B;  1BE3 G;  3B5N D;  1LTJ A;  3OTP A;  1VQK P;  1P2I A;  1L1G A;  3K6Z A;  3RC5 A;  3SU0 A;  3H1H E;  3N4X A;  2M2A A;  3STI A;  1ETS H;  3EFG A;  3VGC C;  2EQN A;  2JIZ D;  2C8Z B;  1NRP H;  2FLR H;  2OIN A;  1UCY E;  1C5T A;  3PTZ A;  3D49 H;  4JPZ B;  6CHA B;  2XBV A;  2QJK C;  1H0T B;  1TQ0 B;  5AVX B;  1LP1 A;  1IK7 A;  1S5L H;  2R3U A;  4M7G A;  1XKA C;  2XBY A;  1DUA A;  1EB2 A;  1GJ9 B;  1TGB A;  4OS7 A;  4Y6D A;  3RXK A;  3HUS B;  2OQ5 A;  3TJN A;  1MKW H;  1Y8T A;  1ZXG A;  3WMM 0;  1O3N A;  5CCH C;  2FOG A;  1SGR E;  1BCC E;  2WZ7 A;  1S0Q A;  3EFF K;  2DE9 A;  4X1N U;  3RMM H;  1ELF A;  5LPE A;  1TX8 A;  4HH2 A;  5E0G A;  1P0S H;  1K0H A;  2FTM A;  1FZA A;  1N7S B;  4A7P A;  1GMC G;  3GY7 A;  2PAJ A;  1V2Q T;  4EI2 A;  1QCP A;  1RXP A;  3ZZD A;  1CZQ A;  1T8M A;  3EA7 A;  3RU4 E;  3P8N A;  2A5A A;  1L0L K;  1GBF A;  1ANE A;  1P02 A;  3GCT F;  1LHF H;  1LT1 A;  4UD9 H;  1LTA C;  1SQV D;  1ACB E;  1Y3U A;  1IC2 A;  4BRY A;  1PFX C;  1CBW C;  1L2E A;  5FAH A;  1OS8 A;  2HVY B;  3CX5 E;  4ABH A;  3GHG C;  1MTV A;  5C5O A;  2EEK A;  1E5W A;  3CME P;  1GI7 B;  1SQV K;  3L72 G;  3MI4 A;  1AVG H;  4AB9 A;  1A61 H;  5AVR B;  2FYU G;  2VRS A;  1NRQ H;  2G4T A;  2PTN A;  5BRR E;  4UB6 E;  1W2B O;  3KCG H;  4Q63 A;  1YIJ P;  1AWF H;  1C5Q A;  4E06 H;  1GI5 A;  3KNX A;  1SQX J;  5TIS H;  4BAK B;  1EX3 A;  3FZZ A;  1QRZ A;  2EY4 C;  1S6H A;  1O2Y A;  1QL9 A;  1L2P A;  1KYO H;  3V2P A;  2QM7 A;  5B6O A;  2QXG A;  2ALP A;  2R9P A;  1VDF A;  4H44 C;  3L71 J;  3FVF B;  2BD8 A;  1O2T A;  2J92 A;  4W80 A;  4J1Y A;  1KLJ H;  1O3H A;  5K5G B;  3AE9 C;  1KDQ A;  5F03 A;  4CBN A;  2W26 A;  1RHZ B;  2ZVN B;  2FOH A;  2RDE A;  4XE5 B;  1TGS Z;  2TGA A;  3HK6 B;  2QF4 A;  1BCC G;  1NHL A;  3H1I D;  1ZR2 A;  4X6O A;  2QCY A;  3SOR A;  1BDD A;  1E35 B;  1YPK H;  3ZVD A;  1V2V T;  1OWA A;  1GJC B;  3SBK A;  1RRK A;  5HM2 A;  4DCK A;  1XKB C;  8KME 2;  4JZ1 A;  1BHX F;  4WY4 B;  1TBQ H;  2Z9K A;  4GVU A;  4BNR A;  2NPS A;  3H1H G;  2OYI C;  3A0H H;  2DUC A;  1PP9 E;  3TH3 H;  1FY1 A;  2HOD B;  4FUJ A;  1JMM A;  1QBV H;  4KJM A;  4VGC B;  1BTH H;  2CN0 H;  2HPC A;  3F5H A;  3W67 A;  2HPC B;  3RXT A;  1JY2 P;  1QNJ A;  1OWJ A;  1V2S T;  3QZR A;  4QT8 C;  5KAI E;  1X0T A;  1SLX B;  2STA E;  2UUJ B;  1VIT G;  3A85 A;  4XE4 A;  3VTP C;  3PMB B;  4XSK U;  1UCY H;  3BAS A;  4ZMA H;  5I46 H;  2ZFP H;  3GYL B;  4EDF A;  1FJK A;  2P67 A;  2XCF A;  1Q82 Q;  2OYI B;  3E16 B;  4JYC A;  4GDO A;  2J5U A;  1EPT A;  1G1J A;  3RL0 D;  1O2L A;  1NFX A;  1AVO A;  2H9H A;  1XXF A;  4TYD A;  4OS2 A;  1C1R A;  1QRW A;  2GDD A;  4RKU J;  1BRA A;  1HAG E;  3F3B A;  1Z71 A;  2A2X H;  1YKT A;  4Y28 J;  4K69 A;  1SGD E;  2OD3 B;  4B2B A;  4PV1 B;  1KB9 I;  2AIQ A;  1GBE A;  2QN5 T;  1ZTJ A;  1ZYO A;  1SQR A;  1UJ1 A;  4ISN A;  1M9U A;  1MBQ A;  5H4I B;  4D6T G;  3MQK C;  2FEQ H;  2KK7 A;  2XNI A;  2FLB H;  1LT9 B;  3CX5 H;  3HRN A;  1SGI B;  3UFA A;  2P16 A;  2YIU C;  2Z5H A;  4L75 A;  3L71 E;  3FP8 E;  1GI1 A;  2O3J A;  1NZQ H;  1LTB C;  3E6P H;  4U32 A;  2ODY B;  1WMK A;  1MCV A;  5C3N A;  4CR5 A;  2ZPR A;  1KOR A;  3O8Z A;  3EQ0 H;  1V2L T;  3AE1 C;  1KXD A;  3TNU B;  2KXP B;  2OTL P;  2ZHW H;  4FUH A;  1GBK A;  1UTK A;  1GVL A;  1O2V A;  3V7T A;  1XM1 A;  2BY8 X;  1HAI H;  3L36 A;  1BA8 B;  1O2N A;  4HI3 A;  3RXF A;  3UIA A;  1ARB A;  1KYO E;  2FFD C;  4B86 A;  3Q3Y A;  9LPR A;  1VQP P;  2EC9 H;  4JZF H;  1NFY A;  1FX0 B;  1K9M Q;  2CGA A;  1GGD C;  3V2R A;  4B75 A;  4GOD A;  3K65 B;  1S2E A;  3HD7 C;  2PKA B;  2K88 A;  4N3Y B;  2O8M A;  2KUB A;  3RL0 C;  3RXH A;  5EQQ A;  2V7Q J;  3ZVG A;  2E74 B;  3CCE P;  4Q2K A;  3SGA E;  3E91 A;  1TX7 A;  1JMO H;  3ZZA A;  3RXA A;  3LGT A;  2ZYG A;  1THR H;  1ZPZ A;  4MNY A;  4YTA A;  3BG8 A;  1ZPC A;  5BU8 B;  3LDX H;  2WPR A;  1WDI A;  5DKM A;  3OX7 U;  5KLV G;  4X6P A;  3NPS A;  3PRO A;  5TCC A;  1C1P A;  1ZSL A;  3VP9 A;  1BCC J;  3SU4 A;  1FJP A;  1M8O B;  1C2H A;  1GG6 C;  1QHR B;  2ZGC A;  1GDT A;  4AOQ A;  1X8Y A;  1CA0 C;  1LP1 B;  2Y0C A;  2B5T B;  1Y59 T;  5EXM A;  2WIN I;  1HAV B;  1PYT C;  4RKO B;  1OW7 A;  1FS0 E;  2ZU5 A;  2KI7 B;  3AE4 C;  5M1B A;  5DP5 A;  4DJZ B;  1ZR4 A;  2QXI A;  5DP6 A;  5BPE A;  3TJV A;  2YIU B;  1WQV H;  1J1E C;  1LTJ B;  2D2C C;  1TNI A;  2P95 A;  1RIW B;  1BTY A;  1JOU B;  1SQX E;  1K1M A;  1O35 A;  3RXO A;  4FU7 A;  1XUG A;  2H5D A;  4AX9 H;  4B6F A;  3GIS B;  5APY A;  3ATI A;  5CDF E;  1SGF G;  1VQN P;  4JYU H;  2EI8 A;  3BRV B;  4FUG A;  1Y9B A;  4JBZ A;  1TAB E;  2BB4 A;  2H9T H;  1MUE B;  1PPF E;  2FOE A;  3MHW U;  3N7E A;  4OGQ C;  4NWL A;  3DT0 H;  2ZEC A;  1KTM A;  3JZ2 B;  1CBW B;  3M7U A;  4XFQ A;  2WPD D;  1LHD H;  1QY6 A;  3Q1M A;  1WU1 A;  2G55 A;  1SVP A;  3T29 A;  2ASU B;  1D3P B;  2H88 C;  1C2M A;  1OW8 A;  2Z5I A;  1FON A;  1HPG A;  2BDY A;  4LOY H;  3CXH D;  3ZZ3 A;  5GND A;  1MZ9 A;  3RXE A;  2XDJ A;  2P10 A;  1S82 A;  1KYO I;  3ATL A;  2QJY B;  3FWL A;  2KSE A;  5CBO A;  5GTH E;  4OWF A;  2IOT A;  4ABE A;  1EOL A;  3QGN B;  3IN6 A;  1FJS A;  1FDI A;  2FOB A;  2QE7 H;  2UWO A;  3VP8 A;  3H7T A;  2IPQ X;  5FX5 A;  3TJO A;  1BJV A;  2M3E A;  1VJ9 U;  1KSN A;  4KEL A;  1ZHP A;  1TRY A;  3F9G A;  3PO1 B;  5C20 A;  1WOF A;  2FS8 A;  1RD3 B;  1TOC B;  3SJ9 A;  3ZZB A;  2RMZ A;  3S9A A;  2O1K A;  3M5L A;  3PMJ A;  3TGJ E;  1ANB A;  1JO5 A;  3ODD A;  1RS0 A;  3SNA A;  3GCN A;  3UNR A;  2SFA A;  3BTM E;  3HE4 B;  3LW5 J;  1LNQ A;  1FZF A;  1IAU A;  1SGC A;  2XXL A;  4ZKR U;  2YNY A;  5DP8 A;  4GHQ A;  3QWC H;  1EP5 A;  1BDA A;  1MZA A;  2ZYD A;  2QSI A;  1VIT F;  4PJ0 H;  3TYY A;  5JBB S;  1RF0 A;  3QWO C;  3K5B A;  4ISH H;  1SFC B;  3HE4 A;  3AEA C;  1GTW A;  1DIP A;  5AVY B;  1OXG A;  3A7V A;  3LGW A;  4YPC A;  5T6F A;  3A81 A;  2AER H;  2AH4 X;  1L0N K;  3TJU A;  4GT1 A;  1NFU A;  3EA9 A;  1O38 A;  4ZKO U;  3LGY A;  2OYH B;  3JZ1 B;  1HAV A;  1SG8 B;  2G51 A;  3CXH H;  1FAK H;  1JY2 N;  1LVO A;  1FZB A;  2P3U B;  1DX5 M;  4Q7Z A;  1NO9 H;  2AMP A;  4RJT A;  5CJ4 A;  2Q3E A;  1JBU H;  1GI2 A;  1KD1 Q;  1AN1 E;  3WY8 A;  1MTS A;  1R5L A;  1LPZ B;  1Z8J B;  1LTI C;  3S4R A;  1ZHM A;  1SL3 A;  2KOG A;  2A32 A;  1FDM A;  3EYD A;  4NFE A;  4ZAE A;  2V3H H;  3CPW O;  4AGK A;  2J59 M;  4R0I A;  3BTT E;  2FZZ A;  3KQC A;  1YJ9 P;  2K8I A;  1SQQ G;  3KZI H;  2SGA A;  3GIC B;  3MWI U;  4K8B A;  3RML H;  1EXJ A;  3M36 A;  4M9F A;  2IDB A;  2IYP A;  2DW3 A;  1FY3 A;  1WV7 H;  3HE5 B;  3V4Q A;  4AOR A;  5EXL A;  4ACB A;  5LPR A;  1L0L J;  1G2C B;  4OGQ D;  3ZZ5 A;  1IHS H;  5FBE A;  4KTU A;  1L1J A;  2JJL A;  1TPS A;  4AYY B;  2JKH A;  5GIB A;  3KYF A;  3RU4 D;  1GBC A;  3KID U;  3TGU J;  5DGJ A;  4I31 A;  1F0U A;  4NIV A;  1U7J A;  3A0B H;  1ELT A;  3M9B A;  2P7J A;  2ZU3 A;  1DEE G;  3TLO A;  3DSO A;  1J17 T;  1LT9 C;  2TBS A;  2ZFS A;  1BUI A;  1QIX B;  1GU5 A;  5AW3 B;  4FXG H;  1GMJ A;  2OGU A;  3CL3 D;  1AB9 C;  1QL7 A;  1B0F A;  2NZ2 A;  3O8B A;  4TPI Z;  3G01 A;  4HTC H;  3V13 A;  3L4F A;  3NFQ A;  1UCY K;  1SC8 U;  4K2Y A;  2J9N A;  4PD4 D;  1G3D A;  1UVO A;  3AAU A;  1BMA A;  1HJ9 A;  2AMD A;  1MD7 A;  1FZC A;  1WXR A;  3CMA P;  1CA8 B;  3RXM A;  2XOK D;  1GL0 E;  2P59 A;  1L0N G;  3SN8 A;  2P1J A;  5FCK A;  1KXB A;  1SQX D;  3CP7 A;  2P8O B;  1YLD A;  3H1J E;  1SQQ J;  1P04 A;  2A1D B;  4CRC A;  3L70 J;  1GL2 D;  3HAT H;  2BMG B;  2B7D H;  2R3Y A;  5ABW A;  1L0L G;  2XC0 A;  1AFO A;  2FI4 E;  1NU7 B;  3P8M C;  2FOA A;  2L6O A;  3SWY A;  5F6M A;  1C1S A;  1BSN A;  1HJB A;  3H1K E;  2HAL A;  2UWL A;  4FUD A;  4WWI A;  2HG5 D;  1VF5 C;  4PJ0 E;  3CD6 P;  1HH0 A;  2QG4 A;  1ELE E;  1A3B H;  2KP8 A;  3AEE C;  1GWA A;  2AFQ B;  1KQS O;  2PKA A;  3K9X B;  4NSV A;  2UWP A;  3H1H J;  1YLC A;  3PYH A;  2IFN A;  4IFF A;  2NWN A;  1FY5 A;  3R3G B;  4WY4 C;  5E8E H;  5CMZ A;  1AMH A;  1VCP A;  2LPR A;  2RG3 A;  3E1R A;  1L4D A;  1MBM A;  1P09 A;  1SLV B;  4H4F A;  4INL A;  2WMM A;  5EW2 H;  1WQS A;  3F9E A;  4PV1 D;  3IFM A;  2GT8 A;  3L73 E;  4CRG A;  1C5Y B;  2QXH A;  2CPS A;  3SFD C;  1EAW A;  4BXL A;  5TJX A;  2C9L Y;  3UAI C;  2CJI A;  4INH A;  2WSS H;  4K3J A;  3GCO A;  3OJA B;  4IFD K;  1Q86 Q;  1EZV G;  5HIZ A;  3TU7 H;  3MNX A;  1CT4 E;  2HFE D;  2G5V A;  4OGY A;  4HZH A;  2R44 A;  4K3A A;  4B76 A;  4CH2 B;  1HJ0 A;  1JM0 A;  1PZQ A;  1ZHR A;  1T2K C;  4AN7 A;  1OWI A;  4JYT A;  2C90 B;  3ZIA D;  2FYU E;  3FGA D;  1QB1 A;  4X2V A;  3C9I A;  1VZQ H;  2H5C A;  4ZRO A;  2BDA A;  4B71 A;  2A31 A;  1Y5A T;  2F9U A;  3RXJ A;  1YYC A;  3BTK E;  1SLU B;  2BM2 A;  1R5S A;  2WPL S;  3C27 B;  1PPB H;  1SQX K;  2FM2 A;  1HGZ A;  3SWK A;  2J4I A;  4WJG 2;  3EST A;  4HB1 A;  2ANW A;  3QZQ A;  1TX6 A;  5AFY H;  2ZPQ A;  3PMA B;  2HLD D;  3Q2Y A;  1AQ7 A;  3KF2 A;  3RMO H;  1SGP E;  1GI3 A;  1AKS A;  1HDT H;  5AVZ B;  1O5B B;  2KIK A;  1EZV D;  2M5A A;  3WU2 H;  4DIH H;  1OWK A;  2SGQ E;  4UB6 H;  2BEQ D;  1YTZ I;  2BLV A;  3ZZ8 A;  3S7H B;  2E5T A;  3L37 A;  1CHO F;  2QGR A;  3TVJ B;  1FU1 A;  1SQA A;  2IZ0 A;  2V35 A;  3LJO A;  2RN0 A;  4RI0 A;  2OCV B;  4TSF D;  3SUF A;  3MMG A;  3ZZ7 A;  1B5G H;  2D2C D;  1BML A;  5B5E E;  3Q3K A;  2FTL E;  2TGP Z;  1KMI Z;  4Y0Z E;  3PMH B;  1RF1 B;  1F0R A;  1QJ6 B;  1OP8 A;  4YOJ A;  1YP9 A;  1OFC X;  4C7N B;  4FUF A;  2AHM E;  1ZW0 A;  3U8O H;  1AIX H;  2ALV A;  1JRT A;  4WME A;  1GJ7 B;  4DVA U;  4B1T A;  2PRR A;  4PD4 H;  1VGC B;  5C94 A;  3GY4 A;  4BTT B;  1MMJ N;  1ZLR A;  4F4O C;  1O3G A;  3FWN A;  3CC4 P;  4A7I B;  1BGY J;  4X2X A;  3A86 A;  2ZDM A;  2YXQ B;  2CV3 A;  1MAY A;  4U2W A;  6CHA C;  1PQ7 A;  1SBW A;  3FP7 E;  5E79 E;  1TNJ A;  3LC5 A;  1JNM A;  1EPT C;  2ZGX H;  2WPH S;  1GHW H;  1Y8A A;  5DSF A;  1JTH A;  5B66 H;  2KB7 P;  3VG8 A;  2WSF J;  3D6Z A;  1ZR0 A;  1YBK A;  3F89 A;  1GL2 B;  3VMX A;  1VQO P;  1SFQ B;  1Z8G A;  2QJP C;  5JBT A;  3ATK A;  3UNS A;  2C8Y B;  5K0H A;  3LOX A;  1SQQ E;  4GCH G;  2JJ1 D;  1DD3 A;  3TH4 H;  4H0L D;  2BDI A;  5EW1 H;  3ZVB A;  1O2K A;  1E1R D;  2BLQ A;  3DA9 B;  2GDE H;  2C8W B;  2G52 A;  1GK6 A;  1SQX G;  3U8R H;  1SQV J;  1H8A A;  1EAS A;  5L6N H;  1AFE H;  2BD4 A;  2A06 G;  2F9P A;  5EIY A;  2Z7F E;  4GPG A;  1EQ9 A;  1HAP H;  1IK9 A;  1C2L A;  1C5R A;  1MQ5 A;  1L4A B;  1S85 A;  4TY6 A;  2A4Q A;  2ZTX A;  1W13 U;  4XDE A;  3L73 J;  2XV5 A;  1H9I E;  4WF8 A;  2QVA A;  1JMB A;  3GDS A;  3USS A;  4D6T E;  1S5S A;  2BX3 A;  1J8A A;  5CBN A;  5J4S A;  1VCQ A;  2BLW A;  5DJ7 A;  2ZFF H;  2Q6Q A;  4WXV A;  5AW4 B;  2Q9I A;  1AVW A;  1SGQ E;  4RN6 A;  2FFD A;  1N7S A;  2YMS C;  4U3F D;  5KLV E;  3CC2 P;  1D3Q B;  3BTQ E;  4MDS A;  2LP6 A;  1IQF A;  1ELV A;  3GY8 A;  3AEB C;  2XWA A;  4FU9 A;  4RES B;  3D70 A;  2BVX H;  3DFJ A;  1GMC F;  1QX8 A;  3HUS A;  1BRU P;  1FPC H;  2GZ7 A;  3LC3 A;  3PRJ A;  1Q90 D;  2Y5H A;  3SO3 A;  2RH0 A;  3M5M A;  1MCT A;  3H1L J;  4CRB A;  3T27 A;  1NTK G;  5IK2 D;  2C4F H;  1Q31 A;  1DAN H;  2WWW A;  4WH8 A;  4GCH F;  4YOI A;  3C8V A;  3WU2 E;  3L70 E;  3U1A A;  3UOU A;  4IN2 A;  3F68 H;  2PLX A;  1SQP D;  3F1S B;  1KQF B;  1Y5U T;  5B5E H;  2QJP B;  2PW8 H;  3VB3 A;  1ZGI A;  3L74 D;  1AWH B;  1SFI A;  2FYN C;  1SQB E;  3WUU A;  1A5G H;  1RJX B;  4W7Y A;  1YCP M;  3BTD E;  1FNI A;  2P2U A;  3VYI A;  3SSU A;  2CXV A;  2ZHD A;  1KTT B;  5KLV K;  2YNB A;  2NU1 E;  7LPR A;  2KCY A;  2OXS A;  5EOK A;  1VPC A;  2IJD 1;  3R4Y A;  1CE5 A;  2FYN B;  4IL6 E;  3RXQ A;  1WAY B;  4MVN A;  3PRB A;  2YOL A;  5T6D A;  2E76 B;  1IQN A;  1C5V A;  4FUC A;  1NOH A;  1DM4 B;  2OBQ A;  3H32 B;  1QZ8 A;  2D26 C;  3T2N A;  1JCD A;  1EAI A;  1C1O A;  1CGJ E;  1FI8 A;  1K1N A;  1YPE H;  1ZSK A;  1UW7 A;  4A1V A;  2XTT B;  1O2S A;  3M91 A;  2ZHF H;  1PPG E;  3HK3 B;  1E1Q D;  3OFN D;  2PSY A;  1SQP J;  1P84 H;  2CPB A;  3KDP B;  1IFJ A;  4UB8 H;  2FKW B;  2FI3 E;  2ZT9 B;  2J95 A;  2KCP A;  4NCY A;  2Q6G A;  1BCU H;  2YKP A;  4NIW A;  3AW0 A;  4I86 A;  3GCT G;  2GTB A;  3ZVA A;  1GCT C;  3M3V A;  4D9R A;  3SFE C;  1B7X B;  1MZD A;  3SWF A;  3Q3D A;  1YLN A;  5AF9 H;  1C5O H;  4AFS A;  2BDC A;  1NRS H;  2QEX P;  4DT7 B;  3LKW A;  5E2P A;  2E76 C;  3KQD A;  4P02 A;  1QUR H;  3P95 A;  1AZ8 A;  5L2Z H;  1A46 H;  2QAA A;  3L70 D;  1SQT A;  4I1L A;  3SI3 H;  1P3C A;  3B5N A;  1DVA H;  2PKS B;  4CPG A;  3L74 E;  3IG6 B;  3GCH B;  4CHA C;  2K3R A;  1QJ7 B;  5AW7 B;  5EST E;  5GTI H;  1NTK D;  2P94 A;  1N8O B;  1O5F H;  2BLO A;  2FI5 E;  2V7Q D;  1AUT C;  4O3T A;  3TGI E;  4ABF A;  1V3X A;  2A45 G;  5TIS E;  5APX A;  2KS1 B;  1TMU H;  2BY5 X;  1BTP A;  4THN H;  2YMK A;  1IQJ A;  1G36 A;  5AW0 B;  3JC2 2;  4I6M C;  1D4P B;  3V4W A;  1FZE A;  2B88 A;  1GHA F;  3L74 G;  2BZ6 H;  2R0K A;  4K1E A;  1C9T A;  2ULL A;  3PP5 A;  3U1J B;  1DY9 A;  3L73 G;  4JZI A;  5HKK D;  3G3Z A;  1P57 B;  1GDN A;  1BMN H;  2ZNK H;  1MU6 B;  1OVR A;  2G8Y A;  1GD2 E;  1JTH B;  1NRR H;  4BAN B;  1RF0 C;  1NPM A;  2L5G B;  3GF3 A;  1K1I A;  4AFQ A;  1D6W A;  4N78 E;  1J1D B;  3S0N A;  2Y5F A;  3MU4 A;  1OPH B;  3ZZ4 A;  1NTZ K;  1YC0 A;  4RT1 A;  5A2M H;  2VIP A;  2VIO A;  4KTS A;  4RT0 A;  1ZRT E;  5AW6 B;  2ZTZ A;  2PP6 A;  3JCU H;  3N7N A;  1FOS F;  1GDU A;  1LQE A;  1MUU A;  5AW1 B;  3F2G A;  3HGP A;  3AAV A;  1KTS B;  1YGC H;  1GJ6 A;  1NS3 A;  5A8Z A;  4WWY A;  1SQB J;  1ZLL A;  3FO8 D;  1MV8 A;  4ZNC A;  3A0H E;  3F0O A;  4D76 A;  1O2Q A;  1QL1 A;  2JET B;  4IS5 A;  3M35 A;  2VGC C;  4X2Y A;  1PIX A;  2OYO A;  3H1J G;  1YYY 1;  2Q3I A;  3HTK B;  1TU3 F;  4C7N A;  1NYH A;  1KXF A;  2BZA A;  1G37 A;  4GAW A;  1JY3 N;  1GCT B;  2BD3 A;  2B9L A;  3C1L A;  2FXR A;  1MTN C;  3SUD A;  2RFK C;  1DDJ A;  2G4U A;  3SJ8 A;  1N73 B;  5C5N A;  5FX6 A;  2FOF A;  1C2G A;  3TNU A;  1LGH B;  3AEG C;  2BOH B;  2GA1 A;  4P00 A;  6GCH F;  4MN4 C;  2J94 A;  3Q5P A;  1DH3 A;  1UO6 A;  1RE4 C;  5CJ0 A;  2GCH F;  2ZZU H;  4ISI H;  3PHL A;  2P3F H;  3A82 A;  3EA8 A;  4MNX A;  1QFK H;  1DXW A;  2ZKS A;  4ABJ A;  4ABG A;  2WYG A;  3RXD A;  1IFP A;  1C5S A;  4AUW A;  3CI9 A;  2F91 A;  4FOU C;  1YF4 A;  2WV4 A;  3PRD A;  1QB6 A;  5CE1 A;  2H89 C;  2P58 A;  3SU6 A;  1BIO A;  1VL2 A;  1IJD B;  5FPT A;  1KIL A;  3SNE A;  1GL1 A;  1MH0 A;  1J9C H;  5DK1 A;  2J98 A;  5BVZ A;  4JYB A;  3DFL A;  3W95 A;  4ABI A;  1PPC E;  2N9Y B;  3LH3 A;  4ABA A;  3SQH E;  3FXE A;  5G4B A;  1L4Z A;  3FP6 E;  1FZZ A;  1C2J A;  1H9H E;  4Y8Z A;  1DT2 A;  1U57 A;  1AA0 A;  3BRT B;  3U28 C;  1SQO A;  3T62 A;  2FP7 B;  2J38 A;  1CA0 B;  3TNS A;  3PWB A;  2ANY A;  1F5L A;  4MTB A;  3M5O A;  2KAI B;  1K1P A;  1IQG A;  3GS9 A;  1VQ6 P;  3U9A H;  5T6G A;  1HRT H;  1GBI A;  3CCV P;  3MU1 A;  3Q5R A;  4FUI A;  3I77 A;  2ZCL P;  3QX5 H;  4DY7 B;  3URE A;  2A06 E;  5GCH G;  1EP6 A;  1D3T B;  2HPP H;  1MU8 B;  1CSB A;  1EDI A;  1RTF B;  1X79 B;  2EST E;  4KTC A;  2WSS D;  4CBO A;  1GVK B;  1F92 A;  2WSE J;  1N1L A;  1FQ3 A;  1K22 H;  1S81 A;  3BTE E;  4YOG A;  1V2O T;  4AYV B;  1S4X A;  1NU1 K;  5DJT B;  3A5T A;  1ZML A;  2O01 H;  3A83 A;  3H5C B;  2Y81 A;  4KKD A;  2XKM A;  1FXY A;  4ZH8 A;  3SJO A;  1PQ5 A;  1VQ8 P;  4WB4 A;  3S1K A;  2ZHQ H;  2FX4 A;  2W7U A;  1LHG H;  3OAA D;  2J58 A;  3ABV C;  3TF5 A;  1W14 U;  5KGO A;  2OYH C;  1YM0 A;  1Z8R A;  1WTH D;  3P7K A;  1O31 A;  1DWD H;  4IMQ A;  4I7Y H;  1HF9 A;  1JIM A;  1GJ4 H;  1TAW A;  3BG4 B;  1GBD A;  1XX9 A;  3RM2 H;  3H25 A;  1EST A;  6EST A;  3PH0 A;  1INC A;  3U1C A;  5GJ4 B;  1S3J A;  2OP9 A;  1WRG A;  4XBB A;  2Y80 A;  3M0D C;  2J98 B;  1TPO A;  3PV4 A;  1QA7 A;  1C1T A;  2YMS D;  2W83 C;  3ZYE A;  2Q5U A;  1Y5B T;  1GMD G;  3RK3 C;  2HYN A;  4INK A;  1SKY E;  4ABD A;  1TNG A;  2CHA C;  2ZIQ H;  3ZYD A;  1TON A;  2VIQ A;  1MKM A;  1ANC A;  3AAS A;  4O9V A;  1N8O C;  1Z56 A;  3WWB A;  1PGO A;  1FE6 A;  2HR3 A;  2ZT9 D;  1VQM P;  1KY9 A;  3CC7 P;  1O3F A;  1HFD A;  4MPU A;  1COW D;  1P2M A;  3O8R A;  1MFZ A;  3E1X B;  3U69 H;  2PKS C;  4X6M A;  5EU8 A;  1CW5 A;  3CS7 A;  1C5U A;  1V2P T;  1H8I H;  4ZKN U;  5A0A E;  1EJA A;  2E75 C;  3L71 D;  3VOP A;  1OYT H;  1HGT H;  1O2H A;  1G9I E;  1NTP A;  4L73 A;  2PTC E;  3IR9 A;  1SPJ A;  3H1I E;  1QQ4 A;  3IIT A;  1BDC A;  1NFW A;  2ZU2 A;  3EAJ A;  1HAH H;  3VEQ B;  3JSV C;  4ABB A;  2VWO A;  2VU8 E;  4ASU D;  4GOE A;  1LVY A;  2GGV B;  4NZQ A;  5E0J A;  5H2F H;  1EXI A;  1LKB A;  2XCN A;  1PL5 A;  5AVQ B;  4OVN F;  1HBW A;  1A0J A;  2IYO A;  1N7L A;  2ZGB H;  3SJK A;  2R2W U;  3CCS P;  2G00 A;  1IQK A;  1N8R Q;  4GUX A;  4LK4 A;  1PPH E;  2LXB A;  1KC8 Q;  2C3S A;  3NZI A;  1OX3 A;  2ANK H;  1NBM D;  1HLT H;  1EFR D;  4I8K A;  1GMH F;  1GHY H;  1ZTK A;  2J2U A;  2Q7C A;  1T8N A;  3SZN A;  1NTZ J;  4LC1 A;  1H0T A;  1A02 F;  2JET C;  2KX4 A;  2PWX A;  2AEM A;  4D6T J;  2Z9J A;  2B0F A;  1BTX A;  3B4S A;  3HD7 D;  2K1Q A;  2RA3 A;  1UTL M;  1TE0 A;  1K73 Q;  1KB9 E;  2P93 A;  3DSP A;  3MH7 A;  1DIT H;  4JQ0 D;  5AW2 B;  2OYH A;  2B8O H;  1FZC C;  2Z3D A;  1K9O E;  3CCU P;  3SU5 A;  5EPY A;  1J1D C;  3NTN A;  1GBL A;  3LU9 B;  1IZN B;  1HCG A;  3RU4 T;  2HPQ H;  2SGP E;  3UWI A;  1SHY A;  3ITK A;  1YTZ T;  1EOJ A;  1O5G H;  3UNQ A;  2OUA A;  3MH6 A;  3MTY A;  1GW3 A;  1C5L H;  4O97 A;  1GBA A;  4O9B A;  1BJU A;  2QF5 A;  3F0P A;  1KLI H;  4NPE A;  2HNT F;  3H09 A;  5C2Z A;  3MU8 A;  3G9R A;  4H44 B;  1K8A Q;  2BCC J;  3BTG E;  1QBN A;  4BXS A;  1HXF H;  5C0T A;  1UK3 A;  1HJA C;  1TNL A;  1C2D A;  1YPG H;  1OYQ A;  1TB6 H;  2YMS B;  3V2N A;  2Z94 A;  4TT3 D;  2TRM A;  1T4U H;  4TWY A;  1O2G H;  1N6X A;  2QE7 D;  4IBL H;  4YT7 H;  2B87 B;  2N1T A;  1G32 B;  4AC9 A;  2PHB A;  1HAZ B;  2QC2 A;  2Z3E A;  3NWU A;  4Y11 E;  1C1U H;  1FPH H;  5IYT A;  3RXS A;  1KZU B;  1EZS C;  2W3K A;  5A0C A;  1XTG B;  2F3C E;  3L33 A;  2BDB A;  4TY7 A;  1NAY A;  3RXG A;  5A0B A;  1KIL E;  5A09 A;  2WPK S;  2FFD B;  5LGO A;  3A7Y A;  3O8C A;  2TPI Z;  2WUC A;  2B87 A;  2N1T B;  4H13 B;  4U3F G;  4IFM A;  3ZDM A;  4BWN A;  3W68 A;  1AE5 A;  1QR3 E;  1XXD A;  4ACA A;  4L74 A;  1OSS A;  4BTU B;  1V2U T;  2M5T A;  4BAM B;  3TPI Z;  2AS9 A;  2F9O A;  3VPK A;  1ELG A;  2L91 A;  4R4M A;  2C8X B;  4YXW D;  3WW7 A;  3SV7 A;  3RXB A;  2MKV A;  1K05 A;  4OGQ B;  1D9I A;  3GY3 A;  1QB9 A;  1ORF A;  3UPE A;  4N78 D;  1NY2 2;  3P8G A;  5DP4 A;  5KJ7 A;  2ZDV H;  1D6R A;  4R4L A;  3M3S A;  4H6T A;  2WPS A;  1PPJ D;  2IFM A;  1RIW C;  5H2F E;  2QV1 A;  4OS1 A;  4X0W U;  2O01 J;  1YPL H;  2OQQ A;  3OY5 U;  3RXV A;  2VWL A;  1TIO A;  2I1K A;  2FXO A;  1DIC A;  3VGC B;  3O6Q A;  1BCC D;  3H1I G;  3VMZ A;  1BT7 A;  4DUR A;  1HAY B;  3CWB E;  3H1K G;  1P06 A;  4WY4 D;  1J1E B;  1LTJ C;  2D2C B;  1E0F D;  1C2F A;  5F53 A;  3KQ5 A;  1YCP H;  5DPA A;  3BTW E;  1THS H;  1M1J A;  2FYQ A;  3FFG A;  1FUJ A;  5CCH A;  4NA9 H;  1LQD B;  1H8H D;  1E37 B;  2H8P D;  1SQB G;  3P70 B;  1YWU A;  1VGC C;  2BD7 A;  2XYA A;  2IN2 A;  3MUD C;  1Z6J H;  3RXP A;  3AK5 A;  3URC A;  3R0F A;  3FAO A;  1L1N A;  1XTC C;  4NIX A;  1RTK A;  4TLF A;  1GPZ A;  4MQA A;  3A7O A;  1BGY D;  1C1V H;  1OVU A;  2FPZ A;  3SND A;  2I1J A;  3G71 P;  4GOF A;  4JK6 A;  4H6S B;  1IOE A;  2WHX A;  3M9H A;  1UHB A;  1WCZ A;  2GMT C;  3KQG A;  1O3K A;  2JO1 A;  3T25 A;  1FBM A;  1NU1 E;  3NRL A;  3EQ2 A;  3TK1 A;  1L4A A;  4MPX A;  4IC5 A;  3PV5 A;  5EG4 A;  1P2O A;  1H8E D;  5AVW B;  2N9B A;  1G3B A;  1JWT A;  1LTS C;  2FDA A;  1PGQ A;  2H6M A;  2NRG A;  2ZXX A;  4ASH A;  1YHQ P;  2GX4 A;  1NO4 A;  5L8R J;  3A8A A;  1Q7Y Q;  4YXD C;  1VCW A;  1A5I A;  3Q3X A;  4X2W A;  5GTI E;  3SGQ E;  1LTT C;  3KXD A;  2A2Q H;  5FL7 D;  4ZHM U;  5CCG A;  1QL8 A;  2TGD A;  3Q00 A;  3SUG A;  1TOM H;  1ZOM A;  3NXS A;  1FOS E;  1HTL C;  4NFF A;  2WYJ A;  4CRE A;  1FC2 C;  3IWM A;  1L0N J;  1GL2 A;  2OC1 A;  1V2N T;  2JH0 D;  3RLW H;  1LT9 A;  1G3E A;  3LPR A;  1ELA A;  2OLG A;  4XOJ A;  3F9F A;  4X8S H;  1D7M A;  1JIR A;  2BTC E;  4DGJ A;  1VF5 D;  1EAU A;  3MHV A;  1KB9 D;  2HRV A;  1T6A A;  1GHZ A;  3UR6 A;  1ABJ H;  2KZJ A;  2ILN A;  3A89 A;  4U3F J;  3BIU H;  2H7H A;  5APQ A;  1EPT B;  2O01 N;  1H1B A;  2WT7 B;  2ZF0 H;  3BCC E;  2YMY A;  3KYG A;  1PV3 A;  3PLB A;  3T5F H;  3CWB G;  2VWM A;  2ZWL H;  2CF8 H;  2Z9I A;  4Y76 A;  1VF5 B;  4YZU A;  1GDQ A;  1EQ7 A;  3BCC D;  1ZP0 C;  1RF1 A;  3A3Y B;  3TGU E;  3HPT B;  3QUM P;  3MUD A;  4NGA H;  8EST E;  2VIV A;  3CCQ P;  1SGE E;  1FIZ A;  2FS9 A;  1EDL A;  5DP7 A;  2IBZ D;  1VQ9 P;  3ATM A;  3LT3 A;  2AEF A;  1FN8 A;  4XFJ A;  4ISO A;  2FYU J;  4I2L C;  2XZR A;  2W6J D;  4XBD A;  5HIY A;  1P01 A;  2GVF A;  4FU8 A;  4YM9 A;  2NPS B;  3NUM A;  4ZXX H;  1QGK B;  4WY4 A;  2WPV B;  3MIW A;  1NTM J;  1RFN A;  1DWC H;  1P8V C;  2GT7 A;  2W6I D;  1KFM A;  2NU4 E;  3A7Z A;  3JCU E;  1DE7 H;  1TA6 A;  1L0L D;  4K35 A;  2NPS D;  1JOC A;  5KLV J;  1H89 A;  4WBA A;  1BBR H;  1IO4 A;  1CU1 A;  4X1R U;  1LJ2 A;  4U3F E;  1AHT H;  2AGG X;  1ZPB A;  3F2F A;  5JB9 S;  1Y3V A;  5KED A;  5T1V A;  1EKB B;  1MTU A;  1TA2 A;  1KV4 A;  3RMN H;  1AQT A;  5TCA A;  1Q81 Q;  3KN2 A;  1PPJ G;  1F0S A;  1G30 B;  1KDQ B;  3A84 A;  8LPR A;  4Z1M D;  4WMF A;  4B2A A;  4AQR D;  2WPQ A;  2QM8 A;  1O3O A;  3TGU D;  1ZGV A;  2UUF B;  2XND D;  3QTV H;  4Y10 E;  1N7S D;  3RK3 E;  3MFJ A;  5BU5 A;  3SYJ A;  1M90 Q;  1H8D H;  3V3M A;  3OE7 D;  4OGX A;  4A6L A;  1C5X B;  3PB1 E;  2IBZ E;  2VH6 A;  3MGN A;  3B9F H;  4R8T B;  1W8B H;  2W90 A;  5KAF H;  1O3E A;  3V6I A;  1VQ7 P;  1NAF A;  1KXA A;  3L72 D;  2Q1J A;  4U30 A;  1E36 B;  2C93 B;  1SOZ A;  3KQB A;  3B23 B;  5EJZ A;  1N73 A;  3QH9 A;  1UVU H;  4NWK A;  3ITI A;  3UQV A;  1V6D A;  1YPM H;  3H1J J;  3M61 U;  3MNC A;  1SFC D;  3BTH E;  1EDK A;  1NC6 A;  2UWJ E;  4SGB E;  3I56 P;  4JMY A;  3N7O A;  2W27 A;  5CHA B;  1O3J A;  3KYQ A;  1NKZ B;  3D6Y A;  2A5I A;  2ZU4 A;  5C1X A;  2M8R A;  2FOD A;  1OW6 A;  1O2P A;  1HV7 A;  2HOB A;  2FOC A;  1G2C A;  4K5Z A;  3VB6 A;  3VXE H;  1G2M A;  3RL0 B;  3HE5 A;  1BSH A;  2O9Q A;  2SGF E;  1ESA A;  2VVU A;  1JUN A;  1MFT A;  4DOQ A;  2ZI2 H;  2KZI A;  1H88 A;  2PFE A;  2ZQ2 A;  4KGA A;  4UDW H;  2B89 A;  3WUV A;  1OP0 A;  3M9Q A;  2RKL A;  1XVM A;  1LPK B;  3BAT A;  1RH5 B;  1JY3 O;  3CLQ A;  1LVM A;  1GBT A;  3RP2 A;  2ZFC A;  1SQQ K;  3CNR A;  2POH A;  4D9Q A;  3H7O A;  3C1K A;  4GKG A;  1DFP A;  3VFE A;  1KMH B;  1SGN E;  1KN7 A;  3RC4 A;  2A0Q B;  2ODP A;  4NA8 A;  1KB9 H;  1M1J B;  3CEN A;  1TNH A;  3M0D A;  1ZMJ A;  2W6J H;  1P2K A;  1O2X A;  3AW1 A;  1C5Z B;  4FET A;  1QBO A;  3L6P A;  2FXP A;  5AW8 B;  1JEK A;  1QA0 A;  4D7F A;  2Q1K A;  1P3E A;  1UK2 A;  2H1U A;  3PJS K;  3CWB J;  1OWH A;  1SQV G;  2KS1 A;  1UTO A;  1UIX A;  2AIP A;  3H1L D;  2K9Y A;  1UTN A;  1SOT A;  2CMY A;  2PV9 B;  3NCL A;  3I55 P;  1O34 A;  1EZU C;  3TIT A;  4ZMD A;  5KAI H;  4AYC A;  3S7K B;  1EAT A;  3RBZ A;  1M57 D;  4O03 A;  1XUH A;  1ZME C;  2BDG A;  5GDS H;  5C39 A;  3SOS A;  4B6E A;  2IBZ I;  2M0B A;  3UTU H;  5TJH A;  2PR3 A;  1LWU A;  2K37 A;  3T97 A;  1ZMN A;  3M0A A;  4GLY A;  5F8X A;  1NTM G;  1CI6 B;  1FLE E;  1QQU A;  5T3H A;  1ZRT D;  1VQ4 P;  3EE7 A;  5KJ7 D;  1SQP E;  1N7S C;  1BE3 E;  2F43 B;  4A5T S;  2Y9Y A;  5F8Z A;  5AVV B;  2JDI H;  3H1L G;  1NU9 A;  2EA3 A;  1QL2 A;  1O5C B;  2AEI H;  3M7Q A;  1URQ B;  1M56 D;  1O37 A;  4EYY Q;  1YY3 A;  2ZGJ A;  1TBR H;  3EWK A;  1F2S E;  3G6E P;  1BE3 D;  2G81 E;  2QIQ A;  3RC6 A;  1GVZ A;  3BEI B;  1O0D H;  4ZHA A;  1GJA B;  5JYI A;  3L70 G;  3FOA A;  5AVU B;  2XC5 A;  1MD8 A;  1SHH B;  5GWZ A;  2O8U A;  2WIT A;  1CI6 A;  1NTK E;  4LLH A;  1TRN A;  3SV6 A;  2AMQ A;  4NG9 H;  5APW A;  2QY0 B;  4B2C A;  4H0L C;  5DN6 D;  1C5P A;  3M5N A;  1E38 B;  1USE A;  4OS6 A;  2E74 D;  5E0H A;  3DSG A;  4D8N A;  2OC8 A;  2ZAE B;  1OMI A;  4KP0 A;  1NJI Q;  2KNC B;  1CQQ A;  1TYN A;  1UTQ A;  3I5C A;  2AXT H;  1GU4 A;  1QRX A;  1W7G H;  3SI4 H;  1W12 U;  3ATW A;  1KYN A;  1E34 B;  3B8E B;  4IOI H;  1KXC A;  2R2M B;  1YBW A;  1JB0 J;  1IHT H;  2KZ4 A;  5I25 A;  1A5H A;  3TSI A;  4Y8Y A;  8GCH G;  3DUX H;  2PFX A;  1SLQ A;  3KHU A;  1TGN A;  4DZO A;  1N86 A;  3M37 A;  3BTF E;  4I8J A;  1TPA E;  5EQS A;  2TGT A;  1O3D A;  3IAO A;  1GI9 B;  3RGU A;  2Z9G A;  2GCT C;  1O3I A;  5E79 H;  1P10 A;  2N1T C;  4H13 C;  3GDV A;  2WPJ S;  5AW9 B;  1BMF D;  3PO1 C;  2HWL B;  1GJ8 B;  4CRF A;  4C46 A;  1A02 J;  2QRX A;  4NIY A;  5PTP A;  1N6Y A;  4WVZ A;  1NTZ E;  2BQ6 B;  3FXD A;  2ZC9 H;  1GBM A;  2BHG A;  4MPW A;  1OXZ A;  2BD5 A;  2GV7 A;  4UEH H;  3TH2 H;  1GJD B;  3UY9 A;  1E79 D;  1NTK J;  1O2J A;  1PJP A;  1HNE E;  1W10 U;  1WUN H;  4OM9 A;  1A0H B;  4B73 A;  1C1N A;  1T32 A;  4DII H;  2VH0 A;  3CS0 A;  2IBZ G;  3MYW A;  3CXH I;  3LIW A;  3D62 A;  4EIJ A;  2KLU A;  3FX0 A;  2BVR H;  3AED C;  1A2C H;  3Q77 A;  3QGJ A;  3ZV9 A;  3B5N C;  4CRA A;  3A7W A;  3K6Y A;  1ELC A;  4J2Y B;  4FUE A;  4KT0 J;  2PUQ H;  2V4H A;  1AVY A;  1GK4 A;  1T3J A;  1EJM A;  1T8L A;  2NU0 E;  2PGD A;  2I8D A;  4UFD H;  1DXP A;  1OVV A;  2CK3 D;  1BTW A;  1EZQ A;  5KJ7 C;  5GPI B;  2VWN A;  2OAR A; 
#chains in the Genus database with same CATH homology
 3DSO A;  4XD7 D;  1GMJ A;  3O8B A;  4ASU D;  2QJY C;  2NZ2 A;  2GGV B;  1EXI A;  1S5L X;  2XCN A;  1PL5 A;  3SV9 A;  1NGM B;  2OBO A;  3OEH D;  1WXR A;  1K04 A;  2XOK D;  2P59 A;  1NBM D;  2WV9 A;  1EFR D;  2FOM B;  3DCL A;  2K0Q A;  3SV8 A;  2F9V A;  4A1T A;  2K1Q A;  1DD4 A;  5EPN A;  2L6O A;  2KM0 A;  3DSP A;  5KKZ C;  3FN8 A;  1VF5 C;  5C0U A;  2FBW C;  3AEE C;  3SU5 A;  5EPY A;  5FPS A;  4DT4 A;  3GF7 A;  1R8E A;  1RGQ A;  1RTL A;  4PV1 D;  3N7D A;  2QF5 A;  3F0P A;  3H09 A;  3SFD C;  3G9R A;  4H44 B;  4Z1M H;  2E74 C;  5C0T A;  3B71 A;  2YMS B;  5B6L A;  4TT3 D;  4A92 A;  3AE3 C;  2QE7 D;  5EQR A;  3RL0 g;  4B76 A;  1HJ0 A;  3ZIA D;  5KLI C;  3FGA D;  2JP3 A;  3U1I B;  4I33 A;  1KQG B;  3O8D A;  1KIL E;  4B71 A;  4F55 A;  2F9U A;  3O8C A;  2KFW A;  2WZQ A;  4H13 B;  1W0J D;  2FM2 A;  3AE5 C;  4Q4L A;  2KR7 A;  3AEF C;  2HLD D;  3Q2Y A;  2ZT9 C;  4R4M A;  3KF2 A;  4YXW D;  3WW7 A;  3SV7 A;  2MKV A;  1K05 A;  3OYP A;  4OGQ B;  2BEQ D;  4RI0 A;  1RQU A;  4TSF D;  3AE7 C;  5ETX A;  4R4L A;  1MAB B;  3SUF A;  2D2C D;  2WQY C;  1KMI Z;  2QV1 A;  2O01 J;  3WWF A;  2OQQ A;  1NBM E;  3OTP A;  2AHM E;  3SU0 A;  5C17 A;  3RC5 A;  2KCA A;  3O6Q A;  2M2A A;  1BT7 A;  2JIZ D;  2D2C B;  5F53 A;  2OIN A;  2G3A A;  2QJK C;  4I7Z C;  1IK7 A;  3AE6 C;  3SU3 A;  1H8H D;  3OEE D;  4YTP C;  3AK5 A;  4A1X A;  5DSF A;  3VG8 A;  4TT3 H;  2WSF J;  3D6Z A;  3P8N A;  2E75 D;  2WHX A;  2OC7 A;  2QJP C;  2JO1 A;  3LOX A;  3NRL A;  3PV5 A;  2JJ1 D;  1DD3 A;  4H0L D;  1H8E D;  1E1R D;  5L8R J;  4YXD C;  5FL7 D;  1JXP A;  4Q63 A;  4H0L B;  2A4Q A;  3SUG A;  2F4L A;  3KNX A;  4H44 D;  4WF8 A;  1A1R A;  2OC1 A;  3N99 A;  4H44 C;  2OK5 A;  3UB0 A;  2YMS C;  3AE9 C;  1VF5 D;  3AEB C;  3D70 A;  2QF4 A;  3GLM A;  1Q90 D;  3M5M A;  5IK2 D;  4WH8 A;  3S9O A;  3C8V A;  1PV3 A;  1KQF B;  2BEZ F;  1VF5 B;  1ZP0 C;  1AJY A;  3SU2 A;  2FYN C;  3P8O A;  3LON A;  4XFJ A;  3KEE A;  2IJO B;  5FPY A;  2KCY A;  2W6J D;  2GVF A;  2IJD 1;  3R4Y A;  2WPV B;  2JDI D;  3Q5S A;  1OHH D;  3PRB A;  2YOL A;  2E76 B;  2XCF A;  1S6L A;  2OBQ A;  2W6I D;  4GDO A;  2J5U A;  4TYD A;  4RKU J;  1YQ4 C;  1RQV A;  3F3B A;  4A1V A;  2JJ2 D;  1CU1 A;  1E1Q D;  3OFN D;  4IL6 X;  4Y28 J;  3F2F A;  5T1V A;  2ZT9 B;  2KCP A;  4PV1 B;  3KN2 A;  4U01 A;  5H4I B;  3SFE C;  4Z1M D;  2XNI A;  3Q3D A;  2XND D;  3RK3 E;  1S1C X;  3SYJ A;  2YIU C;  3OE7 D;  3LKW A;  2E76 C;  3T97 B;  4R8T B;  1WMK A;  1KOR A;  3AE1 C;  4ZCN A;  4NWK A;  4H13 D;  2V7Q D;  3AE2 C;  1ZOY C;  4JMY A;  3D6Y A;  2YMK A;  1FX0 B;  1OW6 A;  4B75 A;  3U1J B;  2O8M A;  1DY9 A;  2V7Q J;  1DY8 A;  5EQQ A;  2E74 B;  3PV2 A;  5HKK D;  2OC0 A;  1W0K D;  2A4G A;  2G8Y A;  3GF3 A;  3GMA A;  4U7J A;  3SU4 A;  1ZRT E;  4I7Z B;  1KMH B;  3F2G A;  3RC4 A;  1NS3 A;  1FDO A;  1W3C A;  1OW7 A;  4FET A;  3FO8 D;  3L6P A;  2FXP A;  3AE4 C;  5M1B A;  3F0O A;  4I32 A;  5ESB A;  1PIX A;  2D2C C;  3D71 A;  1TU3 F;  1UIX A;  1NYH A;  4B6F A;  2K9Y A;  3SUD A;  5CDF E;  1Y9B A;  3AEG C;  3N7E A;  4NWL A;  1ZME C;  4OGQ C;  4B6E A;  2E75 B;  3Q5P A;  1KTM A;  2WPD D;  2WSC J;  3AEC C;  3Q1M A;  3AE8 C;  1DXW A;  2H88 C;  1OW8 A;  5GND A;  2E76 D;  3SZE A;  1YQ3 C;  3PRD A;  2P10 A;  2VBC A;  2H89 C;  2F43 B;  3SU6 A;  3W1E A;  1VL2 A;  5FPT A;  2QIW A;  3EWK A;  3RC6 A;  3IN6 A;  1FDI A;  3FOA A;  1U57 A;  2FP7 B;  3SV6 A;  4H0L C;  3M5O A;  5DN6 D;  3M5L A;  3GS9 A;  3M5N A;  2E74 D;  3Q5R A;  3SUE A;  3SU1 A;  2OC8 A;  1OMI A;  2A4R A;  3LW5 J;  3FKS D;  2QSI A;  4B74 A;  4KTC A;  2WSS D;  5CHB A;  5IDK A;  2WSE J;  3AEA C;  1DIP A;  1N1L A;  1JB0 J;  2KZ4 A;  4WH6 A;  5EQS A;  3OAA D;  3IAO A;  3ABV C;  4H13 C;  3EYD A;  1BMF D;  1HF9 A;  2KCO A;  3H25 A;  5GJ4 B;  2K8I A;  4K8B A;  2LEL A;  1EXJ A;  4M9F A;  2IDB A;  1E79 D;  2YMS D;  4B73 A;  4OM9 A;  1SKY E;  4OGQ D;  3F2H A;  4PV1 C;  1MKM A;  3WWB A;  3AED C;  2ZT9 D;  1COW D;  3O8R A;  4KT0 J;  3E90 B;  4I31 A;  1DXP A;  5GPI B;  2CK3 D;  2E75 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...