2J5UA

Mrec lysteria monocytogenes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
210
structure length
210
Chain Sequence
TENQHLKERLEELAQLESEVADLKKENKDLKESLDITDSIRDYDPLNASVISRNPTNWNDQVEIDKGSSDGVKPDMAVTTPSGLIGKVTTTGAKSATVELLTSSDVKNRVSAKVQGKENAFGIINGYDSDTKLLELKQLPYDMKFKKGQKVVTSGLGGKFPAGIFIGTIEKVETDKMGLSQTAFIKPGADMYDLNHVTVLKRSAEAGTTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dimeric Structure of the Cell Shape Protein Mrec and its Functional Implications.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell shape regulation
molecule keywords MREC PROTEIN
total genus 47
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04085 MreC rod shape-determining protein MreC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2j5uA01
2.40.10.340 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2j5uA02
2.40.10.350 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2j5uA03
3D70A 2QF5A 3Q5SA 3Q5PA 3D6ZA 3IAOA 1EXIA 1DIPA 4R4MA 2OQQA 3Q2YA 2QF4A 3T97B 3Q5RA 3Q3DA 2J5UA 1EXJA 3D6YA 4R4LA 3D71A 3G9RA 1R8EA 3Q1MA
chains in the Genus database with same CATH superfamily
1OPHB 1ZPZA 1GK4A 4AYCA 1AV1A 1MU8B 4OGXA 1GI7B 1ZOMA 3GY3A 3EQ2A 1KTTB 1GVLA 1SGTA 1AFEH 4MPUA 4MNWA 5F53A 2V3MA 1LT9B 2GZ7A 3CD6P 4H44D 5FXLA 3KZIH 1OX3A 2P7JA 4QT8C 3E0NB 2FYUG 2YMSB 2POHA 1CGIE 1O3KA 4CHAB 3TSIA 1P05A 2G5VA 3A86A 2GA1A 1W0YH 2ZIQH 3RXTA 4FUJA 4XFQA 1FS0E 3GCOA 2A7HA 3HGNA 4O9VA 4DOJA 3WMM0 5B5EH 1E0FD 2QRXA 2R32A 1HFDA 1HPGA 1VITF 2L5GB 3SQHE 3SU1A 3TH3H 1YPLH 2ZAEB 4XA4A 1BMNH 3C1KA 1GDUA 1VGCB 2G5NA 1L0ND 2VWMA 4WY4A 1HBWA 2A7JA 2ODPA 1ANEA 1XM1A 3PLNA 2ZFCA 4N3YB 2FPZA 2W6JD 3F9GA 3UUZA 5CJ4A 1GD2E 5DP8A 1X22A 4UFFH 5HXFA 1ZJKA 1C5QA 2UUKB 1MD7A 5C1XA 1QA0A 3VMXA 4KGAA 2Z9LA 5AW7B 5E2PA 2JH5D 2IX7C 4AUWA 3QDZB 2JKVA 4I8HA 2GTBA 3OTJE 4Z1MH 2Q7CA 1V2TT 1QURH 4D9QA 4B76A 1Q2WA 2KNCB 1BITA 1HRTH 1O3OA 1HAGE 1HJBA 2FYQA 1MD8A 2G51A 2VINA 1O3PB 2KZIA 2KSJA 3MP7B 2UUFB 3RC4A 1UK2A 3A5TA 5FX6A 2W6AA 1Q31A 2A45I 1YY3A 1TGTA 2WSFJ 5DK1A 5CJ0A 4FUEA 5C0TA 1BUIA 3KN2A 2CV3A 4MVNA 1LTTC 2R0KA 2TRMA 2XU6A 2LNCA 3SU5A 2G52A 2E74D 1NRQH 2AIPA 2HRVA 4X2VA 4Y79A 3V7TA 1CO7E 2N9YB 5KKZC 3BSQA 1ELDE 1Q82Q 5C2ZA 1UVSH 1WV7H 2GZ8A 4JZEH 1QL1A 1SFIA 1O2YA 4D6TD 1GL2D 1G2MA 3D62A 5F03A 2KFWA 1EPTC 1HJ9A 3CLQA 1JRTA 1PPHE 3ZVGA 8GCHG 2G55A 2Z4EA 2V3HH 4CR9A 2D8WA 2HPCA 1JOUB 2B87A 4IS5A 4I7ZB 5HKKD 1L1NA 1SQPE 3JCUE 3KQCA 2D2CB 4A7PA 1LVYA 3M36A 1O3FA 3HD7A 1ANBA 3RMLH 2VWLA 1MCTA 4BAQB 4JQ0D 4NA7A 5HM9A 2Z3EA 2V7QJ 1DITH 4MG3A 1N73C 3AW1A 4LK4A 1RQVA 1UCYK 3NXSA 2EI8A 5CHAC 3E7KA 2FYUD 3ATLA 1AA0A 2AFQB 1GJ8B 3MH4A 4FUDA 1VQKP 1T3UA 1PGOA 1PQ8A 1G3BA 2IOTA 1G2LA 1SQRA 1NTME 5GTHH 1S6LA 1W7GH 1Y3UA 4YXDC 3E0PB 3M5NA 4X1SU 3S7KB 1BQYA 3FP8E 1H8IH 1KLIH 1LWUB 2N1TC 3L71G 1T8MA 4CBNA 1C1WH 3R2PA 4EI2A 2Z94A 1QY6A 2IFMA 2O8MA 1A3BH 5A2MH 5JBAS 2K1QA 3NZIA 2LELA 2YMSC 5J4SA 3CC7P 1CA0B 1IQFA 2IZ1A 2JDID 1C5XB 4NA8A 2BD4A 2ODQA 4NZLA 1C2IA 4RT1A 2GX4A 2BD9A 2F9UA 2QJPC 1KILE 1P84I 2GD4B 1WBGB 1DPOA 1L0NK 1PJPA 4WXIA 3RMOH 3TJNA 4E7NA 3GDSA 5PTPA 1GZLA 1SGQE 3MQKC 2LXBA 2FYZA 3T62A 1NU1J 1W2EA 2FYUJ 5T6FA 4JK5A 3RXKA 4CRDA 1V2RT 3B71A 4N78E 2ZFSA 3S9CA 4H0LC 5K5GB 4GAWA 1BMFD 1EATA 3OFND 1LP1A 4X6MA 3OTPA 2A45B 1HCGA 1RF0A 3BN9A 3CXHH 1LHEH 1THPB 1W10U 1KB9D 2M5AB 2HGTH 1SFCC 1YPHC 1V2VT 2KK7A 3M5MA 5KLIB 2Z9KA 2HWLB 3GS9A 2YKPA 1CHGA 2FLBH 3VTPC 4BTUB 3KYFA 2O01H 1ZMEC 1PP9E 5DJ7A 3UOUA 4IW4E 1INCA 1GJAB 3DFJA 1FY4A 3SU3A 2N1TA 1ZHMA 1OHHD 1T32A 3A81A 1K2I1 4NSYA 1C1RA 3AECC 1NU9A 3JZ1B 1K0HA 1P84H 3ESTA 1KXFA 3KEEA 2H89C 3T29A 4PV1D 3RK2B 4O3TA 1GL2A 3K5BA 3CPWO 2Y9ZA 1LWUA 3M06A 1ZMLA 5GDSH 4WMEA 3FZZA 1FN6A 3L73D 1HBTH 1HAOH 1GBJA 1VITH 2ALPA 4K60A 2LP6A 2GVFA 1FZBA 1T6AA 3GF3A 1SQXK 1TPAE 1XTCC 1GMJA 1N7SB 3G9RA 2KB7P 1FPCH 4P02A 3TJVA 2G00A 3U98H 2WV9A 1Q3XA 1K05A 1OXZA 1C1PA 1C2DA 2NZ2A 1SQBE 2PW8H 4I2LC 2J38A 3T25A 1SLQA 1L4DA 1O2NA 2GV7A 1C2HA 2Q6FA 2E76C 4A5TS 1NKZB 1ZR2A 3SNEA 1EAWA 1SQXD 3AEDC 1VF5C 6ESTA 1WCZA 2A32A 3CWBJ 2HALA 1C1NA 3FWLA 2WT7B 1N6YA 3CCEP 3RXEA 3UR9A 1FE6A 1OVVA 2JKHA 5AW2B 1WU1A 1W11U 1IQHA 1EXFA 2J9NA 4CRCA 2ZU2A 1FQ3A 2KI7B 2FWWA 2P3UB 2AEFA 3GY4A 1RE3A 2QJKC 1BE3J 4JYVH 5KJ7A 3BTGE 3M0DA 4XBDA 1TALA 2K0QA 1Y3VA 4HZHA 2Q3IA 2YMYA 1BJVA 1UTPA 4U2WA 2VVVA 3DSGA 3RXFA 2H88C 1LWUC 4YTPC 1M9UA 4HI3A 4OS6A 1YBKA 5DP7A 4UB8E 3ZYEA 3M3TA 3PMBB 1EZVE 1A61H 1HYLA 4UDWH 3Q2YA 4NZQA 1AB9B 3H1LJ 2XC4A 3M9BA 3PLPA 1GI2A 3M9QA 5KAIH 2ZI2H 4WMDA 3IR9A 2L74A 2OYHA 1YPJH 2QXGA 2E74B 4Y76A 5APWA 2Z5HA 2WPQA 2WTYA 1RJXB 2J98B 3E91A 3FN8A 8KME2 1UMAH 1OWDA 4CRAA 1JOCA 4ASUD 3OY6U 1TMBH 3PV4A 3RMNH 1NFWA 3KQEA 3MH7A 1TONA 1N8OC 3N7EA 2WITA 1R5LA 4WY4C 1KYOI 4D6TJ 4ZNCA 3VB6A 1JM0A 4B6FA 1QCPA 1GL2B 1SKYE 1ZSKA 3MH6A 3KPEA 1S3JA 2IBZD 3V2PA 3AE9C 3MOCA 5TJXA 3U1CA 1MFTA 3HGPA 1U7MA 1ANDA 3A85A 1NGMB 1ZMNA 4TPIZ 1N7SD 1GMDF 3LIDA 3H1HE 1FI8A 3BATA 2ZXEB 1O5AB 3FFGA 4U30A 3R4YA 2NRGA 5EXLA 2ANYA 3AEGC 1BRBE 4DJGA 4OGQD 2ZGCA 3SI4H 4UONA 2VJ1A 3LPRA 2WZ7A 1EPTA 3UIRA 1V2WT 3LGVA 4FU8A 3GHGB 5F8ZA 1LT9A 1AUTC 3C8VA 2AIQA 1KILC 1GI6A 2ZFTA 3MO6A 2ANKH 1D6RA 3SZNA 2AMQA 3Q77A 2ILNA 2P95A 1N86A 2BXTH 1CHOG 1FDMA 4RT0A 1W13U 1O5GH 3SGBE 1P2OA 3UR6A 4IC6A 2W90A 1LTGC 1C5YB 4H13D 3QWOC 2FOCA 1AGJA 4I6MC 5KLVJ 3A0HE 3TGKE 1AO5A 3GW6A 1A0HB 2TGPZ 5T6DA 4DG4A 1UO6A 3AE4C 2XDJA 3SUFA 1MTSA 2W83C 1QTFA 3TK6A 4BRYA 4TWYA 1BCCG 1MBQA 2ZXXA 1TGBA 1RF1C 1JTHA 5C1YA 3SSUA 3CP7A 3TH2H 3MU5A 4GDOA 2NPSA 5SGAE 3E1XB 1JEKA 1H89A 2R2MB 5HMAA 3L72D 1PQ7A 1GDTA 3F9FA 4EIJA 3PV2A 3MNSA 2F43B 1NROH 2I1KA 4NIWA 3LC3A 2FTMA 3B5ND 1VQ5P 3B9FH 3HE5A 1MTVA 2F91A 2H9HA 4Q7ZA 5HIYA 3Q3XA 4KJMA 1Y3WA 4HKZH 1ORFA 1G2CA 4C46A 1F2SE 3SU6A 3P17H 1DWBH 1SVPA 1RE4A 3L74J 2GT7A 1CA8B 1Z7KA 1O33A 3IFMA 3ZZ9A 1L0LD 2BY9X 2J97A 2XCNA 1PPJG 1DXWA 3SYJA 1K28D 5CMXH 5E2OA 1JRSA 2P10A 1DVAH 4D7GA 5CDFE 3KXDA 2GJGA 1NKNA 2P3TB 2Y0CA 3RDZA 1P2QA 4AC9A 1H9LB 2IPPA 1O3IA 1YHQP 2M2AA 3GISB 1O3JA 3FANA 3H1HJ 5APSA 3OE7D 3P7KA 3TYYA 5EJLA 2PUQH 4KTSA 4TLFA 3SHCH 1GHAF 1JO5A 3VB7A 1AVWA 2HLDD 3P8OA 1NTZJ 1C4U2 5GIBA 1P84D 1TNJA 1VCPA 1EB2A 3RXVA 4GOFA 1KQFB 3M5LA 1OP0A 1O2LA 4ABAA 1S5SA 1WUNH 3H1IJ 1PQAA 2QVAA 1FY1A 4JCNA 3QK1A 1GMCF 3CCRP 1GMHG 3SOSA 4X6NA 1F0TA 1RTKA 2BASA 1GL2C 4IN2A 2P2UA 3AAVA 8LPRA 4F4OC 1O2KA 1S81A 3SGQE 2AGIX 2J95A 2C3SA 1A4WH 3C1LA 1MKXH 2QF3A 2PTCE 1KYOD 2PGBB 3TJOA 2ZNKH 5T3HA 3H25A 1J8AA 2GCHF 2QN5T 4FU7A 1M1KQ 1NTMD 1LPKB 2GMTC 2BMGB 2YMSD 2E75C 2H1UA 3SJ8A 1FAVA 1BOQA 3HATH 4YLUA 2ZG0H 1SGFG 4AQRD 2WUBA 4HFPB 5KLVE 4CH8B 4NFFA 1FZCB 1MKXK 2BCCD 3BASA 2ZWLH 1NTMK 5AW8B 2I6QA 4X2XA 5A0AE 4DJZB 5C3NA 1DX5M 3EA9A 4AORA 1YPKH 1IC2A 2STAE 2ZJSE 3MNCA 4RN6A 1EC5A 1OS8A 1MQ6A 1UCYE 1YYY1 4Y11E 5FHTA 3ZZBA 4AOQA 2ZQ1A 4GVUA 3VB3A 1OWKA 3L72E 4ZUHA 4Z1MD 3USSA 2P3FH 1GHWH 3LDXH 2ITAA 3RP2A 1TX7A 3S0NA 2KP8A 1G3DA 5C0UA 2QA4P 4JMYA 1MCVA 2PR3A 1EASA 1ETRH 2RMZA 4U32A 3H1IE 2E5TA 4WBAA 1TB6H 2Q6QA 1BE3G 3P8CE 1G30B 2JP3A 1GBLA 2FDAA 1FBMA 1C5SA 1E37B 1LPGB 2JWAA 1HTLC 4Y6DA 2PKAB 1TFXA 1F92A 2VGCC 3H1HD 2FESH 3SV7A 1VJAU 2R5BA 2EQNA 5B5EE 2PAJA 3RM0H 2BLWA 3SHAH 2CHAB 1BZXE 3NRLA 1URQA 1GU4A 2AMDA 2VIQA 5APQA 1LVBA 4DURA 5EIYA 4LZ4B 1KQSO 1ZJDA 4FETA 1QJ6B 5HIZA 2QF0A 1P11E 4ASVA 3RU4D 2D1JA 3TH4H 1T2KD 5G4BA 1LTIC 3FGAD 2O8TA 4MPWA 1OW7A 1TNKA 2AGGX 3GCTF 4FUFA 1P2IA 3FP7E 2FKWB 3BG4B 3VEQB 4ZKOU 1D6WA 3HRNA 5C94A 1O2UA 4GCHF 3LOXA 2K1AA 4PD4I 2WSSH 1FMGA 1K1IA 1YGCH 2VIWA 3NPSA 5EU8A 1BE3E 1YITP 3UREA 1IFIA 1Z1IA 1Z6JH 5EW1H 1GBHA 3GY6A 1SR5C 3FAOA 2BDCA 3BEIB 2ZVNB 4JZDH 2Y5HA 5E0HA 3MD0A 3VPKA 4GIFA 1LTSC 2ZU3A 2ZP0H 3SW2B 3BG8A 3SWYA 1ZPBA 2H2ZA 5FAHA 2IFNA 4KKDA 1SFCD 1SFQB 5KGOA 1CZQA 1HAHH 1C5OH 3H32B 1H8AA 1BTUA 1X8YA 1KILA 2ZECA 3RMMH 3ZIAD 4MPXA 3DHKH 5E0JA 2VNTA 1KB9E 5CBNA 1LDTT 1AD8H 3ZZ8A 3VFEA 2BX4A 1SS1A 4RKOB 1IFJA 2BCCE 1P2KA 3F2HA 1L0LE 2A06E 3RXHA 1LJ2A 2A0QB 2KAIB 1WYKA 3F89A 2B9LA 2FZZA 1BTYA 4ESTE 3ABVC 1H9IE 5F8XA 1QX8A 3H1JD 3MHVA 2I6SA 2XNIA 3ODFA 3G01A 1RRKA 1NAYA 2FFDB 2FI3E 4NIYA 1ELBA 2BD8A 4Y71A 3IITA 3U8OH 1ZMJA 4KTUA 1V2NT 2P94A 3PWCA 1TPSA 2HOBA 2Y9YA 1XKBC 2ZT9B 1YC0A 1GHXH 3TNSA 5A8XA 1E5WA 1NH4A 5C20A 1QJ1B 5KTBA 3KHUA 1TIOA 2N9BA 2FI5E 1P2NA 2N1TD 4L74A 1O2JA 4D6TE 3L70D 1KN7A 1WTGH 2WZQA 3ZZCA 3L37A 5GCHG 1NRSH 1PPFE 3CX5D 1IK9A 1OVRA 1URQD 2LR2A 4BRYB 3BRVB 1OSSA 3OEHD 3HUSA 4Y99B 4DZOA 1NS3A 3OJAB 4Y7AA 2QM7A 3HKIB 1RE4C 1Y47A 1MAXA 5B66H 1QGFA 3T2NA 1BHXB 1OMIA 4BWNA 4IFFA 2I1JA 1O2VA 3H1JJ 3TK1A 1TNLA 4CRFA 1AQ7A 1YQ3C 1HJAB 4JYUH 3SJKA 2OARA 2FP7B 2R3YA 1NTKK 4IL6X 1ZR4A 5JBBS 2CHAC 4Y0ZE 4OGQC 1GBTA 2P58A 5F6MA 2KCYA 1YTZI 1QVGO 1S85A 3AE6C 2HLOA 1LHDH 1O3BA 3RU4E 3RXMA 2WSFH 1EOJA 3K6ZA 1K04A 3BIVH 2BYAX 2GUSA 2MKVA 3E6PH 4CH2B 3V4QA 3ZVFA 1S2EA 3CCUP 2CMYA 2Y82A 4HYTB 1EAXA 3VN0A 2YKOA 1S72P 4HGCA 1YLNA 3GICB 5I25A 1O3LA 5IYTA 4XSKU 4HH2A 4WY4D 2BY8X 2Y7ZA 1J1EC 2BD2A 3CWBD 2OTLP 2YNBA 3MWIU 5AVQB 1Z1JA 1ZV8A 1SQXJ 4XD7D 2BDHA 1XUKA 1SLWB 2DW3A 1SP4A 1E1QD 1IQJA 2AXCA 1UTLM 2QJYB 2ANWA 2CPBA 3BCCD 2VVUA 1VGCC 3BTEE 1E36B 2ZVOB 1O3DA 5JPMH 4GPGA 2WPRA 1C2GA 1QB9A 2V35A 1MABB 1EDLA 1T7CA 4AG1A 1GBAA 1F0SA 3FVFB 3LT3A 1YCPK 1SQPJ 3H6PA 1O2SA 2PTNA 4OM9A 1IO4A 4A1TA 2F9NA 4SGBE 3P92A 4X8TH 1GK6A 1NWQA 7KMEH 2FXRA 5H2FE 1KMHB 2F9BH 2OQUA 2THFB 5FX5A 5EG4A 1NYHA 2PKAA 2CN0H 1LNQA 1O2WA 1AVYA 1ARCA 2XBVA 1LHCH 4PJ0H 1TQ0B 6CHAB 3RK2D 2ZU5A 1QBOA 2ASUB 2GDDA 4AGJA 1YLCA 4FVDA 1AB9C 4RKJB 2SGFE 2NU2E 2KCPA 1ZTLA 2ZTXA 1XX9A 1DDJA 3SUGA 1A5GH 1CGJE 1ESBA 1GU5A 1UVPA 1O30A 3Q5RA 3RGUA 2BCCG 2RH0A 2HG5D 1AFQB 1Q86Q 5FCRA 2W8ZA 1UVOA 4INLA 2GCTC 1N2DC 3AVZA 4GHTA 4B2AA 1N8OB 1LT9C 2ZA5A 1TRMA 1O2OA 2E42A 2ZDKA 3U9AH 3KQGA 1LHGH 2WT7A 1F5KU 1Y3YA 2BTCE 2NWNA 1SQBD 1BRCE 2QA9E 1PPGE 3KCGH 4B71A 2KYVA 1TNIA 2F9OA 4F55A 1V2JT 1NU1D 4UB8H 1BTWA 4FUCA 1IQGA 1NU1E 3FOAA 2YIUB 1QB1A 1AKSB 1MAYA 1A0JA 4VGCB 3HUSB 1VQ6P 2OGUA 3CENA 2Y5FA 1FY3A 3QN7A 2XC0A 3T97A 1GBDA 5H4IB 4E06H 1H8ED 1KY9A 4NFEA 4NIXA 2JH0D 4GODA 9LPRA 4H4FA 4OVNF 1YYCA 1UW7A 1T4UH 4TSFD 1O2PA 2WPHS 3HE5B 1FJPA 1DY9A 1L4AA 3P8FA 3L33A 1QNJA 5T1VA 1TLDA 1EP5A 5EFWB 3URDA 1BMMH 4X8UH 1NN6A 3CCLP 1PYTC 3ATMA 4I8GA 4H13C 3LJOA 1C2LA 1ZOYC 3ZZ7A 2YNYA 3Q5PA 5AW3B 1EFRD 1EZVD 5KAIE 1SGPE 1SQBJ 1TX8A 2P16A 3UWJH 1ZR0A 1COWD 1DICA 3L73G 4PD4H 4JYTA 4WMFA 1VDFA 3SJIA 1AKSA 1WMKA 2MJZA 1P01A 4QMAA 4ZKNU 1J1EB 3UWIA 1K1JA 1P8VC 4ZKRU 3UIAA 5GTIH 1RFNA 1HH0A 1LCYA 2OD3B 2QJPB 2ZGBH 1O2MA 5EJ1A 2C8WB 2G3AA 2OCVB 1GCTC 1WAYB 2BDIA 4Y0YE 5KEDA 1NTZK 4OS5A 5FPSA 5APTA 1X0TA 1P10A 4ABIA 1JCDA 1LP1B 3KZIE 2OYHC 4R0IA 2KS1A 2BB4A 2WV5A 2W3IA 1C4Y2 3EGKH 3V0XA 4LOYH 2Q1KA 2XRCA 3H1ID 2A5AA 2ZCHP 1J16A 3EE7A 1W14U 4AYYB 1EX3A 4U3FE 4FUHA 2FODA 1A5IA 3BIUH 5ESBA 1KLTA 3SV6A 4BAKB 3RLYH 2BDYA 3CC4P 4JBZA 1BBRE 1NTZD 1T2KC 3DT0H 5KECA 3A0HH 1MQ5A 4PJ0E 1NBMD 1SSXA 2SGAA 2XTTB 2TGTA 1TOCB 3LGYA 2ZCKP 1GHAG 1RIWC 2PRRA 4I7ZC 4U3FJ 1KDQA 2LXCB 2CK3D 1FZZA 3MFJA 1MMJN 4UE7H 1IQNA 1O2IA 4ZROA 3PRBA 1C5MD 3A87A 1IFMA 3E8LA 3QH9A 1BCUH 3K9XB 1VQOP 2FS9A 1B0EA 5EPNA 5DO4H 4JZFH 2HLCA 2Y6TA 4UEHH 4BTIB 4ACAA 2FYUE 5CHAB 2O8LA 3LGTA 1DX7A 1LKBA 2EC9H 3SV9A 1FAKH 4C7RA 2JH6D 3SNBA 3HD7D 3T97B 1G1IA 4XDEA 3Q3DA 4Z0KA 1JB0J 5JBTA 1RTFB 2B8OH 1D3QB 3LONA 1GDNA 3SWFA 3U1JB 1OWIA 2GKVE 1WT6A 3UB0A 1FV9A 2ZYGA 2L6OA 1ZRTE 4B86A 2KXPB 1G37A 1JY2O 1RXPA 2KUBA 1B5GH 5CHXA 1C1VH 1OXGA 4JK6A 1LVMA 5TCCA 1SC8U 2J34A 1DXPA 3AE8C 1B0FA 2YIUC 2O8WA 2IBZG 2RG3A 2HR3A 3PLBA 5KLVG 4DGJA 3HUSC 1QLED 5DJUB 1BTHH 2P59A 2OYIC 4NPFX 1K1LA 4X0WU 2ESTE 3ATWA 3F6UH 3P8NA 5ETXA 3BCCE 1THSH 3WUUA 1HGZA 2HODB 4RESB 3A83A 3L75J 1YPGH 1NVOA 3LW5J 1FJKA 2XWBI 4A1VA 2SNVA 1WQSA 4H6TA 1JIRA 3K6YA 3PB1E 3TGUJ 1PGQA 3UNQA 5E79E 3KDPB 1EQ9A 5GCHF 4K69A 1HNEE 1IK7A 6GCHF 1KXDA 1XXDA 3NFQA 4PD4E 1ZTJA 2YOLA 1ZXGA 1SGDE 1SGEE 3I29A 3AEBC 5FCKA 1GI1A 1FXYA 3V6IA 3L70J 1NRPH 3S4RA 3M35A 3ZV8A 1K22H 2V4HA 4Y8XA 2AMPA 2JIZD 1BTZA 1C1SA 4ISIH 3BRTB 1BA8B 4BXWA 1XXFA 2PP6A 4IC5A 1C1TA 4IOIH 3TNTA 4PV1C 3TITA 1FOSE 4NG9H 3UFAA 4YXWD 3G71P 3SU2A 4DW2U 1V2QT 2KX4A 4ABGA 4RSPA 4ZXXH 4KTCA 1O36A 1IHSH 1ACBE 2GM4A 1LVOA 3P95A 1URQC 2OYHB 2FOGA 1USDA 2QXJA 1SQPG 1MFZA 3KQDA 1HAXB 5C5OA 3BCCG 4WY4B 4NWKA 5AVXB 5AW5B 1AJYA 3SV8A 1KZUB 1KXBA 2KIKA 3O8BA 3DFLA 3F9HA 3CCJP 3V5BA 3I55P 3MTYA 2ZGXH 3A0BE 3QGNB 5DP3A 4K8YA 5BRRE 6GCHG 3IAOA 4H44C 1WOFA 3TGUD 2AGEX 3H1LG 3T28A 3HE4B 3RBZA 1C5RA 2ZKSA 5JB9S 3SU0A 3L75E 3MGNA 2Z3DA 3D23A 1YP9A 4YZUA 4A1XA 1A0LA 1SQVK 1KV4A 1GHZA 1RIWB 4OS7A 4U3FG 3L3TA 3OEED 2FOMB 1ETTH 2ALVA 4OS2A 4MDSA 2KSEA 1VKYA 2KM0A 2O01J 1NY22 4I7YH 1V2PT 3GHGC 1BCCE 1HJ8A 3PH0A 1KTSB 3B8EB 1GI8B 1GJ9B 4ZKPA 5KAFH 1WSSH 2IPHA 4OGYA 3SNCA 1RE3C 3M0AA 3V2RA 2JJ1D 3QZQA 2Q6GA 1C2MA 4U7JA 5APUA 1DFPA 4GKGA 1UTNA 1Q7YQ 3CX5I 4L75A 1T8LA 4I86A 3SJ9A 2G8TA 1HIAB 2ZDNA 1OFCX 1NM6A 1P3EA 1SQQG 1YQ4C 2C90B 1XUFA 3RUOA 3BG4C 1FLEE 2J4IA 2W3KA 1E79D 1HAIH 4JYCA 3A8BA 1SI5H 3RXBA 4B2CA 1BGYJ 5E79H 2A5KA 2BQ6B 3B5NA 2VH6A 4GHQA 4AB8A 2IDBA 4AFSA 1CHOF 2BVXH 3W68A 2XYAA 3MYWA 1DUEA 3EFFK 3U8TH 1OW6A 2WV4A 1QBNA 2EY4C 2QXIA 3L36A 2G81E 3LH3A 4XRNA 1P03A 5TISH 3D70A 1SB1H 3UOPA 1DEEG 3FXEA 2QF5A 1HUCA 1DT2A 1T8OA 1U57A 3HK6B 4RO0A 1PQ5A 1VQ8P 2P8OC 4D9RA 3RK3C 1EKBB 4B6EA 1VQNP 1KTMA 4U3FD 4Q7XA 4XFJA 3KQ5A 5AVYB 2OQQA 3S7HB 3LJJA 3VG8A 1CSBA 4KP0A 1JTHB 5EOKA 1Y3XA 1FN8A 5EJZA 5JYIA 4AN7A 1CBWB 5EPYA 1GJ4H 3CCVP 2PSXA 2WPMS 5C17A 2F4LA 2FEQH 3ITIA 2BDGA 4Z6AH 2YXQB 2HPCB 1B7XB 3U1IB 4DOQA 1EZVI 3SNDA 2ZYDA 3L35A 1ESTA 2C93B 1DY8A 4O3UA 2GGVB 4LZ1H 2AEIH 4B73A 2ZHQH 1F7ZA 4THNH 3H1KJ 1C2KA 1T4VH 2XW9A 1GG6C 3RXOA 1XUIA 1MBMA 3RXDA 5EXMA 1EZVG 7LPRA 4XBCA 1BIOA 4YOIA 2M8RA 1AE8H 2ZC9H 1GJDB 1FC2C 2M5TA 2IZ0A 3U59A 1O5BB 1XVOA 1TBRH 1O3MA 3N4XA 1BGYD 1WRGA 2OBQA 5FPTA 4YT7H 2C8ZB 5CE1A 5K7RA 3BTQE 1BGYE 3EAJA 1Y8AA 2JWDA 1SLUB 1SBWA 4GT1A 3MMGA 4ZHMU 2H43A 2BCCJ 2V0BA 1EPTB 2VH0A 3FZDA 1SGRE 3EE0B 2E76B 1ELFA 1VPCA 1YJNP 2NU0E 2E5YA 4MLFB 2BZ6H 3C9IA 1SFCA 1RS0A 1W0JD 3AE2C 2XNXA 1BB0B 1KILD 3AW0A 4GCHG 1C5UA 2O1KA 1ZRKA 2B89A 1HAYB 4WH6A 2F9PA 4F48B 4ZMDA 1HGTH 1N8RQ 2RDEA 5CCGA 1WTHD 1MUUA 2K37A 2A31A 3RXAA 5EQSA 8GCHF 5HYOA 2H5CA 1KB9H 1N1LA 2BHGA 2J2UA 3WY8A 2F3CE 1D7MA 3SV2H 1GBEA 1J2JB 1HAVB 1XUJA 2Q5UA 3TNUA 2G4TA 3IF4A 1JNMA 1A5HA 5TISE 1VQMP 2OYIA 1QQUA 2BQWB 5AFZH 3STIA 1SHYA 5APVA 2J58A 1UTKA 1P2MA 4LC1A 1LTJA 2Q6DA 4HJGH 3H1JE 1C2FA 1CT4E 1NHLA 4MTBA 2GDEH 2A5IA 2VWOA 1VITG 2KLUA 2Y80A 4MNXA 1NO4A 5AHGH 3T26A 1H8HD 1QRXA 2IJOB 1C5NH 3FWNA 1VQ7P 1BRAA 1DM4B 3BTFE 2R9PA 4K1SA 4H42U 4YO9A 3CS0A 4Q7YA 4KT0J 1DUAA 4GUXA 4GLYA 2CF8H 1NU7B 4B1TA 1R8EA 1TOMH 3CNRA 1NTZG 2HODA 5AW1B 1JMMA 1AWFH 7GCHG 4AYVB 1YPHE 1LTBC 2G8YA 3G4SP 1W7XH 2STBE 2ZDVH 3OX7U 1FDOA 4CHAC 1AVXA 2UWJE 1GGDC 4ZHAA 4Y99C 1P2JA 1BSHA 2H7HA 1RH5B 3NUMA 5I46H 2C0WA 1BHXF 4Q4LA 3RXSA 1CBWC 1Y59T 1SQPD 3U1AA 2VIPA 2VVCA 2BDAA 1AUJA 4ASWA 1QEXA 2ZT9D 1FUJA 1DH3A 3M7TA 3RXPA 3W67A 1UTMA 1A02J 2DE8A 1TAWA 3JSVC 2HPPH 2ODYB 1PPJE 1PPEE 3BCCJ 4NSVA 4X8SH 1E79H 3L72J 2ZU1A 1VF5D 1PPJD 4FXGH 1PPZA 1MTWA 1IOEA 2ZPQA 2BD5A 5GXPA 1FIWA 2YXRB 2D2CD 4WWYA 2OYOA 1O2GH 3E1IA 2BXUH 5L30H 2A45G 3TK9A 1T3JA 2DUCA 2K9YA 5TCAA 3KIDU 1BCCJ 2N1TB 2GZ9A 3PO1B 3RK3E 2H9TH 2AEJA 5KLVD 1JWTA 1O3CA 3EA7A 1VL2A 2YMKA 1GBMA 3VGCC 2R0LA 2Q3EA 1GBIA 1HV7A 1KSNA 2WSSD 1GJ5H 2XBXA 1ZP0C 1LKAA 4SGAE 1BDCA 3L70G 4OH8B 3EQ0H 4FUBA 4JYBA 4ZKSU 3RL0g 2JETC 3AASA 3DD2H 1SQVE 5L2ZH 2BY5X 4H0LB 3AEEC 5EW2H 2E43A 1CSOE 3OY5U 3UY9A 3H1KE 3PROA 3GY8A 1DIPA 2V7QH 2PV9B 5H2FH 4ZAEA 4I31A 1K1OA 1TPPA 2BM2A 4MNVA 2BEQD 3FX0A 4NCYA 1C5ZB 1QA7A 4A6LA 1JY2N 2YKQA 1IQEA 1E1RD 1UVUH 3C27B 3ZZ6A 1C2JA 1OW8A 2UUYA 3CS7A 1EP6A 1ZSLA 2ZPRA 3GHGA 3VOPA 4X1QU 2O8UA 2Q9IA 1U6QA 3CC2P 2D2CC 1NESE 5AW6B 2Z7FE 1LHFH 3QX5H 3WW7A 4JF7A 5E0GA 5KLVK 4IFDK 5AW4B 4O03A 3AE7C 1J1DB 3L71D 4KELA 1IFDA 2F83A 2OQ5A 1FNIA 1X9VA 3UQOA 3BV9B 5IDKA 2W26A 1X7AC 4Y10E 3PWBA 1OX1A 2BLOA 1QFKH 3VYIA 1V2KT 2OP9A 3F2GA 3W1EA 1PP9G 1HJ0A 1Y8TA 4W7YA 1DWDH 5C5NA 5C39A 2J5UA 5CCHD 1O2QA 1CE5A 3L74G 1Y5BT 3M0DC 1Q2NA 2IBZI 1KXAA 1SMFE 4X6PA 4ZHLU 1FAXA 4IMQA 3V2NA 4W80A 3D49H 8ESTE 3I56P 3ZZ3A 1OP2A 3GDUA 3URCA 1GGDB 1ZGVA 3CX5E 3OSYA 3SFDC 3SUDA 2WPSA 5KJ7D 1Z6EA 3ATIA 3A82A 3R0FA 5J4QA 2EEKA 2RKLA 4I8JA 1NC6A 5FPYA 3RXGA 2ZYAA 2OTJP 1MV8A 2FX6A 1BE3D 1LMWB 1O5DH 2PKSC 2VU8E 1V6DA 5JBCS 3MU0A 5DP5A 4N6JA 5B6LA 1VQ4P 1ARBA 1SGFA 4ABFA 2QE7H 5M1BA 4U01A 3SZEA 4DCKA 1AZ8A 5K0HA 1ID5H 4ACBA 1DD3A 3AE3C 2B88A 3Q3YA 1Y5UT 4I33A 5AFYH 1TMTH 4TYDA 1HAPH 1J17T 1K9OE 3W95A 2PGDA 4ABJA 3CWBG 3BTKE 4FU9A 2WPVB 2W7SA 2GV6A 1KFMA 5HM2A 4Y7BA 1NFYA 1F0UA 2BY7X 4LGDE 3MU4A 3HE4A 3HD7C 3B23B 5GTIE 4R4MA 1YPEH 1J15A 1GHVH 2FXMA 2PSYA 2QIWA 2Z3CA 1N73A 1AI8H 2XV5A 3OW2O 3V13A 1IJDB 2AXTE 1HDTH 2KZ4A 3KF2A 1C9PA 1ZSJA 4CRGA 2WPKS 3VGCB 1LTJB 4NWLA 1EDJA 1K1NA 2HNTF 2P93A 3L73J 3EDXB 2P67A 2NU3E 5DP6A 2E74C 2KNCA 3GG2A 1SVFA 1GDQA 4R4LA 1PPCE 3MNXA 4FUGA 5AF9H 3EYDA 3MUDA 1N7SA 1G36A 1P06A 1S9KD 3H1KD 3TNUB 1TGSZ 4WVZA 2Z6BD 1SHHB 1SQXG 4AGKA 4HG6A 3A80A 5KJ7C 1E38B 3N7NA 1BDAA 1O3EA 1TYNA 1L0NG 3B8JA 2M0BA 4UD9H 3S9AA 3O8RA 3CXHI 3L70E 3F3BA 1FJSA 1YCPM 2BVRH 2A4OA 2ZU4A 1GJ6A 4A92A 3SI3H 2UWOA 1YBWA 1NBME 4HTCH 3M91A 3Q3KA 1H9HE 1YF4A 1NTKJ 1VQLP 1FONA 3P70B 1MTNB 5CCHC 4UB6E 1HXFH 2ULLA 1Q90D 1TGNA 3HPTB 2FOFA 1EZXC 3L4FA 3PLKA 1RY3A 1SQQK 1O3HA 1GTWA 2QY0B 1JMBA 4FUIA 4HB1A 1O0DH 4Q2KA 2A2QH 2KR7A 3SN8A 2R2WU 2ZDLA 1GHBG 1P9SA 3FO8D 6LPRA 3K2UA 3AK5A 3Q5SA 2PGQB 3ZZAA 3AE5C 2QG4A 2PHBA 1VJ9U 3KGPA 1S6HA 4Y8ZA 3QWCH 1V3XA 1O34A 1NOHA 4MQAA 3LIWA 4AFUA 4WXVA 1EJNA 3PTZA 4MN4C 4K3AA 2JR8A 2HPQH 4M3LA 4K35A 4C7NA 4ZKUA 1A02F 1RD3B 4TY7A 3EWKA 1ETSH 1NTMG 1ZRTD 1DLEA 2BZAA 1GW4A 2W7UA 3S9BA 1AVOA 1SQTA 1HLTH 2XZRA 1O2RA 1H4WA 4H44B 1CA0C 4KHXA 3U8RH 1L4ZA 1NPMA 2ZO3H 1G9IE 4ZXYH 2FXPA 2W5EA 4J2YB 1QRZA 5C67A 1GBCA 3RL0C 1A3EH 1QBVH 2B7DH 2EI6A 2QGRA 1SQQD 2QE7D 3AAUA 2BD3A 2ZGHA 1SQQE 1DWCH 1V2LT 4IL6E 2LKMA 3SGAE 1G1JA 1UTQA 1L4AB 1QL2A 2XCFA 3SQEE 2SFAA 4Y8YA 1ZLLA 2Q1JA 1C1MA 1P9UA 1PZQA 2CGAA 4BOHA 5B6OA 1UTOA 2V7QD 1Z8GA 1IQMA 3LU9B 2E75B 3A8CA 1EDKA 1RTLA 2RDLA 1SOZA 1O31A 1S4XA 4LXBH 5AVRB 2FFDA 5FL7D 1S5LH 4EDFA 1Z71A 4PD4D 5DG6A 3A7YA 3B5NB 2FO9A 3QUMP 1FX0B 3HD7B 1UHBA 1VQ9P 1G3EA 2K9JB 5GJ4B 2K88A 1ANCA 4XBBA 1PL5A 3L71E 4ISHH 3E16B 3PMAB 1FY8E 1SQAA 1F5LA 1FDPA 2NU4E 2QYIA 2FYUK 1ZGIA 1KILB 3AEAC 2I8DA 4UB6H 3BTME 2W6JH 2ZT9C 1ABJH 2VWNA 2KS1B 3HKJB 4RJTA 1KLJH 2FIRH 3RK2C 3TIUA 3PYHA 2FY8A 1VQPP 4Q63A 4K1TA 2O01N 1DANH 5KAFE 3O6QB 2BOHB 4MNYA 3AE1C 4BXLA 4K8BA 2B5TB 3KYGA 4OWFA 1OWAA 1M1JC 3LKWA 3QZRA 1BBRK 1L0LJ 1MH0A 4UFDH 5A8ZA 2QEXP 4JZ1A 2RCEA 1S82A 1FIZA 3PRDA 1C5WB 4I8KA 3WUVA 3NKKA 1GHYH 2PWXA 4CRBA 1IQIA 1SQXE 1SGYE 2QC2A 1TA6A 4NPEA 1TPOA 1LO6A 1O37A 3L75D 1SQBG 1C5VA 4Q80A 3H5CB 1P57B 3MTUE 2A4GA 2RA0A 1KYOE 3RXRA 2HVXA 1DOJA 2ZZUH 2TBSA 3TJUA 2A7CA 4DIIH 2J59M 3CMEP 4YT6H 2A4RA 1T8NA 3CI9A 2NU1E 1OP8A 3A8DA 3F2FA 2EA3A 3QTOH 3D65E 2Y0DA 1QIXB 4E7RG 4NPDA 2ZCLP 1P09A 1P04A 2XNDH 1HF9A 4TT3D 2SGEE 3M61U 1FZCC 4A7IB 2OUAA 3TLOA 2BQ7B 1GBFA 2FLRH 5A09A 1VR1H 1E34B 3L72G 1JY3N 1RGQA 2J94A 7GCHF 1D3DB 4X8VH 1KQGB 1BBRH 1QJ7B 4I8LA 1GI4A 2OLGA 3IG6B 1NFUA 3HTKA 2ANMH 1S5LE 5A0BA 3GOVB 1AY6H 4ABEA 2H5DA 1C1UH 1GI5A 2V3OH 3GCTG 4K1EA 4WVPE 3RM2H 2FM2A 4O97A 1RHZB 3I78A 2WWWA 3SORA 1H8DH 3PJSK 2Z9GA 3U69H 2FYNB 3H1JG 1BMLA 1QZ8A 4UFGH 1GJBB 3NWUA 1ZW0A 2UUJB 1XUGA 1YIJP 1H1BA 1CT2E 1A2CH 5DP9A 1LT1A 3JZ2B 2QCYA 1F0RA 3ZVBA 1NJIQ 4DT7B 1UK4A 1SLXB 4DIHH 1TGCA 2ZEBA 4CR5A 5AVZB 3DA9B 2FX4A 2KLVA 2JEEA 2TGDA 3HTKB 3SUEA 4UFEH 2PFEA 2XOKD 3U28C 3PP5A 3HK3B 1O2HA 1O2ZA 1UK3A 3E3TA 2ZF0H 3W94A 4K2YA 4WY3A 1FZCA 3L71J 2FXOA 1YM0A 4WJG2 5EGMA 1GHBF 1BTPA 1AWHB 1WQVH 4GSOA 1AE5A 1FPHH 1JBUH 1BJUA 1O3NA 3LGWA 3KYQA 1AFQC 5TJHA 3L73E 1TX6A 1C5TA 2M3EA 4W7ZA 2GCTB 2TPIZ 1UVTH 3T5FH 3AEFC 3MNBA 2D26C 3B4SA 3CXHE 3PRJA 3A7OA 3BTDE 4OS4A 3V3MA 3VB5A 1V2MT 3ZVDA 2W6BA 3CCMP 2JO1A 4CREA 2CF9H 3I5CA 1KDQB 2ZQ2A 1PPBH 1D3PB 4DT0A 1PIXA 3GCHB 3UQVA 1M1JB 3F5HA 1A46H 1XVMA 1ZYOA 3M7UA 1ELCA 1M8OB 3PHLA 1SQQJ 1DSTA 4NIVA 3ELAH 1W3CA 5EQQA 2VRSA 1Z8RA 1O2XA 4X1RU 1M56D 4YM9A 4I1LA 1CGHA 2XNDD 2D2DA 1BTXA 1EAIA 1RF1B 1CW5A 1NZQH 1JUNA 1YKTA 1IQLA 1DLKB 2BDBA 3NTNA 3WU2E 1HGVA 1C1OA 2FOHA 3BTTE 4ISNA 1IQKA 4TY6A 3H1HG 2JJLA 1FZGA 1DE7H 1KFNA 1CVWH 2OC8A 1O35A 2R5DA 1S84A 5CCGC 3Q00A 3A7VA 2OK5A 3S69A 2K8IA 2ZFPH 2BVSH 5EQRA 1NAFA 1F5RA 2ZPSA 1D9IA 5FBEA 3MIWA 1D4PB 1QRWA 2WINI 3TPIZ 4CBOA 1K1MA 1AN1E 1M90Q 2IYOA 2KOGA 3L6PA 2Y5GA 2OC0A 2O1JA 3N7DA 1HXEH 1M7LA 3GMAA 1SLVB 1V2UT 1OOKB 2XC5A 2F9VA 2VGCB 1GVZA 3TK5A 3D6ZA 1UHBB 2FOBA 1FOSF 1MKWH 1ZHRA 3UTUH 5A8YA 1MU6B 1KXCA 3GDVA 1L2EA 3RC5A 5A0CA 2QM8A 1ZLRA 1EJMA 2ZHWH 1OWHA 3VMZA 5T6GA 1GMDG 1EXJA 5GPIB 2HVYB 1KD1Q 2FFDC 3RL0D 3E90B 3D6YA 2PLXA 3ODDA 4FOUC 3T27A 1NTKE 3UNSA 4D76A 3ATKA 2ZDAH 2KCOA 2R3CA 2CXVA 3MZWB 2OC7A 4M7GA 5KKZB 1GWAA 1TRNA 2KCAA 4RI0A 1TU3F 1ABIH 1S6FA 3ZZDA 1EQ7A 3BTHE 2OC1A 5AVTB 3MU8A 1LTAC 2IBZE 2Y81A 1URQB 1FY5A 3Q76A 3VXEH 2BD7A 4BAHB 1FZEA 1PYTD 3ZVCA 1WXRA 3ZDMA 1RQUA 3II6A 3A84A 4INHA 1YJ9P 3FP6E 4D8NA 3L74D 5APYA 3CCSP 1K73Q 3L74E 3F1SB 2RN0A 4ZMAH 1W0KD 2C8XB 4ISOA 4J1YA 1SQOA 3GF7A 1HIAA 1GBBA 2VIOA 3H32A 3GLMA 1LTOA 1OKXA 1OYTH 3BF6H 3ITKA 4X1NU 1OWEA 4DCDA 4ABHA 1QHRB 4LLHA 2QJKB 1VZQH 1AFOA 2FTLE 1ZN5A 1S83A 2ZFQH 1GG6B 1MZ9A 5C1UA 3LC5A 4ZH8A 1LQDB 1EZUC 2NPSD 2TGAA 4XE5B 3A88A 3F68H 1O39A 3PV5A 4Y28J 1JMOH 1NTKG 3MI4A 3NCLA 3PO1C 3DUXH 1JY3P 1L0LK 4CPGA 2WYGA 2QIQA 4H6SB 5GTHE 5BVZA 3JCUH 1TRYA 4B74A 1Q81Q 1JXPA 3H09A 1GBKA 4XOJA 2A45H 2HNTC 2WPDD 5AW0B 1NO9H 2WQYC 3CWBE 2OYIB 3KNXA 1IFPA 4VGCC 5EXNA 1SQVD 1C5PA 5ABWA 1H0TB 3WU2H 1GL1A 2FI4E 3OA7A 1L1GA 1YPMH 3SWKA 2PKSB 2W6ID 1HAVA 5DP4A 2QJYC 1L2PA 1MUEB 1UJ1A 2G4UA 1XUHA 4BAMB 1WDIA 2K3RA 1H0TA 2A4QA 4ISLA 4EOTA 3M9HA 1JY2P 3ZVAA 5L2YH 1SOTA 2HYNA 3A0BH 1ELAA 2SGDE 4BTTB 3F0PA 4JPZB 3IWMA 1V2ST 2YO2A 1NTZE 3ENSB 4WH8A 4H13B 1TQ7B 3A3YB 1L0ZA 2BLVA 4YOJA 2P1JA 1SFCB 4X2WA 4YESB 5CBOA 5KLIC 3H1IG 1IAUA 2ZHEH 1N73B 1O3AA 2FBWC 1O3GA 1GMHF 1GJCB 2OBOA 3M3SA 1SGIB 4IGDA 4ZCNA 1ELTA 2BX3A 3H7TA 3MO3A 1QL8A 1UTJA 3RXUA 1GCDA 1SG8B 3DSPA 1QB6A 1Y9BA 2WSCH 3O6QA 1QL7A 5F8TA 1CU1A 1P0SH 1DD4A 3ZVEA 4YXWH 9ESTA 1M57D 1GCTB 2E76D 1P84E 3E1RA 1AMHA 1TNGA 3RC6A 4YTAA 1GI3A 5DGJA 3M3VA 2GT8A 1JY3O 2R3SA 1ZPCA 4B2BA 3H1LD 4TWWA 2GCHG 1KYOH 3SFEC 3ZZ4A 2C0XA 2CJIA 1HB0B 3TVJB 3P6ZB 3LGIA 3L75G 2C9NY 1TMUH 2E75D 4M9FA 1S5LX 4AX9H 1L4AD 1YJWP 2FS8A 1O5FH 3PTNA 1S0QA 3H1KG 3PMHB 2CK3H 3TGUE 1KXEA 1PGJA 2AXTH 2YO3A 5AVDA 4AG2A 3O8CA 3RXQA 2ZFFH 3IN6A 1K21H 1Z56A 1E35B 5BU8B 1TE0A 4E05H 2WSEJ 4P00A 2B9BA 5BU5A 4ASHA 2AERH 1SL3A 3ZV9A 1QL9A 2ZGJA 4INKA 3LIEA 1L0NJ 1BCCD 3KHVA 3QTVH 4RKUJ 1SGNE 1AZZA 1TBZH 1ESAA 2WMMA 4NA9H 1GL0E 1LPZB 2A1DB 1OVUA 4FVBA 1CI6B 1J14A 3RK3D 3SU4A 1DEBA 2VIVA 3M37A 1P12E 1TA2A 5CHBA 1ELGA 1PFXC 1HAZB 1VCQA 2RA3A 1LTJC 1UIIA 4K5ZA 3M7QA 1N7LA 2LPRA 1EUFA 3NXPA 3RXIA 1TBQH 4F49A 2EI7A 2M5AA 2UWPA 5BPEA 1KORA 1L0LG 3GCNA 3RXJA 4C7NB 1BGYG 1ELEE 1MKWK 1KYNA 1HVVA 1S9KE 1YTZT 3A7WA 2P8OB 3RXLA 5FBIA 3MO9A 2O9QA 5LGOA 5LPRA 1EZQA 2WPIS 1T31A 1AQ5A 1L4AC 1N7SC 1C2EA 1Z8JB 4TT3H 1GJ7B 2IPQX 4BANB 4AFQA 4AZ2B 1P02A 2O3JA 1KQLA 1V2OT 2Y0EA 1DSUA 1ZHPA 4D7FA 5HGGA 1HWTC 3SBKA 1MTNC 1JIMA 3TU7H 1C5LH 4X6OA 1W2BO 1H88A 1O32A 3VMYA 5AVUB 4NGAH 1L1JA 2DE9A 3RU4T 1PP9D 1VF5B 5AVVB 1AQTA 4D6TG 1NT1A 1DS2E 2AS9A 2IJD1 1K9MQ 3GYLB 3VB4A 2WPJS 1CI6A 3CMAP 1M1JA 3LW5H 1D3TB 3KL6A 4DY7B 2Z5IA 1MZAA 1J1DC 5CCHA 1MKMA 2Y7XA 2Z9IA 3TDKA 2J92A 3PTBA 7ESTE 1G2CB 2GMTB 4PV1B 3VP8A 3STJA 1TWXB 3MU1A 2ZDMA 4IL6H 2Z9JA 3QGJA 2CPSA 5DPAA 1OYQA 1SQVJ 1G3CA 1HUTH 4YOGA 1LQEA 1W5CE 1NTPA 5DSFA 1FZAA 2AEMA 2J98A 1QGKB 3K65B 1AHTH 1EOLA 2QSIA 2NPSB 2ZFRH 1EZSC 3PMJA 4BAOB 2WYJA 1G32B 3LH1A 2M3BA 2SGPE 2FYRA 2WHXA 3ZZ5A 1CT0E 5APXA 4K3JA 4OS1A 2PFXA 5E8EH 1EB1H 1ZTKA 2WPLS 1LGHB 1MZDA 2QXHA 3CCQP 3OYPA 1FU1A 1ZRBA 4PROA 3RL0B 1R5SA 3A2AA 4L73A 1XMNB 1IFNA 3RBXA 5B66E 1NTMJ 1K1PA 3F0OA 1O5CB 1L0NE 4L76A 3S9OA 3R3GB 1A1RA 5IK2D 2W27A 3BEFB 2TIOA 1ELVA 2A2XH 3P32A 3QO6A 2WUCA 1NU1K 1KC8Q 1GI9B 1Z8IB 4N78D 2H8PD 3A8AA 3N7OA 3TGUG 1YWUA 2KZJA 1C4V2 5AW9B 1EAUA 1C9TA 2BOKA 1TNHA 1GVKB 1JCCA 2QAAA 1S0RA 3OU0A 1THRH 1NFXA 1VCWA 3TGJE 1KMIZ 3DSOA 2AHME 2XWAA 4XE4A 1DWEH 3M5OA 3WUTA 3VXFH 2JJ2D 2FMJA 3MH5A 2A06D 1OWJA 4AFZA 1UIXA 3CL3D 3A7XA 3V12A 1T8ZA 1BMAA 5L6NH 4X1PU 2SNWA 5L8RJ 3RLWH 3UNRA 3BVHA 3N99A 3FXDA 3O8DA 6CHAC 1EDIA 1C1QA 1BSNA 4WB4A 1O38A 3UAIC 1NTKD 3O8ZA 1QR3E 1W0ZU 2UWLA 5ESTE 5LH8A 2R44A 2WVRA 4B75A 2XBWA 1GW3A 1N6XA 5AVSB 1O2TA 2OINA 3D71A 2GP9B 4TPYA 1YCPH 1GMCG 3CXHD 3BTWE 2FOAA 3H1LE 1OZHA 1IHTH 4YPCA 3S1KA 3VP9A 4WF8A 1BDDA 1BT7A 2C8YB 3V2QA 1Y5AT 3BEUA 1A7SA 1FDIA 3F9EA 4ABBA 4IFMA 1X79B 3FKSD 5GNDA 1SQVG 2ZTYA 1NRRH 2L91A 3NMDA 2SGQE 2R3UA 1SPJA 3V4WA 2ZHFH 3GYMA 4AB9A 2BEZF 3SNAA 5DN6D 4X2YA 1YI2P 2VB0A 1W12U 2XBYA 4BNRA 1USEA 1AU8A 2B0FA 1FZFA 1W8BH 2BY6X 4IBLH 2OXSA 4OGQB 1NU1G 3G3ZA 1PV3A 5LPEA 4YLQH 4ABDA 3GY7A 2GUVA 1RF0C 3NK8A 3DCLA 3P8GA 4MPVA 3LGUA 1KB9I 1S1CX 1GPZA 3SJOA 3A7ZA 2HNTE 2FOEA 2ZHDA 1K8AQ 2C9LY 1BRUP 2WSEH 5EODA 1KIGH 2OTVA 3OAKA 1OIPA 1EXIA 2H6MA 4JZIA 4WWIA 1RF1A 2WSCJ 1NRNH 2V6NA 3H7OA 3WWBA 1TABE 2NPSC 3I77A 5DJTB 1J9CH 2RFKC 1GI0A 2QF4A 3ZYDA 1U7JA 3PM3A 3G6EP 3JC22 5AVWB 2C4FH 5CCGD 5LPFA 2K9JA 3GCHC 3UPEA 1IZNB 2IN2A 2YNAA 2VIDA 2JETB 1QVFO 3P8MC 1ZZZA 4DVAU 3A89A 2QV1A 1P3CA 4EYYQ 1O5EH 2PUXB 3Q1MA 2FYNC 2IYPA 3TGIE 3VMAA 3MHWU 3QLPH 1XKAC 3SO3A 3MUDC 3EFGA 1SGCA 1PGPA 1AVGH 1SQPK 1XTGB 1UCYH 1YLDA 1QQ4A 3WWFA 2A06G 4GOEA 1EJAA 4IMZA 1PP9J 4O9BA 3RK3B 2BLQA 3P8CD 2H9EH 3GY2A 3OAAD 4BXSA 5JB8S 3CX5H 2XXLA 2HFED 2SPZA 1SQBK 2OTKE 5CMZA 1MTUA 2VBCA 1AIXH 2ZTZA 4I32A 4R8TB 4DT4A 3A7TA 5GWZA 2XKMA 2JDIH 4IN1A 1CQQA 3RXCA 2AH4X 5DKMA 4H0LD 3KQBA 3EA8A 2KAIA 3TF5A 3GY5A 1W2KH 5JDUB 2AYWA 2B87B 3B5NC 1HJAC 1PFIA
chains in the Genus database with same CATH topology
1DY8A 2GGVB 3NRLA 4B73A 4FETA 5F53A 3AEFC 3FGAD 4H44D 1OW7A 5FPTA 2OBQA 2JO1A 2YMSB 1PIXA 2E76B 3LOXA 1W3CA 1W0JD 5EQQA 3AE2C 3SU1A 2XNDD 4WH6A 2W6JD 5EQSA 2OC8A 1N1LA 2OK5A 2K8IA 5EQRA 4Z1MH 3ZIAD 4B76A 3L6PA 2OC0A 3N7DA 3GMAA 3F2HA 2F9VA 3D6ZA 3ABVC 3RC4A 2XNIA 3RC5A 2WSFJ 5C0TA 1H8HD 2IJOB 3KN2A 1EXJA 5GPIB 3SU5A 2E74D 3E90B 3D6YA 5KKZC 4KT0J 2KCOA 1R8EA 2ZT9B 2OC7A 2KCAA 4RI0A 1TU3F 2OC1A 2G8YA 1FDOA 2KFWA 2WZQA 1WXRA 1RQUA 4I7ZB 3OEHD 5HKKD 1NS3A 4Q4LA 2D2CB 1OMIA 1W0KD 2V7QJ 2ZT9D 3GF7A 1RQVA 1YQ3C 3GLMA 2FP7B 4IL6X 4OGQC 1VF5D 2KCYA 3AE6C 2D2CD 3M5NA 1S6LA 1K04A 4YXDC 2MKVA 3PV5A 4Y28J 2K9YA 2O8MA 3RK3E 2K1QA 2LELA 2YMSC 4B74A 2JDID 1JXPA 1VL2A 2YMKA 3H09A 2WPDD 2WSSD 1ZP0C 2WQYC 2F9UA 2QJPC 1KILE 4XD7D 3KNXA 1E1QD 3RL0g 4H0LB 3AEEC 2W6ID 2QJYC 3B71A 4H0LC 1BMFD 1DIPA 3OFND 1MABB 4I31A 2BEQD 3OTPA 2A4QA 1E1RD 4OM9A 1OW8A 4A1TA 3F0PA 1KMHB 3M5MA 4H13B 2D2CC 3WW7A 1NYHA 3GS9A 1ZMEC 5KLIC 2FBWC 3AE7C 2OBOA 3SU3A 1OHHD 4ZCNA 3AECC 2KCPA 3KEEA 2H89C 5IDKA 3F2GA 4PV1D 3DSPA 3SUGA 3W1EA 1Y9BA 3O6QA 1CU1A 1HJ0A 1DD4A 3Q5RA 2E76D 2J5UA 3RC6A 2GVFA 3GF3A 1GMJA 3G9RA 3SFEC 2WV9A 1K05A 2E75D 4M9FA 2NZ2A 4B71A 4F55A 1S5LX 3SFDC 3SUDA 3FOAA 2E76C 5FPYA 3O8CA 3AEDC 1VF5C 3IN6A 2WSEJ 5B6LA 5H4IB 1H8ED 5M1BA 4U01A 3SZEA 4TSFD 2QJKC 1DD3A 3AE3C 1DY9A 4I33A 4RKUJ 4TYDA 5T1VA 2K0QA 2WPVB 4H13C 1ZOYC 2H88C 4YTPC 3Q5PA 1EFRD 3SU4A 1COWD 4R4MA 5CHBA 2QIWA 3Q2YA 1WMKA 2KZ4A 3KF2A 4NWLA 1KORA 2E74C 4R4LA 3EYDA 2E74B 2G3AA 3FN8A 5FPSA 4ASUD 3N7EA 4TT3H 4B6FA 1SKYE 3O8RA 3F3BA 5ESBA 3SV6A 3AE9C 4A92A 1NBME 1NGMB 1NBMD 1VF5B 3R4YA 1Q90D 2CK3D 4I7ZC 3AEGC 2IJD1 4OGQD 3PRBA 1MKMA 2KR7A 5EPNA 4PV1B 3C8VA 3FO8D 3AK5A 3Q5SA 3AE5C 3SV9A 5DSFA 3T97B 3Q3DA 2QSIA 1JB0J 2JJ2D 4H13D 3LONA 2WHXA 3EWKA 3U1JB 3UB0A 2L6OA 1ZRTE 3AE4C 3SUFA 4H44B 3OYPA 1DXPA 3AE8C 2FXPA 2YIUC 4GDOA 2QE7D 3F0OA 2P59A 3S9OA 5IK2D 1A1RA 3P8NA 3PV2A 5ETXA 2F43B 2XCFA 4A1VA 3LW5J 2V7QD 2E75B 3SU6A 1RTLA 1IK7A 2XCNA 5FL7D 1DXWA 2YOLA 3SYJA 1KMIZ 3DSOA 2AHME 2P10A 3AEBC 3M5OA 5CDFE 1FX0B 1UIXA 2JIZD 5GJ4B 5L8RJ 2M2AA 3N99A 3O8DA 1PL5A 3OE7D 4PV1C 4YXWD 3SU2A 3AEAC 4KTCA 2ZT9C 2HLDD 3P8OA 4B75A 2OINA 4Q63A 3D71A 1KQFB 3M5LA 3AE1C 4K8BA 4WF8A 1BT7A 3SV8A 4NWKA 1FDIA 1AJYA 5GNDA 3FKSD 3O8BA 3LKWA 3IAOA 4H44C 3PRDA 5DN6D 2BEZF 3SU0A 4A1XA 2A4GA 4OGQB 3OEED 2FOMB 1PV3A 3H25A 2KM0A 2O01J 3DCLA 2A4RA 1S1CX 3F2FA 2YMSD 2E75C 2JJ1D 4U7JA 1HF9A 4TT3D 1EXIA 3WWBA 2WSCJ 1YQ4C 2QF4A 1E79D 1RGQA 1KQGB 2IDBA 2QV1A 1OW6A 2FM2A 3Q1MA 2FYNC 4Z1MD 3D70A 2QF5A 1U57A 3WWFA 5C0UA 4B6EA 4JMYA 1KTMA 4XFJA 2OQQA 3VG8A 3OAAD 2JP3A 4R8TB 2VBCA 4I32A 4DT4A 5EPYA 3SUEA 5C17A 2F4LA 2XOKD 4H0LD 3SV7A 4WH8A 3U1IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D70 A;  2QF5 A;  3Q5S A;  3Q5P A;  3D6Z A;  3IAO A;  1EXI A;  1DIP A;  4R4M A;  2OQQ A;  3Q2Y A;  2QF4 A;  3T97 B;  3Q5R A;  3Q3D A;  2J5U A;  1EXJ A;  3D6Y A;  4R4L A;  3D71 A;  3G9R A;  1R8E A;  3Q1M A; 
#chains in the Genus database with same CATH topology
 1OPH B;  1ZPZ A;  1GK4 A;  4AYC A;  1AV1 A;  1MU8 B;  4OGX A;  1GI7 B;  1ZOM A;  3GY3 A;  3EQ2 A;  1KTT B;  1GVL A;  1SGT A;  1AFE H;  4MPU A;  4MNW A;  5F53 A;  2V3M A;  1LT9 B;  2GZ7 A;  3CD6 P;  4H44 D;  5FXL A;  3KZI H;  1OX3 A;  2P7J A;  4QT8 C;  3E0N B;  2FYU G;  2YMS B;  2POH A;  1CGI E;  1O3K A;  4CHA B;  3TSI A;  1P05 A;  2G5V A;  3A86 A;  2GA1 A;  1W0Y H;  2ZIQ H;  3RXT A;  4FUJ A;  4XFQ A;  1FS0 E;  3GCO A;  2A7H A;  3HGN A;  4O9V A;  4DOJ A;  3WMM 0;  5B5E H;  1E0F D;  2QRX A;  2R32 A;  1HFD A;  1HPG A;  1VIT F;  2L5G B;  3SQH E;  3SU1 A;  3TH3 H;  1YPL H;  2ZAE B;  4XA4 A;  1BMN H;  3C1K A;  1GDU A;  1VGC B;  2G5N A;  1L0N D;  2VWM A;  4WY4 A;  1HBW A;  2A7J A;  2ODP A;  1ANE A;  1XM1 A;  3PLN A;  2ZFC A;  4N3Y B;  2FPZ A;  2W6J D;  3F9G A;  3UUZ A;  5CJ4 A;  1GD2 E;  5DP8 A;  1X22 A;  4UFF H;  5HXF A;  1ZJK A;  1C5Q A;  2UUK B;  1MD7 A;  5C1X A;  1QA0 A;  3VMX A;  4KGA A;  2Z9L A;  5AW7 B;  5E2P A;  2JH5 D;  2IX7 C;  4AUW A;  3QDZ B;  2JKV A;  4I8H A;  2GTB A;  3OTJ E;  4Z1M H;  2Q7C A;  1V2T T;  1QUR H;  4D9Q A;  4B76 A;  1Q2W A;  2KNC B;  1BIT A;  1HRT H;  1O3O A;  1HAG E;  1HJB A;  2FYQ A;  1MD8 A;  2G51 A;  2VIN A;  1O3P B;  2KZI A;  2KSJ A;  3MP7 B;  2UUF B;  3RC4 A;  1UK2 A;  3A5T A;  5FX6 A;  2W6A A;  1Q31 A;  2A45 I;  1YY3 A;  1TGT A;  2WSF J;  5DK1 A;  5CJ0 A;  4FUE A;  5C0T A;  1BUI A;  3KN2 A;  2CV3 A;  4MVN A;  1LTT C;  2R0K A;  2TRM A;  2XU6 A;  2LNC A;  3SU5 A;  2G52 A;  2E74 D;  1NRQ H;  2AIP A;  2HRV A;  4X2V A;  4Y79 A;  3V7T A;  1CO7 E;  2N9Y B;  5KKZ C;  3BSQ A;  1ELD E;  1Q82 Q;  5C2Z A;  1UVS H;  1WV7 H;  2GZ8 A;  4JZE H;  1QL1 A;  1SFI A;  1O2Y A;  4D6T D;  1GL2 D;  1G2M A;  3D62 A;  5F03 A;  2KFW A;  1EPT C;  1HJ9 A;  3CLQ A;  1JRT A;  1PPH E;  3ZVG A;  8GCH G;  2G55 A;  2Z4E A;  2V3H H;  4CR9 A;  2D8W A;  2HPC A;  1JOU B;  2B87 A;  4IS5 A;  4I7Z B;  5HKK D;  1L1N A;  1SQP E;  3JCU E;  3KQC A;  2D2C B;  4A7P A;  1LVY A;  3M36 A;  1O3F A;  3HD7 A;  1ANB A;  3RML H;  2VWL A;  1MCT A;  4BAQ B;  4JQ0 D;  4NA7 A;  5HM9 A;  2Z3E A;  2V7Q J;  1DIT H;  4MG3 A;  1N73 C;  3AW1 A;  4LK4 A;  1RQV A;  1UCY K;  3NXS A;  2EI8 A;  5CHA C;  3E7K A;  2FYU D;  3ATL A;  1AA0 A;  2AFQ B;  1GJ8 B;  3MH4 A;  4FUD A;  1VQK P;  1T3U A;  1PGO A;  1PQ8 A;  1G3B A;  2IOT A;  1G2L A;  1SQR A;  1NTM E;  5GTH H;  1S6L A;  1W7G H;  1Y3U A;  4YXD C;  3E0P B;  3M5N A;  4X1S U;  3S7K B;  1BQY A;  3FP8 E;  1H8I H;  1KLI H;  1LWU B;  2N1T C;  3L71 G;  1T8M A;  4CBN A;  1C1W H;  3R2P A;  4EI2 A;  2Z94 A;  1QY6 A;  2IFM A;  2O8M A;  1A3B H;  5A2M H;  5JBA S;  2K1Q A;  3NZI A;  2LEL A;  2YMS C;  5J4S A;  3CC7 P;  1CA0 B;  1IQF A;  2IZ1 A;  2JDI D;  1C5X B;  4NA8 A;  2BD4 A;  2ODQ A;  4NZL A;  1C2I A;  4RT1 A;  2GX4 A;  2BD9 A;  2F9U A;  2QJP C;  1KIL E;  1P84 I;  2GD4 B;  1WBG B;  1DPO A;  1L0N K;  1PJP A;  4WXI A;  3RMO H;  3TJN A;  4E7N A;  3GDS A;  5PTP A;  1GZL A;  1SGQ E;  3MQK C;  2LXB A;  2FYZ A;  3T62 A;  1NU1 J;  1W2E A;  2FYU J;  5T6F A;  4JK5 A;  3RXK A;  4CRD A;  1V2R T;  3B71 A;  4N78 E;  2ZFS A;  3S9C A;  4H0L C;  5K5G B;  4GAW A;  1BMF D;  1EAT A;  3OFN D;  1LP1 A;  4X6M A;  3OTP A;  2A45 B;  1HCG A;  1RF0 A;  3BN9 A;  3CXH H;  1LHE H;  1THP B;  1W10 U;  1KB9 D;  2M5A B;  2HGT H;  1SFC C;  1YPH C;  1V2V T;  2KK7 A;  3M5M A;  5KLI B;  2Z9K A;  2HWL B;  3GS9 A;  2YKP A;  1CHG A;  2FLB H;  3VTP C;  4BTU B;  3KYF A;  2O01 H;  1ZME C;  1PP9 E;  5DJ7 A;  3UOU A;  4IW4 E;  1INC A;  1GJA B;  3DFJ A;  1FY4 A;  3SU3 A;  2N1T A;  1ZHM A;  1OHH D;  1T32 A;  3A81 A;  1K2I 1;  4NSY A;  1C1R A;  3AEC C;  1NU9 A;  3JZ1 B;  1K0H A;  1P84 H;  3EST A;  1KXF A;  3KEE A;  2H89 C;  3T29 A;  4PV1 D;  3RK2 B;  4O3T A;  1GL2 A;  3K5B A;  3CPW O;  2Y9Z A;  1LWU A;  3M06 A;  1ZML A;  5GDS H;  4WME A;  3FZZ A;  1FN6 A;  3L73 D;  1HBT H;  1HAO H;  1GBJ A;  1VIT H;  2ALP A;  4K60 A;  2LP6 A;  2GVF A;  1FZB A;  1T6A A;  3GF3 A;  1SQX K;  1TPA E;  1XTC C;  1GMJ A;  1N7S B;  3G9R A;  2KB7 P;  1FPC H;  4P02 A;  3TJV A;  2G00 A;  3U98 H;  2WV9 A;  1Q3X A;  1K05 A;  1OXZ A;  1C1P A;  1C2D A;  2NZ2 A;  1SQB E;  2PW8 H;  4I2L C;  2J38 A;  3T25 A;  1SLQ A;  1L4D A;  1O2N A;  2GV7 A;  1C2H A;  2Q6F A;  2E76 C;  4A5T S;  1NKZ B;  1ZR2 A;  3SNE A;  1EAW A;  1SQX D;  3AED C;  1VF5 C;  6EST A;  1WCZ A;  2A32 A;  3CWB J;  2HAL A;  1C1N A;  3FWL A;  2WT7 B;  1N6Y A;  3CCE P;  3RXE A;  3UR9 A;  1FE6 A;  1OVV A;  2JKH A;  5AW2 B;  1WU1 A;  1W11 U;  1IQH A;  1EXF A;  2J9N A;  4CRC A;  2ZU2 A;  1FQ3 A;  2KI7 B;  2FWW A;  2P3U B;  2AEF A;  3GY4 A;  1RE3 A;  2QJK C;  1BE3 J;  4JYV H;  5KJ7 A;  3BTG E;  3M0D A;  4XBD A;  1TAL A;  2K0Q A;  1Y3V A;  4HZH A;  2Q3I A;  2YMY A;  1BJV A;  1UTP A;  4U2W A;  2VVV A;  3DSG A;  3RXF A;  2H88 C;  1LWU C;  4YTP C;  1M9U A;  4HI3 A;  4OS6 A;  1YBK A;  5DP7 A;  4UB8 E;  3ZYE A;  3M3T A;  3PMB B;  1EZV E;  1A61 H;  1HYL A;  4UDW H;  3Q2Y A;  4NZQ A;  1AB9 B;  3H1L J;  2XC4 A;  3M9B A;  3PLP A;  1GI2 A;  3M9Q A;  5KAI H;  2ZI2 H;  4WMD A;  3IR9 A;  2L74 A;  2OYH A;  1YPJ H;  2QXG A;  2E74 B;  4Y76 A;  5APW A;  2Z5H A;  2WPQ A;  2WTY A;  1RJX B;  2J98 B;  3E91 A;  3FN8 A;  8KME 2;  1UMA H;  1OWD A;  4CRA A;  1JOC A;  4ASU D;  3OY6 U;  1TMB H;  3PV4 A;  3RMN H;  1NFW A;  3KQE A;  3MH7 A;  1TON A;  1N8O C;  3N7E A;  2WIT A;  1R5L A;  4WY4 C;  1KYO I;  4D6T J;  4ZNC A;  3VB6 A;  1JM0 A;  4B6F A;  1QCP A;  1GL2 B;  1SKY E;  1ZSK A;  3MH6 A;  3KPE A;  1S3J A;  2IBZ D;  3V2P A;  3AE9 C;  3MOC A;  5TJX A;  3U1C A;  1MFT A;  3HGP A;  1U7M A;  1AND A;  3A85 A;  1NGM B;  1ZMN A;  4TPI Z;  1N7S D;  1GMD F;  3LID A;  3H1H E;  1FI8 A;  3BAT A;  2ZXE B;  1O5A B;  3FFG A;  4U30 A;  3R4Y A;  2NRG A;  5EXL A;  2ANY A;  3AEG C;  1BRB E;  4DJG A;  4OGQ D;  2ZGC A;  3SI4 H;  4UON A;  2VJ1 A;  3LPR A;  2WZ7 A;  1EPT A;  3UIR A;  1V2W T;  3LGV A;  4FU8 A;  3GHG B;  5F8Z A;  1LT9 A;  1AUT C;  3C8V A;  2AIQ A;  1KIL C;  1GI6 A;  2ZFT A;  3MO6 A;  2ANK H;  1D6R A;  3SZN A;  2AMQ A;  3Q77 A;  2ILN A;  2P95 A;  1N86 A;  2BXT H;  1CHO G;  1FDM A;  4RT0 A;  1W13 U;  1O5G H;  3SGB E;  1P2O A;  3UR6 A;  4IC6 A;  2W90 A;  1LTG C;  1C5Y B;  4H13 D;  3QWO C;  2FOC A;  1AGJ A;  4I6M C;  5KLV J;  3A0H E;  3TGK E;  1AO5 A;  3GW6 A;  1A0H B;  2TGP Z;  5T6D A;  4DG4 A;  1UO6 A;  3AE4 C;  2XDJ A;  3SUF A;  1MTS A;  2W83 C;  1QTF A;  3TK6 A;  4BRY A;  4TWY A;  1BCC G;  1MBQ A;  2ZXX A;  1TGB A;  1RF1 C;  1JTH A;  5C1Y A;  3SSU A;  3CP7 A;  3TH2 H;  3MU5 A;  4GDO A;  2NPS A;  5SGA E;  3E1X B;  1JEK A;  1H89 A;  2R2M B;  5HMA A;  3L72 D;  1PQ7 A;  1GDT A;  3F9F A;  4EIJ A;  3PV2 A;  3MNS A;  2F43 B;  1NRO H;  2I1K A;  4NIW A;  3LC3 A;  2FTM A;  3B5N D;  1VQ5 P;  3B9F H;  3HE5 A;  1MTV A;  2F91 A;  2H9H A;  4Q7Z A;  5HIY A;  3Q3X A;  4KJM A;  1Y3W A;  4HKZ H;  1ORF A;  1G2C A;  4C46 A;  1F2S E;  3SU6 A;  3P17 H;  1DWB H;  1SVP A;  1RE4 A;  3L74 J;  2GT7 A;  1CA8 B;  1Z7K A;  1O33 A;  3IFM A;  3ZZ9 A;  1L0L D;  2BY9 X;  2J97 A;  2XCN A;  1PPJ G;  1DXW A;  3SYJ A;  1K28 D;  5CMX H;  5E2O A;  1JRS A;  2P10 A;  1DVA H;  4D7G A;  5CDF E;  3KXD A;  2GJG A;  1NKN A;  2P3T B;  2Y0C A;  3RDZ A;  1P2Q A;  4AC9 A;  1H9L B;  2IPP A;  1O3I A;  1YHQ P;  2M2A A;  3GIS B;  1O3J A;  3FAN A;  3H1H J;  5APS A;  3OE7 D;  3P7K A;  3TYY A;  5EJL A;  2PUQ H;  4KTS A;  4TLF A;  3SHC H;  1GHA F;  1JO5 A;  3VB7 A;  1AVW A;  2HLD D;  3P8O A;  1NTZ J;  1C4U 2;  5GIB A;  1P84 D;  1TNJ A;  1VCP A;  1EB2 A;  3RXV A;  4GOF A;  1KQF B;  3M5L A;  1OP0 A;  1O2L A;  4ABA A;  1S5S A;  1WUN H;  3H1I J;  1PQA A;  2QVA A;  1FY1 A;  4JCN A;  3QK1 A;  1GMC F;  3CCR P;  1GMH G;  3SOS A;  4X6N A;  1F0T A;  1RTK A;  2BAS A;  1GL2 C;  4IN2 A;  2P2U A;  3AAV A;  8LPR A;  4F4O C;  1O2K A;  1S81 A;  3SGQ E;  2AGI X;  2J95 A;  2C3S A;  1A4W H;  3C1L A;  1MKX H;  2QF3 A;  2PTC E;  1KYO D;  2PGB B;  3TJO A;  2ZNK H;  5T3H A;  3H25 A;  1J8A A;  2GCH F;  2QN5 T;  4FU7 A;  1M1K Q;  1NTM D;  1LPK B;  2GMT C;  2BMG B;  2YMS D;  2E75 C;  2H1U A;  3SJ8 A;  1FAV A;  1BOQ A;  3HAT H;  4YLU A;  2ZG0 H;  1SGF G;  4AQR D;  2WUB A;  4HFP B;  5KLV E;  4CH8 B;  4NFF A;  1FZC B;  1MKX K;  2BCC D;  3BAS A;  2ZWL H;  1NTM K;  5AW8 B;  2I6Q A;  4X2X A;  5A0A E;  4DJZ B;  5C3N A;  1DX5 M;  3EA9 A;  4AOR A;  1YPK H;  1IC2 A;  2STA E;  2ZJS E;  3MNC A;  4RN6 A;  1EC5 A;  1OS8 A;  1MQ6 A;  1UCY E;  1YYY 1;  4Y11 E;  5FHT A;  3ZZB A;  4AOQ A;  2ZQ1 A;  4GVU A;  3VB3 A;  1OWK A;  3L72 E;  4ZUH A;  4Z1M D;  3USS A;  2P3F H;  1GHW H;  3LDX H;  2ITA A;  3RP2 A;  1TX7 A;  3S0N A;  2KP8 A;  1G3D A;  5C0U A;  2QA4 P;  4JMY A;  1MCV A;  2PR3 A;  1EAS A;  1ETR H;  2RMZ A;  4U32 A;  3H1I E;  2E5T A;  4WBA A;  1TB6 H;  2Q6Q A;  1BE3 G;  3P8C E;  1G30 B;  2JP3 A;  1GBL A;  2FDA A;  1FBM A;  1C5S A;  1E37 B;  1LPG B;  2JWA A;  1HTL C;  4Y6D A;  2PKA B;  1TFX A;  1F92 A;  2VGC C;  3H1H D;  2FES H;  3SV7 A;  1VJA U;  2R5B A;  2EQN A;  5B5E E;  2PAJ A;  3RM0 H;  2BLW A;  3SHA H;  2CHA B;  1BZX E;  3NRL A;  1URQ A;  1GU4 A;  2AMD A;  2VIQ A;  5APQ A;  1LVB A;  4DUR A;  5EIY A;  4LZ4 B;  1KQS O;  1ZJD A;  4FET A;  1QJ6 B;  5HIZ A;  2QF0 A;  1P11 E;  4ASV A;  3RU4 D;  2D1J A;  3TH4 H;  1T2K D;  5G4B A;  1LTI C;  3FGA D;  2O8T A;  4MPW A;  1OW7 A;  1TNK A;  2AGG X;  3GCT F;  4FUF A;  1P2I A;  3FP7 E;  2FKW B;  3BG4 B;  3VEQ B;  4ZKO U;  1D6W A;  3HRN A;  5C94 A;  1O2U A;  4GCH F;  3LOX A;  2K1A A;  4PD4 I;  2WSS H;  1FMG A;  1K1I A;  1YGC H;  2VIW A;  3NPS A;  5EU8 A;  1BE3 E;  1YIT P;  3URE A;  1IFI A;  1Z1I A;  1Z6J H;  5EW1 H;  1GBH A;  3GY6 A;  1SR5 C;  3FAO A;  2BDC A;  3BEI B;  2ZVN B;  4JZD H;  2Y5H A;  5E0H A;  3MD0 A;  3VPK A;  4GIF A;  1LTS C;  2ZU3 A;  2ZP0 H;  3SW2 B;  3BG8 A;  3SWY A;  1ZPB A;  2H2Z A;  5FAH A;  2IFN A;  4KKD A;  1SFC D;  1SFQ B;  5KGO A;  1CZQ A;  1HAH H;  1C5O H;  3H32 B;  1H8A A;  1BTU A;  1X8Y A;  1KIL A;  2ZEC A;  3RMM H;  3ZIA D;  4MPX A;  3DHK H;  5E0J A;  2VNT A;  1KB9 E;  5CBN A;  1LDT T;  1AD8 H;  3ZZ8 A;  3VFE A;  2BX4 A;  1SS1 A;  4RKO B;  1IFJ A;  2BCC E;  1P2K A;  3F2H A;  1L0L E;  2A06 E;  3RXH A;  1LJ2 A;  2A0Q B;  2KAI B;  1WYK A;  3F89 A;  2B9L A;  2FZZ A;  1BTY A;  4EST E;  3ABV C;  1H9I E;  5F8X A;  1QX8 A;  3H1J D;  3MHV A;  2I6S A;  2XNI A;  3ODF A;  3G01 A;  1RRK A;  1NAY A;  2FFD B;  2FI3 E;  4NIY A;  1ELB A;  2BD8 A;  4Y71 A;  3IIT A;  3U8O H;  1ZMJ A;  4KTU A;  1V2N T;  2P94 A;  3PWC A;  1TPS A;  2HOB A;  2Y9Y A;  1XKB C;  2ZT9 B;  1YC0 A;  1GHX H;  3TNS A;  5A8X A;  1E5W A;  1NH4 A;  5C20 A;  1QJ1 B;  5KTB A;  3KHU A;  1TIO A;  2N9B A;  2FI5 E;  1P2N A;  2N1T D;  4L74 A;  1O2J A;  4D6T E;  3L70 D;  1KN7 A;  1WTG H;  2WZQ A;  3ZZC A;  3L37 A;  5GCH G;  1NRS H;  1PPF E;  3CX5 D;  1IK9 A;  1OVR A;  1URQ D;  2LR2 A;  4BRY B;  3BRV B;  1OSS A;  3OEH D;  3HUS A;  4Y99 B;  4DZO A;  1NS3 A;  3OJA B;  4Y7A A;  2QM7 A;  3HKI B;  1RE4 C;  1Y47 A;  1MAX A;  5B66 H;  1QGF A;  3T2N A;  1BHX B;  1OMI A;  4BWN A;  4IFF A;  2I1J A;  1O2V A;  3H1J J;  3TK1 A;  1TNL A;  4CRF A;  1AQ7 A;  1YQ3 C;  1HJA B;  4JYU H;  3SJK A;  2OAR A;  2FP7 B;  2R3Y A;  1NTK K;  4IL6 X;  1ZR4 A;  5JBB S;  2CHA C;  4Y0Z E;  4OGQ C;  1GBT A;  2P58 A;  5F6M A;  2KCY A;  1YTZ I;  1QVG O;  1S85 A;  3AE6 C;  2HLO A;  1LHD H;  1O3B A;  3RU4 E;  3RXM A;  2WSF H;  1EOJ A;  3K6Z A;  1K04 A;  3BIV H;  2BYA X;  2GUS A;  2MKV A;  3E6P H;  4CH2 B;  3V4Q A;  3ZVF A;  1S2E A;  3CCU P;  2CMY A;  2Y82 A;  4HYT B;  1EAX A;  3VN0 A;  2YKO A;  1S72 P;  4HGC A;  1YLN A;  3GIC B;  5I25 A;  1O3L A;  5IYT A;  4XSK U;  4HH2 A;  4WY4 D;  2BY8 X;  2Y7Z A;  1J1E C;  2BD2 A;  3CWB D;  2OTL P;  2YNB A;  3MWI U;  5AVQ B;  1Z1J A;  1ZV8 A;  1SQX J;  4XD7 D;  2BDH A;  1XUK A;  1SLW B;  2DW3 A;  1SP4 A;  1E1Q D;  1IQJ A;  2AXC A;  1UTL M;  2QJY B;  2ANW A;  2CPB A;  3BCC D;  2VVU A;  1VGC C;  3BTE E;  1E36 B;  2ZVO B;  1O3D A;  5JPM H;  4GPG A;  2WPR A;  1C2G A;  1QB9 A;  2V35 A;  1MAB B;  1EDL A;  1T7C A;  4AG1 A;  1GBA A;  1F0S A;  3FVF B;  3LT3 A;  1YCP K;  1SQP J;  3H6P A;  1O2S A;  2PTN A;  4OM9 A;  1IO4 A;  4A1T A;  2F9N A;  4SGB E;  3P92 A;  4X8T H;  1GK6 A;  1NWQ A;  7KME H;  2FXR A;  5H2F E;  1KMH B;  2F9B H;  2OQU A;  2THF B;  5FX5 A;  5EG4 A;  1NYH A;  2PKA A;  2CN0 H;  1LNQ A;  1O2W A;  1AVY A;  1ARC A;  2XBV A;  1LHC H;  4PJ0 H;  1TQ0 B;  6CHA B;  3RK2 D;  2ZU5 A;  1QBO A;  2ASU B;  2GDD A;  4AGJ A;  1YLC A;  4FVD A;  1AB9 C;  4RKJ B;  2SGF E;  2NU2 E;  2KCP A;  1ZTL A;  2ZTX A;  1XX9 A;  1DDJ A;  3SUG A;  1A5G H;  1CGJ E;  1ESB A;  1GU5 A;  1UVP A;  1O30 A;  3Q5R A;  3RGU A;  2BCC G;  2RH0 A;  2HG5 D;  1AFQ B;  1Q86 Q;  5FCR A;  2W8Z A;  1UVO A;  4INL A;  2GCT C;  1N2D C;  3AVZ A;  4GHT A;  4B2A A;  1N8O B;  1LT9 C;  2ZA5 A;  1TRM A;  1O2O A;  2E42 A;  2ZDK A;  3U9A H;  3KQG A;  1LHG H;  2WT7 A;  1F5K U;  1Y3Y A;  2BTC E;  2NWN A;  1SQB D;  1BRC E;  2QA9 E;  1PPG E;  3KCG H;  4B71 A;  2KYV A;  1TNI A;  2F9O A;  4F55 A;  1V2J T;  1NU1 D;  4UB8 H;  1BTW A;  4FUC A;  1IQG A;  1NU1 E;  3FOA A;  2YIU B;  1QB1 A;  1AKS B;  1MAY A;  1A0J A;  4VGC B;  3HUS B;  1VQ6 P;  2OGU A;  3CEN A;  2Y5F A;  1FY3 A;  3QN7 A;  2XC0 A;  3T97 A;  1GBD A;  5H4I B;  4E06 H;  1H8E D;  1KY9 A;  4NFE A;  4NIX A;  2JH0 D;  4GOD A;  9LPR A;  4H4F A;  4OVN F;  1YYC A;  1UW7 A;  1T4U H;  4TSF D;  1O2P A;  2WPH S;  3HE5 B;  1FJP A;  1DY9 A;  1L4A A;  3P8F A;  3L33 A;  1QNJ A;  5T1V A;  1TLD A;  1EP5 A;  5EFW B;  3URD A;  1BMM H;  4X8U H;  1NN6 A;  3CCL P;  1PYT C;  3ATM A;  4I8G A;  4H13 C;  3LJO A;  1C2L A;  1ZOY C;  3ZZ7 A;  2YNY A;  3Q5P A;  5AW3 B;  1EFR D;  1EZV D;  5KAI E;  1SGP E;  1SQB J;  1TX8 A;  2P16 A;  3UWJ H;  1ZR0 A;  1COW D;  1DIC A;  3L73 G;  4PD4 H;  4JYT A;  4WMF A;  1VDF A;  3SJI A;  1AKS A;  1WMK A;  2MJZ A;  1P01 A;  4QMA A;  4ZKN U;  1J1E B;  3UWI A;  1K1J A;  1P8V C;  4ZKR U;  3UIA A;  5GTI H;  1RFN A;  1HH0 A;  1LCY A;  2OD3 B;  2QJP B;  2ZGB H;  1O2M A;  5EJ1 A;  2C8W B;  2G3A A;  2OCV B;  1GCT C;  1WAY B;  2BDI A;  4Y0Y E;  5KED A;  1NTZ K;  4OS5 A;  5FPS A;  5APT A;  1X0T A;  1P10 A;  4ABI A;  1JCD A;  1LP1 B;  3KZI E;  2OYH C;  4R0I A;  2KS1 A;  2BB4 A;  2WV5 A;  2W3I A;  1C4Y 2;  3EGK H;  3V0X A;  4LOY H;  2Q1K A;  2XRC A;  3H1I D;  2A5A A;  2ZCH P;  1J16 A;  3EE7 A;  1W14 U;  4AYY B;  1EX3 A;  4U3F E;  4FUH A;  2FOD A;  1A5I A;  3BIU H;  5ESB A;  1KLT A;  3SV6 A;  4BAK B;  3RLY H;  2BDY A;  3CC4 P;  4JBZ A;  1BBR E;  1NTZ D;  1T2K C;  3DT0 H;  5KEC A;  3A0H H;  1MQ5 A;  4PJ0 E;  1NBM D;  1SSX A;  2SGA A;  2XTT B;  2TGT A;  1TOC B;  3LGY A;  2ZCK P;  1GHA G;  1RIW C;  2PRR A;  4I7Z C;  4U3F J;  1KDQ A;  2LXC B;  2CK3 D;  1FZZ A;  3MFJ A;  1MMJ N;  4UE7 H;  1IQN A;  1O2I A;  4ZRO A;  3PRB A;  1C5M D;  3A87 A;  1IFM A;  3E8L A;  3QH9 A;  1BCU H;  3K9X B;  1VQO P;  2FS9 A;  1B0E A;  5EPN A;  5DO4 H;  4JZF H;  2HLC A;  2Y6T A;  4UEH H;  4BTI B;  4ACA A;  2FYU E;  5CHA B;  2O8L A;  3LGT A;  1DX7 A;  1LKB A;  2EC9 H;  3SV9 A;  1FAK H;  4C7R A;  2JH6 D;  3SNB A;  3HD7 D;  3T97 B;  1G1I A;  4XDE A;  3Q3D A;  4Z0K A;  1JB0 J;  5JBT A;  1RTF B;  2B8O H;  1D3Q B;  3LON A;  1GDN A;  3SWF A;  3U1J B;  1OWI A;  2GKV E;  1WT6 A;  3UB0 A;  1FV9 A;  2ZYG A;  2L6O A;  1ZRT E;  4B86 A;  2KXP B;  1G37 A;  1JY2 O;  1RXP A;  2KUB A;  1B5G H;  5CHX A;  1C1V H;  1OXG A;  4JK6 A;  1LVM A;  5TCC A;  1SC8 U;  2J34 A;  1DXP A;  3AE8 C;  1B0F A;  2YIU C;  2O8W A;  2IBZ G;  2RG3 A;  2HR3 A;  3PLB A;  5KLV G;  4DGJ A;  3HUS C;  1QLE D;  5DJU B;  1BTH H;  2P59 A;  2OYI C;  4NPF X;  1K1L A;  4X0W U;  2EST E;  3ATW A;  3F6U H;  3P8N A;  5ETX A;  3BCC E;  1THS H;  3WUU A;  1HGZ A;  2HOD B;  4RES B;  3A83 A;  3L75 J;  1YPG H;  1NVO A;  3LW5 J;  1FJK A;  2XWB I;  4A1V A;  2SNV A;  1WQS A;  4H6T A;  1JIR A;  3K6Y A;  3PB1 E;  3TGU J;  1PGQ A;  3UNQ A;  5E79 E;  3KDP B;  1EQ9 A;  5GCH F;  4K69 A;  1HNE E;  1IK7 A;  6GCH F;  1KXD A;  1XXD A;  3NFQ A;  4PD4 E;  1ZTJ A;  2YOL A;  1ZXG A;  1SGD E;  1SGE E;  3I29 A;  3AEB C;  5FCK A;  1GI1 A;  1FXY A;  3V6I A;  3L70 J;  1NRP H;  3S4R A;  3M35 A;  3ZV8 A;  1K22 H;  2V4H A;  4Y8X A;  2AMP A;  2JIZ D;  1BTZ A;  1C1S A;  4ISI H;  3BRT B;  1BA8 B;  4BXW A;  1XXF A;  2PP6 A;  4IC5 A;  1C1T A;  4IOI H;  3TNT A;  4PV1 C;  3TIT A;  1FOS E;  4NG9 H;  3UFA A;  4YXW D;  3G71 P;  3SU2 A;  4DW2 U;  1V2Q T;  2KX4 A;  4ABG A;  4RSP A;  4ZXX H;  4KTC A;  1O36 A;  1IHS H;  1ACB E;  2GM4 A;  1LVO A;  3P95 A;  1URQ C;  2OYH B;  2FOG A;  1USD A;  2QXJ A;  1SQP G;  1MFZ A;  3KQD A;  1HAX B;  5C5O A;  3BCC G;  4WY4 B;  4NWK A;  5AVX B;  5AW5 B;  1AJY A;  3SV8 A;  1KZU B;  1KXB A;  2KIK A;  3O8B A;  3DFL A;  3F9H A;  3CCJ P;  3V5B A;  3I55 P;  3MTY A;  2ZGX H;  3A0B E;  3QGN B;  5DP3 A;  4K8Y A;  5BRR E;  6GCH G;  3IAO A;  4H44 C;  1WOF A;  3TGU D;  2AGE X;  3H1L G;  3T28 A;  3HE4 B;  3RBZ A;  1C5R A;  2ZKS A;  5JB9 S;  3SU0 A;  3L75 E;  3MGN A;  2Z3D A;  3D23 A;  1YP9 A;  4YZU A;  4A1X A;  1A0L A;  1SQV K;  1KV4 A;  1GHZ A;  1RIW B;  4OS7 A;  4U3F G;  3L3T A;  3OEE D;  2FOM B;  1ETT H;  2ALV A;  4OS2 A;  4MDS A;  2KSE A;  1VKY A;  2KM0 A;  2O01 J;  1NY2 2;  4I7Y H;  1V2P T;  3GHG C;  1BCC E;  1HJ8 A;  3PH0 A;  1KTS B;  3B8E B;  1GI8 B;  1GJ9 B;  4ZKP A;  5KAF H;  1WSS H;  2IPH A;  4OGY A;  3SNC A;  1RE3 C;  3M0A A;  3V2R A;  2JJ1 D;  3QZQ A;  2Q6G A;  1C2M A;  4U7J A;  5APU A;  1DFP A;  4GKG A;  1UTN A;  1Q7Y Q;  3CX5 I;  4L75 A;  1T8L A;  4I86 A;  3SJ9 A;  2G8T A;  1HIA B;  2ZDN A;  1OFC X;  1NM6 A;  1P3E A;  1SQQ G;  1YQ4 C;  2C90 B;  1XUF A;  3RUO A;  3BG4 C;  1FLE E;  2J4I A;  2W3K A;  1E79 D;  1HAI H;  4JYC A;  3A8B A;  1SI5 H;  3RXB A;  4B2C A;  1BGY J;  5E79 H;  2A5K A;  2BQ6 B;  3B5N A;  2VH6 A;  4GHQ A;  4AB8 A;  2IDB A;  4AFS A;  1CHO F;  2BVX H;  3W68 A;  2XYA A;  3MYW A;  1DUE A;  3EFF K;  3U8T H;  1OW6 A;  2WV4 A;  1QBN A;  2EY4 C;  2QXI A;  3L36 A;  2G81 E;  3LH3 A;  4XRN A;  1P03 A;  5TIS H;  3D70 A;  1SB1 H;  3UOP A;  1DEE G;  3FXE A;  2QF5 A;  1HUC A;  1DT2 A;  1T8O A;  1U57 A;  3HK6 B;  4RO0 A;  1PQ5 A;  1VQ8 P;  2P8O C;  4D9R A;  3RK3 C;  1EKB B;  4B6E A;  1VQN P;  1KTM A;  4U3F D;  4Q7X A;  4XFJ A;  3KQ5 A;  5AVY B;  2OQQ A;  3S7H B;  3LJJ A;  3VG8 A;  1CSB A;  4KP0 A;  1JTH B;  5EOK A;  1Y3X A;  1FN8 A;  5EJZ A;  5JYI A;  4AN7 A;  1CBW B;  5EPY A;  1GJ4 H;  3CCV P;  2PSX A;  2WPM S;  5C17 A;  2F4L A;  2FEQ H;  3ITI A;  2BDG A;  4Z6A H;  2YXQ B;  2HPC B;  1B7X B;  3U1I B;  4DOQ A;  1EZV I;  3SND A;  2ZYD A;  3L35 A;  1EST A;  2C93 B;  1DY8 A;  4O3U A;  2GGV B;  4LZ1 H;  2AEI H;  4B73 A;  2ZHQ H;  1F7Z A;  4THN H;  3H1K J;  1C2K A;  1T4V H;  2XW9 A;  1GG6 C;  3RXO A;  1XUI A;  1MBM A;  3RXD A;  5EXM A;  1EZV G;  7LPR A;  4XBC A;  1BIO A;  4YOI A;  2M8R A;  1AE8 H;  2ZC9 H;  1GJD B;  1FC2 C;  2M5T A;  2IZ0 A;  3U59 A;  1O5B B;  1XVO A;  1TBR H;  1O3M A;  3N4X A;  1BGY D;  1WRG A;  2OBQ A;  5FPT A;  4YT7 H;  2C8Z B;  5CE1 A;  5K7R A;  3BTQ E;  1BGY E;  3EAJ A;  1Y8A A;  2JWD A;  1SLU B;  1SBW A;  4GT1 A;  3MMG A;  4ZHM U;  2H43 A;  2BCC J;  2V0B A;  1EPT B;  2VH0 A;  3FZD A;  1SGR E;  3EE0 B;  2E76 B;  1ELF A;  1VPC A;  1YJN P;  2NU0 E;  2E5Y A;  4MLF B;  2BZ6 H;  3C9I A;  1SFC A;  1RS0 A;  1W0J D;  3AE2 C;  2XNX A;  1BB0 B;  1KIL D;  3AW0 A;  4GCH G;  1C5U A;  2O1K A;  1ZRK A;  2B89 A;  1HAY B;  4WH6 A;  2F9P A;  4F48 B;  4ZMD A;  1HGT H;  1N8R Q;  2RDE A;  5CCG A;  1WTH D;  1MUU A;  2K37 A;  2A31 A;  3RXA A;  5EQS A;  8GCH F;  5HYO A;  2H5C A;  1KB9 H;  1N1L A;  2BHG A;  2J2U A;  3WY8 A;  2F3C E;  1D7M A;  3SV2 H;  1GBE A;  1J2J B;  1HAV B;  1XUJ A;  2Q5U A;  3TNU A;  2G4T A;  3IF4 A;  1JNM A;  1A5H A;  5TIS E;  1VQM P;  2OYI A;  1QQU A;  2BQW B;  5AFZ H;  3STI A;  1SHY A;  5APV A;  2J58 A;  1UTK A;  1P2M A;  4LC1 A;  1LTJ A;  2Q6D A;  4HJG H;  3H1J E;  1C2F A;  1CT4 E;  1NHL A;  4MTB A;  2GDE H;  2A5I A;  2VWO A;  1VIT G;  2KLU A;  2Y80 A;  4MNX A;  1NO4 A;  5AHG H;  3T26 A;  1H8H D;  1QRX A;  2IJO B;  1C5N H;  3FWN A;  1VQ7 P;  1BRA A;  1DM4 B;  3BTF E;  2R9P A;  4K1S A;  4H42 U;  4YO9 A;  3CS0 A;  4Q7Y A;  4KT0 J;  1DUA A;  4GUX A;  4GLY A;  2CF8 H;  1NU7 B;  4B1T A;  1R8E A;  1TOM H;  3CNR A;  1NTZ G;  2HOD A;  5AW1 B;  1JMM A;  1AWF H;  7GCH G;  4AYV B;  1YPH E;  1LTB C;  2G8Y A;  3G4S P;  1W7X H;  2STB E;  2ZDV H;  3OX7 U;  1FDO A;  4CHA C;  1AVX A;  2UWJ E;  1GGD C;  4ZHA A;  4Y99 C;  1P2J A;  1BSH A;  2H7H A;  1RH5 B;  3NUM A;  5I46 H;  2C0W A;  1BHX F;  4Q4L A;  3RXS A;  1CBW C;  1Y59 T;  1SQP D;  3U1A A;  2VIP A;  2VVC A;  2BDA A;  1AUJ A;  4ASW A;  1QEX A;  2ZT9 D;  1FUJ A;  1DH3 A;  3M7T A;  3RXP A;  3W67 A;  1UTM A;  1A02 J;  2DE8 A;  1TAW A;  3JSV C;  2HPP H;  2ODY B;  1PPJ E;  1PPE E;  3BCC J;  4NSV A;  4X8S H;  1E79 H;  3L72 J;  2ZU1 A;  1VF5 D;  1PPJ D;  4FXG H;  1PPZ A;  1MTW A;  1IOE A;  2ZPQ A;  2BD5 A;  5GXP A;  1FIW A;  2YXR B;  2D2C D;  4WWY A;  2OYO A;  1O2G H;  3E1I A;  2BXU H;  5L30 H;  2A45 G;  3TK9 A;  1T3J A;  2DUC A;  2K9Y A;  5TCA A;  3KID U;  1BCC J;  2N1T B;  2GZ9 A;  3PO1 B;  3RK3 E;  2H9T H;  2AEJ A;  5KLV D;  1JWT A;  1O3C A;  3EA7 A;  1VL2 A;  2YMK A;  1GBM A;  3VGC C;  2R0L A;  2Q3E A;  1GBI A;  1HV7 A;  1KSN A;  2WSS D;  1GJ5 H;  2XBX A;  1ZP0 C;  1LKA A;  4SGA E;  1BDC A;  3L70 G;  4OH8 B;  3EQ0 H;  4FUB A;  4JYB A;  4ZKS U;  3RL0 g;  2JET C;  3AAS A;  3DD2 H;  1SQV E;  5L2Z H;  2BY5 X;  4H0L B;  3AEE C;  5EW2 H;  2E43 A;  1CSO E;  3OY5 U;  3UY9 A;  3H1K E;  3PRO A;  3GY8 A;  1DIP A;  2V7Q H;  2PV9 B;  5H2F H;  4ZAE A;  4I31 A;  1K1O A;  1TPP A;  2BM2 A;  4MNV A;  2BEQ D;  3FX0 A;  4NCY A;  1C5Z B;  1QA7 A;  4A6L A;  1JY2 N;  2YKQ A;  1IQE A;  1E1R D;  1UVU H;  3C27 B;  3ZZ6 A;  1C2J A;  1OW8 A;  2UUY A;  3CS7 A;  1EP6 A;  1ZSL A;  2ZPR A;  3GHG A;  3VOP A;  4X1Q U;  2O8U A;  2Q9I A;  1U6Q A;  3CC2 P;  2D2C C;  1NES E;  5AW6 B;  2Z7F E;  1LHF H;  3QX5 H;  3WW7 A;  4JF7 A;  5E0G A;  5KLV K;  4IFD K;  5AW4 B;  4O03 A;  3AE7 C;  1J1D B;  3L71 D;  4KEL A;  1IFD A;  2F83 A;  2OQ5 A;  1FNI A;  1X9V A;  3UQO A;  3BV9 B;  5IDK A;  2W26 A;  1X7A C;  4Y10 E;  3PWB A;  1OX1 A;  2BLO A;  1QFK H;  3VYI A;  1V2K T;  2OP9 A;  3F2G A;  3W1E A;  1PP9 G;  1HJ0 A;  1Y8T A;  4W7Y A;  1DWD H;  5C5N A;  5C39 A;  2J5U A;  5CCH D;  1O2Q A;  1CE5 A;  3L74 G;  1Y5B T;  3M0D C;  1Q2N A;  2IBZ I;  1KXA A;  1SMF E;  4X6P A;  4ZHL U;  1FAX A;  4IMQ A;  3V2N A;  4W80 A;  3D49 H;  8EST E;  3I56 P;  3ZZ3 A;  1OP2 A;  3GDU A;  3URC A;  1GGD B;  1ZGV A;  3CX5 E;  3OSY A;  3SFD C;  3SUD A;  2WPS A;  5KJ7 D;  1Z6E A;  3ATI A;  3A82 A;  3R0F A;  5J4Q A;  2EEK A;  2RKL A;  4I8J A;  1NC6 A;  5FPY A;  3RXG A;  2ZYA A;  2OTJ P;  1MV8 A;  2FX6 A;  1BE3 D;  1LMW B;  1O5D H;  2PKS C;  2VU8 E;  1V6D A;  5JBC S;  3MU0 A;  5DP5 A;  4N6J A;  5B6L A;  1VQ4 P;  1ARB A;  1SGF A;  4ABF A;  2QE7 H;  5M1B A;  4U01 A;  3SZE A;  4DCK A;  1AZ8 A;  5K0H A;  1ID5 H;  4ACB A;  1DD3 A;  3AE3 C;  2B88 A;  3Q3Y A;  1Y5U T;  4I33 A;  5AFY H;  1TMT H;  4TYD A;  1HAP H;  1J17 T;  1K9O E;  3W95 A;  2PGD A;  4ABJ A;  3CWB G;  3BTK E;  4FU9 A;  2WPV B;  2W7S A;  2GV6 A;  1KFM A;  5HM2 A;  4Y7B A;  1NFY A;  1F0U A;  2BY7 X;  4LGD E;  3MU4 A;  3HE4 A;  3HD7 C;  3B23 B;  5GTI E;  4R4M A;  1YPE H;  1J15 A;  1GHV H;  2FXM A;  2PSY A;  2QIW A;  2Z3C A;  1N73 A;  1AI8 H;  2XV5 A;  3OW2 O;  3V13 A;  1IJD B;  2AXT E;  1HDT H;  2KZ4 A;  3KF2 A;  1C9P A;  1ZSJ A;  4CRG A;  2WPK S;  3VGC B;  1LTJ B;  4NWL A;  1EDJ A;  1K1N A;  2HNT F;  2P93 A;  3L73 J;  3EDX B;  2P67 A;  2NU3 E;  5DP6 A;  2E74 C;  2KNC A;  3GG2 A;  1SVF A;  1GDQ A;  4R4L A;  1PPC E;  3MNX A;  4FUG A;  5AF9 H;  3EYD A;  3MUD A;  1N7S A;  1G36 A;  1P06 A;  1S9K D;  3H1K D;  3TNU B;  1TGS Z;  4WVZ A;  2Z6B D;  1SHH B;  1SQX G;  4AGK A;  4HG6 A;  3A80 A;  5KJ7 C;  1E38 B;  3N7N A;  1BDA A;  1O3E A;  1TYN A;  1L0N G;  3B8J A;  2M0B A;  4UD9 H;  3S9A A;  3O8R A;  3CXH I;  3L70 E;  3F3B A;  1FJS A;  1YCP M;  2BVR H;  2A4O A;  2ZU4 A;  1GJ6 A;  4A92 A;  3SI3 H;  2UWO A;  1YBW A;  1NBM E;  4HTC H;  3M91 A;  3Q3K A;  1H9H E;  1YF4 A;  1NTK J;  1VQL P;  1FON A;  3P70 B;  1MTN B;  5CCH C;  4UB6 E;  1HXF H;  2ULL A;  1Q90 D;  1TGN A;  3HPT B;  2FOF A;  1EZX C;  3L4F A;  3PLK A;  1RY3 A;  1SQQ K;  1O3H A;  1GTW A;  2QY0 B;  1JMB A;  4FUI A;  4HB1 A;  1O0D H;  4Q2K A;  2A2Q H;  2KR7 A;  3SN8 A;  2R2W U;  2ZDL A;  1GHB G;  1P9S A;  3FO8 D;  6LPR A;  3K2U A;  3AK5 A;  3Q5S A;  2PGQ B;  3ZZA A;  3AE5 C;  2QG4 A;  2PHB A;  1VJ9 U;  3KGP A;  1S6H A;  4Y8Z A;  3QWC H;  1V3X A;  1O34 A;  1NOH A;  4MQA A;  3LIW A;  4AFU A;  4WXV A;  1EJN A;  3PTZ A;  4MN4 C;  4K3A A;  2JR8 A;  2HPQ H;  4M3L A;  4K35 A;  4C7N A;  4ZKU A;  1A02 F;  1RD3 B;  4TY7 A;  3EWK A;  1ETS H;  1NTM G;  1ZRT D;  1DLE A;  2BZA A;  1GW4 A;  2W7U A;  3S9B A;  1AVO A;  1SQT A;  1HLT H;  2XZR A;  1O2R A;  1H4W A;  4H44 B;  1CA0 C;  4KHX A;  3U8R H;  1L4Z A;  1NPM A;  2ZO3 H;  1G9I E;  4ZXY H;  2FXP A;  2W5E A;  4J2Y B;  1QRZ A;  5C67 A;  1GBC A;  3RL0 C;  1A3E H;  1QBV H;  2B7D H;  2EI6 A;  2QGR A;  1SQQ D;  2QE7 D;  3AAU A;  2BD3 A;  2ZGH A;  1SQQ E;  1DWC H;  1V2L T;  4IL6 E;  2LKM A;  3SGA E;  1G1J A;  1UTQ A;  1L4A B;  1QL2 A;  2XCF A;  3SQE E;  2SFA A;  4Y8Y A;  1ZLL A;  2Q1J A;  1C1M A;  1P9U A;  1PZQ A;  2CGA A;  4BOH A;  5B6O A;  1UTO A;  2V7Q D;  1Z8G A;  1IQM A;  3LU9 B;  2E75 B;  3A8C A;  1EDK A;  1RTL A;  2RDL A;  1SOZ A;  1O31 A;  1S4X A;  4LXB H;  5AVR B;  2FFD A;  5FL7 D;  1S5L H;  4EDF A;  1Z71 A;  4PD4 D;  5DG6 A;  3A7Y A;  3B5N B;  2FO9 A;  3QUM P;  1FX0 B;  3HD7 B;  1UHB A;  1VQ9 P;  1G3E A;  2K9J B;  5GJ4 B;  2K88 A;  1ANC A;  4XBB A;  1PL5 A;  3L71 E;  4ISH H;  3E16 B;  3PMA B;  1FY8 E;  1SQA A;  1F5L A;  1FDP A;  2NU4 E;  2QYI A;  2FYU K;  1ZGI A;  1KIL B;  3AEA C;  2I8D A;  4UB6 H;  3BTM E;  2W6J H;  2ZT9 C;  1ABJ H;  2VWN A;  2KS1 B;  3HKJ B;  4RJT A;  1KLJ H;  2FIR H;  3RK2 C;  3TIU A;  3PYH A;  2FY8 A;  1VQP P;  4Q63 A;  4K1T A;  2O01 N;  1DAN H;  5KAF E;  3O6Q B;  2BOH B;  4MNY A;  3AE1 C;  4BXL A;  4K8B A;  2B5T B;  3KYG A;  4OWF A;  1OWA A;  1M1J C;  3LKW A;  3QZR A;  1BBR K;  1L0L J;  1MH0 A;  4UFD H;  5A8Z A;  2QEX P;  4JZ1 A;  2RCE A;  1S82 A;  1FIZ A;  3PRD A;  1C5W B;  4I8K A;  3WUV A;  3NKK A;  1GHY H;  2PWX A;  4CRB A;  1IQI A;  1SQX E;  1SGY E;  2QC2 A;  1TA6 A;  4NPE A;  1TPO A;  1LO6 A;  1O37 A;  3L75 D;  1SQB G;  1C5V A;  4Q80 A;  3H5C B;  1P57 B;  3MTU E;  2A4G A;  2RA0 A;  1KYO E;  3RXR A;  2HVX A;  1DOJ A;  2ZZU H;  2TBS A;  3TJU A;  2A7C A;  4DII H;  2J59 M;  3CME P;  4YT6 H;  2A4R A;  1T8N A;  3CI9 A;  2NU1 E;  1OP8 A;  3A8D A;  3F2F A;  2EA3 A;  3QTO H;  3D65 E;  2Y0D A;  1QIX B;  4E7R G;  4NPD A;  2ZCL P;  1P09 A;  1P04 A;  2XND H;  1HF9 A;  4TT3 D;  2SGE E;  3M61 U;  1FZC C;  4A7I B;  2OUA A;  3TLO A;  2BQ7 B;  1GBF A;  2FLR H;  5A09 A;  1VR1 H;  1E34 B;  3L72 G;  1JY3 N;  1RGQ A;  2J94 A;  7GCH F;  1D3D B;  4X8V H;  1KQG B;  1BBR H;  1QJ7 B;  4I8L A;  1GI4 A;  2OLG A;  3IG6 B;  1NFU A;  3HTK A;  2ANM H;  1S5L E;  5A0B A;  3GOV B;  1AY6 H;  4ABE A;  2H5D A;  1C1U H;  1GI5 A;  2V3O H;  3GCT G;  4K1E A;  4WVP E;  3RM2 H;  2FM2 A;  4O97 A;  1RHZ B;  3I78 A;  2WWW A;  3SOR A;  1H8D H;  3PJS K;  2Z9G A;  3U69 H;  2FYN B;  3H1J G;  1BML A;  1QZ8 A;  4UFG H;  1GJB B;  3NWU A;  1ZW0 A;  2UUJ B;  1XUG A;  1YIJ P;  1H1B A;  1CT2 E;  1A2C H;  5DP9 A;  1LT1 A;  3JZ2 B;  2QCY A;  1F0R A;  3ZVB A;  1NJI Q;  4DT7 B;  1UK4 A;  1SLX B;  4DIH H;  1TGC A;  2ZEB A;  4CR5 A;  5AVZ B;  3DA9 B;  2FX4 A;  2KLV A;  2JEE A;  2TGD A;  3HTK B;  3SUE A;  4UFE H;  2PFE A;  2XOK D;  3U28 C;  3PP5 A;  3HK3 B;  1O2H A;  1O2Z A;  1UK3 A;  3E3T A;  2ZF0 H;  3W94 A;  4K2Y A;  4WY3 A;  1FZC A;  3L71 J;  2FXO A;  1YM0 A;  4WJG 2;  5EGM A;  1GHB F;  1BTP A;  1AWH B;  1WQV H;  4GSO A;  1AE5 A;  1FPH H;  1JBU H;  1BJU A;  1O3N A;  3LGW A;  3KYQ A;  1AFQ C;  5TJH A;  3L73 E;  1TX6 A;  1C5T A;  2M3E A;  4W7Z A;  2GCT B;  2TPI Z;  1UVT H;  3T5F H;  3AEF C;  3MNB A;  2D26 C;  3B4S A;  3CXH E;  3PRJ A;  3A7O A;  3BTD E;  4OS4 A;  3V3M A;  3VB5 A;  1V2M T;  3ZVD A;  2W6B A;  3CCM P;  2JO1 A;  4CRE A;  2CF9 H;  3I5C A;  1KDQ B;  2ZQ2 A;  1PPB H;  1D3P B;  4DT0 A;  1PIX A;  3GCH B;  3UQV A;  1M1J B;  3F5H A;  1A46 H;  1XVM A;  1ZYO A;  3M7U A;  1ELC A;  1M8O B;  3PHL A;  1SQQ J;  1DST A;  4NIV A;  3ELA H;  1W3C A;  5EQQ A;  2VRS A;  1Z8R A;  1O2X A;  4X1R U;  1M56 D;  4YM9 A;  4I1L A;  1CGH A;  2XND D;  2D2D A;  1BTX A;  1EAI A;  1RF1 B;  1CW5 A;  1NZQ H;  1JUN A;  1YKT A;  1IQL A;  1DLK B;  2BDB A;  3NTN A;  3WU2 E;  1HGV A;  1C1O A;  2FOH A;  3BTT E;  4ISN A;  1IQK A;  4TY6 A;  3H1H G;  2JJL A;  1FZG A;  1DE7 H;  1KFN A;  1CVW H;  2OC8 A;  1O35 A;  2R5D A;  1S84 A;  5CCG C;  3Q00 A;  3A7V A;  2OK5 A;  3S69 A;  2K8I A;  2ZFP H;  2BVS H;  5EQR A;  1NAF A;  1F5R A;  2ZPS A;  1D9I A;  5FBE A;  3MIW A;  1D4P B;  1QRW A;  2WIN I;  3TPI Z;  4CBO A;  1K1M A;  1AN1 E;  1M90 Q;  2IYO A;  2KOG A;  3L6P A;  2Y5G A;  2OC0 A;  2O1J A;  3N7D A;  1HXE H;  1M7L A;  3GMA A;  1SLV B;  1V2U T;  1OOK B;  2XC5 A;  2F9V A;  2VGC B;  1GVZ A;  3TK5 A;  3D6Z A;  1UHB B;  2FOB A;  1FOS F;  1MKW H;  1ZHR A;  3UTU H;  5A8Y A;  1MU6 B;  1KXC A;  3GDV A;  1L2E A;  3RC5 A;  5A0C A;  2QM8 A;  1ZLR A;  1EJM A;  2ZHW H;  1OWH A;  3VMZ A;  5T6G A;  1GMD G;  1EXJ A;  5GPI B;  2HVY B;  1KD1 Q;  2FFD C;  3RL0 D;  3E90 B;  3D6Y A;  2PLX A;  3ODD A;  4FOU C;  3T27 A;  1NTK E;  3UNS A;  4D76 A;  3ATK A;  2ZDA H;  2KCO A;  2R3C A;  2CXV A;  3MZW B;  2OC7 A;  4M7G A;  5KKZ B;  1GWA A;  1TRN A;  2KCA A;  4RI0 A;  1TU3 F;  1ABI H;  1S6F A;  3ZZD A;  1EQ7 A;  3BTH E;  2OC1 A;  5AVT B;  3MU8 A;  1LTA C;  2IBZ E;  2Y81 A;  1URQ B;  1FY5 A;  3Q76 A;  3VXE H;  2BD7 A;  4BAH B;  1FZE A;  1PYT D;  3ZVC A;  1WXR A;  3ZDM A;  1RQU A;  3II6 A;  3A84 A;  4INH A;  1YJ9 P;  3FP6 E;  4D8N A;  3L74 D;  5APY A;  3CCS P;  1K73 Q;  3L74 E;  3F1S B;  2RN0 A;  4ZMA H;  1W0K D;  2C8X B;  4ISO A;  4J1Y A;  1SQO A;  3GF7 A;  1HIA A;  1GBB A;  2VIO A;  3H32 A;  3GLM A;  1LTO A;  1OKX A;  1OYT H;  3BF6 H;  3ITK A;  4X1N U;  1OWE A;  4DCD A;  4ABH A;  1QHR B;  4LLH A;  2QJK B;  1VZQ H;  1AFO A;  2FTL E;  1ZN5 A;  1S83 A;  2ZFQ H;  1GG6 B;  1MZ9 A;  5C1U A;  3LC5 A;  4ZH8 A;  1LQD B;  1EZU C;  2NPS D;  2TGA A;  4XE5 B;  3A88 A;  3F68 H;  1O39 A;  3PV5 A;  4Y28 J;  1JMO H;  1NTK G;  3MI4 A;  3NCL A;  3PO1 C;  3DUX H;  1JY3 P;  1L0L K;  4CPG A;  2WYG A;  2QIQ A;  4H6S B;  5GTH E;  5BVZ A;  3JCU H;  1TRY A;  4B74 A;  1Q81 Q;  1JXP A;  3H09 A;  1GBK A;  4XOJ A;  2A45 H;  2HNT C;  2WPD D;  5AW0 B;  1NO9 H;  2WQY C;  3CWB E;  2OYI B;  3KNX A;  1IFP A;  4VGC C;  5EXN A;  1SQV D;  1C5P A;  5ABW A;  1H0T B;  3WU2 H;  1GL1 A;  2FI4 E;  3OA7 A;  1L1G A;  1YPM H;  3SWK A;  2PKS B;  2W6I D;  1HAV A;  5DP4 A;  2QJY C;  1L2P A;  1MUE B;  1UJ1 A;  2G4U A;  1XUH A;  4BAM B;  1WDI A;  2K3R A;  1H0T A;  2A4Q A;  4ISL A;  4EOT A;  3M9H A;  1JY2 P;  3ZVA A;  5L2Y H;  1SOT A;  2HYN A;  3A0B H;  1ELA A;  2SGD E;  4BTT B;  3F0P A;  4JPZ B;  3IWM A;  1V2S T;  2YO2 A;  1NTZ E;  3ENS B;  4WH8 A;  4H13 B;  1TQ7 B;  3A3Y B;  1L0Z A;  2BLV A;  4YOJ A;  2P1J A;  1SFC B;  4X2W A;  4YES B;  5CBO A;  5KLI C;  3H1I G;  1IAU A;  2ZHE H;  1N73 B;  1O3A A;  2FBW C;  1O3G A;  1GMH F;  1GJC B;  2OBO A;  3M3S A;  1SGI B;  4IGD A;  4ZCN A;  1ELT A;  2BX3 A;  3H7T A;  3MO3 A;  1QL8 A;  1UTJ A;  3RXU A;  1GCD A;  1SG8 B;  3DSP A;  1QB6 A;  1Y9B A;  2WSC H;  3O6Q A;  1QL7 A;  5F8T A;  1CU1 A;  1P0S H;  1DD4 A;  3ZVE A;  4YXW H;  9EST A;  1M57 D;  1GCT B;  2E76 D;  1P84 E;  3E1R A;  1AMH A;  1TNG A;  3RC6 A;  4YTA A;  1GI3 A;  5DGJ A;  3M3V A;  2GT8 A;  1JY3 O;  2R3S A;  1ZPC A;  4B2B A;  3H1L D;  4TWW A;  2GCH G;  1KYO H;  3SFE C;  3ZZ4 A;  2C0X A;  2CJI A;  1HB0 B;  3TVJ B;  3P6Z B;  3LGI A;  3L75 G;  2C9N Y;  1TMU H;  2E75 D;  4M9F A;  1S5L X;  4AX9 H;  1L4A D;  1YJW P;  2FS8 A;  1O5F H;  3PTN A;  1S0Q A;  3H1K G;  3PMH B;  2CK3 H;  3TGU E;  1KXE A;  1PGJ A;  2AXT H;  2YO3 A;  5AVD A;  4AG2 A;  3O8C A;  3RXQ A;  2ZFF H;  3IN6 A;  1K21 H;  1Z56 A;  1E35 B;  5BU8 B;  1TE0 A;  4E05 H;  2WSE J;  4P00 A;  2B9B A;  5BU5 A;  4ASH A;  2AER H;  1SL3 A;  3ZV9 A;  1QL9 A;  2ZGJ A;  4INK A;  3LIE A;  1L0N J;  1BCC D;  3KHV A;  3QTV H;  4RKU J;  1SGN E;  1AZZ A;  1TBZ H;  1ESA A;  2WMM A;  4NA9 H;  1GL0 E;  1LPZ B;  2A1D B;  1OVU A;  4FVB A;  1CI6 B;  1J14 A;  3RK3 D;  3SU4 A;  1DEB A;  2VIV A;  3M37 A;  1P12 E;  1TA2 A;  5CHB A;  1ELG A;  1PFX C;  1HAZ B;  1VCQ A;  2RA3 A;  1LTJ C;  1UII A;  4K5Z A;  3M7Q A;  1N7L A;  2LPR A;  1EUF A;  3NXP A;  3RXI A;  1TBQ H;  4F49 A;  2EI7 A;  2M5A A;  2UWP A;  5BPE A;  1KOR A;  1L0L G;  3GCN A;  3RXJ A;  4C7N B;  1BGY G;  1ELE E;  1MKW K;  1KYN A;  1HVV A;  1S9K E;  1YTZ T;  3A7W A;  2P8O B;  3RXL A;  5FBI A;  3MO9 A;  2O9Q A;  5LGO A;  5LPR A;  1EZQ A;  2WPI S;  1T31 A;  1AQ5 A;  1L4A C;  1N7S C;  1C2E A;  1Z8J B;  4TT3 H;  1GJ7 B;  2IPQ X;  4BAN B;  4AFQ A;  4AZ2 B;  1P02 A;  2O3J A;  1KQL A;  1V2O T;  2Y0E A;  1DSU A;  1ZHP A;  4D7F A;  5HGG A;  1HWT C;  3SBK A;  1MTN C;  1JIM A;  3TU7 H;  1C5L H;  4X6O A;  1W2B O;  1H88 A;  1O32 A;  3VMY A;  5AVU B;  4NGA H;  1L1J A;  2DE9 A;  3RU4 T;  1PP9 D;  1VF5 B;  5AVV B;  1AQT A;  4D6T G;  1NT1 A;  1DS2 E;  2AS9 A;  2IJD 1;  1K9M Q;  3GYL B;  3VB4 A;  2WPJ S;  1CI6 A;  3CMA P;  1M1J A;  3LW5 H;  1D3T B;  3KL6 A;  4DY7 B;  2Z5I A;  1MZA A;  1J1D C;  5CCH A;  1MKM A;  2Y7X A;  2Z9I A;  3TDK A;  2J92 A;  3PTB A;  7EST E;  1G2C B;  2GMT B;  4PV1 B;  3VP8 A;  3STJ A;  1TWX B;  3MU1 A;  2ZDM A;  4IL6 H;  2Z9J A;  3QGJ A;  2CPS A;  5DPA A;  1OYQ A;  1SQV J;  1G3C A;  1HUT H;  4YOG A;  1LQE A;  1W5C E;  1NTP A;  5DSF A;  1FZA A;  2AEM A;  2J98 A;  1QGK B;  3K65 B;  1AHT H;  1EOL A;  2QSI A;  2NPS B;  2ZFR H;  1EZS C;  3PMJ A;  4BAO B;  2WYJ A;  1G32 B;  3LH1 A;  2M3B A;  2SGP E;  2FYR A;  2WHX A;  3ZZ5 A;  1CT0 E;  5APX A;  4K3J A;  4OS1 A;  2PFX A;  5E8E H;  1EB1 H;  1ZTK A;  2WPL S;  1LGH B;  1MZD A;  2QXH A;  3CCQ P;  3OYP A;  1FU1 A;  1ZRB A;  4PRO A;  3RL0 B;  1R5S A;  3A2A A;  4L73 A;  1XMN B;  1IFN A;  3RBX A;  5B66 E;  1NTM J;  1K1P A;  3F0O A;  1O5C B;  1L0N E;  4L76 A;  3S9O A;  3R3G B;  1A1R A;  5IK2 D;  2W27 A;  3BEF B;  2TIO A;  1ELV A;  2A2X H;  3P32 A;  3QO6 A;  2WUC A;  1NU1 K;  1KC8 Q;  1GI9 B;  1Z8I B;  4N78 D;  2H8P D;  3A8A A;  3N7O A;  3TGU G;  1YWU A;  2KZJ A;  1C4V 2;  5AW9 B;  1EAU A;  1C9T A;  2BOK A;  1TNH A;  1GVK B;  1JCC A;  2QAA A;  1S0R A;  3OU0 A;  1THR H;  1NFX A;  1VCW A;  3TGJ E;  1KMI Z;  3DSO A;  2AHM E;  2XWA A;  4XE4 A;  1DWE H;  3M5O A;  3WUT A;  3VXF H;  2JJ2 D;  2FMJ A;  3MH5 A;  2A06 D;  1OWJ A;  4AFZ A;  1UIX A;  3CL3 D;  3A7X A;  3V12 A;  1T8Z A;  1BMA A;  5L6N H;  4X1P U;  2SNW A;  5L8R J;  3RLW H;  3UNR A;  3BVH A;  3N99 A;  3FXD A;  3O8D A;  6CHA C;  1EDI A;  1C1Q A;  1BSN A;  4WB4 A;  1O38 A;  3UAI C;  1NTK D;  3O8Z A;  1QR3 E;  1W0Z U;  2UWL A;  5EST E;  5LH8 A;  2R44 A;  2WVR A;  4B75 A;  2XBW A;  1GW3 A;  1N6X A;  5AVS B;  1O2T A;  2OIN A;  3D71 A;  2GP9 B;  4TPY A;  1YCP H;  1GMC G;  3CXH D;  3BTW E;  2FOA A;  3H1L E;  1OZH A;  1IHT H;  4YPC A;  3S1K A;  3VP9 A;  4WF8 A;  1BDD A;  1BT7 A;  2C8Y B;  3V2Q A;  1Y5A T;  3BEU A;  1A7S A;  1FDI A;  3F9E A;  4ABB A;  4IFM A;  1X79 B;  3FKS D;  5GND A;  1SQV G;  2ZTY A;  1NRR H;  2L91 A;  3NMD A;  2SGQ E;  2R3U A;  1SPJ A;  3V4W A;  2ZHF H;  3GYM A;  4AB9 A;  2BEZ F;  3SNA A;  5DN6 D;  4X2Y A;  1YI2 P;  2VB0 A;  1W12 U;  2XBY A;  4BNR A;  1USE A;  1AU8 A;  2B0F A;  1FZF A;  1W8B H;  2BY6 X;  4IBL H;  2OXS A;  4OGQ B;  1NU1 G;  3G3Z A;  1PV3 A;  5LPE A;  4YLQ H;  4ABD A;  3GY7 A;  2GUV A;  1RF0 C;  3NK8 A;  3DCL A;  3P8G A;  4MPV A;  3LGU A;  1KB9 I;  1S1C X;  1GPZ A;  3SJO A;  3A7Z A;  2HNT E;  2FOE A;  2ZHD A;  1K8A Q;  2C9L Y;  1BRU P;  2WSE H;  5EOD A;  1KIG H;  2OTV A;  3OAK A;  1OIP A;  1EXI A;  2H6M A;  4JZI A;  4WWI A;  1RF1 A;  2WSC J;  1NRN H;  2V6N A;  3H7O A;  3WWB A;  1TAB E;  2NPS C;  3I77 A;  5DJT B;  1J9C H;  2RFK C;  1GI0 A;  2QF4 A;  3ZYD A;  1U7J A;  3PM3 A;  3G6E P;  3JC2 2;  5AVW B;  2C4F H;  5CCG D;  5LPF A;  2K9J A;  3GCH C;  3UPE A;  1IZN B;  2IN2 A;  2YNA A;  2VID A;  2JET B;  1QVF O;  3P8M C;  1ZZZ A;  4DVA U;  3A89 A;  2QV1 A;  1P3C A;  4EYY Q;  1O5E H;  2PUX B;  3Q1M A;  2FYN C;  2IYP A;  3TGI E;  3VMA A;  3MHW U;  3QLP H;  1XKA C;  3SO3 A;  3MUD C;  3EFG A;  1SGC A;  1PGP A;  1AVG H;  1SQP K;  1XTG B;  1UCY H;  1YLD A;  1QQ4 A;  3WWF A;  2A06 G;  4GOE A;  1EJA A;  4IMZ A;  1PP9 J;  4O9B A;  3RK3 B;  2BLQ A;  3P8C D;  2H9E H;  3GY2 A;  3OAA D;  4BXS A;  5JB8 S;  3CX5 H;  2XXL A;  2HFE D;  2SPZ A;  1SQB K;  2OTK E;  5CMZ A;  1MTU A;  2VBC A;  1AIX H;  2ZTZ A;  4I32 A;  4R8T B;  4DT4 A;  3A7T A;  5GWZ A;  2XKM A;  2JDI H;  4IN1 A;  1CQQ A;  3RXC A;  2AH4 X;  5DKM A;  4H0L D;  3KQB A;  3EA8 A;  2KAI A;  3TF5 A;  3GY5 A;  1W2K H;  5JDU B;  2AYW A;  2B87 B;  3B5N C;  1HJA C;  1PFI A; 
#chains in the Genus database with same CATH homology
 1DY8 A;  2GGV B;  3NRL A;  4B73 A;  4FET A;  5F53 A;  3AEF C;  3FGA D;  4H44 D;  1OW7 A;  5FPT A;  2OBQ A;  2JO1 A;  2YMS B;  1PIX A;  2E76 B;  3LOX A;  1W3C A;  1W0J D;  5EQQ A;  3AE2 C;  3SU1 A;  2XND D;  4WH6 A;  2W6J D;  5EQS A;  2OC8 A;  1N1L A;  2OK5 A;  2K8I A;  5EQR A;  4Z1M H;  3ZIA D;  4B76 A;  3L6P A;  2OC0 A;  3N7D A;  3GMA A;  3F2H A;  2F9V A;  3D6Z A;  3ABV C;  3RC4 A;  2XNI A;  3RC5 A;  2WSF J;  5C0T A;  1H8H D;  2IJO B;  3KN2 A;  1EXJ A;  5GPI B;  3SU5 A;  2E74 D;  3E90 B;  3D6Y A;  5KKZ C;  4KT0 J;  2KCO A;  1R8E A;  2ZT9 B;  2OC7 A;  2KCA A;  4RI0 A;  1TU3 F;  2OC1 A;  2G8Y A;  1FDO A;  2KFW A;  2WZQ A;  1WXR A;  1RQU A;  4I7Z B;  3OEH D;  5HKK D;  1NS3 A;  4Q4L A;  2D2C B;  1OMI A;  1W0K D;  2V7Q J;  2ZT9 D;  3GF7 A;  1RQV A;  1YQ3 C;  3GLM A;  2FP7 B;  4IL6 X;  4OGQ C;  1VF5 D;  2KCY A;  3AE6 C;  2D2C D;  3M5N A;  1S6L A;  1K04 A;  4YXD C;  2MKV A;  3PV5 A;  4Y28 J;  2K9Y A;  2O8M A;  3RK3 E;  2K1Q A;  2LEL A;  2YMS C;  4B74 A;  2JDI D;  1JXP A;  1VL2 A;  2YMK A;  3H09 A;  2WPD D;  2WSS D;  1ZP0 C;  2WQY C;  2F9U A;  2QJP C;  1KIL E;  4XD7 D;  3KNX A;  1E1Q D;  3RL0 g;  4H0L B;  3AEE C;  2W6I D;  2QJY C;  3B71 A;  4H0L C;  1BMF D;  1DIP A;  3OFN D;  1MAB B;  4I31 A;  2BEQ D;  3OTP A;  2A4Q A;  1E1R D;  4OM9 A;  1OW8 A;  4A1T A;  3F0P A;  1KMH B;  3M5M A;  4H13 B;  2D2C C;  3WW7 A;  1NYH A;  3GS9 A;  1ZME C;  5KLI C;  2FBW C;  3AE7 C;  2OBO A;  3SU3 A;  1OHH D;  4ZCN A;  3AEC C;  2KCP A;  3KEE A;  2H89 C;  5IDK A;  3F2G A;  4PV1 D;  3DSP A;  3SUG A;  3W1E A;  1Y9B A;  3O6Q A;  1CU1 A;  1HJ0 A;  1DD4 A;  3Q5R A;  2E76 D;  2J5U A;  3RC6 A;  2GVF A;  3GF3 A;  1GMJ A;  3G9R A;  3SFE C;  2WV9 A;  1K05 A;  2E75 D;  4M9F A;  2NZ2 A;  4B71 A;  4F55 A;  1S5L X;  3SFD C;  3SUD A;  3FOA A;  2E76 C;  5FPY A;  3O8C A;  3AED C;  1VF5 C;  3IN6 A;  2WSE J;  5B6L A;  5H4I B;  1H8E D;  5M1B A;  4U01 A;  3SZE A;  4TSF D;  2QJK C;  1DD3 A;  3AE3 C;  1DY9 A;  4I33 A;  4RKU J;  4TYD A;  5T1V A;  2K0Q A;  2WPV B;  4H13 C;  1ZOY C;  2H88 C;  4YTP C;  3Q5P A;  1EFR D;  3SU4 A;  1COW D;  4R4M A;  5CHB A;  2QIW A;  3Q2Y A;  1WMK A;  2KZ4 A;  3KF2 A;  4NWL A;  1KOR A;  2E74 C;  4R4L A;  3EYD A;  2E74 B;  2G3A A;  3FN8 A;  5FPS A;  4ASU D;  3N7E A;  4TT3 H;  4B6F A;  1SKY E;  3O8R A;  3F3B A;  5ESB A;  3SV6 A;  3AE9 C;  4A92 A;  1NBM E;  1NGM B;  1NBM D;  1VF5 B;  3R4Y A;  1Q90 D;  2CK3 D;  4I7Z C;  3AEG C;  2IJD 1;  4OGQ D;  3PRB A;  1MKM A;  2KR7 A;  5EPN A;  4PV1 B;  3C8V A;  3FO8 D;  3AK5 A;  3Q5S A;  3AE5 C;  3SV9 A;  5DSF A;  3T97 B;  3Q3D A;  2QSI A;  1JB0 J;  2JJ2 D;  4H13 D;  3LON A;  2WHX A;  3EWK A;  3U1J B;  3UB0 A;  2L6O A;  1ZRT E;  3AE4 C;  3SUF A;  4H44 B;  3OYP A;  1DXP A;  3AE8 C;  2FXP A;  2YIU C;  4GDO A;  2QE7 D;  3F0O A;  2P59 A;  3S9O A;  5IK2 D;  1A1R A;  3P8N A;  3PV2 A;  5ETX A;  2F43 B;  2XCF A;  4A1V A;  3LW5 J;  2V7Q D;  2E75 B;  3SU6 A;  1RTL A;  1IK7 A;  2XCN A;  5FL7 D;  1DXW A;  2YOL A;  3SYJ A;  1KMI Z;  3DSO A;  2AHM E;  2P10 A;  3AEB C;  3M5O A;  5CDF E;  1FX0 B;  1UIX A;  2JIZ D;  5GJ4 B;  5L8R J;  2M2A A;  3N99 A;  3O8D A;  1PL5 A;  3OE7 D;  4PV1 C;  4YXW D;  3SU2 A;  3AEA C;  4KTC A;  2ZT9 C;  2HLD D;  3P8O A;  4B75 A;  2OIN A;  4Q63 A;  3D71 A;  1KQF B;  3M5L A;  3AE1 C;  4K8B A;  4WF8 A;  1BT7 A;  3SV8 A;  4NWK A;  1FDI A;  1AJY A;  5GND A;  3FKS D;  3O8B A;  3LKW A;  3IAO A;  4H44 C;  3PRD A;  5DN6 D;  2BEZ F;  3SU0 A;  4A1X A;  2A4G A;  4OGQ B;  3OEE D;  2FOM B;  1PV3 A;  3H25 A;  2KM0 A;  2O01 J;  3DCL A;  2A4R A;  1S1C X;  3F2F A;  2YMS D;  2E75 C;  2JJ1 D;  4U7J A;  1HF9 A;  4TT3 D;  1EXI A;  3WWB A;  2WSC J;  1YQ4 C;  2QF4 A;  1E79 D;  1RGQ A;  1KQG B;  2IDB A;  2QV1 A;  1OW6 A;  2FM2 A;  3Q1M A;  2FYN C;  4Z1M D;  3D70 A;  2QF5 A;  1U57 A;  3WWF A;  5C0U A;  4B6E A;  4JMY A;  1KTM A;  4XFJ A;  2OQQ A;  3VG8 A;  3OAA D;  2JP3 A;  4R8T B;  2VBC A;  4I32 A;  4DT4 A;  5EPY A;  3SUE A;  5C17 A;  2F4L A;  2XOK D;  4H0L D;  3SV7 A;  4WH8 A;  3U1I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...