2J5UA

Mrec lysteria monocytogenes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
210
structure length
210
Chain Sequence
TENQHLKERLEELAQLESEVADLKKENKDLKESLDITDSIRDYDPLNASVISRNPTNWNDQVEIDKGSSDGVKPDMAVTTPSGLIGKVTTTGAKSATVELLTSSDVKNRVSAKVQGKENAFGIINGYDSDTKLLELKQLPYDMKFKKGQKVVTSGLGGKFPAGIFIGTIEKVETDKMGLSQTAFIKPGADMYDLNHVTVLKRSAEAGTTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MREC PROTEIN
publication title Dimeric Structure of the Cell Shape Protein Mrec and its Functional Implications.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell shape regulation
total genus 47
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04085 MreC rod shape-determining protein MreC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2j5uA01
2.40.10.340 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2j5uA02
2.40.10.350 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2j5uA03
3Q5SA 1DIPA 3D71A 3Q1MA 3D70A 3Q5PA 3Q2YA 2QF5A 3IAOA 3Q5RA 2QF4A 4R4LA 3G9RA 3T97B 3D6ZA 1R8EA 3Q3DA 2OQQA 2J5UA 3D6YA 1EXIA 4R4MA 1EXJA
chains in the Genus database with same CATH superfamily
3S9CA 3FXDA 3F9FA 2KK7A 2YO2A 1EZSC 1IHTH 1S6HA 2I1KA 3F9GA 3LJOA 1ZOMA 1AVGH 4HJGH 2FS8A 5DKMA 1O2TA 2GM4A 1C2LA 1NBMD 2F9OA 5T6GA 3O8CA 2V4HA 5JBAS 1HGVA 4MG3A 3PTNA 5LPEA 1SKYE 4Y0ZE 1DUEA 2BXUH 1GI1A 1O3JA 1RF1A 5FCRA 1K1OA 1ELGA 2WSSD 1NU7B 3VB6A 2G81E 2RN0A 2CJIA 1PP9J 3B5NB 2FLRH 2VBCA 2V3MA 3TGIE 2SPZA 1ARBA 3CC2P 1HXFH 1OWEA 1ZSLA 2PSXA 2W6BA 5AVRB 3L3TA 1OVRA 2OBOA 1P10A 1RTFB 4DJZB 5KAIE 1SQBE 2DE8A 1CBWB 2ZFFH 1A3BH 2ZVNB 4XBDA 3WU2H 1ZHRA 2O01H 1P05A 2ANWA 3H1JE 5KEDA 3M3TA 1O31A 1VKYA 1QURH 3KHUA 2OYHA 2ZFQH 2PKSB 5C0UA 8LPRA 2HODA 1FPHH 1GJ7B 3HTKB 1RF1C 4JF7A 1DPOA 1P01A 1IK7A 2G3AA 1PJPA 9ESTA 3LGVA 3QX5H 5K7RA 3RXJA 1ZPZA 4K69A 5B6OA 1FS0E 5AVXB 1M56D 1C2JA 3BF6H 1HVVA 4FUGA 1BGYJ 1YYY1 2XCNA 3AAVA 4LZ4B 1LT9C 3RXSA 3KF2A 3ZDMA 2M2AA 2OTLP 1C2DA 2P2UA 1SL3A 1Y47A 3P7KA 3H25A 3M06A 1ZRTE 4U30A 2Z9LA 2WZQA 3F0OA 4H0LC 1FNIA 1SQQG 1DOJA 1DX5M 5EPYA 2OINA 2BCCG 3FZDA 3L36A 4D7GA 4BTIB 1ANCA 1VQMP 5EQRA 3RUOA 1Y9BA 2QM8A 5AW2B 1KILE 1A5IA 3OFND 3M7TA 2EEKA 4EIJA 1ANEA 3RU4D 1N86A 3TLOA 1CHGA 2VVCA 3PLPA 1LT1A 3BSQA 2Z5HA 5EFWB 4ABEA 3CXHD 3SNBA 3V13A 5AVQB 4ABIA 2BEZF 5FPYA 3L75E 1AVXA 1PV3A 3CCJP 1HAGE 3BCCD 1LDTT 1XUJA 2ZT9D 5CMZA 7GCHF 2WSSH 3SU0A 1Z7KA 4DIHH 2UWLA 1EP6A 4M9FA 3SO3A 2BY7X 1GBTA 1S85A 2GV6A 5A0CA 1YPHE 3UY9A 4ISOA 4UFGH 1JY3N 2KS1A 3E0NB 1H0TA 1ZR2A 5C5NA 2P1JA 5GCHF 1NU1G 3TPIZ 4HTCH 1J2JB 3FOAA 5T3HA 5TCCA 4ZKPA 1C1OA 1Y8TA 1F0SA 2BDCA 3B5NA 2PKAB 3LT3A 7LPRA 1GG6C 1THRH 3UUZA 2IPPA 4DT7B 2NU4E 1BTXA 1MCTA 2J4IA 1IHSH 1T8OA 4A7IB 1QL1A 2GDDA 4FVDA 3P17H 1IC2A 1IFDA 1OSSA 2YKQA 1Y3YA 3S4RA 1P2MA 3GYLB 1AE8H 1MTSA 3IN6A 1GGDC 3Q00A 2Y5HA 2D8WA 1EC5A 1QLED 3V6IA 3U1CA 1FZCA 2ZIQH 5AVDA 5TJXA 1ZR4A 5I25A 3FZZA 1C5ZB 1B5GH 1NFUA 2IJOB 1T6AA 1L0LE 4KHXA 3A7WA 3LGIA 2OYIA 1G3EA 3HTKA 5AVUB 1K9MQ 1C5NH 3GOVB 1EAXA 5L2ZH 2WSFJ 1G32B 1AI8H 1V2ST 3STJA 3UWIA 1DWBH 3WWBA 5ABWA 2ZT9B 3L74E 1FJSA 5HM2A 1OW8A 3B5NC 1BCCE 2WT7A 2R2WU 1SOZA 3MI4A 4WVPE 5A2MH 1MH0A 4C7RA 1SR5C 2GT7A 4D8NA 1EJAA 1S82A 3ATIA 6CHAB 4NIWA 2ZECA 1LTAC 5J4QA 2VINA 2R2MB 2OD3B 1EAIA 2IJD1 1KYNA 1CBWC 2FM2A 1UJ1A 2VIPA 3PV5A 2QE7H 3CENA 1YLCA 3V4WA 1OMIA 2BASA 2GD4B 2J2UA 1NKNA 3D62A 3UNRA 1C1SA 1M90Q 4Q4LA 4GOEA 2TGTA 2VIWA 2TPIZ 4H4FA 3CXHH 1EZQA 1TRMA 2H9EH 5CJ0A 4NA9H 3RXQA 5DP5A 2PKSC 1HV7A 2QN5T 4H42U 3F2FA 1PGJA 4UFDH 1BT7A 4MNXA 3GY5A 2WSCH 1P9UA 1GBBA 3I56P 4PD4D 3BTKE 3SU1A 2QV1A 1NTMJ 3EA8A 5APWA 1W11U 1YPEH 5HMAA 1XKBC 3M9QA 1PPJE 2JR8A 3HE5A 4XFJA 1GMJA 1PPBH 2WPHS 5K0HA 3A89A 2BDHA 3I55P 1AFQC 1E0FD 1Y5BT 3LC5A 3P95A 3VB5A 1FDMA 2MJZA 3IAOA 3V12A 1TRNA 2JJ1D 5AW4B 1BTYA 1FQ3A 2M8RA 4OS5A 4YZUA 4DJGA 5DO4H 5A8YA 1OWIA 4XBCA 1LNQA 1W5CE 5KLVG 1UTPA 2C4FH 5C94A 3FWLA 2QIQA 4YO9A 3CC7P 1NO9H 3TH3H 1EZVG 2C3SA 7ESTE 2GV7A 2PKAA 2XC4A 1Q31A 2WPSA 2WPJS 1Q2WA 5ESTE 1QJ1B 4MN4C 3GCOA 2ZI2H 5C1UA 3PV4A 1JEKA 3A86A 5CBOA 4CH2B 2WINI 3QGJA 1BGYD 4ZH8A 1TPOA 3AEEC 1HBTH 5C5OA 1ZMJA 2JJLA 1K1LA 2P67A 1E1RD 2V6NA 3A8BA 1GBDA 1UCYE 1Q86Q 2A7HA 2QYIA 2ZU1A 4GAWA 3GY2A 4GLYA 4M7GA 5E0JA 1VQ8P 3SV2H 2SGDE 3U1JB 4Z1MD 2ZDNA 1E36B 2KI7B 3PP5A 1NT1A 2VU8E 1C5TA 1C1RA 2A4RA 3KZIH 2KFWA 1ELTA 2CV3A 2P3TB 3MQKC 1LHEH 2A31A 3PRDA 1EB1H 3D23A 3KQBA 3AVZA 1VQ4P 4TLFA 2ZGBH 1EP5A 3SOSA 4ASHA 1Y5AT 4JK5A 4I1LA 1V2MT 3H1LJ 4ASWA 3N7OA 2G4TA 5LH8A 1O2LA 1A4WH 5APQA 3UPEA 3AE5C 1BITA 1SGYE 1WXRA 2KR7A 1SQBG 2OK5A 4DT4A 4PD4H 3AE3C 1IQHA 1OVUA 2FIRH 1VQ5P 1GBIA 5APXA 5A8XA 1TNHA 4Y8ZA 2ZCLP 1AFEH 1QHRB 1WOFA 3H1JG 1EPTA 1ZV8A 3P32A 3FANA 1C5SA 4RSPA 4ACAA 1GPZA 2VIVA 3CXHI 5FX5A 1SGCA 2ZT9C 1J15A 1F92A 1UTJA 3RMMH 1WT6A 1GBFA 4SGBE 1IQFA 4I7ZC 3UIAA 3D70A 4XDEA 1ELEE 1DY9A 1TU3F 1GMCF 6CHAC 1O35A 2XXLA 6GCHG 1TABE 1O3KA 1BCUH 4JK6A 1HPGA 1TBQH 1AVWA 2ZXEB 3MOCA 2FEQH 4F55A 3L71J 4I33A 1P8VC 1JY2P 2QSIA 5GTHH 2PUXB 5B5EE 2ZPRA 3SJ9A 1ZMNA 3FGAD 2C0WA 3O8BA 2ZXXA 2G5VA 1HAPH 1SGRE 1Z8RA 2CPSA 3E1IA 4ZNCA 1H8DH 2FYRA 2HLCA 1LTBC 4K1EA 1EPTC 2ALVA 3DFLA 1Q3XA 5A8ZA 1Z8JB 2FX6A 5BVZA 2ZG0H 1ZRKA 1TA6A 1DFPA 4B6FA 1FX0B 1W7XH 3ODDA 3TNUB 2V7QJ 2FLBH 3V3MA 3E1RA 2QC2A 1C5UA 4D6TD 3OSYA 3SORA 3NWUA 2QF5A 1HAVB 4TT3D 3BTTE 2H9HA 3CC4P 1N6YA 1SQRA 2VVVA 2LPRA 3RXVA 3L75G 2NZ2A 2J59M 4Y7BA 1UVSH 1ZMEC 3PMAB 2ULLA 2O01N 3V2NA 2A45B 1FY1A 2IZ1A 3ATWA 5EOKA 2QVAA 5APUA 3S9OA 2WYGA 5CMXH 4ABHA 1GHAF 1LHDH 1O2SA 3PYHA 3EFGA 2WHXA 5HGGA 4HB1A 1YY3A 1HIAB 2G00A 1DLKB 3KDPB 4HZHA 2IPQX 1NTMD 2QG4A 4C7NB 1MUUA 4NIVA 4ZKOU 2PLXA 1C1MA 5JB9S 1C5VA 2BDIA 2BX4A 1KTTB 3HGNA 4INLA 3Q3XA 3H1IE 4IS5A 1YLDA 4TWYA 3SU2A 3W94A 1UTQA 1HLTH 4PD4I 3HD7A 2GTBA 5JBBS 3VGCC 3ZZ5A 1D7MA 1IOEA 3QZRA 1QEXA 3RDZA 1O3DA 3KCGH 2HR3A 1L0LG 1ELAA 2Q6DA 4XD7D 5EXNA 2Z5IA 1KTSB 1TB6H 2CN0H 3CS7A 5E79H 4X6OA 1GMDF 2FO9A 3AE8C 2W8ZA 3L74G 2C93B 3Q5PA 1BMMH 2YIUB 1LTJB 1VQ7P 1BCCG 2NPSA 3TJOA 2GUVA 2XU6A 2JJ2D 2OYOA 3JZ2B 2ZZUH 3B8EB 2D1JA 2HRVA 1TQ0B 1ZRBA 4B71A 4FU7A 1OX1A 2ZFSA 4JYTA 2K9JB 1NZQH 1NTZD 4NFFA 1PP9E 2VIOA 1K22H 5APVA 3TF5A 1AKSA 5APSA 1H8AA 2AMPA 4KTUA 3HE4B 1GW3A 2OCVB 5EJZA 1M57D 1TONA 1IFJA 1P2NA 1SQTA 4I8LA 3TK6A 2P58A 1HAIH 4TT3H 1ZTJA 5E2OA 1VF5B 1IQMA 2BD5A 1F0UA 1IQGA 3BTME 6LPRA 1N8OB 1QX8A 2IFMA 3CP7A 2VNTA 2JO1A 2YOLA 1T3UA 1GBCA 5HXFA 2NU0E 2BLWA 2LELA 1Q81Q 3SFDC 3C1KA 1PPJG 3ZZBA 2XDJA 3FP7E 3ZZ6A 1O2KA 4DY7B 2BLOA 1SGPE 2EQNA 1G9IE 1P2OA 4ZHAA 2B8OH 1VQNP 4MNYA 1HGZA 3H1KJ 3V0XA 1ZMLA 1BGYE 2D26C 4VGCB 1WCZA 2N1TA 3VYIA 1TYNA 1TE0A 5EIYA 3L72D 3TK9A 1DANH 3L70D 2IYOA 5G4BA 2W3KA 3CS0A 1LMWB 3G4SP 3MHVA 1D6WA 5EJLA 2ZFTA 5B6LA 2FBWC 1O3IA 2P16A 1BUIA 3L73J 4AFSA 1M1JA 2Z9JA 1JM0A 1FZGA 1SGFG 2FODA 3QZQA 3CX5D 2O01J 2BEQD 4AGJA 4CR5A 3F3BA 2GVFA 4UB8H 1KXEA 4CRDA 1MFTA 1FOSF 2O8MA 4ISIH 3HK3B 4RT0A 1JNMA 1PFIA 2L6OA 3PLBA 2STBE 2C9LY 3RBZA 2FPZA 2JH6D 2C8WB 1YGCH 3A2AA 2O8UA 1P57B 1TFXA 3SU3A 1TX7A 1ZJDA 4ABDA 4I2LC 5GIBA 2ZDMA 1GZLA 4K35A 5AW5B 1NTMK 1SHYA 1OS8A 1INCA 3PWCA 2QJPB 2SGPE 3V7TA 4WH8A 2O8LA 1O37A 5CJ4A 3S0NA 1SGQE 3TH4H 1P84E 2V7QD 3FFGA 3DD2H 1BTPA 1KXBA 1NRPH 2ANKH 2THFB 1ABJH 1OWDA 5AW9B 3RXDA 3H1HJ 1J1EC 1SGTA 3BEUA 1L1NA 1OX3A 2FYUJ 1TMUH 1AY6H 1JBUH 2XBVA 2M3BA 2K8IA 1NH4A 2C0XA 4RKUJ 2Y6TA 3CLQA 4XE4A 4Y76A 4M3LA 2WUCA 2BQ7B 3MU8A 2RDLA 1DITH 1NM6A 1XX9A 3MD0A 4DOQA 1KLJH 4YTAA 1EXJA 4NIXA 3EE7A 2V3HH 1YBKA 3ZIAD 3F1SB 1DLEA 4IBLH 1C2EA 3GDUA 3UFAA 3OX7U 3RXOA 2AGEX 1VJ9U 2QCYA 3F89A 4HI3A 2E76D 1TRYA 4GUXA 1F0RA 2BLVA 1KQFB 1G3DA 2ZA5A 2YIUC 4RJTA 1NTZK 1FY5A 2HALA 2J98B 2B89A 2ZO3H 2CHAB 1G2LA 2FOAA 4FOUC 1YTZI 1VITF 3Q3DA 3RXGA 3D6YA 1FC2C 2OQUA 1O2WA 1CSOE 1L2EA 4WH6A 1SP4A 1GI2A 1RTKA 1KLTA 4JZIA 4ABAA 3CX5H 2E5TA 4DGJA 3NKKA 1DIPA 1DXPA 2Q1KA 1G3BA 3IFMA 4ZMAH 3AE6C 2AHME 1S9KD 4F48B 1H89A 1MTNC 1SQPD 1U6QA 3UOPA 3GCTG 1N8OC 1KSNA 3RXRA 3N99A 2OC7A 5GTIH 3CCVP 4JZDH 6ESTA 3MHWU 4IL6H 1PL5A 3I78A 1THSH 1IK9A 1AN1E 4DG4A 5DJUB 5LPFA 1KB9E 3E7KA 1YI2P 1GCDA 4PJ0E 2WPDD 4FUDA 5AFZH 1JOUB 3U59A 1FDPA 3P8CD 2QEXP 1XVMA 1GBKA 5DK1A 3QUMP 2ITAA 1T8NA 4P00A 1NN6A 3K2UA 3LKWA 4THNH 4N78E 1L0ND 5DPAA 4H6SB 2V7QH 4VGCC 2RMZA 1OPHB 5L8RJ 1MZAA 2AGGX 2L74A 2ODYB 2OP9A 2YKOA 1W0ZU 1MMJN 2I6QA 3VOPA 1X7AC 1K73Q 5A0AE 3P70B 3SGQE 1FY8E 8ESTE 1DWEH 1YKTA 2QA4P 1QBNA 3ZZDA 1OW6A 1VL2A 2TGDA 3AEDC 5GPIB 3SHCH 1RF1B 1ESAA 2Z9KA 1W12U 3P8NA 2HFED 1Y8AA 3OU0A 1SI5H 2H2ZA 1USEA 1HJBA 3MU1A 3PJSK 3M0DC 1JWTA 1SQAA 2VWNA 2WSCJ 3KNXA 2W6JD 3BCCJ 4OVNF 2AXTH 3H1IG 1LQEA 1YC0A 5FL7D 1VQOP 1V2QT 2OQ5A 3PH0A 4DIIH 1T8ZA 4I32A 1GI3A 1K1JA 2ZTZA 1QTFA 1SQVD 1AHTH 1TGTA 1JY2O 4ACBA 1IFMA 1FIZA 1O2VA 2QRXA 2EI8A 3TGKE 2OYHB 3D65E 3KYGA 2HODB 1QZ8A 4AB8A 2AYWA 1QBOA 3L73D 2C8YB 5I46H 4GIFA 3T27A 2Z7FE 2WPRA 5AVWB 2VH0A 4JCNA 3UIRA 1GJCB 1NOHA 3AE2C 3QO6A 5AVVB 4DZOA 3HKIB 4FUJA 2B7DH 1BRBE 3H1LE 1PP9G 1GJ8B 3QLPH 5DP6A 3GDSA 3TNTA 4U01A 1D9IA 1BBRE 5E0HA 2Y5GA 5GDSH 1O34A 1O0DH 1BE3J 1N8RQ 4UE7H 3CX5I 4UEHH 2F9BH 1ELBA 2F9NA 2ZQ2A 3M5LA 3E1XB 2V0BA 2B9BA 2R5DA 2C8XB 1LWUB 4X1NU 3EQ2A 3GS9A 3C1LA 1DT2A 3SUFA 1PPZA 2CHAC 1PPCE 2BLQA 1GCTB 4IN2A 5CE1A 3BTQE 2HVYB 2FYUD 2PAJA 5C20A 1AWFH 2HVXA 3W67A 2V35A 2FYZA 3KHVA 2PWXA 4I7YH 3RXEA 2ALPA 3ZVEA 2BVSH 1BHXF 1SQPK 5JPMH 1BDDA 1RF0A 1PZQA 1GGDB 1BGYG 2Y81A 4WY4A 1QRZA 3L71E 3MO9A 1A46H 4UDWH 2VVUA 1NRSH 2K0QA 3RL0D 1X22A 1QRXA 1XUHA 2KS1B 2FFDA 1IQIA 1H0TB 1ZPBA 3A87A 2W6JH 4Y6DA 1FZZA 4YOIA 3SBKA 2AERH 1A1RA 1YPJH 2F4LA 1FUJA 1TBZH 1QFKH 5DP9A 2HOBA 2YKPA 3M37A 1OWJA 1GU5A 4CHAC 1HAOH 1L0NK 1WBGB 2QF3A 4J1YA 1FAVA 2AEIH 1KYOH 1HAZB 2BOHB 2OBQA 1DS2E 5KLIC 2P10A 1QGFA 2W6AA 3LPRA 2E76C 5LPRA 5H2FH 1BZXE 4NSVA 1NTKD 2L91A 2WVRA 1O2QA 3N7DA 3P8OA 1O38A 2FI5E 4E06H 4AFUA 1C5QA 3ZVCA 1FZCB 1M9UA 1NFXA 1Y59T 4A92A 1HXEH 1W0JD 1CO7E 4AFZA 5BRRE 4MPUA 4DVAU 1HJ8A 2FFDC 1KILA 1T3JA 2OYIB 3RBXA 1C1WH 1XXDA 1DSUA 2KCAA 1MZDA 4B1TA 4YXDC 1FJPA 1KV4A 2WT7B 1TLDA 2PHBA 3GHGA 2A45G 4BWNA 1RD3B 1TOMH 3A83A 3UQOA 1P2KA 4BTUB 3CCRP 3G3ZA 2C90B 1F5KU 1SQVK 2OUAA 1EFRD 1SOTA 1AFQB 3SUDA 1MTUA 1SFIA 5EG4A 3PMJA 4X2VA 3ZVFA 2AEFA 5CCGA 3EA7A 1UO6A 3WUTA 2SFAA 2UUYA 2IBZD 5FBIA 3K9XB 1RH5B 2D2CD 4GCHG 3SUEA 1YCPM 2OYHC 3GCNA 2BX3A 5DP3A 3SV9A 2ZHQH 3A7TA 1LWUA 2P3UB 1EATA 5PTPA 1LJ2A 2ZAEB 4OS6A 4FVBA 1CT2E 1HAXB 2H43A 2A2XH 2A0QB 3HE5B 2P93A 1OYQA 1UVUH 2PFEA 3A8CA 3A7VA 2BD7A 5E0GA 2AIQA 1VCWA 2R44A 1YP9A 1FN8A 1GI9B 4I8JA 2XNIA 2ZPSA 1D3DB 3UQVA 2FZZA 2FY8A 3II6A 1Z8IB 1NJIQ 1HAHH 1LVBA 3DUXH 3GICB 4NWLA 1ZTKA 2WPLS 1P11E 1CGHA 2OXSA 1KFNA 3NXPA 5DJTB 1LWUC 2FYUK 4RESB 5BU8B 3PV2A 5KECA 1GJBB 4AZ2B 3A5TA 1EZXC 1TGBA 5SGAE 1GCTC 1R5LA 5IYTA 3STIA 3ITIA 4DCKA 5JBCS 4KTSA 3RK2D 1VR1H 2FOBA 3A85A 4Y0YE 1B0FA 2GX4A 3KQGA 1KYOI 3Q77A 2BVRH 3GISB 3SQEE 2QXGA 1YJWP 4IFDK 2J9NA 3Q5RA 2OC8A 1V2JT 2R32A 4ZUHA 2A06E 3DSGA 3F6UH 2KZJA 1N1LA 2OC1A 2ZCHP 1YTZT 1AQTA 3PLKA 1BE3D 3H1KE 5EPNA 2FXPA 1LTGC 2GDEH 1C5MD 1P06A 4Q80A 1ELDE 3GDVA 1ZP0C 4NZQA 5APYA 4OS2A 2KNCB 1YLNA 2ANMH 1O5DH 3U1IB 4YOGA 1KYOE 3TK5A 3T29A 4HYTB 4D6TJ 3KYFA 4U32A 3MYWA 3F2HA 4I7ZB 4JYVH 5DN6D 4GHQA 3WU2E 2GUSA 2Q7CA 4D9QA 1P04A 3KL6A 1KQSO 1K21H 4AYCA 2XTTB 1FZCC 1H8ED 4J2YB 3TU7H 1CSBA 3ABVC 1LTIC 3EAJA 4R8TB 2R3CA 2J38A 3E91A 1M8OB 2HNTF 2ZHFH 1EPTB 4YT6H 5DJ7A 2WWWA 3RK2B 1YIJP 2H89C 2UWJE 2OYIC 1GDTA 1RIWC 3HK6B 2ODQA 4IW4E 4WJG2 2KXPB 1YBWA 1UTNA 1RGQA 1V2WT 1D6RA 1O5BB 4RKJB 1MAYA 2XWBI 5HIZA 2A4OA 1TNLA 4L74A 4MPXA 3VXFH 4GDOA 1FY4A 1HGTH 2CK3D 4B2AA 2NU1E 3A7YA 3RL0C 3K5BA 1WYKA 1ZPCA 1AA0A 4RN6A 3AASA 1DY8A 1A61H 1RQUA 3H1HE 2ZU2A 4XRNA 3H1LG 2XW9A 2Q6FA 2VIDA 3VMXA 3NXSA 1WSSH 2ZDVH 3SZNA 3L4FA 1JY2N 3A7OA 1LPZB 4IOIH 2G52A 1LPGB 3MNSA 1N73B 1PQ8A 2HNTC 2ZPQA 1UK2A 1NY22 2XYAA 1O3CA 3SGBE 2PP6A 2XRCA 1B0EA 1YPLH 2A7JA 2HWLB 2W26A 2A5KA 3OTPA 1UIIA 1EDLA 1NBME 3MP7B 1SLUB 4MPWA 3BASA 1S4XA 3HD7D 2R5BA 1MD8A 3Q3KA 3U69H 1QB9A 5J4SA 1AJYA 1DH3A 4H13C 3Q2YA 2BM2A 2QY0B 3SV8A 1USDA 3TITA 1NTZJ 2RCEA 3UTUH 2HLDD 2W5EA 1AZ8A 4WF8A 1W10U 3V2PA 1L4DA 3T97B 4WXVA 1EDIA 1GHWH 3NMDA 3OW2O 2NPSD 1S6FA 4EOTA 3V2RA 2POHA 4U3FD 1K2I1 1Y3UA 2LNCA 3L71G 1NAYA 3VGCB 2IZ0A 4JZ1A 4WMDA 3A8DA 1CGIE 3A80A 2KNCA 4YLUA 2BY9X 3ZVGA 3KEEA 3ZZ8A 1F0TA 1GJDB 2Q1JA 3SJIA 1V2UT 2FDAA 3PRJA 1TOCB 1IJDB 4LLHA 4NPEA 1P2QA 2BD2A 2UWOA 2B87A 2GT8A 3GCHB 3SU4A 3UNQA 1EZUC 3ATMA 3QWCH 5T1VA 5TCAA 1H8IH 2D2CC 2G55A 4H6TA 2IBZI 2WUBA 1G1JA 4OS1A 4YLQH 3VMZA 4O9VA 3FAOA 1Z71A 5CHAB 1TNJA 1HB0B 2ZVOB 2BY6X 3A8AA 4INHA 3U8OH 1M7LA 1ESTA 2VB0A 5F53A 4AG1A 5EW1H 3HD7B 2Y0CA 2CK3H 1A0JA 4B86A 1OVVA 3L72J 2WPIS 4ISNA 3L70J 1TBRH 3N7EA 1N6XA 4X8SH 2CGAA 1L1GA 5T6FA 3E3TA 4B74A 1O3FA 1QB1A 1ZGVA 3RXAA 1NRNH 2ZYAA 4A7PA 4HKZH 2Z9GA 3MH4A 2N1TD 3V2QA 1EJMA 1EQ9A 2NPSB 1CHOF 1QVGO 1DUAA 5AVYB 4TY6A 1LVMA 1ETSH 1RFNA 3RU4E 3WWFA 2YMYA 3CXHE 1F5RA 5A09A 3MGNA 1BDCA 3CI9A 1QY6A 3TH2H 2WYJA 1AKSB 1E37B 1CU1A 1N73A 1OOKB 1X0TA 2O8TA 3ZZ7A 1C5WB 4NFEA 3BCCE 1SLVB 2C8ZB 1F5LA 3RK2C 1DVAH 1LQDB 1SBWA 2M3EA 2UWPA 3TJNA 2ILNA 2JKVA 1UK3A 1BMAA 1P3CA 1E38B 1XUFA 2B5TB 4MQAA 2H88C 3K6YA 4D9RA 5JB8S 4Z1MH 1LPKB 3EGKH 2XZRA 3F9HA 3KIDU 3T28A 1SQQD 3LGUA 1C2KA 4N6JA 3SQHE 1GHYH 2Y9ZA 2XWAA 4FUHA 1E35B 5M1BA 2BY8X 3SSUA 3T97A 1PYTD 2F9VA 4MTBA 3A84A 4I8GA 1SGNE 1A02J 3MU0A 1YPGH 1CW5A 2PGQB 1N73C 1BSHA 3GLMA 3OY5U 4XSKU 1A0HB 3MIWA 2N1TB 3E8LA 2CF8H 5FPTA 1ZLLA 4AFQA 4AG2A 4NA7A 4OGQD 8GCHF 3F5HA 1V2VT 1V6DA 3UNSA 1LHFH 3OA7A 2KX4A 4TWWA 1JMOH 1X9VA 1BE3E 1KXCA 1URQA 1RE3A 4B2CA 1EB2A 1C4Y2 3E16B 5AVTB 1C2FA 1TMBH 3RK3D 2D2DA 1M1JB 4PV1D 1AMHA 1XUKA 2SGQE 1T4UH 1JIRA 2XV5A 3M7UA 1GVKB 3MH5A 1GD2E 2FOFA 1J1EB 1O5FH 1HJ0A 1PQ7A 1DICA 1UK4A 3RXHA 1LP1A 3LW5H 1NU1D 3USSA 2WV5A 3PTBA 3KZIE 4RO0A 1Z1JA 3SWYA 1GL2D 2H7HA 2R0LA 3CCEP 3SGAE 4ABJA 2GKVE 1MKMA 2A06G 4XA4A 1O2PA 1SGIB 3PMBB 1KIGH 2ZP0H 3U9AH 3H1KG 1C5YB 3AEFC 1FN6A 1SQPJ 2PGDA 5DG6A 3AECC 3PHLA 1JCDA 1AD8H 2JDID 1MKXH 1SB1H 3GCHC 4X2XA 5E8EH 1RE3C 3LGYA 4L75A 1IFPA 1LCYA 2FX4A 2Q3EA 3RC6A 7GCHG 4PD4E 4BRYB 1AWHB 2OTVA 3IG6B 1QA0A 2BMGB 3BN9A 1FONA 5CHAC 1ZHMA 4TPIZ 1HH0A 1L0NJ 1TX6A 5AHGH 3HGPA 3LH3A 4KJMA 2O9QA 3QK1A 1NGMB 2PRRA 1XTCC 5L2YH 1XMNB 3PM3A 2BQ6B 5F8TA 3V5BA 1D3TB 3HD7C 3RK3B 3A7ZA 3M7QA 1YCPK 2Z3EA 4UB6H 1MTNB 5AFYH 3SI4H 1MTWA 1YJNP 4IGDA 3O8RA 4LOYH 4RKOB 2NRGA 1W0YH 1GJ4H 4JZEH 2ZYDA 1FU1A 2UUJB 8KME2 2NPSC 3DFJA 4LC1A 1BTZA 2XBYA 1MKXK 1PPGE 4IC5A 2XNDD 5GTHE 1BMFD 2ZGCA 2W90A 2VGCB 3AE4C 2LR2A 3QDZB 1XUIA 3UREA 2ZF0H 3T5FH 1GJ9B 1S72P 3H1HG 4TY7A 1OYTH 4A1TA 3SFEC 4YM9A 3BRVB 3MO3A 2KCYA 4K60A 1OXZA 2FS9A 3BTGE 3TGUJ 4UFFH 1QL7A 2M5AA 2WZ7A 1C4U2 1TMTH 1SQVJ 2AS9A 2Y82A 4K3JA 2QAAA 1P2IA 1AUJA 1G3CA 1OP8A 1WTGH 5GNDA 1FLEE 5EXLA 3Q3YA 1ZJKA 1SQQK 4Z0KA 2FYQA 4E05H 3E90B 5CDFE 1K04A 2KUBA 2EI7A 4QMAA 3H7TA 5KLVD 2FWWA 2GP9B 2ZQ1A 2WQYC 1YITP 2OGUA 1H4WA 1GDNA 1VITH 2QA9E 2FKWB 3OYPA 4EYYQ 5BPEA 2BQWB 1KTMA 1EZVD 3U1AA 2JKHA 3RXCA 1GL0E 2KAIA 1CT0E 4A1XA 5C67A 4XE5B 2LXCB 3T2NA 2ZHWH 4Q2KA 1PPEE 3NZIA 2FI4E 2K1AA 1HRTH 2N1TC 4WY3A 4IFFA 3SWKA 1BIOA 1NRQH 1CGJE 4FETA 1TALA 4MNWA 4H44D 1AVOA 1MBQA 1EQ7A 1V3XA 2IN2A 1M1JC 1ETRH 3FX0A 3G01A 1NU1K 4FU9A 1HBWA 1MQ5A 4BRYA 4U2WA 9LPRA 4YXWD 1ZXGA 1GBHA 3WY8A 3A0BH 4WB4A 3A0HH 1S0RA 3R0FA 3M5MA 2E5YA 3AK5A 1GJ6A 2IDBA 1IFNA 2VWLA 2DE9A 2Q9IA 2EY4C 4O9BA 5KAFH 5KTBA 5E79E 4L73A 1BRUP 1GI5A 3EE0B 4KGAA 3MZWB 1MBMA 2YNBA 2XNDH 3GY4A 2LP6A 4X1RU 1LVYA 1S84A 4K5ZA 2HG5D 2A32A 4O3UA 3JCUH 2RG3A 1SQBD 2BB4A 3RXLA 1PYTC 1GL2A 1FOSE 4NCYA 3MTUE 3HUSB 4WY4D 2RH0A 1VCPA 1HUTH 3KQCA 3H1JD 3BRTB 1RTLA 3BVHA 1J9CH 1G1IA 2HYNA 1PGQA 3UAIC 2M5TA 4OGQC 3CCQP 3LH1A 1BMLA 1KXAA 4D6TE 3QWOC 4K3AA 4OH8B 1G30B 3ODFA 2N9BA 1C4V2 4AYYB 4WXIA 1CA0B 3H5CB 3U98H 1NTKJ 1TPAE 2ZYGA 2QJYB 2KIKA 3A88A 3LONA 3URCA 5L30H 1O2ZA 3RK3C 4PV1C 2F43B 1O3OA 3Q76A 4TSFD 4ZHMU 4YT7H 3BCCG 1HWTC 2NU3E 4UD9H 1NESE 1Q90D 2Y80A 4AOQA 4IFMA 1P9SA 4HGCA 2BOKA 2WPMS 2R0KA 2BD3A 4NWKA 4GOFA 4O97A 2WPVB 1ZSKA 5DP7A 3RXFA 4BAMB 1PQ5A 1S3JA 1GL2C 1OW7A 1BTUA 2NWNA 3RU4T 3VTPC 2I8DA 2B0FA 1ZRTD 4ZKSU 5FCKA 3T26A 2BZAA 1KN7A 1YHQP 4CRGA 4CHAB 1G2CA 2VGCC 3NTNA 2H9TH 3QGNB 1NTME 2KZIA 1ORFA 3RP2A 1S5LX 3RK3E 3M5OA 4R4MA 1O2HA 1Y5UT 5KLIB 1KILD 2PW8H 3SNEA 2E76B 2K88A 2HGTH 2XC5A 1BHXB 5AVSB 4HG6A 5DP4A 1AVYA 3LU9B 2FOHA 3PB1E 4AUWA 4WY4B 3GMAA 2Z6BD 3NPSA 1O39A 4YXWH 2YO3A 1EX3A 1QCPA 2W7SA 3L75D 4LK4A 3PTZA 3ZYEA 3LC3A 5KLVK 5A0BA 1HJ9A 1GMCG 1PPHE 2FFDB 4UB8E 2K3RA 1BE3G 2G8YA 3GYMA 1T31A 2P8OB 3I5CA 2GZ8A 5CCGD 4ZXXH 1AFOA 1O3AA 1NRRH 2N9YB 1AV1A 3ZVAA 3FXEA 2QXIA 1JRTA 1DEEG 3MTYA 5C39A 5EU8A 4X6NA 5KAIH 1Q82Q 4A1VA 3N4XA 3LDXH 3C9IA 5GJ4B 1A5HA 1FI8A 3TGUD 1O3PB 3NFQA 1NTZE 2ASUB 1KXFA 1OP2A 3OY6U 3SNCA 5L6NH 1FXYA 1ZTLA 5KKZB 2ZTYA 1J17T 3KXDA 1GU4A 1SLQA 2F3CE 4AX9H 5EW2H 1GI8B 1SG8B 1H9HE 3HUSA 1KILB 1K9OE 2A7CA 2K1QA 2QF0A 3LGWA 4CBNA 3G71P 1LHCH 1KY9A 3V4QA 2BD9A 2J5UA 1XM1A 1AU8A 1AIXH 1AB9C 3D49H 2OLGA 2VIQA 1L0LD 2Y0EA 1KD1Q 3GHGB 2DW3A 3P8MC 5AW1B 1O2MA 2SGAA 3GY3A 5AVZB 1UMAH 3ZZ3A 3MNXA 3SV7A 1ZN5A 2A4GA 1L4AD 1P2JA 1J16A 1OWKA 1GHAG 1Z6EA 3L74D 1EUFA 1O2XA 3NUMA 5IDKA 1SFQB 1WUNH 4Y11E 1BCCD 2HPQH 1SQBK 2KOGA 1QQUA 3ZV9A 1L2PA 1ZW0A 2O1JA 2ZTXA 1ZYOA 4NPDA 3SN8A 1SQXJ 3VB4A 2R3YA 2GA1A 1M1KQ 2HLOA 3CWBJ 1EZVI 3HUSC 3VP8A 3RXUA 1L4ZA 3L72E 3L70E 2FOGA 4NIYA 1GI6A 1WV7H 2QM7A 3BEFB 5FXLA 1BRAA 4R0IA 3EA9A 2BD4A 3DCLA 5H4IB 3FN8A 5F8XA 4C46A 1YM0A 1V2TT 1NC6A 1EAWA 1K1MA 2FMJA 1K1PA 3CX5E 5HIYA 1Z6JH 4H44C 2G51A 1CA0C 3CNRA 2A2QH 2QJYC 3A7XA 1C1TA 2FXRA 2H1UA 4JPZB 1KDQA 3BATA 5AW0B 1YPMH 1PPJD 5GTIE 1GMDG 2VRSA 1NFYA 4IL6E 5KGOA 1HDTH 2BDBA 2OTKE 1BMNH 1GHBG 5CBNA 5FAHA 1VQKP 2ZU3A 1Y3VA 3P6ZB 1JOCA 1R8EA 4OGYA 2IOTA 1EAUA 1L4AB 1FPCH 4FUEA 3CCMP 1JO5A 3GY6A 2ZGHA 2PSYA 4IN1A 2ODPA 1MKWH 4BNRA 1XTGB 2TGAA 3CCUP 2AFQB 2P59A 1O3LA 2IYPA 6GCHF 5TJHA 4L76A 4DT0A 2FTMA 4ESTE 1DDJA 1H9IE 1K1IA 3WW7A 4WWIA 1RF0C 1E34B 4WY4C 1H1BA 3KPEA 3ZYDA 3M9BA 4EI2A 2XC0A 3RGUA 1FZAA 2FI3E 4H13D 1ZOYC 4YTPC 2BTCE 4XOJA 3CCSP 3DSPA 3ZVDA 1RIWB 1PGOA 1O5GH 1OP0A 3HRNA 4K8YA 2R3UA 2P8OC 3DSOA 3JZ1B 2Z94A 3AAUA 1LT9A 3B71A 1KFMA 1T2KD 3URDA 2AXTE 4JBZA 5IK2D 1QR3E 2AH4X 5CCHD 2O1KA 3RL0B 3CCLP 2J95A 3WUUA 1MKWK 4K2YA 1XXFA 3M3VA 2F9PA 1SGEE 2DUCA 2VWOA 1CVWH 2GCHG 1WDIA 3FVFB 2ZU4A 5KKZC 4GKGA 2YMSD 3RXTA 5EJ1A 4U3FJ 1B7XB 3SNAA 4ZKUA 3O6QA 4GVUA 1FDOA 3EWKA 1GWAA 2WMMA 4IMZA 3SNDA 1KILC 1FZFA 3TGJE 1AZZA 2KLUA 1L0LK 1S9KE 1SQPE 1NPMA 3ESTA 3B8JA 1VPCA 3AEBC 1QVFO 1COWD 1Z8GA 4NZLA 4BAQB 1P0SH 7KMEH 2XBXA 3GHGC 1HF9A 2PFXA 1IQNA 4H13B 3GW6A 5LGOA 4D6TG 3AE9C 3RC4A 4JQ0D 4JYUH 2QXJA 4KT0J 3P8CE 2ZNKH 5C17A 1J1DC 1MZ9A 5CCGC 1GHXH 2ZWLH 4FUCA 1L0NE 1HAYB 3W68A 1OKXA 1IQLA 1YPHC 2QE7D 4X8UH 3PROA 1QJ7B 1WTHD 5CHBA 2F83A 1GBLA 2YNYA 1N7SA 2RFKC 3LW5J 4BXLA 3SI3H 1L4AA 2WTYA 1BQYA 2QGRA 2L5GB 2H5CA 3EFFK 1K0HA 1W8BH 4CR9A 3GF3A 3N7NA 1U7JA 2E75D 1QNJA 4HFPB 2W27A 1K1NA 4NA8A 1NKZB 5CHXA 1TGCA 2YMSB 3VFEA 2D2CB 1MCVA 3QN7A 4U7JA 1NTMG 1T8LA 1GBJA 2HPCB 3U8TH 1UCYH 2OARA 2XBWA 3G6EP 1DSTA 1GI7B 1LO6A 4ISLA 2IPHA 1GTWA 3MWIU 3IR9A 1P12E 5T6DA 1O2IA 2H5DA 4X0WU 1SQXD 3TGUE 3F68H 1EDJA 1GL1A 4B6EA 1N7SC 2QIWA 1XKAC 1SQVE 4OM9A 1ELCA 3CWBD 3C8VA 1L4AC 1NYHA 1VITG 5FPSA 4WWYA 4AN7A 1FAXA 1KQLA 3GF7A 4RI0A 1W2BO 3L37A 4WVZA 2B87B 1FAKH 4SGAE 1NTKK 5H2FE 1SQQJ 3L73E 2BCCJ 1BA8B 1KLIH 2RDEA 4E7NA 1O5CB 1S6LA 1SLXB 1FDIA 1VQLP 1O3EA 2ZGJA 1QRWA 1GDQA 1C1QA 2AMQA 3SJOA 1D3QB 2Y9YA 2B9LA 4ZKRU 2OC0A 1YQ4C 1NTZG 1UIXA 2JWDA 3OTJE 1UCYK 1VDFA 4IC6A 2E75B 1C2IA 2Q6GA 2V3OH 3MMGA 1QGKB 5AW6B 1IQJA 2GZ7A 3VP9A 5APTA 3H1ID 5GWZA 4D76A 4FUBA 1SGFA 3A82A 2W83C 1DWDH 3CD6P 1KZUB 2WITA 1O2JA 3L33A 3VG8A 1W2EA 3GY8A 1Q7YQ 4XBBA 1VZQH 1JTHB 3PWBA 3TJUA 2AGIX 1CQQA 1MUEB 1BDAA 1O36A 2FYNB 4JZFH 1NU1J 3S9BA 1IAUA 1O3GA 1T32A 4I8KA 2FYUE 2HPPH 4Z6AH 1URQD 5B5EH 1VQPP 1RJXB 3VMYA 2NU2E 5GXPA 1RY3A 5C1XA 3BTDE 2AEJA 4MDSA 4ZAEA 1C1VH 2EI6A 5CCHA 1YPKH 2C9NY 4WMEA 4Y10E 2J58A 1O2OA 5K5GB 1PFXC 2A5IA 1PP9D 4X8TH 1TPPA 1UW7A 4ZROA 2CMYA 5EQQA 3U8RH 3L72G 4E7RG 1C2MA 3L70G 2BYAX 1X79B 1Z56A 3OE7D 3EDXB 4JYBA 1OHHD 1YWUA 2ZGXH 1P3EA 1S1CX 1FMGA 2P7JA 3S1KA 1P09A 2ZHDA 3K65B 1SQOA 1RRKA 2HPCA 1D3PB 4R4LA 5E2PA 1JY3P 3G9RA 1O3HA 3KN2A 4CRCA 3VMAA 2M0BA 1BSNA 2HNTE 2BZ6H 1MTVA 3RMOH 1T2KC 1TWXB 2QJKB 1NTKE 1FIWA 3ZV8A 2XOKD 5CCHC 2ZEBA 1J14A 3MO6A 1ELFA 2FOMB 4Q7YA 2BXTH 4AC9A 3CPWO 3OAAD 4A6LA 4JYCA 3BG4B 2WPQA 1GMHG 1TNGA 3SYJA 1URQB 3BV9B 4A5TS 3WUVA 4LGDE 2YMSC 2WSEH 5TISH 2BDGA 3SU5A 1W13U 3K6ZA 4BOHA 4Q7XA 2LKMA 2XNXA 1V2LT 4FU8A 4ABFA 4UONA 1FE6A 4BANB 4CRFA 1LP1B 1EXFA 5F03A 1A2CH 1GBAA 1SQXK 3TIUA 2J92A 1C1NA 3VB7A 4Y8XA 5AW3B 4Y7AA 4AYVB 2PUQH 1FZEA 1LTOA 3SHAH 3AE7C 4AQRD 1O32A 4BAHB 1WU1A 1A7SA 3GCTF 3U28C 2XKMA 3B9FH 2ZDAH 2B88A 3ITKA 2IBZE 4KP0A 4WBAA 3Q1MA 1NTPA 2R3SA 4INKA 4I86A 4D7FA 1HTLC 4I6MC 1H9LB 1JTHA 1LGHB 2Q5UA 1JIMA 1BTHH 1Q2NA 5KLVJ 1SVPA 1TAWA 4ASVA 3AEGC 2EA3A 2H8PD 3PLNA 4PROA 4BAKB 1BRCE 1OWAA 1QIXB 5FX6A 2CPBA 2RA0A 4MLFB 3FO8D 4O03A 1RXPA 1QL2A 3CMEP 1JCCA 1DD4A 1DWCH 1UTMA 1P84D 1HYLA 1U57A 4BAOB 2E75C 4YESB 2W7UA 5C2ZA 1S5SA 3UR6A 3RXIA 1CI6B 3O8DA 1LVOA 2Z4EA 1C1PA 1HJAB 3MU5A 1O5AB 4GT1A 3ENSB 1WQVH 3MH7A 3AE1C 2A1DB 1C5XB 1UHBB 1SQPG 2RKLA 4Y71A 2QF4A 3UR9A 3MNBA 2BCCD 2FYNC 2O8WA 1HUCA 3HPTB 4K1SA 4ABBA 2FESH 3BIUH 2AEMA 4Y79A 1L0ZA 1E79D 3L35A 1BOQA 1S81A 1ZR0A 2BVXH 4RT1A 2Z3CA 1ESBA 3FKSD 1JMMA 3RMNH 1L0NG 2M5AB 1VQ6P 1O3MA 2PR3A 3KQEA 1UVPA 1SPJA 3SJKA 2BDAA 1VGCB 3MU4A 3VXEH 3SWFA 1DXWA 1SQBJ 4FXGH 1RQVA 2AXCA 1SQXE 4B73A 4KTCA 1S0QA 4ABGA 1UVTH 3H1JJ 1V2PT 3CWBE 1KORA 1NU9A 2KSEA 1BJUA 3M0AA 1O2RA 1TPSA 3LOXA 1PIXA 1G36A 2UUFB 5DSFA 4B76A 2TGPZ 4LZ1H 3BEIB 4EDFA 1ANDA 2KAIB 3RM0H 5JYIA 1ZLRA 1UVOA 1KB9D 1G37A 1GVZA 3B23B 4OS4A 2QJKC 2G4UA 2W3IA 1QB6A 1TIOA 1HCGA 1GVLA 1NROH 4F49A 4OS7A 3Q5SA 1KMIZ 2K37A 1C1UH 3NCLA 1ZZZA 3D71A 1RHZB 1V2RT 4BTTB 3TGUG 3M35A 5KJ7D 4YPCA 1FBMA 1OZHA 1SQVG 4N78D 2Y0DA 2YMKA 5TISE 1VF5D 1C5RA 1QQ4A 3BG4C 1P84H 2JH0D 1URQC 1V2OT 4ZKNU 1U7MA 4ASUD 2F91A 2YXQB 4P02A 3ZZCA 2A45H 4Y28J 1GI4A 4X8VH 3L73G 4MNVA 4CPGA 3RM2H 4OGQB 2ZFCA 1QJ6B 3MFJA 1THPB 2TBSA 4I31A 1K8AQ 2VWMA 2Z9IA 4KKDA 3M3SA 1ANBA 1SLWB 2E74D 3RXBA 2WV9A 5GCHG 3S7KB 4YOJA 1SS1A 1O3BA 2JEEA 1CI6A 4PV1B 1EOLA 3OEHD 3FP6E 2I1JA 1GJ5H 1N7LA 2KZ4A 3C27B 3L75J 1GHBF 4AGKA 2SNWA 2P3FH 1E79H 1CA8B 3ATLA 4X1PU 1UHBA 3HKJB 5DGJA 1KQGB 1GL2B 1C2GA 1O2NA 2Q6QA 2JH5D 3AEAC 5AF9H 1GK4A 2Z3DA 1ID5H 3SW2B 2WSFH 1GHZA 4CREA 5EQSA 3CMAP 3WMM0 3A3YB 1JMBA 1YYCA 3E0PB 1O33A 1TNKA 1EXIA 1C5PA 1NS3A 4Q7ZA 3CL3D 2FYUG 4QT8C 4CRAA 2FTLE 4GSOA 5DP8A 4W7YA 1GW4A 4N3YB 1VCQA 3SJ8A 4X1QU 4XFQA 3TNUA 2OTJP 2YXRB 2GCTB 1ZGIA 3AW0A 5HM9A 1A5GH 1HJAC 1QA7A 1OFCX 4WMFA 2PTNA 4X1SU 3H1LD 1HAVA 3SUGA 1C9PA 2KLVA 4U3FE 3SU6A 3F2GA 3I29A 1MV8A 3QH9A 2E74B 1UTOA 1KB9H 1K28D 3H7OA 3SV6A 1NHLA 1R5SA 4PJ0H 1E5WA 1SVFA 2ZJSE 1TA2A 3M5NA 5B66H 2G8TA 1L0LJ 1G2CB 2OQQA 1TGSZ 2PTCE 2FOEA 4CBOA 3LIWA 2CF9H 1TNIA 2JETB 3RXMA 1C9TA 1JRSA 2JDIH 2MKVA 2F9UA 1O30A 3RL0g 1H88A 3L74J 4OWFA 2ESTE 2GCHF 1HIAA 3H32B 2WPKS 3R3GB 1BCCJ 5AW8B 2KB7P 3O8ZA 4X6MA 2KP8A 1KC8Q 2ZCKP 4C7NA 3DHKH 4GCHF 1NTKG 2VJ1A 1VGCC 3ZZAA 3BIVH 2FP7B 4Y99B 1K05A 1ACBE 1GBMA 5EXMA 4ZXYH 5F6MA 2FXMA 3B4SA 1N2DC 3PO1B 2KCOA 4HH2A 1EASA 4GPGA 2PV9B 1P84I 3BTWE 1G2MA 3L71D 4IMQA 3MH6A 3NRLA 1DEBA 4GODA 1AB9B 1W7GH 4BXSA 1BB0B 2E43A 4FUFA 1T4VH 2A45I 1IQEA 1O2YA 2P94A 2XCFA 1FV9A 1OIPA 4Q63A 3UWJH 3BTFE 1VQ9P 1UTKA 5C0TA 2A5AA 4W80A 4B75A 2JWAA 3MNCA 3UB0A 2ZKSA 1W0KD 5EGMA 3H09A 3UOUA 1S5LH 2IFNA 1W14U 1XUGA 2GMTB 2BD8A 1SFCD 4O3TA 3JC22 1VJAU 5JDUB 2KSJA 3M61U 2J97A 5FBEA 1EDKA 4DW2U 3VPKA 1LTJA 2Y5FA 1J8AA 3KQ5A 3RLYH 3LJJA 4CH8B 4MPVA 3W1EA 2E42A 1UTLM 4Y8YA 1A3EH 4X2YA 2IBZG 3S69A 1O2GH 2TRMA 2ZC9H 2K9JA 3BTHE 1T8MA 3M36A 1OXGA 3P8GA 3KQDA 4X6PA 3L6PA 4NSYA 1X8YA 3VEQB 2J94A 1MFZA 1ARCA 3F0PA 3HE4A 4K1TA 4B2BA 3DA9B 1C5LH 2KM0A 1RE4A 1GK6A 1GJAB 2ANYA 5KJ7A 1F7ZA 2SNVA 3M91A 1BTWA 1SQQE 4H44B 1DM4B 5BU5A 2BCCE 3RXKA 2CXVA 3QTOH 2R9PA 3ATKA 1S2EA 3R4YA 4UB6E 1AE5A 1BBRH 3M9HA 1JY3O 3TYYA 1GHVH 1MU8B 3BTEE 4DURA 1ZHPA 1PQAA 2GGVB 2J34A 1Y3WA 1HNEE 1O3NA 2ZFPH 4CRBA 2BHGA 1W3CA 2ZDLA 1LTJC 3E6PH 1OWHA 4UFEH 2I6SA 2JP3A 3AW1A 2AIPA 3D6ZA 1PGPA 3OAKA 2ZHEH 1WRGA 1O5EH 4NGAH 1SFCB 1WAYB 1KB9I 1WMKA 3OJAB 3TK1A 3SZEA 1RE4C 5FHTA 1TGNA 3EQ0H 5KJ7C 1JUNA 1Y3XA 2Y7ZA 2TIOA 3TDKA 5ESBA 1MABB 1VF5C 1LTSC 1PPFE 4ISHH 3H32A 3R2PA 1NWQA 4NG9H 3RMLH 4MVNA 3S9AA 4ZCNA 1KXDA 1NU1E 1KDQB 2KCPA 2FOCA 2GCTC 4DOJA 5EODA 3T25A 1BBRK 1V2KT 1ZSJA 1MU6B 2VH6A 2W6ID 1JB0J 1SC8U 2YNAA 4H0LD 3ELAH 1EKBB 4FUIA 1CHOG 1MAXA 1SMFE 2KYVA 2E74C 5B66E 2JIZD 3LIEA 3HATH 1NFWA 1LKBA 1GDUA 3MUDA 1SQXG 3M0DA 1Z1IA 3TNSA 3ZZ9A 1EJNA 3A81A 2Q3IA 2O3JA 4BXWA 3KGPA 2Y7XA 3CWBG 1C2HA 2RA3A 1L1JA 1AGJA 1NVOA 4AORA 2JETC 3ZVBA 4DCDA 2STAE 4TYDA 1IO4A 3KYQA 2ZDKA 3LGTA 1ETTH 1DX7A 1AQ7A 3IF4A 1MD7A 1IZNB 1C5OH 1LTTC 1LKAA 3TJVA 3VN0A 4Y99C 2H6MA 1QBVH 4ZHLU 1YQ3C 3FWNA 3LIDA 1QL8A 5AW7B 2SGFE 3GG2A 3PO1C 4F4OC 2ZFRH 3EYDA 5C3NA 1IQKA 1SGDE 3A0BE 2A06D 3GY7A 2SGEE 3A0HE 2FXOA 3PRBA 3MUDC 3P8FA 1LT9B 1QL9A 1S83A 3T62A 3NK8A 1TQ7B 3H1KD 4LXBH 1P02A 5HYOA 1TX8A 1S5LE 1D4PB 1N7SD 1A0LA 1HFDA 3PMHB 1IFIA 5KAFE 4KELA 1ELVA 2UUKB 3IWMA 4TPYA 1LHGH 4H0LB 2QJPC 4IL6X 1YJ9P 1KYOD 1MQ6A 2GMTC 3QTVH 2G5NA 1GI0A 1BJVA 3H6PA 5C1YA 8GCHG 3TVJB 1J1DB 1E1QD 3JCUE 4NPFX 2AMDA 1FY3A 3I77A 1FZBA 2J98A 4X2WA 4AB9A 1EOJA 2ZU5A 3O6QB 3S7HB 1NAFA 2K9YA 4K8BA 3FP8E 1V2NT 3BG8A 1YCPH 3JSVC 1GMHF 1JXPA 1CZQA 1GBEA 1SFCA 4GHTA 2LXBA 3F9EA 1AQ5A 2EC9H 3VB3A 1T7CA 1DE7H 3ZZ4A 1NO4A 2GZ9A 1KMHB 3B5ND 1XVOA 2A4QA 1AO5A 3DT0H 3RLWH 5ETXA 5KLVE 2IX7C 5HKKD 2BY5X 2BDYA 1H8HD 1CT4E 1P03A 1EZVE 1DD3A 3P92A 2WSEJ 1WQSA 1FJKA 1SHHB 1O2UA 1YF4A 2GJGA 2WV4A 3OEED 2QXHA 3W95A 1A02F 1CE5A 1ABIH 2PGBB 3RXPA 3H1HD 1GG6B 1AUTC 1N7SB 4U3FG 4ZMDA 1SSXA 3H1IJ 5F8ZA 4W7ZA 1W2KH 4JMYA 2P95A 3RC5A 1F2SE 5JBTA 3TSIA 4OGXA 1SFCC 4I8HA 3IITA 1RS0A
chains in the Genus database with same CATH topology
3ZIAD 3VG8A 2E76D 4PV1D 1NBMD 3O8CA 1KQFB 2YIUC 1SKYE 1HJ0A 2WSSD 3Q3DA 2VBCA 3D6YA 1MKMA 4WH6A 3AEFC 2OBOA 5EQQA 1DIPA 1DXPA 3AE6C 3AECC 2AHME 3OE7D 1OHHD 2JDID 1S1CX 3N99A 2OC7A 4R4LA 1PL5A 3G9RA 5C0UA 3RC6A 3KN2A 2WPDD 1IK7A 2G3AA 1NGMB 3LKWA 2XOKD 2XCNA 2FOMB 3KF2A 3OAAD 5L8RJ 2M2AA 3SYJA 3H25A 1ZRTE 2YMSC 3O8RA 2WZQA 3F0OA 4H0LC 3SU5A 1OW6A 5EPYA 2OINA 1VL2A 3AEDC 5GPIB 5EQRA 1Y9BA 2XNDD 1BMFD 1KILE 3AE4C 3OFND 3P8NA 4A1TA 3SFEC 3AE7C 2KCYA 2WSCJ 3KNXA 2W6JD 2BEZF 5FL7D 5FPYA 1PV3A 4I32A 5GNDA 3Q1MA 2ZT9D 3SU0A 3E90B 5CDFE 1K04A 4M9FA 3AEGC 2WQYC 3FO8D 3OYPA 1DD4A 1KTMA 3FOAA 1U57A 3AE2C 2E75C 4A1XA 3O8DA 4U01A 3AE1C 4FETA 3IN6A 4H44D 2QF4A 3M5LA 2FYNC 2IJOB 3GS9A 1E79D 3SUFA 4YXWD 2WSFJ 3WWBA 2ZT9B 3M5MA 3FKSD 1OW8A 3AK5A 2IDBA 1DXWA 2IJD1 3PV5A 2FM2A 1RQVA 4B73A 1OMIA 4KTCA 2K0QA 4Q4LA 1KORA 1BT7A 3F2FA 1RTLA 3LOXA 1A1RA 1PIXA 2F4LA 5DSFA 4B76A 4OGQC 3SU1A 2QV1A 2QJKC 2OBQA 3LONA 5KLIC 2P10A 1KMIZ 4XFJA 2E76C 4PV1C 3Q5SA 1GMJA 3D71A 2F43B 4TSFD 3N7DA 2YMKA 3P8OA 1Q90D 1VF5D 3IAOA 2JJ1D 4A92A 4NWKA 1W0JD 4ASUD 2WPVB 4Y28J 1OW7A 4OGQB 2KCAA 4I31A 4YXDC 2E74D 1S5LX 3RK3E 3M5OA 4R4MA 2WV9A 3OEHD 2E76B 4PV1B 2KZ4A 1EFRD 3SUDA 3GMAA 3AEEC 1E1RD 1KQGB 3AEAC 2D2CD 3U1JB 3SUEA 4Z1MD 2G8YA 3SV9A 5EQSA 2A4RA 2KFWA 3PRDA 1EXIA 1NS3A 4A1VA 5GJ4B 3AE5C 3SUGA 3SU6A 3F2GA 2XNIA 1WXRA 2KR7A 4DT4A 2OK5A 2E74B 3AE3C 4NWLA 3SV6A 2K1QA 3M5NA 2OQQA 2J5UA 3PV2A 2MKVA 2F9UA 3RC5A 2ZT9C 3RL0g 3SV7A 2A4GA 4I7ZC 3D70A 5IDKA 1DY9A 1TU3F 2FP7B 3Q5RA 2OC8A 1K05A 1N1LA 2OC1A 4F55A 4I33A 2KCOA 2QSIA 5EPNA 2FXPA 3FGAD 3O8BA 3NRLA 1ZP0C 2XCFA 4Q63A 3U1IB 3DCLA 5H4IB 3FN8A 5C0TA 4B75A 3UB0A 1W0KD 4B6FA 3H09A 1FX0B 3F2HA 4I7ZB 4H44C 2V7QJ 5DN6D 2QJYC 2QF5A 4TT3D 3W1EA 2NZ2A 1ZMEC 1H8ED 3ABVC 4R8TB 3L6PA 1R8EA 3F0PA 3S9OA 2H89C 2KM0A 2WHXA 1RGQA 2P59A 4H44B 3R4YA 4GDOA 2CK3D 3WW7A 2GGVB 1DY8A 1RQUA 1W3CA 2JP3A 1ZOYC 4H13D 4YTPC 3DSPA 3D6ZA 3SU2A 3DSOA 1WMKA 3SZEA 3B71A 3OTPA 5IK2D 1NBME 4XD7D 5ESBA 1MABB 1VF5C 3AE8C 4ZCNA 1AJYA 3Q5PA 4H13C 3Q2YA 2KCPA 3SV8A 2JJ2D 5KKZC 2HLDD 2W6ID 4B71A 1JB0J 2YMSD 4WF8A 3O6QA 4H0LD 3T97B 1FDOA 3EWKA 2JIZD 2E74C 3KEEA 3AEBC 4TT3H 1COWD 1VF5B 1HF9A 4TYDA 3SU4A 4H13B 5T1VA 2JO1A 2YOLA 2D2CC 3AE9C 3RC4A 2LELA 4KT0J 3SFDC 5C17A 1YQ3C 2QE7D 5CHBA 3EYDA 5F53A 3LW5J 3PRBA 3N7EA 3GF3A 2E75D 4B74A 2YMSB 2D2CB 5B6LA 4H0LB 2QJPC 4IL6X 4U7JA 2FBWC 1E1QD 2O01J 2BEQD 3WWFA 3F3BA 2GVFA 2O8MA 2K9YA 4K8BA 2L6OA 1CU1A 4B6EA 2QIWA 1JXPA 4OM9A 3SU3A 3C8VA 1NYHA 5FPSA 4RI0A 3GF7A 1KMHB 2A4QA 2H88C 5ETXA 4WH8A 4Z1MH 5HKKD 1S6LA 1FDIA 1H8HD 2V7QD 1DD3A 2WSEJ 3OEED 5M1BA 2OC0A 1YQ4C 1UIXA 2F9VA 2E75B 2K8IA 4RKUJ 3GLMA 4JMYA 5FPTA 4OGQD 1EXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q5S A;  1DIP A;  3D71 A;  3Q1M A;  3D70 A;  3Q5P A;  3Q2Y A;  2QF5 A;  3IAO A;  3Q5R A;  2QF4 A;  4R4L A;  3G9R A;  3T97 B;  3D6Z A;  1R8E A;  3Q3D A;  2OQQ A;  2J5U A;  3D6Y A;  1EXI A;  4R4M A;  1EXJ A; 
#chains in the Genus database with same CATH topology
 3S9C A;  3FXD A;  3F9F A;  2KK7 A;  2YO2 A;  1EZS C;  1IHT H;  1S6H A;  2I1K A;  3F9G A;  3LJO A;  1ZOM A;  1AVG H;  4HJG H;  2FS8 A;  5DKM A;  1O2T A;  2GM4 A;  1C2L A;  1NBM D;  2F9O A;  5T6G A;  3O8C A;  2V4H A;  5JBA S;  1HGV A;  4MG3 A;  3PTN A;  5LPE A;  1SKY E;  4Y0Z E;  1DUE A;  2BXU H;  1GI1 A;  1O3J A;  1RF1 A;  5FCR A;  1K1O A;  1ELG A;  2WSS D;  1NU7 B;  3VB6 A;  2G81 E;  2RN0 A;  2CJI A;  1PP9 J;  3B5N B;  2FLR H;  2VBC A;  2V3M A;  3TGI E;  2SPZ A;  1ARB A;  3CC2 P;  1HXF H;  1OWE A;  1ZSL A;  2PSX A;  2W6B A;  5AVR B;  3L3T A;  1OVR A;  2OBO A;  1P10 A;  1RTF B;  4DJZ B;  5KAI E;  1SQB E;  2DE8 A;  1CBW B;  2ZFF H;  1A3B H;  2ZVN B;  4XBD A;  3WU2 H;  1ZHR A;  2O01 H;  1P05 A;  2ANW A;  3H1J E;  5KED A;  3M3T A;  1O31 A;  1VKY A;  1QUR H;  3KHU A;  2OYH A;  2ZFQ H;  2PKS B;  5C0U A;  8LPR A;  2HOD A;  1FPH H;  1GJ7 B;  3HTK B;  1RF1 C;  4JF7 A;  1DPO A;  1P01 A;  1IK7 A;  2G3A A;  1PJP A;  9EST A;  3LGV A;  3QX5 H;  5K7R A;  3RXJ A;  1ZPZ A;  4K69 A;  5B6O A;  1FS0 E;  5AVX B;  1M56 D;  1C2J A;  3BF6 H;  1HVV A;  4FUG A;  1BGY J;  1YYY 1;  2XCN A;  3AAV A;  4LZ4 B;  1LT9 C;  3RXS A;  3KF2 A;  3ZDM A;  2M2A A;  2OTL P;  1C2D A;  2P2U A;  1SL3 A;  1Y47 A;  3P7K A;  3H25 A;  3M06 A;  1ZRT E;  4U30 A;  2Z9L A;  2WZQ A;  3F0O A;  4H0L C;  1FNI A;  1SQQ G;  1DOJ A;  1DX5 M;  5EPY A;  2OIN A;  2BCC G;  3FZD A;  3L36 A;  4D7G A;  4BTI B;  1ANC A;  1VQM P;  5EQR A;  3RUO A;  1Y9B A;  2QM8 A;  5AW2 B;  1KIL E;  1A5I A;  3OFN D;  3M7T A;  2EEK A;  4EIJ A;  1ANE A;  3RU4 D;  1N86 A;  3TLO A;  1CHG A;  2VVC A;  3PLP A;  1LT1 A;  3BSQ A;  2Z5H A;  5EFW B;  4ABE A;  3CXH D;  3SNB A;  3V13 A;  5AVQ B;  4ABI A;  2BEZ F;  5FPY A;  3L75 E;  1AVX A;  1PV3 A;  3CCJ P;  1HAG E;  3BCC D;  1LDT T;  1XUJ A;  2ZT9 D;  5CMZ A;  7GCH F;  2WSS H;  3SU0 A;  1Z7K A;  4DIH H;  2UWL A;  1EP6 A;  4M9F A;  3SO3 A;  2BY7 X;  1GBT A;  1S85 A;  2GV6 A;  5A0C A;  1YPH E;  3UY9 A;  4ISO A;  4UFG H;  1JY3 N;  2KS1 A;  3E0N B;  1H0T A;  1ZR2 A;  5C5N A;  2P1J A;  5GCH F;  1NU1 G;  3TPI Z;  4HTC H;  1J2J B;  3FOA A;  5T3H A;  5TCC A;  4ZKP A;  1C1O A;  1Y8T A;  1F0S A;  2BDC A;  3B5N A;  2PKA B;  3LT3 A;  7LPR A;  1GG6 C;  1THR H;  3UUZ A;  2IPP A;  4DT7 B;  2NU4 E;  1BTX A;  1MCT A;  2J4I A;  1IHS H;  1T8O A;  4A7I B;  1QL1 A;  2GDD A;  4FVD A;  3P17 H;  1IC2 A;  1IFD A;  1OSS A;  2YKQ A;  1Y3Y A;  3S4R A;  1P2M A;  3GYL B;  1AE8 H;  1MTS A;  3IN6 A;  1GGD C;  3Q00 A;  2Y5H A;  2D8W A;  1EC5 A;  1QLE D;  3V6I A;  3U1C A;  1FZC A;  2ZIQ H;  5AVD A;  5TJX A;  1ZR4 A;  5I25 A;  3FZZ A;  1C5Z B;  1B5G H;  1NFU A;  2IJO B;  1T6A A;  1L0L E;  4KHX A;  3A7W A;  3LGI A;  2OYI A;  1G3E A;  3HTK A;  5AVU B;  1K9M Q;  1C5N H;  3GOV B;  1EAX A;  5L2Z H;  2WSF J;  1G32 B;  1AI8 H;  1V2S T;  3STJ A;  3UWI A;  1DWB H;  3WWB A;  5ABW A;  2ZT9 B;  3L74 E;  1FJS A;  5HM2 A;  1OW8 A;  3B5N C;  1BCC E;  2WT7 A;  2R2W U;  1SOZ A;  3MI4 A;  4WVP E;  5A2M H;  1MH0 A;  4C7R A;  1SR5 C;  2GT7 A;  4D8N A;  1EJA A;  1S82 A;  3ATI A;  6CHA B;  4NIW A;  2ZEC A;  1LTA C;  5J4Q A;  2VIN A;  2R2M B;  2OD3 B;  1EAI A;  2IJD 1;  1KYN A;  1CBW C;  2FM2 A;  1UJ1 A;  2VIP A;  3PV5 A;  2QE7 H;  3CEN A;  1YLC A;  3V4W A;  1OMI A;  2BAS A;  2GD4 B;  2J2U A;  1NKN A;  3D62 A;  3UNR A;  1C1S A;  1M90 Q;  4Q4L A;  4GOE A;  2TGT A;  2VIW A;  2TPI Z;  4H4F A;  3CXH H;  1EZQ A;  1TRM A;  2H9E H;  5CJ0 A;  4NA9 H;  3RXQ A;  5DP5 A;  2PKS C;  1HV7 A;  2QN5 T;  4H42 U;  3F2F A;  1PGJ A;  4UFD H;  1BT7 A;  4MNX A;  3GY5 A;  2WSC H;  1P9U A;  1GBB A;  3I56 P;  4PD4 D;  3BTK E;  3SU1 A;  2QV1 A;  1NTM J;  3EA8 A;  5APW A;  1W11 U;  1YPE H;  5HMA A;  1XKB C;  3M9Q A;  1PPJ E;  2JR8 A;  3HE5 A;  4XFJ A;  1GMJ A;  1PPB H;  2WPH S;  5K0H A;  3A89 A;  2BDH A;  3I55 P;  1AFQ C;  1E0F D;  1Y5B T;  3LC5 A;  3P95 A;  3VB5 A;  1FDM A;  2MJZ A;  3IAO A;  3V12 A;  1TRN A;  2JJ1 D;  5AW4 B;  1BTY A;  1FQ3 A;  2M8R A;  4OS5 A;  4YZU A;  4DJG A;  5DO4 H;  5A8Y A;  1OWI A;  4XBC A;  1LNQ A;  1W5C E;  5KLV G;  1UTP A;  2C4F H;  5C94 A;  3FWL A;  2QIQ A;  4YO9 A;  3CC7 P;  1NO9 H;  3TH3 H;  1EZV G;  2C3S A;  7EST E;  2GV7 A;  2PKA A;  2XC4 A;  1Q31 A;  2WPS A;  2WPJ S;  1Q2W A;  5EST E;  1QJ1 B;  4MN4 C;  3GCO A;  2ZI2 H;  5C1U A;  3PV4 A;  1JEK A;  3A86 A;  5CBO A;  4CH2 B;  2WIN I;  3QGJ A;  1BGY D;  4ZH8 A;  1TPO A;  3AEE C;  1HBT H;  5C5O A;  1ZMJ A;  2JJL A;  1K1L A;  2P67 A;  1E1R D;  2V6N A;  3A8B A;  1GBD A;  1UCY E;  1Q86 Q;  2A7H A;  2QYI A;  2ZU1 A;  4GAW A;  3GY2 A;  4GLY A;  4M7G A;  5E0J A;  1VQ8 P;  3SV2 H;  2SGD E;  3U1J B;  4Z1M D;  2ZDN A;  1E36 B;  2KI7 B;  3PP5 A;  1NT1 A;  2VU8 E;  1C5T A;  1C1R A;  2A4R A;  3KZI H;  2KFW A;  1ELT A;  2CV3 A;  2P3T B;  3MQK C;  1LHE H;  2A31 A;  3PRD A;  1EB1 H;  3D23 A;  3KQB A;  3AVZ A;  1VQ4 P;  4TLF A;  2ZGB H;  1EP5 A;  3SOS A;  4ASH A;  1Y5A T;  4JK5 A;  4I1L A;  1V2M T;  3H1L J;  4ASW A;  3N7O A;  2G4T A;  5LH8 A;  1O2L A;  1A4W H;  5APQ A;  3UPE A;  3AE5 C;  1BIT A;  1SGY E;  1WXR A;  2KR7 A;  1SQB G;  2OK5 A;  4DT4 A;  4PD4 H;  3AE3 C;  1IQH A;  1OVU A;  2FIR H;  1VQ5 P;  1GBI A;  5APX A;  5A8X A;  1TNH A;  4Y8Z A;  2ZCL P;  1AFE H;  1QHR B;  1WOF A;  3H1J G;  1EPT A;  1ZV8 A;  3P32 A;  3FAN A;  1C5S A;  4RSP A;  4ACA A;  1GPZ A;  2VIV A;  3CXH I;  5FX5 A;  1SGC A;  2ZT9 C;  1J15 A;  1F92 A;  1UTJ A;  3RMM H;  1WT6 A;  1GBF A;  4SGB E;  1IQF A;  4I7Z C;  3UIA A;  3D70 A;  4XDE A;  1ELE E;  1DY9 A;  1TU3 F;  1GMC F;  6CHA C;  1O35 A;  2XXL A;  6GCH G;  1TAB E;  1O3K A;  1BCU H;  4JK6 A;  1HPG A;  1TBQ H;  1AVW A;  2ZXE B;  3MOC A;  2FEQ H;  4F55 A;  3L71 J;  4I33 A;  1P8V C;  1JY2 P;  2QSI A;  5GTH H;  2PUX B;  5B5E E;  2ZPR A;  3SJ9 A;  1ZMN A;  3FGA D;  2C0W A;  3O8B A;  2ZXX A;  2G5V A;  1HAP H;  1SGR E;  1Z8R A;  2CPS A;  3E1I A;  4ZNC A;  1H8D H;  2FYR A;  2HLC A;  1LTB C;  4K1E A;  1EPT C;  2ALV A;  3DFL A;  1Q3X A;  5A8Z A;  1Z8J B;  2FX6 A;  5BVZ A;  2ZG0 H;  1ZRK A;  1TA6 A;  1DFP A;  4B6F A;  1FX0 B;  1W7X H;  3ODD A;  3TNU B;  2V7Q J;  2FLB H;  3V3M A;  3E1R A;  2QC2 A;  1C5U A;  4D6T D;  3OSY A;  3SOR A;  3NWU A;  2QF5 A;  1HAV B;  4TT3 D;  3BTT E;  2H9H A;  3CC4 P;  1N6Y A;  1SQR A;  2VVV A;  2LPR A;  3RXV A;  3L75 G;  2NZ2 A;  2J59 M;  4Y7B A;  1UVS H;  1ZME C;  3PMA B;  2ULL A;  2O01 N;  3V2N A;  2A45 B;  1FY1 A;  2IZ1 A;  3ATW A;  5EOK A;  2QVA A;  5APU A;  3S9O A;  2WYG A;  5CMX H;  4ABH A;  1GHA F;  1LHD H;  1O2S A;  3PYH A;  3EFG A;  2WHX A;  5HGG A;  4HB1 A;  1YY3 A;  1HIA B;  2G00 A;  1DLK B;  3KDP B;  4HZH A;  2IPQ X;  1NTM D;  2QG4 A;  4C7N B;  1MUU A;  4NIV A;  4ZKO U;  2PLX A;  1C1M A;  5JB9 S;  1C5V A;  2BDI A;  2BX4 A;  1KTT B;  3HGN A;  4INL A;  3Q3X A;  3H1I E;  4IS5 A;  1YLD A;  4TWY A;  3SU2 A;  3W94 A;  1UTQ A;  1HLT H;  4PD4 I;  3HD7 A;  2GTB A;  5JBB S;  3VGC C;  3ZZ5 A;  1D7M A;  1IOE A;  3QZR A;  1QEX A;  3RDZ A;  1O3D A;  3KCG H;  2HR3 A;  1L0L G;  1ELA A;  2Q6D A;  4XD7 D;  5EXN A;  2Z5I A;  1KTS B;  1TB6 H;  2CN0 H;  3CS7 A;  5E79 H;  4X6O A;  1GMD F;  2FO9 A;  3AE8 C;  2W8Z A;  3L74 G;  2C93 B;  3Q5P A;  1BMM H;  2YIU B;  1LTJ B;  1VQ7 P;  1BCC G;  2NPS A;  3TJO A;  2GUV A;  2XU6 A;  2JJ2 D;  2OYO A;  3JZ2 B;  2ZZU H;  3B8E B;  2D1J A;  2HRV A;  1TQ0 B;  1ZRB A;  4B71 A;  4FU7 A;  1OX1 A;  2ZFS A;  4JYT A;  2K9J B;  1NZQ H;  1NTZ D;  4NFF A;  1PP9 E;  2VIO A;  1K22 H;  5APV A;  3TF5 A;  1AKS A;  5APS A;  1H8A A;  2AMP A;  4KTU A;  3HE4 B;  1GW3 A;  2OCV B;  5EJZ A;  1M57 D;  1TON A;  1IFJ A;  1P2N A;  1SQT A;  4I8L A;  3TK6 A;  2P58 A;  1HAI H;  4TT3 H;  1ZTJ A;  5E2O A;  1VF5 B;  1IQM A;  2BD5 A;  1F0U A;  1IQG A;  3BTM E;  6LPR A;  1N8O B;  1QX8 A;  2IFM A;  3CP7 A;  2VNT A;  2JO1 A;  2YOL A;  1T3U A;  1GBC A;  5HXF A;  2NU0 E;  2BLW A;  2LEL A;  1Q81 Q;  3SFD C;  3C1K A;  1PPJ G;  3ZZB A;  2XDJ A;  3FP7 E;  3ZZ6 A;  1O2K A;  4DY7 B;  2BLO A;  1SGP E;  2EQN A;  1G9I E;  1P2O A;  4ZHA A;  2B8O H;  1VQN P;  4MNY A;  1HGZ A;  3H1K J;  3V0X A;  1ZML A;  1BGY E;  2D26 C;  4VGC B;  1WCZ A;  2N1T A;  3VYI A;  1TYN A;  1TE0 A;  5EIY A;  3L72 D;  3TK9 A;  1DAN H;  3L70 D;  2IYO A;  5G4B A;  2W3K A;  3CS0 A;  1LMW B;  3G4S P;  3MHV A;  1D6W A;  5EJL A;  2ZFT A;  5B6L A;  2FBW C;  1O3I A;  2P16 A;  1BUI A;  3L73 J;  4AFS A;  1M1J A;  2Z9J A;  1JM0 A;  1FZG A;  1SGF G;  2FOD A;  3QZQ A;  3CX5 D;  2O01 J;  2BEQ D;  4AGJ A;  4CR5 A;  3F3B A;  2GVF A;  4UB8 H;  1KXE A;  4CRD A;  1MFT A;  1FOS F;  2O8M A;  4ISI H;  3HK3 B;  4RT0 A;  1JNM A;  1PFI A;  2L6O A;  3PLB A;  2STB E;  2C9L Y;  3RBZ A;  2FPZ A;  2JH6 D;  2C8W B;  1YGC H;  3A2A A;  2O8U A;  1P57 B;  1TFX A;  3SU3 A;  1TX7 A;  1ZJD A;  4ABD A;  4I2L C;  5GIB A;  2ZDM A;  1GZL A;  4K35 A;  5AW5 B;  1NTM K;  1SHY A;  1OS8 A;  1INC A;  3PWC A;  2QJP B;  2SGP E;  3V7T A;  4WH8 A;  2O8L A;  1O37 A;  5CJ4 A;  3S0N A;  1SGQ E;  3TH4 H;  1P84 E;  2V7Q D;  3FFG A;  3DD2 H;  1BTP A;  1KXB A;  1NRP H;  2ANK H;  2THF B;  1ABJ H;  1OWD A;  5AW9 B;  3RXD A;  3H1H J;  1J1E C;  1SGT A;  3BEU A;  1L1N A;  1OX3 A;  2FYU J;  1TMU H;  1AY6 H;  1JBU H;  2XBV A;  2M3B A;  2K8I A;  1NH4 A;  2C0X A;  4RKU J;  2Y6T A;  3CLQ A;  4XE4 A;  4Y76 A;  4M3L A;  2WUC A;  2BQ7 B;  3MU8 A;  2RDL A;  1DIT H;  1NM6 A;  1XX9 A;  3MD0 A;  4DOQ A;  1KLJ H;  4YTA A;  1EXJ A;  4NIX A;  3EE7 A;  2V3H H;  1YBK A;  3ZIA D;  3F1S B;  1DLE A;  4IBL H;  1C2E A;  3GDU A;  3UFA A;  3OX7 U;  3RXO A;  2AGE X;  1VJ9 U;  2QCY A;  3F89 A;  4HI3 A;  2E76 D;  1TRY A;  4GUX A;  1F0R A;  2BLV A;  1KQF B;  1G3D A;  2ZA5 A;  2YIU C;  4RJT A;  1NTZ K;  1FY5 A;  2HAL A;  2J98 B;  2B89 A;  2ZO3 H;  2CHA B;  1G2L A;  2FOA A;  4FOU C;  1YTZ I;  1VIT F;  3Q3D A;  3RXG A;  3D6Y A;  1FC2 C;  2OQU A;  1O2W A;  1CSO E;  1L2E A;  4WH6 A;  1SP4 A;  1GI2 A;  1RTK A;  1KLT A;  4JZI A;  4ABA A;  3CX5 H;  2E5T A;  4DGJ A;  3NKK A;  1DIP A;  1DXP A;  2Q1K A;  1G3B A;  3IFM A;  4ZMA H;  3AE6 C;  2AHM E;  1S9K D;  4F48 B;  1H89 A;  1MTN C;  1SQP D;  1U6Q A;  3UOP A;  3GCT G;  1N8O C;  1KSN A;  3RXR A;  3N99 A;  2OC7 A;  5GTI H;  3CCV P;  4JZD H;  6EST A;  3MHW U;  4IL6 H;  1PL5 A;  3I78 A;  1THS H;  1IK9 A;  1AN1 E;  4DG4 A;  5DJU B;  5LPF A;  1KB9 E;  3E7K A;  1YI2 P;  1GCD A;  4PJ0 E;  2WPD D;  4FUD A;  5AFZ H;  1JOU B;  3U59 A;  1FDP A;  3P8C D;  2QEX P;  1XVM A;  1GBK A;  5DK1 A;  3QUM P;  2ITA A;  1T8N A;  4P00 A;  1NN6 A;  3K2U A;  3LKW A;  4THN H;  4N78 E;  1L0N D;  5DPA A;  4H6S B;  2V7Q H;  4VGC C;  2RMZ A;  1OPH B;  5L8R J;  1MZA A;  2AGG X;  2L74 A;  2ODY B;  2OP9 A;  2YKO A;  1W0Z U;  1MMJ N;  2I6Q A;  3VOP A;  1X7A C;  1K73 Q;  5A0A E;  3P70 B;  3SGQ E;  1FY8 E;  8EST E;  1DWE H;  1YKT A;  2QA4 P;  1QBN A;  3ZZD A;  1OW6 A;  1VL2 A;  2TGD A;  3AED C;  5GPI B;  3SHC H;  1RF1 B;  1ESA A;  2Z9K A;  1W12 U;  3P8N A;  2HFE D;  1Y8A A;  3OU0 A;  1SI5 H;  2H2Z A;  1USE A;  1HJB A;  3MU1 A;  3PJS K;  3M0D C;  1JWT A;  1SQA A;  2VWN A;  2WSC J;  3KNX A;  2W6J D;  3BCC J;  4OVN F;  2AXT H;  3H1I G;  1LQE A;  1YC0 A;  5FL7 D;  1VQO P;  1V2Q T;  2OQ5 A;  3PH0 A;  4DII H;  1T8Z A;  4I32 A;  1GI3 A;  1K1J A;  2ZTZ A;  1QTF A;  1SQV D;  1AHT H;  1TGT A;  1JY2 O;  4ACB A;  1IFM A;  1FIZ A;  1O2V A;  2QRX A;  2EI8 A;  3TGK E;  2OYH B;  3D65 E;  3KYG A;  2HOD B;  1QZ8 A;  4AB8 A;  2AYW A;  1QBO A;  3L73 D;  2C8Y B;  5I46 H;  4GIF A;  3T27 A;  2Z7F E;  2WPR A;  5AVW B;  2VH0 A;  4JCN A;  3UIR A;  1GJC B;  1NOH A;  3AE2 C;  3QO6 A;  5AVV B;  4DZO A;  3HKI B;  4FUJ A;  2B7D H;  1BRB E;  3H1L E;  1PP9 G;  1GJ8 B;  3QLP H;  5DP6 A;  3GDS A;  3TNT A;  4U01 A;  1D9I A;  1BBR E;  5E0H A;  2Y5G A;  5GDS H;  1O34 A;  1O0D H;  1BE3 J;  1N8R Q;  4UE7 H;  3CX5 I;  4UEH H;  2F9B H;  1ELB A;  2F9N A;  2ZQ2 A;  3M5L A;  3E1X B;  2V0B A;  2B9B A;  2R5D A;  2C8X B;  1LWU B;  4X1N U;  3EQ2 A;  3GS9 A;  3C1L A;  1DT2 A;  3SUF A;  1PPZ A;  2CHA C;  1PPC E;  2BLQ A;  1GCT B;  4IN2 A;  5CE1 A;  3BTQ E;  2HVY B;  2FYU D;  2PAJ A;  5C20 A;  1AWF H;  2HVX A;  3W67 A;  2V35 A;  2FYZ A;  3KHV A;  2PWX A;  4I7Y H;  3RXE A;  2ALP A;  3ZVE A;  2BVS H;  1BHX F;  1SQP K;  5JPM H;  1BDD A;  1RF0 A;  1PZQ A;  1GGD B;  1BGY G;  2Y81 A;  4WY4 A;  1QRZ A;  3L71 E;  3MO9 A;  1A46 H;  4UDW H;  2VVU A;  1NRS H;  2K0Q A;  3RL0 D;  1X22 A;  1QRX A;  1XUH A;  2KS1 B;  2FFD A;  1IQI A;  1H0T B;  1ZPB A;  3A87 A;  2W6J H;  4Y6D A;  1FZZ A;  4YOI A;  3SBK A;  2AER H;  1A1R A;  1YPJ H;  2F4L A;  1FUJ A;  1TBZ H;  1QFK H;  5DP9 A;  2HOB A;  2YKP A;  3M37 A;  1OWJ A;  1GU5 A;  4CHA C;  1HAO H;  1L0N K;  1WBG B;  2QF3 A;  4J1Y A;  1FAV A;  2AEI H;  1KYO H;  1HAZ B;  2BOH B;  2OBQ A;  1DS2 E;  5KLI C;  2P10 A;  1QGF A;  2W6A A;  3LPR A;  2E76 C;  5LPR A;  5H2F H;  1BZX E;  4NSV A;  1NTK D;  2L91 A;  2WVR A;  1O2Q A;  3N7D A;  3P8O A;  1O38 A;  2FI5 E;  4E06 H;  4AFU A;  1C5Q A;  3ZVC A;  1FZC B;  1M9U A;  1NFX A;  1Y59 T;  4A92 A;  1HXE H;  1W0J D;  1CO7 E;  4AFZ A;  5BRR E;  4MPU A;  4DVA U;  1HJ8 A;  2FFD C;  1KIL A;  1T3J A;  2OYI B;  3RBX A;  1C1W H;  1XXD A;  1DSU A;  2KCA A;  1MZD A;  4B1T A;  4YXD C;  1FJP A;  1KV4 A;  2WT7 B;  1TLD A;  2PHB A;  3GHG A;  2A45 G;  4BWN A;  1RD3 B;  1TOM H;  3A83 A;  3UQO A;  1P2K A;  4BTU B;  3CCR P;  3G3Z A;  2C90 B;  1F5K U;  1SQV K;  2OUA A;  1EFR D;  1SOT A;  1AFQ B;  3SUD A;  1MTU A;  1SFI A;  5EG4 A;  3PMJ A;  4X2V A;  3ZVF A;  2AEF A;  5CCG A;  3EA7 A;  1UO6 A;  3WUT A;  2SFA A;  2UUY A;  2IBZ D;  5FBI A;  3K9X B;  1RH5 B;  2D2C D;  4GCH G;  3SUE A;  1YCP M;  2OYH C;  3GCN A;  2BX3 A;  5DP3 A;  3SV9 A;  2ZHQ H;  3A7T A;  1LWU A;  2P3U B;  1EAT A;  5PTP A;  1LJ2 A;  2ZAE B;  4OS6 A;  4FVB A;  1CT2 E;  1HAX B;  2H43 A;  2A2X H;  2A0Q B;  3HE5 B;  2P93 A;  1OYQ A;  1UVU H;  2PFE A;  3A8C A;  3A7V A;  2BD7 A;  5E0G A;  2AIQ A;  1VCW A;  2R44 A;  1YP9 A;  1FN8 A;  1GI9 B;  4I8J A;  2XNI A;  2ZPS A;  1D3D B;  3UQV A;  2FZZ A;  2FY8 A;  3II6 A;  1Z8I B;  1NJI Q;  1HAH H;  1LVB A;  3DUX H;  3GIC B;  4NWL A;  1ZTK A;  2WPL S;  1P11 E;  1CGH A;  2OXS A;  1KFN A;  3NXP A;  5DJT B;  1LWU C;  2FYU K;  4RES B;  5BU8 B;  3PV2 A;  5KEC A;  1GJB B;  4AZ2 B;  3A5T A;  1EZX C;  1TGB A;  5SGA E;  1GCT C;  1R5L A;  5IYT A;  3STI A;  3ITI A;  4DCK A;  5JBC S;  4KTS A;  3RK2 D;  1VR1 H;  2FOB A;  3A85 A;  4Y0Y E;  1B0F A;  2GX4 A;  3KQG A;  1KYO I;  3Q77 A;  2BVR H;  3GIS B;  3SQE E;  2QXG A;  1YJW P;  4IFD K;  2J9N A;  3Q5R A;  2OC8 A;  1V2J T;  2R32 A;  4ZUH A;  2A06 E;  3DSG A;  3F6U H;  2KZJ A;  1N1L A;  2OC1 A;  2ZCH P;  1YTZ T;  1AQT A;  3PLK A;  1BE3 D;  3H1K E;  5EPN A;  2FXP A;  1LTG C;  2GDE H;  1C5M D;  1P06 A;  4Q80 A;  1ELD E;  3GDV A;  1ZP0 C;  4NZQ A;  5APY A;  4OS2 A;  2KNC B;  1YLN A;  2ANM H;  1O5D H;  3U1I B;  4YOG A;  1KYO E;  3TK5 A;  3T29 A;  4HYT B;  4D6T J;  3KYF A;  4U32 A;  3MYW A;  3F2H A;  4I7Z B;  4JYV H;  5DN6 D;  4GHQ A;  3WU2 E;  2GUS A;  2Q7C A;  4D9Q A;  1P04 A;  3KL6 A;  1KQS O;  1K21 H;  4AYC A;  2XTT B;  1FZC C;  1H8E D;  4J2Y B;  3TU7 H;  1CSB A;  3ABV C;  1LTI C;  3EAJ A;  4R8T B;  2R3C A;  2J38 A;  3E91 A;  1M8O B;  2HNT F;  2ZHF H;  1EPT B;  4YT6 H;  5DJ7 A;  2WWW A;  3RK2 B;  1YIJ P;  2H89 C;  2UWJ E;  2OYI C;  1GDT A;  1RIW C;  3HK6 B;  2ODQ A;  4IW4 E;  4WJG 2;  2KXP B;  1YBW A;  1UTN A;  1RGQ A;  1V2W T;  1D6R A;  1O5B B;  4RKJ B;  1MAY A;  2XWB I;  5HIZ A;  2A4O A;  1TNL A;  4L74 A;  4MPX A;  3VXF H;  4GDO A;  1FY4 A;  1HGT H;  2CK3 D;  4B2A A;  2NU1 E;  3A7Y A;  3RL0 C;  3K5B A;  1WYK A;  1ZPC A;  1AA0 A;  4RN6 A;  3AAS A;  1DY8 A;  1A61 H;  1RQU A;  3H1H E;  2ZU2 A;  4XRN A;  3H1L G;  2XW9 A;  2Q6F A;  2VID A;  3VMX A;  3NXS A;  1WSS H;  2ZDV H;  3SZN A;  3L4F A;  1JY2 N;  3A7O A;  1LPZ B;  4IOI H;  2G52 A;  1LPG B;  3MNS A;  1N73 B;  1PQ8 A;  2HNT C;  2ZPQ A;  1UK2 A;  1NY2 2;  2XYA A;  1O3C A;  3SGB E;  2PP6 A;  2XRC A;  1B0E A;  1YPL H;  2A7J A;  2HWL B;  2W26 A;  2A5K A;  3OTP A;  1UII A;  1EDL A;  1NBM E;  3MP7 B;  1SLU B;  4MPW A;  3BAS A;  1S4X A;  3HD7 D;  2R5B A;  1MD8 A;  3Q3K A;  3U69 H;  1QB9 A;  5J4S A;  1AJY A;  1DH3 A;  4H13 C;  3Q2Y A;  2BM2 A;  2QY0 B;  3SV8 A;  1USD A;  3TIT A;  1NTZ J;  2RCE A;  3UTU H;  2HLD D;  2W5E A;  1AZ8 A;  4WF8 A;  1W10 U;  3V2P A;  1L4D A;  3T97 B;  4WXV A;  1EDI A;  1GHW H;  3NMD A;  3OW2 O;  2NPS D;  1S6F A;  4EOT A;  3V2R A;  2POH A;  4U3F D;  1K2I 1;  1Y3U A;  2LNC A;  3L71 G;  1NAY A;  3VGC B;  2IZ0 A;  4JZ1 A;  4WMD A;  3A8D A;  1CGI E;  3A80 A;  2KNC A;  4YLU A;  2BY9 X;  3ZVG A;  3KEE A;  3ZZ8 A;  1F0T A;  1GJD B;  2Q1J A;  3SJI A;  1V2U T;  2FDA A;  3PRJ A;  1TOC B;  1IJD B;  4LLH A;  4NPE A;  1P2Q A;  2BD2 A;  2UWO A;  2B87 A;  2GT8 A;  3GCH B;  3SU4 A;  3UNQ A;  1EZU C;  3ATM A;  3QWC H;  5T1V A;  5TCA A;  1H8I H;  2D2C C;  2G55 A;  4H6T A;  2IBZ I;  2WUB A;  1G1J A;  4OS1 A;  4YLQ H;  3VMZ A;  4O9V A;  3FAO A;  1Z71 A;  5CHA B;  1TNJ A;  1HB0 B;  2ZVO B;  2BY6 X;  3A8A A;  4INH A;  3U8O H;  1M7L A;  1EST A;  2VB0 A;  5F53 A;  4AG1 A;  5EW1 H;  3HD7 B;  2Y0C A;  2CK3 H;  1A0J A;  4B86 A;  1OVV A;  3L72 J;  2WPI S;  4ISN A;  3L70 J;  1TBR H;  3N7E A;  1N6X A;  4X8S H;  2CGA A;  1L1G A;  5T6F A;  3E3T A;  4B74 A;  1O3F A;  1QB1 A;  1ZGV A;  3RXA A;  1NRN H;  2ZYA A;  4A7P A;  4HKZ H;  2Z9G A;  3MH4 A;  2N1T D;  3V2Q A;  1EJM A;  1EQ9 A;  2NPS B;  1CHO F;  1QVG O;  1DUA A;  5AVY B;  4TY6 A;  1LVM A;  1ETS H;  1RFN A;  3RU4 E;  3WWF A;  2YMY A;  3CXH E;  1F5R A;  5A09 A;  3MGN A;  1BDC A;  3CI9 A;  1QY6 A;  3TH2 H;  2WYJ A;  1AKS B;  1E37 B;  1CU1 A;  1N73 A;  1OOK B;  1X0T A;  2O8T A;  3ZZ7 A;  1C5W B;  4NFE A;  3BCC E;  1SLV B;  2C8Z B;  1F5L A;  3RK2 C;  1DVA H;  1LQD B;  1SBW A;  2M3E A;  2UWP A;  3TJN A;  2ILN A;  2JKV A;  1UK3 A;  1BMA A;  1P3C A;  1E38 B;  1XUF A;  2B5T B;  4MQA A;  2H88 C;  3K6Y A;  4D9R A;  5JB8 S;  4Z1M H;  1LPK B;  3EGK H;  2XZR A;  3F9H A;  3KID U;  3T28 A;  1SQQ D;  3LGU A;  1C2K A;  4N6J A;  3SQH E;  1GHY H;  2Y9Z A;  2XWA A;  4FUH A;  1E35 B;  5M1B A;  2BY8 X;  3SSU A;  3T97 A;  1PYT D;  2F9V A;  4MTB A;  3A84 A;  4I8G A;  1SGN E;  1A02 J;  3MU0 A;  1YPG H;  1CW5 A;  2PGQ B;  1N73 C;  1BSH A;  3GLM A;  3OY5 U;  4XSK U;  1A0H B;  3MIW A;  2N1T B;  3E8L A;  2CF8 H;  5FPT A;  1ZLL A;  4AFQ A;  4AG2 A;  4NA7 A;  4OGQ D;  8GCH F;  3F5H A;  1V2V T;  1V6D A;  3UNS A;  1LHF H;  3OA7 A;  2KX4 A;  4TWW A;  1JMO H;  1X9V A;  1BE3 E;  1KXC A;  1URQ A;  1RE3 A;  4B2C A;  1EB2 A;  1C4Y 2;  3E16 B;  5AVT B;  1C2F A;  1TMB H;  3RK3 D;  2D2D A;  1M1J B;  4PV1 D;  1AMH A;  1XUK A;  2SGQ E;  1T4U H;  1JIR A;  2XV5 A;  3M7U A;  1GVK B;  3MH5 A;  1GD2 E;  2FOF A;  1J1E B;  1O5F H;  1HJ0 A;  1PQ7 A;  1DIC A;  1UK4 A;  3RXH A;  1LP1 A;  3LW5 H;  1NU1 D;  3USS A;  2WV5 A;  3PTB A;  3KZI E;  4RO0 A;  1Z1J A;  3SWY A;  1GL2 D;  2H7H A;  2R0L A;  3CCE P;  3SGA E;  4ABJ A;  2GKV E;  1MKM A;  2A06 G;  4XA4 A;  1O2P A;  1SGI B;  3PMB B;  1KIG H;  2ZP0 H;  3U9A H;  3H1K G;  1C5Y B;  3AEF C;  1FN6 A;  1SQP J;  2PGD A;  5DG6 A;  3AEC C;  3PHL A;  1JCD A;  1AD8 H;  2JDI D;  1MKX H;  1SB1 H;  3GCH C;  4X2X A;  5E8E H;  1RE3 C;  3LGY A;  4L75 A;  1IFP A;  1LCY A;  2FX4 A;  2Q3E A;  3RC6 A;  7GCH G;  4PD4 E;  4BRY B;  1AWH B;  2OTV A;  3IG6 B;  1QA0 A;  2BMG B;  3BN9 A;  1FON A;  5CHA C;  1ZHM A;  4TPI Z;  1HH0 A;  1L0N J;  1TX6 A;  5AHG H;  3HGP A;  3LH3 A;  4KJM A;  2O9Q A;  3QK1 A;  1NGM B;  2PRR A;  1XTC C;  5L2Y H;  1XMN B;  3PM3 A;  2BQ6 B;  5F8T A;  3V5B A;  1D3T B;  3HD7 C;  3RK3 B;  3A7Z A;  3M7Q A;  1YCP K;  2Z3E A;  4UB6 H;  1MTN B;  5AFY H;  3SI4 H;  1MTW A;  1YJN P;  4IGD A;  3O8R A;  4LOY H;  4RKO B;  2NRG A;  1W0Y H;  1GJ4 H;  4JZE H;  2ZYD A;  1FU1 A;  2UUJ B;  8KME 2;  2NPS C;  3DFJ A;  4LC1 A;  1BTZ A;  2XBY A;  1MKX K;  1PPG E;  4IC5 A;  2XND D;  5GTH E;  1BMF D;  2ZGC A;  2W90 A;  2VGC B;  3AE4 C;  2LR2 A;  3QDZ B;  1XUI A;  3URE A;  2ZF0 H;  3T5F H;  1GJ9 B;  1S72 P;  3H1H G;  4TY7 A;  1OYT H;  4A1T A;  3SFE C;  4YM9 A;  3BRV B;  3MO3 A;  2KCY A;  4K60 A;  1OXZ A;  2FS9 A;  3BTG E;  3TGU J;  4UFF H;  1QL7 A;  2M5A A;  2WZ7 A;  1C4U 2;  1TMT H;  1SQV J;  2AS9 A;  2Y82 A;  4K3J A;  2QAA A;  1P2I A;  1AUJ A;  1G3C A;  1OP8 A;  1WTG H;  5GND A;  1FLE E;  5EXL A;  3Q3Y A;  1ZJK A;  1SQQ K;  4Z0K A;  2FYQ A;  4E05 H;  3E90 B;  5CDF E;  1K04 A;  2KUB A;  2EI7 A;  4QMA A;  3H7T A;  5KLV D;  2FWW A;  2GP9 B;  2ZQ1 A;  2WQY C;  1YIT P;  2OGU A;  1H4W A;  1GDN A;  1VIT H;  2QA9 E;  2FKW B;  3OYP A;  4EYY Q;  5BPE A;  2BQW B;  1KTM A;  1EZV D;  3U1A A;  2JKH A;  3RXC A;  1GL0 E;  2KAI A;  1CT0 E;  4A1X A;  5C67 A;  4XE5 B;  2LXC B;  3T2N A;  2ZHW H;  4Q2K A;  1PPE E;  3NZI A;  2FI4 E;  2K1A A;  1HRT H;  2N1T C;  4WY3 A;  4IFF A;  3SWK A;  1BIO A;  1NRQ H;  1CGJ E;  4FET A;  1TAL A;  4MNW A;  4H44 D;  1AVO A;  1MBQ A;  1EQ7 A;  1V3X A;  2IN2 A;  1M1J C;  1ETR H;  3FX0 A;  3G01 A;  1NU1 K;  4FU9 A;  1HBW A;  1MQ5 A;  4BRY A;  4U2W A;  9LPR A;  4YXW D;  1ZXG A;  1GBH A;  3WY8 A;  3A0B H;  4WB4 A;  3A0H H;  1S0R A;  3R0F A;  3M5M A;  2E5Y A;  3AK5 A;  1GJ6 A;  2IDB A;  1IFN A;  2VWL A;  2DE9 A;  2Q9I A;  2EY4 C;  4O9B A;  5KAF H;  5KTB A;  5E79 E;  4L73 A;  1BRU P;  1GI5 A;  3EE0 B;  4KGA A;  3MZW B;  1MBM A;  2YNB A;  2XND H;  3GY4 A;  2LP6 A;  4X1R U;  1LVY A;  1S84 A;  4K5Z A;  2HG5 D;  2A32 A;  4O3U A;  3JCU H;  2RG3 A;  1SQB D;  2BB4 A;  3RXL A;  1PYT C;  1GL2 A;  1FOS E;  4NCY A;  3MTU E;  3HUS B;  4WY4 D;  2RH0 A;  1VCP A;  1HUT H;  3KQC A;  3H1J D;  3BRT B;  1RTL A;  3BVH A;  1J9C H;  1G1I A;  2HYN A;  1PGQ A;  3UAI C;  2M5T A;  4OGQ C;  3CCQ P;  3LH1 A;  1BML A;  1KXA A;  4D6T E;  3QWO C;  4K3A A;  4OH8 B;  1G30 B;  3ODF A;  2N9B A;  1C4V 2;  4AYY B;  4WXI A;  1CA0 B;  3H5C B;  3U98 H;  1NTK J;  1TPA E;  2ZYG A;  2QJY B;  2KIK A;  3A88 A;  3LON A;  3URC A;  5L30 H;  1O2Z A;  3RK3 C;  4PV1 C;  2F43 B;  1O3O A;  3Q76 A;  4TSF D;  4ZHM U;  4YT7 H;  3BCC G;  1HWT C;  2NU3 E;  4UD9 H;  1NES E;  1Q90 D;  2Y80 A;  4AOQ A;  4IFM A;  1P9S A;  4HGC A;  2BOK A;  2WPM S;  2R0K A;  2BD3 A;  4NWK A;  4GOF A;  4O97 A;  2WPV B;  1ZSK A;  5DP7 A;  3RXF A;  4BAM B;  1PQ5 A;  1S3J A;  1GL2 C;  1OW7 A;  1BTU A;  2NWN A;  3RU4 T;  3VTP C;  2I8D A;  2B0F A;  1ZRT D;  4ZKS U;  5FCK A;  3T26 A;  2BZA A;  1KN7 A;  1YHQ P;  4CRG A;  4CHA B;  1G2C A;  2VGC C;  3NTN A;  2H9T H;  3QGN B;  1NTM E;  2KZI A;  1ORF A;  3RP2 A;  1S5L X;  3RK3 E;  3M5O A;  4R4M A;  1O2H A;  1Y5U T;  5KLI B;  1KIL D;  2PW8 H;  3SNE A;  2E76 B;  2K88 A;  2HGT H;  2XC5 A;  1BHX B;  5AVS B;  4HG6 A;  5DP4 A;  1AVY A;  3LU9 B;  2FOH A;  3PB1 E;  4AUW A;  4WY4 B;  3GMA A;  2Z6B D;  3NPS A;  1O39 A;  4YXW H;  2YO3 A;  1EX3 A;  1QCP A;  2W7S A;  3L75 D;  4LK4 A;  3PTZ A;  3ZYE A;  3LC3 A;  5KLV K;  5A0B A;  1HJ9 A;  1GMC G;  1PPH E;  2FFD B;  4UB8 E;  2K3R A;  1BE3 G;  2G8Y A;  3GYM A;  1T31 A;  2P8O B;  3I5C A;  2GZ8 A;  5CCG D;  4ZXX H;  1AFO A;  1O3A A;  1NRR H;  2N9Y B;  1AV1 A;  3ZVA A;  3FXE A;  2QXI A;  1JRT A;  1DEE G;  3MTY A;  5C39 A;  5EU8 A;  4X6N A;  5KAI H;  1Q82 Q;  4A1V A;  3N4X A;  3LDX H;  3C9I A;  5GJ4 B;  1A5H A;  1FI8 A;  3TGU D;  1O3P B;  3NFQ A;  1NTZ E;  2ASU B;  1KXF A;  1OP2 A;  3OY6 U;  3SNC A;  5L6N H;  1FXY A;  1ZTL A;  5KKZ B;  2ZTY A;  1J17 T;  3KXD A;  1GU4 A;  1SLQ A;  2F3C E;  4AX9 H;  5EW2 H;  1GI8 B;  1SG8 B;  1H9H E;  3HUS A;  1KIL B;  1K9O E;  2A7C A;  2K1Q A;  2QF0 A;  3LGW A;  4CBN A;  3G71 P;  1LHC H;  1KY9 A;  3V4Q A;  2BD9 A;  2J5U A;  1XM1 A;  1AU8 A;  1AIX H;  1AB9 C;  3D49 H;  2OLG A;  2VIQ A;  1L0L D;  2Y0E A;  1KD1 Q;  3GHG B;  2DW3 A;  3P8M C;  5AW1 B;  1O2M A;  2SGA A;  3GY3 A;  5AVZ B;  1UMA H;  3ZZ3 A;  3MNX A;  3SV7 A;  1ZN5 A;  2A4G A;  1L4A D;  1P2J A;  1J16 A;  1OWK A;  1GHA G;  1Z6E A;  3L74 D;  1EUF A;  1O2X A;  3NUM A;  5IDK A;  1SFQ B;  1WUN H;  4Y11 E;  1BCC D;  2HPQ H;  1SQB K;  2KOG A;  1QQU A;  3ZV9 A;  1L2P A;  1ZW0 A;  2O1J A;  2ZTX A;  1ZYO A;  4NPD A;  3SN8 A;  1SQX J;  3VB4 A;  2R3Y A;  2GA1 A;  1M1K Q;  2HLO A;  3CWB J;  1EZV I;  3HUS C;  3VP8 A;  3RXU A;  1L4Z A;  3L72 E;  3L70 E;  2FOG A;  4NIY A;  1GI6 A;  1WV7 H;  2QM7 A;  3BEF B;  5FXL A;  1BRA A;  4R0I A;  3EA9 A;  2BD4 A;  3DCL A;  5H4I B;  3FN8 A;  5F8X A;  4C46 A;  1YM0 A;  1V2T T;  1NC6 A;  1EAW A;  1K1M A;  2FMJ A;  1K1P A;  3CX5 E;  5HIY A;  1Z6J H;  4H44 C;  2G51 A;  1CA0 C;  3CNR A;  2A2Q H;  2QJY C;  3A7X A;  1C1T A;  2FXR A;  2H1U A;  4JPZ B;  1KDQ A;  3BAT A;  5AW0 B;  1YPM H;  1PPJ D;  5GTI E;  1GMD G;  2VRS A;  1NFY A;  4IL6 E;  5KGO A;  1HDT H;  2BDB A;  2OTK E;  1BMN H;  1GHB G;  5CBN A;  5FAH A;  1VQK P;  2ZU3 A;  1Y3V A;  3P6Z B;  1JOC A;  1R8E A;  4OGY A;  2IOT A;  1EAU A;  1L4A B;  1FPC H;  4FUE A;  3CCM P;  1JO5 A;  3GY6 A;  2ZGH A;  2PSY A;  4IN1 A;  2ODP A;  1MKW H;  4BNR A;  1XTG B;  2TGA A;  3CCU P;  2AFQ B;  2P59 A;  1O3L A;  2IYP A;  6GCH F;  5TJH A;  4L76 A;  4DT0 A;  2FTM A;  4EST E;  1DDJ A;  1H9I E;  1K1I A;  3WW7 A;  4WWI A;  1RF0 C;  1E34 B;  4WY4 C;  1H1B A;  3KPE A;  3ZYD A;  3M9B A;  4EI2 A;  2XC0 A;  3RGU A;  1FZA A;  2FI3 E;  4H13 D;  1ZOY C;  4YTP C;  2BTC E;  4XOJ A;  3CCS P;  3DSP A;  3ZVD A;  1RIW B;  1PGO A;  1O5G H;  1OP0 A;  3HRN A;  4K8Y A;  2R3U A;  2P8O C;  3DSO A;  3JZ1 B;  2Z94 A;  3AAU A;  1LT9 A;  3B71 A;  1KFM A;  1T2K D;  3URD A;  2AXT E;  4JBZ A;  5IK2 D;  1QR3 E;  2AH4 X;  5CCH D;  2O1K A;  3RL0 B;  3CCL P;  2J95 A;  3WUU A;  1MKW K;  4K2Y A;  1XXF A;  3M3V A;  2F9P A;  1SGE E;  2DUC A;  2VWO A;  1CVW H;  2GCH G;  1WDI A;  3FVF B;  2ZU4 A;  5KKZ C;  4GKG A;  2YMS D;  3RXT A;  5EJ1 A;  4U3F J;  1B7X B;  3SNA A;  4ZKU A;  3O6Q A;  4GVU A;  1FDO A;  3EWK A;  1GWA A;  2WMM A;  4IMZ A;  3SND A;  1KIL C;  1FZF A;  3TGJ E;  1AZZ A;  2KLU A;  1L0L K;  1S9K E;  1SQP E;  1NPM A;  3EST A;  3B8J A;  1VPC A;  3AEB C;  1QVF O;  1COW D;  1Z8G A;  4NZL A;  4BAQ B;  1P0S H;  7KME H;  2XBX A;  3GHG C;  1HF9 A;  2PFX A;  1IQN A;  4H13 B;  3GW6 A;  5LGO A;  4D6T G;  3AE9 C;  3RC4 A;  4JQ0 D;  4JYU H;  2QXJ A;  4KT0 J;  3P8C E;  2ZNK H;  5C17 A;  1J1D C;  1MZ9 A;  5CCG C;  1GHX H;  2ZWL H;  4FUC A;  1L0N E;  1HAY B;  3W68 A;  1OKX A;  1IQL A;  1YPH C;  2QE7 D;  4X8U H;  3PRO A;  1QJ7 B;  1WTH D;  5CHB A;  2F83 A;  1GBL A;  2YNY A;  1N7S A;  2RFK C;  3LW5 J;  4BXL A;  3SI3 H;  1L4A A;  2WTY A;  1BQY A;  2QGR A;  2L5G B;  2H5C A;  3EFF K;  1K0H A;  1W8B H;  4CR9 A;  3GF3 A;  3N7N A;  1U7J A;  2E75 D;  1QNJ A;  4HFP B;  2W27 A;  1K1N A;  4NA8 A;  1NKZ B;  5CHX A;  1TGC A;  2YMS B;  3VFE A;  2D2C B;  1MCV A;  3QN7 A;  4U7J A;  1NTM G;  1T8L A;  1GBJ A;  2HPC B;  3U8T H;  1UCY H;  2OAR A;  2XBW A;  3G6E P;  1DST A;  1GI7 B;  1LO6 A;  4ISL A;  2IPH A;  1GTW A;  3MWI U;  3IR9 A;  1P12 E;  5T6D A;  1O2I A;  2H5D A;  4X0W U;  1SQX D;  3TGU E;  3F68 H;  1EDJ A;  1GL1 A;  4B6E A;  1N7S C;  2QIW A;  1XKA C;  1SQV E;  4OM9 A;  1ELC A;  3CWB D;  3C8V A;  1L4A C;  1NYH A;  1VIT G;  5FPS A;  4WWY A;  4AN7 A;  1FAX A;  1KQL A;  3GF7 A;  4RI0 A;  1W2B O;  3L37 A;  4WVZ A;  2B87 B;  1FAK H;  4SGA E;  1NTK K;  5H2F E;  1SQQ J;  3L73 E;  2BCC J;  1BA8 B;  1KLI H;  2RDE A;  4E7N A;  1O5C B;  1S6L A;  1SLX B;  1FDI A;  1VQL P;  1O3E A;  2ZGJ A;  1QRW A;  1GDQ A;  1C1Q A;  2AMQ A;  3SJO A;  1D3Q B;  2Y9Y A;  2B9L A;  4ZKR U;  2OC0 A;  1YQ4 C;  1NTZ G;  1UIX A;  2JWD A;  3OTJ E;  1UCY K;  1VDF A;  4IC6 A;  2E75 B;  1C2I A;  2Q6G A;  2V3O H;  3MMG A;  1QGK B;  5AW6 B;  1IQJ A;  2GZ7 A;  3VP9 A;  5APT A;  3H1I D;  5GWZ A;  4D76 A;  4FUB A;  1SGF A;  3A82 A;  2W83 C;  1DWD H;  3CD6 P;  1KZU B;  2WIT A;  1O2J A;  3L33 A;  3VG8 A;  1W2E A;  3GY8 A;  1Q7Y Q;  4XBB A;  1VZQ H;  1JTH B;  3PWB A;  3TJU A;  2AGI X;  1CQQ A;  1MUE B;  1BDA A;  1O36 A;  2FYN B;  4JZF H;  1NU1 J;  3S9B A;  1IAU A;  1O3G A;  1T32 A;  4I8K A;  2FYU E;  2HPP H;  4Z6A H;  1URQ D;  5B5E H;  1VQP P;  1RJX B;  3VMY A;  2NU2 E;  5GXP A;  1RY3 A;  5C1X A;  3BTD E;  2AEJ A;  4MDS A;  4ZAE A;  1C1V H;  2EI6 A;  5CCH A;  1YPK H;  2C9N Y;  4WME A;  4Y10 E;  2J58 A;  1O2O A;  5K5G B;  1PFX C;  2A5I A;  1PP9 D;  4X8T H;  1TPP A;  1UW7 A;  4ZRO A;  2CMY A;  5EQQ A;  3U8R H;  3L72 G;  4E7R G;  1C2M A;  3L70 G;  2BYA X;  1X79 B;  1Z56 A;  3OE7 D;  3EDX B;  4JYB A;  1OHH D;  1YWU A;  2ZGX H;  1P3E A;  1S1C X;  1FMG A;  2P7J A;  3S1K A;  1P09 A;  2ZHD A;  3K65 B;  1SQO A;  1RRK A;  2HPC A;  1D3P B;  4R4L A;  5E2P A;  1JY3 P;  3G9R A;  1O3H A;  3KN2 A;  4CRC A;  3VMA A;  2M0B A;  1BSN A;  2HNT E;  2BZ6 H;  1MTV A;  3RMO H;  1T2K C;  1TWX B;  2QJK B;  1NTK E;  1FIW A;  3ZV8 A;  2XOK D;  5CCH C;  2ZEB A;  1J14 A;  3MO6 A;  1ELF A;  2FOM B;  4Q7Y A;  2BXT H;  4AC9 A;  3CPW O;  3OAA D;  4A6L A;  4JYC A;  3BG4 B;  2WPQ A;  1GMH G;  1TNG A;  3SYJ A;  1URQ B;  3BV9 B;  4A5T S;  3WUV A;  4LGD E;  2YMS C;  2WSE H;  5TIS H;  2BDG A;  3SU5 A;  1W13 U;  3K6Z A;  4BOH A;  4Q7X A;  2LKM A;  2XNX A;  1V2L T;  4FU8 A;  4ABF A;  4UON A;  1FE6 A;  4BAN B;  4CRF A;  1LP1 B;  1EXF A;  5F03 A;  1A2C H;  1GBA A;  1SQX K;  3TIU A;  2J92 A;  1C1N A;  3VB7 A;  4Y8X A;  5AW3 B;  4Y7A A;  4AYV B;  2PUQ H;  1FZE A;  1LTO A;  3SHA H;  3AE7 C;  4AQR D;  1O32 A;  4BAH B;  1WU1 A;  1A7S A;  3GCT F;  3U28 C;  2XKM A;  3B9F H;  2ZDA H;  2B88 A;  3ITK A;  2IBZ E;  4KP0 A;  4WBA A;  3Q1M A;  1NTP A;  2R3S A;  4INK A;  4I86 A;  4D7F A;  1HTL C;  4I6M C;  1H9L B;  1JTH A;  1LGH B;  2Q5U A;  1JIM A;  1BTH H;  1Q2N A;  5KLV J;  1SVP A;  1TAW A;  4ASV A;  3AEG C;  2EA3 A;  2H8P D;  3PLN A;  4PRO A;  4BAK B;  1BRC E;  1OWA A;  1QIX B;  5FX6 A;  2CPB A;  2RA0 A;  4MLF B;  3FO8 D;  4O03 A;  1RXP A;  1QL2 A;  3CME P;  1JCC A;  1DD4 A;  1DWC H;  1UTM A;  1P84 D;  1HYL A;  1U57 A;  4BAO B;  2E75 C;  4YES B;  2W7U A;  5C2Z A;  1S5S A;  3UR6 A;  3RXI A;  1CI6 B;  3O8D A;  1LVO A;  2Z4E A;  1C1P A;  1HJA B;  3MU5 A;  1O5A B;  4GT1 A;  3ENS B;  1WQV H;  3MH7 A;  3AE1 C;  2A1D B;  1C5X B;  1UHB B;  1SQP G;  2RKL A;  4Y71 A;  2QF4 A;  3UR9 A;  3MNB A;  2BCC D;  2FYN C;  2O8W A;  1HUC A;  3HPT B;  4K1S A;  4ABB A;  2FES H;  3BIU H;  2AEM A;  4Y79 A;  1L0Z A;  1E79 D;  3L35 A;  1BOQ A;  1S81 A;  1ZR0 A;  2BVX H;  4RT1 A;  2Z3C A;  1ESB A;  3FKS D;  1JMM A;  3RMN H;  1L0N G;  2M5A B;  1VQ6 P;  1O3M A;  2PR3 A;  3KQE A;  1UVP A;  1SPJ A;  3SJK A;  2BDA A;  1VGC B;  3MU4 A;  3VXE H;  3SWF A;  1DXW A;  1SQB J;  4FXG H;  1RQV A;  2AXC A;  1SQX E;  4B73 A;  4KTC A;  1S0Q A;  4ABG A;  1UVT H;  3H1J J;  1V2P T;  3CWB E;  1KOR A;  1NU9 A;  2KSE A;  1BJU A;  3M0A A;  1O2R A;  1TPS A;  3LOX A;  1PIX A;  1G36 A;  2UUF B;  5DSF A;  4B76 A;  2TGP Z;  4LZ1 H;  3BEI B;  4EDF A;  1AND A;  2KAI B;  3RM0 H;  5JYI A;  1ZLR A;  1UVO A;  1KB9 D;  1G37 A;  1GVZ A;  3B23 B;  4OS4 A;  2QJK C;  2G4U A;  2W3I A;  1QB6 A;  1TIO A;  1HCG A;  1GVL A;  1NRO H;  4F49 A;  4OS7 A;  3Q5S A;  1KMI Z;  2K37 A;  1C1U H;  3NCL A;  1ZZZ A;  3D71 A;  1RHZ B;  1V2R T;  4BTT B;  3TGU G;  3M35 A;  5KJ7 D;  4YPC A;  1FBM A;  1OZH A;  1SQV G;  4N78 D;  2Y0D A;  2YMK A;  5TIS E;  1VF5 D;  1C5R A;  1QQ4 A;  3BG4 C;  1P84 H;  2JH0 D;  1URQ C;  1V2O T;  4ZKN U;  1U7M A;  4ASU D;  2F91 A;  2YXQ B;  4P02 A;  3ZZC A;  2A45 H;  4Y28 J;  1GI4 A;  4X8V H;  3L73 G;  4MNV A;  4CPG A;  3RM2 H;  4OGQ B;  2ZFC A;  1QJ6 B;  3MFJ A;  1THP B;  2TBS A;  4I31 A;  1K8A Q;  2VWM A;  2Z9I A;  4KKD A;  3M3S A;  1ANB A;  1SLW B;  2E74 D;  3RXB A;  2WV9 A;  5GCH G;  3S7K B;  4YOJ A;  1SS1 A;  1O3B A;  2JEE A;  1CI6 A;  4PV1 B;  1EOL A;  3OEH D;  3FP6 E;  2I1J A;  1GJ5 H;  1N7L A;  2KZ4 A;  3C27 B;  3L75 J;  1GHB F;  4AGK A;  2SNW A;  2P3F H;  1E79 H;  1CA8 B;  3ATL A;  4X1P U;  1UHB A;  3HKJ B;  5DGJ A;  1KQG B;  1GL2 B;  1C2G A;  1O2N A;  2Q6Q A;  2JH5 D;  3AEA C;  5AF9 H;  1GK4 A;  2Z3D A;  1ID5 H;  3SW2 B;  2WSF H;  1GHZ A;  4CRE A;  5EQS A;  3CMA P;  3WMM 0;  3A3Y B;  1JMB A;  1YYC A;  3E0P B;  1O33 A;  1TNK A;  1EXI A;  1C5P A;  1NS3 A;  4Q7Z A;  3CL3 D;  2FYU G;  4QT8 C;  4CRA A;  2FTL E;  4GSO A;  5DP8 A;  4W7Y A;  1GW4 A;  4N3Y B;  1VCQ A;  3SJ8 A;  4X1Q U;  4XFQ A;  3TNU A;  2OTJ P;  2YXR B;  2GCT B;  1ZGI A;  3AW0 A;  5HM9 A;  1A5G H;  1HJA C;  1QA7 A;  1OFC X;  4WMF A;  2PTN A;  4X1S U;  3H1L D;  1HAV A;  3SUG A;  1C9P A;  2KLV A;  4U3F E;  3SU6 A;  3F2G A;  3I29 A;  1MV8 A;  3QH9 A;  2E74 B;  1UTO A;  1KB9 H;  1K28 D;  3H7O A;  3SV6 A;  1NHL A;  1R5S A;  4PJ0 H;  1E5W A;  1SVF A;  2ZJS E;  1TA2 A;  3M5N A;  5B66 H;  2G8T A;  1L0L J;  1G2C B;  2OQQ A;  1TGS Z;  2PTC E;  2FOE A;  4CBO A;  3LIW A;  2CF9 H;  1TNI A;  2JET B;  3RXM A;  1C9T A;  1JRS A;  2JDI H;  2MKV A;  2F9U A;  1O30 A;  3RL0 g;  1H88 A;  3L74 J;  4OWF A;  2EST E;  2GCH F;  1HIA A;  3H32 B;  2WPK S;  3R3G B;  1BCC J;  5AW8 B;  2KB7 P;  3O8Z A;  4X6M A;  2KP8 A;  1KC8 Q;  2ZCK P;  4C7N A;  3DHK H;  4GCH F;  1NTK G;  2VJ1 A;  1VGC C;  3ZZA A;  3BIV H;  2FP7 B;  4Y99 B;  1K05 A;  1ACB E;  1GBM A;  5EXM A;  4ZXY H;  5F6M A;  2FXM A;  3B4S A;  1N2D C;  3PO1 B;  2KCO A;  4HH2 A;  1EAS A;  4GPG A;  2PV9 B;  1P84 I;  3BTW E;  1G2M A;  3L71 D;  4IMQ A;  3MH6 A;  3NRL A;  1DEB A;  4GOD A;  1AB9 B;  1W7G H;  4BXS A;  1BB0 B;  2E43 A;  4FUF A;  1T4V H;  2A45 I;  1IQE A;  1O2Y A;  2P94 A;  2XCF A;  1FV9 A;  1OIP A;  4Q63 A;  3UWJ H;  3BTF E;  1VQ9 P;  1UTK A;  5C0T A;  2A5A A;  4W80 A;  4B75 A;  2JWA A;  3MNC A;  3UB0 A;  2ZKS A;  1W0K D;  5EGM A;  3H09 A;  3UOU A;  1S5L H;  2IFN A;  1W14 U;  1XUG A;  2GMT B;  2BD8 A;  1SFC D;  4O3T A;  3JC2 2;  1VJA U;  5JDU B;  2KSJ A;  3M61 U;  2J97 A;  5FBE A;  1EDK A;  4DW2 U;  3VPK A;  1LTJ A;  2Y5F A;  1J8A A;  3KQ5 A;  3RLY H;  3LJJ A;  4CH8 B;  4MPV A;  3W1E A;  2E42 A;  1UTL M;  4Y8Y A;  1A3E H;  4X2Y A;  2IBZ G;  3S69 A;  1O2G H;  2TRM A;  2ZC9 H;  2K9J A;  3BTH E;  1T8M A;  3M36 A;  1OXG A;  3P8G A;  3KQD A;  4X6P A;  3L6P A;  4NSY A;  1X8Y A;  3VEQ B;  2J94 A;  1MFZ A;  1ARC A;  3F0P A;  3HE4 A;  4K1T A;  4B2B A;  3DA9 B;  1C5L H;  2KM0 A;  1RE4 A;  1GK6 A;  1GJA B;  2ANY A;  5KJ7 A;  1F7Z A;  2SNV A;  3M91 A;  1BTW A;  1SQQ E;  4H44 B;  1DM4 B;  5BU5 A;  2BCC E;  3RXK A;  2CXV A;  3QTO H;  2R9P A;  3ATK A;  1S2E A;  3R4Y A;  4UB6 E;  1AE5 A;  1BBR H;  3M9H A;  1JY3 O;  3TYY A;  1GHV H;  1MU8 B;  3BTE E;  4DUR A;  1ZHP A;  1PQA A;  2GGV B;  2J34 A;  1Y3W A;  1HNE E;  1O3N A;  2ZFP H;  4CRB A;  2BHG A;  1W3C A;  2ZDL A;  1LTJ C;  3E6P H;  1OWH A;  4UFE H;  2I6S A;  2JP3 A;  3AW1 A;  2AIP A;  3D6Z A;  1PGP A;  3OAK A;  2ZHE H;  1WRG A;  1O5E H;  4NGA H;  1SFC B;  1WAY B;  1KB9 I;  1WMK A;  3OJA B;  3TK1 A;  3SZE A;  1RE4 C;  5FHT A;  1TGN A;  3EQ0 H;  5KJ7 C;  1JUN A;  1Y3X A;  2Y7Z A;  2TIO A;  3TDK A;  5ESB A;  1MAB B;  1VF5 C;  1LTS C;  1PPF E;  4ISH H;  3H32 A;  3R2P A;  1NWQ A;  4NG9 H;  3RML H;  4MVN A;  3S9A A;  4ZCN A;  1KXD A;  1NU1 E;  1KDQ B;  2KCP A;  2FOC A;  2GCT C;  4DOJ A;  5EOD A;  3T25 A;  1BBR K;  1V2K T;  1ZSJ A;  1MU6 B;  2VH6 A;  2W6I D;  1JB0 J;  1SC8 U;  2YNA A;  4H0L D;  3ELA H;  1EKB B;  4FUI A;  1CHO G;  1MAX A;  1SMF E;  2KYV A;  2E74 C;  5B66 E;  2JIZ D;  3LIE A;  3HAT H;  1NFW A;  1LKB A;  1GDU A;  3MUD A;  1SQX G;  3M0D A;  1Z1I A;  3TNS A;  3ZZ9 A;  1EJN A;  3A81 A;  2Q3I A;  2O3J A;  4BXW A;  3KGP A;  2Y7X A;  3CWB G;  1C2H A;  2RA3 A;  1L1J A;  1AGJ A;  1NVO A;  4AOR A;  2JET C;  3ZVB A;  4DCD A;  2STA E;  4TYD A;  1IO4 A;  3KYQ A;  2ZDK A;  3LGT A;  1ETT H;  1DX7 A;  1AQ7 A;  3IF4 A;  1MD7 A;  1IZN B;  1C5O H;  1LTT C;  1LKA A;  3TJV A;  3VN0 A;  4Y99 C;  2H6M A;  1QBV H;  4ZHL U;  1YQ3 C;  3FWN A;  3LID A;  1QL8 A;  5AW7 B;  2SGF E;  3GG2 A;  3PO1 C;  4F4O C;  2ZFR H;  3EYD A;  5C3N A;  1IQK A;  1SGD E;  3A0B E;  2A06 D;  3GY7 A;  2SGE E;  3A0H E;  2FXO A;  3PRB A;  3MUD C;  3P8F A;  1LT9 B;  1QL9 A;  1S83 A;  3T62 A;  3NK8 A;  1TQ7 B;  3H1K D;  4LXB H;  1P02 A;  5HYO A;  1TX8 A;  1S5L E;  1D4P B;  1N7S D;  1A0L A;  1HFD A;  3PMH B;  1IFI A;  5KAF E;  4KEL A;  1ELV A;  2UUK B;  3IWM A;  4TPY A;  1LHG H;  4H0L B;  2QJP C;  4IL6 X;  1YJ9 P;  1KYO D;  1MQ6 A;  2GMT C;  3QTV H;  2G5N A;  1GI0 A;  1BJV A;  3H6P A;  5C1Y A;  8GCH G;  3TVJ B;  1J1D B;  1E1Q D;  3JCU E;  4NPF X;  2AMD A;  1FY3 A;  3I77 A;  1FZB A;  2J98 A;  4X2W A;  4AB9 A;  1EOJ A;  2ZU5 A;  3O6Q B;  3S7H B;  1NAF A;  2K9Y A;  4K8B A;  3FP8 E;  1V2N T;  3BG8 A;  1YCP H;  3JSV C;  1GMH F;  1JXP A;  1CZQ A;  1GBE A;  1SFC A;  4GHT A;  2LXB A;  3F9E A;  1AQ5 A;  2EC9 H;  3VB3 A;  1T7C A;  1DE7 H;  3ZZ4 A;  1NO4 A;  2GZ9 A;  1KMH B;  3B5N D;  1XVO A;  2A4Q A;  1AO5 A;  3DT0 H;  3RLW H;  5ETX A;  5KLV E;  2IX7 C;  5HKK D;  2BY5 X;  2BDY A;  1H8H D;  1CT4 E;  1P03 A;  1EZV E;  1DD3 A;  3P92 A;  2WSE J;  1WQS A;  1FJK A;  1SHH B;  1O2U A;  1YF4 A;  2GJG A;  2WV4 A;  3OEE D;  2QXH A;  3W95 A;  1A02 F;  1CE5 A;  1ABI H;  2PGB B;  3RXP A;  3H1H D;  1GG6 B;  1AUT C;  1N7S B;  4U3F G;  4ZMD A;  1SSX A;  3H1I J;  5F8Z A;  4W7Z A;  1W2K H;  4JMY A;  2P95 A;  3RC5 A;  1F2S E;  5JBT A;  3TSI A;  4OGX A;  1SFC C;  4I8H A;  3IIT A;  1RS0 A; 
#chains in the Genus database with same CATH homology
 3ZIA D;  3VG8 A;  2E76 D;  4PV1 D;  1NBM D;  3O8C A;  1KQF B;  2YIU C;  1SKY E;  1HJ0 A;  2WSS D;  3Q3D A;  2VBC A;  3D6Y A;  1MKM A;  4WH6 A;  3AEF C;  2OBO A;  5EQQ A;  1DIP A;  1DXP A;  3AE6 C;  3AEC C;  2AHM E;  3OE7 D;  1OHH D;  2JDI D;  1S1C X;  3N99 A;  2OC7 A;  4R4L A;  1PL5 A;  3G9R A;  5C0U A;  3RC6 A;  3KN2 A;  2WPD D;  1IK7 A;  2G3A A;  1NGM B;  3LKW A;  2XOK D;  2XCN A;  2FOM B;  3KF2 A;  3OAA D;  5L8R J;  2M2A A;  3SYJ A;  3H25 A;  1ZRT E;  2YMS C;  3O8R A;  2WZQ A;  3F0O A;  4H0L C;  3SU5 A;  1OW6 A;  5EPY A;  2OIN A;  1VL2 A;  3AED C;  5GPI B;  5EQR A;  1Y9B A;  2XND D;  1BMF D;  1KIL E;  3AE4 C;  3OFN D;  3P8N A;  4A1T A;  3SFE C;  3AE7 C;  2KCY A;  2WSC J;  3KNX A;  2W6J D;  2BEZ F;  5FL7 D;  5FPY A;  1PV3 A;  4I32 A;  5GND A;  3Q1M A;  2ZT9 D;  3SU0 A;  3E90 B;  5CDF E;  1K04 A;  4M9F A;  3AEG C;  2WQY C;  3FO8 D;  3OYP A;  1DD4 A;  1KTM A;  3FOA A;  1U57 A;  3AE2 C;  2E75 C;  4A1X A;  3O8D A;  4U01 A;  3AE1 C;  4FET A;  3IN6 A;  4H44 D;  2QF4 A;  3M5L A;  2FYN C;  2IJO B;  3GS9 A;  1E79 D;  3SUF A;  4YXW D;  2WSF J;  3WWB A;  2ZT9 B;  3M5M A;  3FKS D;  1OW8 A;  3AK5 A;  2IDB A;  1DXW A;  2IJD 1;  3PV5 A;  2FM2 A;  1RQV A;  4B73 A;  1OMI A;  4KTC A;  2K0Q A;  4Q4L A;  1KOR A;  1BT7 A;  3F2F A;  1RTL A;  3LOX A;  1A1R A;  1PIX A;  2F4L A;  5DSF A;  4B76 A;  4OGQ C;  3SU1 A;  2QV1 A;  2QJK C;  2OBQ A;  3LON A;  5KLI C;  2P10 A;  1KMI Z;  4XFJ A;  2E76 C;  4PV1 C;  3Q5S A;  1GMJ A;  3D71 A;  2F43 B;  4TSF D;  3N7D A;  2YMK A;  3P8O A;  1Q90 D;  1VF5 D;  3IAO A;  2JJ1 D;  4A92 A;  4NWK A;  1W0J D;  4ASU D;  2WPV B;  4Y28 J;  1OW7 A;  4OGQ B;  2KCA A;  4I31 A;  4YXD C;  2E74 D;  1S5L X;  3RK3 E;  3M5O A;  4R4M A;  2WV9 A;  3OEH D;  2E76 B;  4PV1 B;  2KZ4 A;  1EFR D;  3SUD A;  3GMA A;  3AEE C;  1E1R D;  1KQG B;  3AEA C;  2D2C D;  3U1J B;  3SUE A;  4Z1M D;  2G8Y A;  3SV9 A;  5EQS A;  2A4R A;  2KFW A;  3PRD A;  1EXI A;  1NS3 A;  4A1V A;  5GJ4 B;  3AE5 C;  3SUG A;  3SU6 A;  3F2G A;  2XNI A;  1WXR A;  2KR7 A;  4DT4 A;  2OK5 A;  2E74 B;  3AE3 C;  4NWL A;  3SV6 A;  2K1Q A;  3M5N A;  2OQQ A;  2J5U A;  3PV2 A;  2MKV A;  2F9U A;  3RC5 A;  2ZT9 C;  3RL0 g;  3SV7 A;  2A4G A;  4I7Z C;  3D70 A;  5IDK A;  1DY9 A;  1TU3 F;  2FP7 B;  3Q5R A;  2OC8 A;  1K05 A;  1N1L A;  2OC1 A;  4F55 A;  4I33 A;  2KCO A;  2QSI A;  5EPN A;  2FXP A;  3FGA D;  3O8B A;  3NRL A;  1ZP0 C;  2XCF A;  4Q63 A;  3U1I B;  3DCL A;  5H4I B;  3FN8 A;  5C0T A;  4B75 A;  3UB0 A;  1W0K D;  4B6F A;  3H09 A;  1FX0 B;  3F2H A;  4I7Z B;  4H44 C;  2V7Q J;  5DN6 D;  2QJY C;  2QF5 A;  4TT3 D;  3W1E A;  2NZ2 A;  1ZME C;  1H8E D;  3ABV C;  4R8T B;  3L6P A;  1R8E A;  3F0P A;  3S9O A;  2H89 C;  2KM0 A;  2WHX A;  1RGQ A;  2P59 A;  4H44 B;  3R4Y A;  4GDO A;  2CK3 D;  3WW7 A;  2GGV B;  1DY8 A;  1RQU A;  1W3C A;  2JP3 A;  1ZOY C;  4H13 D;  4YTP C;  3DSP A;  3D6Z A;  3SU2 A;  3DSO A;  1WMK A;  3SZE A;  3B71 A;  3OTP A;  5IK2 D;  1NBM E;  4XD7 D;  5ESB A;  1MAB B;  1VF5 C;  3AE8 C;  4ZCN A;  1AJY A;  3Q5P A;  4H13 C;  3Q2Y A;  2KCP A;  3SV8 A;  2JJ2 D;  5KKZ C;  2HLD D;  2W6I D;  4B71 A;  1JB0 J;  2YMS D;  4WF8 A;  3O6Q A;  4H0L D;  3T97 B;  1FDO A;  3EWK A;  2JIZ D;  2E74 C;  3KEE A;  3AEB C;  4TT3 H;  1COW D;  1VF5 B;  1HF9 A;  4TYD A;  3SU4 A;  4H13 B;  5T1V A;  2JO1 A;  2YOL A;  2D2C C;  3AE9 C;  3RC4 A;  2LEL A;  4KT0 J;  3SFD C;  5C17 A;  1YQ3 C;  2QE7 D;  5CHB A;  3EYD A;  5F53 A;  3LW5 J;  3PRB A;  3N7E A;  3GF3 A;  2E75 D;  4B74 A;  2YMS B;  2D2C B;  5B6L A;  4H0L B;  2QJP C;  4IL6 X;  4U7J A;  2FBW C;  1E1Q D;  2O01 J;  2BEQ D;  3WWF A;  3F3B A;  2GVF A;  2O8M A;  2K9Y A;  4K8B A;  2L6O A;  1CU1 A;  4B6E A;  2QIW A;  1JXP A;  4OM9 A;  3SU3 A;  3C8V A;  1NYH A;  5FPS A;  4RI0 A;  3GF7 A;  1KMH B;  2A4Q A;  2H88 C;  5ETX A;  4WH8 A;  4Z1M H;  5HKK D;  1S6L A;  1FDI A;  1H8H D;  2V7Q D;  1DD3 A;  2WSE J;  3OEE D;  5M1B A;  2OC0 A;  1YQ4 C;  1UIX A;  2F9V A;  2E75 B;  2K8I A;  4RKU J;  3GLM A;  4JMY A;  5FPT A;  4OGQ D;  1EXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...