2J5UA

Mrec lysteria monocytogenes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
210
structure length
210
Chain Sequence
TENQHLKERLEELAQLESEVADLKKENKDLKESLDITDSIRDYDPLNASVISRNPTNWNDQVEIDKGSSDGVKPDMAVTTPSGLIGKVTTTGAKSATVELLTSSDVKNRVSAKVQGKENAFGIINGYDSDTKLLELKQLPYDMKFKKGQKVVTSGLGGKFPAGIFIGTIEKVETDKMGLSQTAFIKPGADMYDLNHVTVLKRSAEAGTTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dimeric Structure of the Cell Shape Protein Mrec and its Functional Implications.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Cell shape regulation
molecule keywords MREC PROTEIN
total genus 47
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04085 MreC rod shape-determining protein MreC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2j5uA01
2.40.10.340 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2j5uA02
2.40.10.350 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2j5uA03
1DIPA 1R8EA 2J5UA 4R4LA 3D70A 3Q3DA 3IAOA 2QF4A 2QF5A 3Q5RA 3D71A 3Q5SA 3T97B 1EXJA 2OQQA 3D6ZA 1EXIA 3G9RA 3Q5PA 3Q1MA 3D6YA 4R4MA 3Q2YA
chains in the Genus database with same CATH superfamily
5APWA 5EXLA 1GHXH 4OVNF 1AGJA 1F2SE 4GDOA 1BIOA 4HG6A 3GY6A 2PW8H 2PP6A 3L73D 3AAVA 3TJNA 4BXSA 2V0BA 1VGCC 3A7YA 1XX9A 1C2KA 1ANCA 3NTNA 1IHSH 3EQ2A 2FBWC 3CC7P 2B89A 2CHAB 2HLDD 4ASUD 5BVZA 1EZUC 1S81A 3V13A 1DWCH 1C5RA 4ABDA 2K88A 2B0FA 3JZ1B 3WMM0 5B6OA 1KLIH 2CF8H 3V12A 3SV9A 1GMHG 2C3SA 1SLQA 3UOPA 2XZRA 1HBWA 1FZZA 1RE3C 1BHXF 3MI4A 1DY8A 1FBMA 2E75D 3KXDA 4FUBA 2IOTA 5T6DA 1Y3YA 4JF7A 1O36A 4Z1MH 3HD7C 4LLHA 1UVPA 5JPMH 4AG1A 1BOQA 1KTSB 2V4HA 4FU8A 4X1NU 3E1XB 4LOYH 1DOJA 3SN8A 1SB1H 1GL2A 4HFPB 1KQSO 1F5RA 1H9LB 1OP0A 3QLPH 2HRVA 5KTBA 1BSHA 3K65B 2XWBI 2ZFRH 5CHAC 3RBZA 2MKVA 1K1OA 2ZO3H 3FVFB 4ZCNA 1QL9A 5JDUB 2YOLA 7ESTE 1K8AQ 2HPPH 3WUUA 4L75A 1S9KE 4ZXXH 4D6TD 5DP7A 1FY4A 1F0UA 4IN2A 2ZPRA 7LPRA 3UR6A 5DP8A 3UTUH 3EDXB 4QMAA 2FDAA 3GDUA 3P92A 3S9CA 3LIEA 5KAIH 1FLEE 1E79D 2ZG0H 3ABVC 5BU5A 1OWKA 1QJ6B 2E42A 2ZCHP 3KQCA 1XUJA 2D2CC 2OUAA 1NU1G 1ZOMA 3L74E 1FZFA 1HJAB 2A5AA 3PMJA 3W95A 1FDIA 3MOCA 3FOAA 3PV2A 1GHBF 3UAIC 1O34A 1BGYJ 3BTME 2JIZD 1C4Y2 1S6LA 3TH4H 4Y99C 1YJ9P 1BTZA 2EA3A 4GHQA 4ZHAA 3CCJP 2KSJA 4YXDC 2NU0E 3FP7E 1DDJA 3P8FA 5EU8A 2WT7B 1AWFH 2K9YA 4XE5B 5A8ZA 1RF1B 3H5CB 1GW4A 3CENA 4X8VH 1JY2N 1PPBH 2EI8A 2GV7A 2VB0A 2ZHQH 2A45I 4E7RG 5AFZH 3UFAA 3M0DA 3UUZA 1LTGC 1HVVA 3MHVA 2I8DA 3M7QA 1QA0A 1SI5H 4Q7XA 2D2CB 3EQ0H 1HH0A 3H09A 4NSYA 3W94A 1GWAA 3EFFK 1HFDA 1UTPA 1V2QT 1SGIB 1TYNA 1P10A 1SKYE 3A0HE 1NU7B 1HRTH 4DJZB 2O8MA 2ODQA 4D76A 1BGYG 3QWOC 3RXTA 3BATA 5APSA 1GZLA 3LC5A 4GT1A 2AIQA 1YPEH 3KQBA 3B5NA 5EPYA 1L1NA 5AW7B 4O03A 1TWXB 1D3PB 1YPHC 5A0CA 4ZKOU 3EE0B 1UHBA 1VJAU 2ZFPH 1XMNB 1VQPP 1GMCG 3QDZB 5JYIA 2JR8A 5EXNA 4OGXA 4WF8A 5ABWA 5KKZB 4ZKUA 4Y6DA 1L0NK 2R44A 2OINA 4UFGH 5EGMA 4RT1A 3V3MA 1T8OA 3B23B 3RGUA 2YXRB 1QRXA 3FAOA 2P59A 2ZP0H 1S84A 2SFAA 3ZZ6A 4JMYA 3VEQB 3H1LD 4TPYA 1OPHB 1MV8A 5A0AE 1Q7YQ 5AW1B 5GTHE 2ILNA 3LPRA 3GCNA 3MTYA 2JJLA 3SV6A 3VB3A 4NSVA 3F0PA 1AI8H 2FYQA 3U8TH 5A09A 2O1JA 1RXPA 4H4FA 1MCTA 3E90B 4FUIA 4IW4E 3FN8A 3SJKA 2ZYDA 1RF1A 4U3FD 1NU1D 3LJOA 2Q6GA 4NPDA 1W5CE 4FUGA 3ENSB 1C4U2 1HAHH 2FODA 2N1TD 3ZZ7A 1VF5B 1QA7A 1V2ST 3CNRA 3EWKA 1C1PA 4AGJA 1TBQH 1GJDB 1PPJE 2ZEBA 1O2KA 1ZRBA 3TH3H 1HTLC 1VCWA 2HODA 2XTTB 1L4ZA 2WZ7A 1T6AA 1GJBB 2K37A 1TGNA 2OTLP 2KI7B 2FEQH 1J1EC 4CBOA 1Y3UA 3IG6B 3BCCG 1WU1A 2AH4X 4H44B 2GCTC 3PM3A 2JKHA 4PROA 4B6EA 2OQQA 4GLYA 2E76D 1XUFA 4DT4A 3C1LA 1G2LA 2FXMA 1E36B 1H8IH 1UTQA 3P95A 1KYOD 1GL2B 1OVRA 4PD4D 3VMZA 1GI7B 1OP8A 1JCCA 1UIXA 1URQA 1D6RA 1EJAA 2OD3B 1FZGA 3W68A 3PV4A 4CH2B 4DJGA 2GX4A 1ZR2A 2Q3IA 2BCCG 1MU8B 2YXQB 3GY2A 3L73G 3U1AA 2J2UA 3TK9A 3RMLH 1TGSZ 2WSEH 3A8BA 1CO7E 5HGGA 3BRTB 1F92A 2Z94A 3D62A 3GISB 4K3JA 1TRYA 5F03A 2AXTE 3Q5RA 4CRGA 1YY3A 3ZDMA 2Y9YA 5APYA 1UTNA 1CI6B 1NAYA 3H1ID 3A7VA 2GCHF 3MYWA 4RKOB 4W80A 2JH0D 1U57A 4Y76A 1C5NH 2G55A 1YYY1 1FY3A 2FYNB 1T4VH 3L74J 1Y3XA 2W6JH 4Y8XA 3SU2A 2QIQA 4Q7YA 4BAMB 1B5GH 2EI7A 3SU5A 3CX5E 2BM2A 2Z7FE 2EY4C 5C94A 1YPGH 1IJDB 4LXBH 4TY7A 4X6OA 2WSCJ 2OARA 5IYTA 4W7ZA 2ZGXH 3L36A 5AHGH 4DOJA 1O2UA 1SPJA 3BEFB 5AW8B 1ZRKA 1X79B 3SNBA 1LNQA 3BCCJ 3OU0A 1MBMA 4U01A 2AYWA 1NFUA 3MUDC 2WV4A 2ZECA 4Q80A 1KYOE 1C1OA 1SQVD 3Q1MA 4B71A 1QGFA 1LPKB 1GL2D 1KSNA 2VVCA 2XC0A 3I5CA 3E8LA 1SLWB 1THPB 1EAWA 1HGTH 1L1JA 4N78D 1CBWB 2BY7X 2CN0H 2QJPC 2KLVA 1TRNA 3R3GB 5KGOA 4I86A 2QE7D 3FGAD 1QZ8A 3R2PA 4KP0A 1A61H 1V2JT 2E5TA 4LC1A 4WH6A 4AFSA 5APTA 2WPHS 5TCAA 2OYIB 1MKMA 1O3MA 1FZBA 1S1CX 1VCQA 2P3TB 2BX3A 3A7WA 2FI4E 1L1GA 1VCPA 3KDPB 1DT2A 1HGVA 5EPNA 2A32A 2G81E 3FO8D 1XVMA 1OP2A 4NCYA 5EFWB 3OW2O 2N9BA 2GV6A 2VJ1A 1TE0A 2UWOA 4EIJA 1BTWA 1QURH 4OM9A 4UB6E 3LW5H 4GCHF 1KB9E 2R5BA 3E0NB 4MNVA 3CCVP 2O8TA 4L74A 1E0FD 4XRNA 1SFQB 2H5CA 4KTCA 4ZH8A 1N7SA 4R4LA 3ZZ8A 2ZJSE 1AUJA 1P02A 1Y5BT 3M9BA 2BOKA 2HPQH 1SVPA 3KNXA 1RF0A 1ELDE 3AE6C 3A86A 1TNLA 2WTYA 2J58A 1QTFA 2FOFA 3HUSB 1CZQA 4U7JA 1LCYA 8KME2 1O2TA 3L35A 2Y0CA 2OP9A 4I33A 1QRWA 2JJ2D 2G00A 9ESTA 2M5AB 2JH5D 4JZEH 1HF9A 1C5SA 3E7KA 3CCEP 3UOUA 1TOCB 1Q81Q 2ZU1A 2AEIH 3BTTE 1YPKH 1F7ZA 2PAJA 1LO6A 1YC0A 2QM8A 1P84D 2FLRH 3K6ZA 1DIPA 1DY9A 1FOSE 1AMHA 5EQQA 1A3EH 1G2CA 1WAYB 1XKAC 3MH7A 4M9FA 1E37B 1EAUA 4BOHA 2YO3A 1M9UA 4AX9H 3EFGA 1HAVB 1GW3A 1TALA 2BVXH 2YMKA 4MPVA 1K22H 2B9LA 2QJYC 2BCCJ 2VBCA 1BBRH 1L0NE 2WSCH 4BAQB 2EC9H 1YPJH 1ARBA 1MTNB 1ID5H 1TBZH 2FM2A 1GJAB 1RTFB 4Z6AH 4ABJA 1KV4A 4U2WA 1ANBA 2ZYGA 1L0LJ 1AWHB 2OC8A 1QY6A 4UDWH 4YLUA 1UK2A 4GCHG 4B73A 3MD0A 3MP7B 3BIVH 1FZAA 2VVUA 4D9QA 1C9TA 2EEKA 4Y0YE 1PP9D 1BBRE 1O2VA 1OFCX 3CMAP 3AE8C 1O2IA 2ZHWH 3ATMA 3SV8A 3RMMH 1JXPA 1XUHA 1T8LA 1H4WA 1TIOA 2WSSD 3TNTA 2JWDA 4X6PA 1C2DA 1OXGA 2PKAA 1OOKB 1ESTA 3GDSA 1ANEA 3RXIA 4OH8B 5ETXA 2KZJA 1W12U 2POHA 4W7YA 1YI2P 5DG6A 3CC2P 1DE7H 4AFUA 3T26A 1W8BH 5KKZC 2FYUJ 4KHXA 1Y9BA 1SGNE 1UCYK 3TGKE 4ZNCA 1SFCD 2NPSD 3H1LG 2UUFB 2ZTXA 4LZ4B 3AE5C 1AUTC 1UMAH 2XKMA 1LPGB 3QWCH 2KYVA 1PJPA 4X6MA 2ZQ2A 4RT0A 4IL6E 1C2LA 1E35B 1CI6A 1P57B 1UVTH 3UPEA 3F68H 4Y79A 2VINA 1EOLA 1N8RQ 1EAIA 3CXHI 3DSPA 4ZKNU 3AEAC 2JDIH 1TGCA 1BTXA 4C7NB 4I6MC 4GHTA 3CC4P 1MQ6A 2QF5A 1VITG 3M7UA 2GT7A 2ZF0H 3DT0H 4ZHMU 1BTPA 1K1PA 3NXPA 3VMXA 1HXFH 1DX5M 1GJ5H 3H1JJ 3IR9A 1TX7A 3CLQA 3MHWU 4ZKRU 3RXPA 1G30B 1TOMH 4MNWA 3A83A 3KCGH 1KDQB 5DP9A 2ZZUH 1BCCD 3L74D 1V2RT 5PTPA 1YP9A 3MU5A 1NT1A 2GZ7A 1BE3G 1BHXB 1LVYA 5CJ4A 1HCGA 3ODDA 1NY22 3HKJB 5JBCS 6CHAC 3UNQA 1KB9I 1KB9D 3CCRP 1YITP 4BTUB 2CGAA 3VMYA 1HBTH 1M8OB 3O6QA 4A7IB 2BD8A 1VQMP 2QA9E 2HVYB 1TX6A 1K05A 5L2ZH 2J94A 2LP6A 3SJ9A 2E74B 1EC5A 1AVGH 1QL8A 1SC8U 2FOHA 2WPLS 3WY8A 1TQ0B 1ELVA 1EPTC 2A4OA 4I8LA 4B2BA 3GOVB 3QTVH 1TNIA 3ZV9A 1NTKK 4IL6X 1YGCH 3N99A 1TPAE 3T2NA 3VGCB 1FAKH 4Y10E 1L4AC 3P8NA 2TGTA 2VGCB 4BAKB 1W11U 3WUTA 1WQVH 4I8JA 1J17T 5E0GA 3DSGA 5FPTA 1N6XA 1SOZA 2E75C 3H1JD 1J16A 4WY4C 4WWIA 1EFRD 2E76B 2VWNA 3T28A 1IQKA 3ZZ9A 2ZYAA 3NMDA 3E0PB 2V3OH 3KPEA 1RS0A 1IFNA 1P2IA 3KEEA 2BCCD 4H0LD 3ESTA 3Q3YA 4MPXA 5C39A 1BTUA 2ZCLP 5EXMA 3VP9A 1UK3A 3PWBA 5AW4B 4ISNA 1WTGH 1IZNB 2E74C 2OYIC 3GMAA 1A5GH 1FNIA 2N1TC 1NTZG 1QGKB 5CCGC 1MUEB 1P01A 1V2MT 2C9NY 3GY3A 2IJOB 3TITA 3VGCC 2OBQA 4NPFX 3T5FH 3W1EA 3M5LA 1JY3N 1PPGE 3M35A 1VGCB 4BRYA 2G8TA 1L2EA 4MQAA 2QJKB 1K04A 2SGEE 2M8RA 2IPPA 2J4IA 2Y5HA 3FZZA 3A8CA 1UIIA 3AW1A 2DE9A 3MNSA 2FTLE 5TJXA 3SGBE 3EA7A 5E0JA 3LGUA 1AQ5A 2NU1E 3F5HA 1YF4A 1ABIH 2QA4P 2PUXB 5KLVE 1U7JA 3R4YA 3V6IA 3H1HE 1VQ9P 2F9OA 3V0XA 2VWOA 2V7QH 1PP9G 3I77A 2FZZA 1MKWK 1TGBA 2N9YB 3TF5A 3S69A 4Q63A 8ESTE 3RMOH 5AW3B 3KN2A 2V35A 4NA9H 3VG8A 1L0LK 1C5YB 2HODB 1ORFA 3L70E 1QR3E 2RMZA 2FYZA 3L71G 1VQ7P 1G2CB 2AFQB 2WPJS 3A7ZA 3TU7H 1KILE 3A89A 4F4OC 1RH5B 2ZDNA 1AFOA 3PP5A 1G32B 4B2CA 1EKBB 1XUIA 2SGFE 4WY4D 1D9IA 1O2NA 2XRCA 4Y7AA 2VIDA 5E8EH 5LH8A 4Q7ZA 1AIXH 2PSYA 3DFLA 2RN0A 1AA0A 2M5AA 1W2BO 3RXUA 1IQFA 2HGTH 4CPGA 1WV7H 5F6MA 1DD3A 2YMSC 4X8TH 4L73A 1GI8B 1K1IA 2GKVE 4H42U 3LGYA 3VB5A 4BAOB 4Y28J 4ZMDA 4GIFA 5KJ7C 2F43B 2BYAX 1J1EB 3TJVA 3P17H 4OS7A 1DUEA 3RU4E 5DO4H 1FS0E 2K9JA 1ANDA 4DURA 2VRSA 4TT3H 2Z5HA 2W6BA 1GBBA 1Q3XA 1SL3A 4BXWA 2J59M 1O2JA 1FMGA 2P8OC 2N1TA 2WPIS 4PV1D 2HLCA 1UTLM 1NTZE 1ZP0C 4GODA 3RL0B 2ZU4A 3O8BA 3ZZ5A 5CDFE 4UFDH 4OS6A 3S9BA 1NAFA 4GVUA 1DEBA 3TJOA 1BCCG 1RJXB 1T7CA 5TISH 3SORA 1EX3A 3K2UA 1DFPA 1AVYA 1SG8B 5AVXB 2GT8A 4JYVH 2C0WA 3RXFA 1FDOA 4OWFA 4Y11E 1SS1A 4K1EA 4SGBE 1H8AA 4U3FE 1H0TA 4FVDA 1C1WH 4X8UH 3A82A 5DGJA 5GPIB 1H8DH 4X2VA 3T29A 2CK3H 4WY4B 1KIGH 1GDTA 3B5NC 4EOTA 1ARCA 1BITA 1TBRH 3BF6H 5AW0B 1HAZB 3FXEA 1JIRA 1W7XH 2PRRA 2P3FH 3IN6A 3RL0C 1GHBG 2XDJA 4B86A 4BXLA 4YTPC 1GHZA 2F9VA 2KAIB 2NU3E 2CPSA 2BLQA 4HYTB 1BTYA 4ABBA 2R3SA 2QV1A 1F5KU 1TA6A 5T1VA 1FZCA 4KT0J 2LXBA 1DVAH 2ZT9B 1KXCA 2PSXA 3LGVA 1FPCH 2P3UB 1O3HA 1HAPH 2OCVB 3PH0A 2P16A 1DUAA 3AEBC 4CREA 2E43A 5A8XA 1FIZA 2JO1A 1CHOG 1SGDE 4TLFA 2GD4B 2NWNA 1GVKB 1NRQH 1HJBA 1TLDA 5KAFH 2W7UA 1GVLA 1PPZA 1HAVA 1TPOA 1DXPA 2CMYA 1IQJA 2ANMH 1C5XB 1FPHH 2IN2A 3V2NA 1KMHB 2F9BH 1EB1H 2B5TB 2HFED 3IF4A 1OSSA 2ZAEB 3L33A 2G51A 2WSEJ 3JSVC 1EZVE 3PHLA 2RCEA 2KZIA 2XWAA 1OW7A 4BRYB 1IQNA 4MNYA 3CX5D 1OWEA 2ZU5A 2FWWA 3D6ZA 1FOSF 4X1SU 2FKWB 5IDKA 5HXFA 5LGOA 1GI6A 3F9FA 3HUSA 5AVWB 3RK2C 1FZCB 2ALPA 3BTDE 1QL2A 5BU8B 2B87A 4JYUH 4D7FA 4JBZA 4IC6A 1Z1IA 3CX5I 2J98A 1L0ZA 1EZVG 4PD4H 1ZZZA 2FPZA 3I29A 4OS5A 1O2ZA 2R32A 3A7OA 2A7HA 2WHXA 2FO9A 4UB8H 4ABGA 1U7MA 3VB4A 3SWYA 1BMFD 5AVDA 2D2CD 3RU4T 1OZHA 2YKQA 3B8EB 2XXLA 3BASA 1RRKA 3MZWB 1GJ8B 1LTJC 1O3CA 1Y8TA 2WPQA 1BDDA 1RTLA 2ODPA 2RA0A 3ZVCA 4MTBA 4INHA 1PQAA 1Y47A 1C5QA 1GTWA 2PKAB 5T3HA 1DPOA 4H0LC 4BWNA 1QJ1B 1QVGO 3E1RA 1MTUA 1AE8H 3CS0A 2ASUB 1HWTC 4I1LA 1AVWA 2KCAA 1JMMA 2BEQD 3C27B 1GDUA 4ZHLU 5C20A 6CHAB 1C2GA 2NU4E 2HVXA 1IQEA 1E1RD 1JO5A 4JZFH 2WYJA 3B71A 4IOIH 1VQ8P 1C1QA 1EJMA 1EXJA 1GBFA 5FCRA 3G4SP 2XBVA 3UNSA 2Y81A 1QLED 3BTFE 1VITF 5GTIE 3LH3A 4UD9H 3BTWE 3GHGB 3P8CE 4U3FG 4NIYA 3HE4A 3GLMA 1EDJA 2BDBA 4I7ZC 1EZQA 1ZW0A 1LHCH 1Q86Q 2G4TA 1K21H 2KNCA 1L0LE 5ESTE 5GCHG 1NH4A 1X0TA 3I55P 3ZIAD 5CMXH 2QYIA 1LP1B 1WT6A 3BIUH 3P8OA 4D9RA 2KXPB 2Q1JA 7KMEH 2K1AA 1SQXE 2QGRA 2KCPA 1X9VA 1HJ8A 4RO0A 2WT7A 2O9QA 5APVA 2EQNA 3H1KD 2Y5FA 4K8YA 3SHAH 3ZVFA 5CBNA 2QIWA 2XBYA 5J4SA 2F9NA 3ZZBA 3TLOA 1ZPBA 3O8RA 1FDPA 2AMQA 2ITAA 3K6YA 3SHCH 1NHLA 1KXDA 2EI6A 2IFNA 3GCHC 5F53A 1AKSA 1C5MD 1LQEA 1PFIA 3AAUA 1PPFE 3HKIB 4MLFB 1NTMJ 1LHFH 5BPEA 3EA9A 3P6ZB 2IX7C 3B8JA 3WU2H 1H0TB 2H9HA 2C8YB 3FKSD 4JK6A 2FS9A 4JZ1A 4K3AA 2QJKC 3M9QA 1LTJA 1GI3A 2SGQE 3LDXH 4YM9A 5CHXA 2C8XB 2AGGX 1HNEE 2GMTC 1BMLA 2G5NA 3V2RA 4RI0A 1ELFA 1ZJKA 1J9CH 3H7OA 3RXVA 1GBLA 1O5AB 1V2VT 2ZFSA 3SNEA 4Q4LA 1DS2E 1NZQH 1SHYA 4I8HA 3SU6A 3SW2B 2AS9A 4OS4A 1SQTA 5KAIE 4K1SA 4YOGA 4AGKA 1EQ7A 1SQPD 3NZIA 3QK1A 1K2I1 2FESH 2P2UA 3PJSK 2GUSA 1KILC 4K2YA 3L70G 1SGRE 4LGDE 1QEXA 3P8GA 3VN0A 1JBUH 1ELAA 4RESB 1LHGH 1NBME 2ZHFH 2KP8A 1SLXB 3C8VA 2ZHEH 2XNXA 1PP9E 1JUNA 1P2KA 3LGIA 2ZXEB 2M3EA 2BVRH 4DVAU 5C1UA 1LT9C 2YMYA 3RC4A 3VP8A 1NC6A 5GXPA 1V3XA 3LT3A 2CJIA 3G9RA 1SR5C 2R2WU 1ESBA 1GK6A 2IBZD 3M0AA 1LHDH 3NWUA 1QJ7B 2IDBA 3EAJA 5AW2B 1G1JA 3QTOH 4IMQA 5JB8S 1Q90D 2J9NA 1IAUA 1NTKD 2H88C 1N8OB 1LT9A 1O38A 2R3CA 1FAXA 1OW6A 3PB1E 3KZIH 5EW1H 3CXHH 1VQNP 1C1MA 5DJUB 1XXDA 3RK2D 4O9VA 2Z3DA 5CMZA 2WPMS 1O3DA 2M0BA 2OC7A 1RD3B 1GGDC 3LC3A 1IFIA 3K5BA 2BCCE 1S82A 3OJAB 2O3JA 2H2ZA 1HAOH 3URDA 4X1PU 4PD4E 2P95A 1O2OA 4HZHA 3NUMA 5DJ7A 1SLUB 3EGKH 3L71E 1JTHA 4UB8E 1S83A 1JOCA 1K1JA 3VPKA 3GS9A 1P0SH 3V2QA 1TQ7B 2CF9H 4N6JA 2V6NA 1FZEA 3G6EP 1GDNA 4NWLA 3SU4A 2IPHA 4BAHB 4J1YA 1K0HA 2ANWA 4YPCA 3BCCE 3AEGC 1C5WB 1W3CA 2TGAA 2J5UA 3GY7A 5E79H 2IBZG 3MU4A 5DP5A 1SGTA 3OAKA 1V2TT 4I7YH 4P02A 1JY3P 1QQ4A 4B1TA 2BHGA 5GCHF 4B76A 1KZUB 5HKKD 1K1NA 1NESE 3ELAH 1LWUA 1SQBG 2CK3D 2BB4A 3A7XA 1TPPA 4H13B 4GAWA 1C4V2 3P32A 2WQYC 2O8WA 2YMSD 2QJYB 1DM4B 1TGTA 3QZRA 2ZVOB 3V2PA 1T31A 1PGJA 1SQXG 1OWAA 1ZGVA 2PFEA 3M3SA 3Q3KA 2Y82A 3L70D 1NU1K 1LMWB 4A1VA 1ZPZA 1KFMA 1O2WA 3OEED 1BMMH 4FU7A 1H8ED 5F8ZA 1FAVA 2TRMA 2ZI2H 2V7QD 4N78E 1HJAC 3VB7A 5EJZA 2HOBA 5KLVD 5GTHH 2V7QJ 5FX6A 3CCSP 3SWFA 1DITH 4DIIH 4LZ1H 3AEEC 1NTME 3GY4A 5CE1A 2BVSH 1AV1A 1LTTC 3MO6A 4NPEA 3S7KB 3D65E 1BRUP 1N7SB 1KQFB 4KJMA 3PTNA 2B9BA 2ZFQH 4AUWA 3MQKC 1FIWA 3RUOA 3CL3D 3VYIA 5EQSA 8GCHG 2UWLA 1U6QA 1HLTH 3A80A 1QBNA 1C5VA 2QXGA 2HYNA 1FX0B 4OGYA 1FJSA 1YIJP 1SVFA 5F8TA 4XA4A 3TGUD 1C2EA 1GBEA 1P2QA 1C5UA 1UVUH 1QB9A 1KYNA 2WYGA 1O2RA 1EP5A 2PHBA 3PLKA 4CH8B 2K0QA 1YBKA 3P8MC 1SQVE 4HJGH 3TGUJ 2W8ZA 4K8BA 4Y7BA 3E1IA 4SGAE 1EQ9A 1HV7A 1URQB 1ELBA 1FQ3A 3KYFA 5AVQB 1UCYH 2KAIA 1E79H 3UREA 1P12E 2WV5A 4RKUJ 3Q3XA 3UQVA 4J2YB 4ABIA 1GL1A 2KK7A 4F55A 1TRMA 3MO3A 4AZ2B 3F6UH 2R2MB 1RE4C 1YHQP 2ZVNB 4YXWD 4XD7D 1Y59T 2BX4A 2ZNKH 1CA8B 5C3NA 1GD2E 1AQ7A 2FLBH 2XBXA 1KILD 3DUXH 5K0HA 2F4LA 4H44C 2GCTB 1GI1A 3AK5A 2VGCC 1NTZK 1P84E 2BTCE 3Q3DA 1O3GA 1O3AA 2BY8X 2PWXA 3CS7A 4L76A 2THFB 5EW2H 2JH6D 1MU6B 3HTKA 3CCLP 2E76C 5C5NA 5AVVB 1AD8H 1GHWH 2BD5A 3UIAA 1E1QD 1FONA 3QUMP 1M57D 3G71P 1IFDA 4H6SB 1Y8AA 1G36A 2UWJE 3Q5PA 4ISIH 3RM0H 1HAIH 4WMEA 3L72D 1BDAA 1P84I 1P2JA 1ZYOA 5A8YA 1RHZB 1KORA 1Z1JA 4F49A 1MTWA 3CWBD 2ZGJA 2A4QA 3MH6A 3RU4D 1MKXK 1V2LT 1WXRA 2ZT9D 4UEHH 1LJ2A 1D6WA 2ODYB 1YLNA 3RK3B 4Y8ZA 2ZFTA 1GMJA 5FBIA 1OX3A 2F3CE 3FFGA 4JZIA 1S5LH 5KLIC 1TNHA 1M1JB 1K9MQ 2Y80A 2FYUG 5GJ4B 3Q5SA 4IL6H 2G52A 3AASA 2B88A 1Q31A 3HE4B 1GBHA 3TK6A 1SQPK 4JYCA 1T2KC 1GHAG 1WMKA 3MU8A 2O01J 5EG4A 3G3ZA 2ZU2A 2QSIA 3BTHE 3HTKB 3QH9A 2KLUA 1C2JA 1M1KQ 1CT2E 2QCYA 2Q6FA 3SWKA 1W0KD 1XTGB 1KXAA 3HK6B 1PGQA 5KLVK 5CCGA 1QBOA 3LIWA 2ZIQH 4H6TA 4TPIZ 4BTTB 2HR3A 3QX5H 1DWEH 2XC4A 1TFXA 1K1LA 4AG2A 4O97A 3SZEA 4CRCA 1BMNH 1K73Q 3KQDA 3LW5J 1S6HA 3I78A 5I25A 3MNCA 2D1JA 2C0XA 5J4QA 5CHAB 5DK1A 3VXFH 1A7SA 1NTMD 3QO6A 3SGQE 2GMTB 1EP6A 1CE5A 1P2MA 4R0IA 3BVHA 4NZLA 4WWYA 3ZVGA 1W14U 4BANB 4CHAC 1SP4A 1K28D 4XE4A 1PQ8A 2M2AA 3B9FH 3OTJE 2ZT9C 1EXFA 4NG9H 2BLWA 1GBTA 2A4RA 4XFJA 1BRCE 1OW8A 4ZKPA 1LP1A 2QAAA 1M1JA 2MJZA 3PV5A 5KECA 2OTJP 1BJUA 1SGPE 2ALVA 1SFCC 2NPSC 3ITIA 3LONA 5CCHA 1WSSH 4FUJA 3AE9C 3MUDA 1BCCE 5AVRB 5AVUB 1CGJE 1UVOA 6GCHG 2KOGA 3SNDA 5KLVJ 4B74A 2K3RA 3Q76A 5K7RA 2E75B 1D4PB 2FX4A 1DH3A 1BRAA 2WUBA 1XVOA 4IN1A 1USDA 1MQ5A 2KCYA 4BNRA 1OKXA 2BXTH 4CRBA 1TMTH 3SU1A 3OX7U 1P3CA 4CRDA 2RA3A 3TVJB 1AE5A 2DE8A 3G01A 4IS5A 3FP6E 1KC8Q 4E06H 2JETC 2QRXA 1V2OT 3F2HA 4DIHH 2OBOA 2H89C 2ZDMA 1BQYA 4EYYQ 1Y5UT 2A06E 3RXSA 3UQOA 1SLVB 2V3HH 3B5ND 5C1YA 1WTHD 2Z9KA 1KLTA 1MD7A 3PO1B 1S5SA 1SQXK 4RKJB 1FJPA 1ZR0A 3IFMA 2BD4A 4Z0KA 1MTVA 1C1NA 2QM7A 1J1DB 3QGNB 4AYVB 5GWZA 1MZ9A 1RFNA 2L74A 4UFEH 4B2AA 4D7GA 1N73C 2YIUB 2BMGB 1S3JA 3MNBA 2KFWA 3RXMA 1EDLA 1HAYB 1QHRB 3H1HD 4MG3A 1LWUB 1CVWH 2QXIA 1KYOI 2TBSA 4XSKU 2AMPA 2ULLA 3RXQA 2AGIX 4KGAA 1SFCA 2NPSA 1FN8A 2JETB 2Z3CA 3PRDA 3V7TA 3VXEH 2WPSA 2PLXA 2WPKS 1GL0E 4YLQH 5DP4A 1HAXB 1MFZA 2QN5T 3RXCA 3SOSA 2SGAA 2FOGA 2FXRA 2HNTF 3IITA 2OQ5A 1NYHA 3A87A 3DSOA 1G3BA 2GCHG 4AYYB 4TWYA 4MVNA 1BDCA 4H0LB 4ZXYH 5H4IB 2PGBB 1PFXC 3OYPA 1NTKG 1LGHB 3HATH 1M1JC 4ASHA 1EZVI 1TMUH 1NPMA 3CP7A 1UTKA 3C9IA 2DW3A 3II6A 1WYKA 2OC1A 2QF3A 1NFYA 2BXUH 1GBDA 1WDIA 4JZDH 1G3EA 1O3OA 4ASWA 1W2KH 1PPJG 2XU6A 1LPZB 5TISE 1UTMA 1LTSC 1PPJD 4H13D 4RJTA 1YQ3C 4H13C 2KIKA 1MMJN 4GKGA 4PV1B 2ZXXA 2Z5IA 1HJ9A 3NCLA 1GCTB 1NJIQ 1XKBC 2BLOA 2WVRA 1SQXJ 2FXPA 3H32A 6GCHF 2WITA 1GI9B 3QZQA 3L73E 2ZDKA 5F8XA 3M5MA 1QB1A 3SI4H 1T8NA 4YOJA 1GG6B 1GI4A 4AFQA 1T8MA 2QF4A 3FZDA 3TH2H 3CX5H 1JTHB 3HGPA 4EI2A 1SFIA 3MO9A 1SQBJ 1TA2A 4WMFA 1OWDA 1C1VH 2H7HA 1VF5C 2VNTA 3KZIE 3KL6A 4A5TS 5FBEA 1FJKA 1HXEH 3LIDA 1BCUH 1QNJA 1MABB 4U32A 1B0FA 2A45H 4PJ0E 1G1IA 2GDEH 3GYLB 1CHGA 3HGNA 2WPRA 1P11E 1Z8IB 2I6SA 1C2IA 1T8ZA 4PV1C 1GI0A 1HIAA 5EJLA 2Y6TA 1NKZB 2W6AA 3P7KA 1GPZA 4NIXA 1EOJA 2ZDVH 4WY4A 1GU4A 4WVPE 1KD1Q 1ZV8A 2SGPE 2BDCA 2Z9LA 1C5TA 4THNH 1NTKJ 4WJG2 1SQPE 1PL5A 2KNCB 3A85A 6ESTA 2YNYA 1VJ9U 5C1XA 1OX1A 3TJUA 1KY9A 1N73A 1RQVA 2Y7ZA 3RXRA 1ABJH 3U28C 1P8VC 4DW2U 1QVFO 1AHTH 1NBMD 4AOQA 3OE7D 2UUYA 3L71J 4ABEA 3TIUA 1SQQG 3P70B 1SQPG 1P9UA 3H1KJ 1RY3A 3O8CA 1T32A 2FMJA 2YNAA 1SQQK 1UW7A 4RN6A 3ZVBA 2OGUA 2KS1B 4INKA 1IO4A 3M37A 1ZTKA 2F83A 2QEXP 3MH4A 4ESTE 1LQDB 3A0HH 2WPDD 5FHTA 1O5GH 1YKTA 3LGWA 1KILB 1YBWA 1J2JB 1L4AD 1S72P 3PRJA 2AEFA 1F0TA 3H1LE 4I7ZB 1C2MA 1O2QA 5JB9S 1BCCJ 1GHYH 2PUQH 4IC5A 1S85A 4K69A 2IYPA 1H9IE 1ZHMA 1A5IA 5T6FA 3NRLA 3I56P 3MNXA 4H44D 3M91A 3CD6P 4EDFA 5EJ1A 3KYGA 2ESTE 4YTAA 1HPGA 3PLBA 1CA0B 2I1JA 2D2DA 3H6PA 1O3PB 3L74G 2OYOA 1YCPK 2I6QA 1GJ4H 1K9OE 1SOTA 3TGJE 1ZR4A 2BEZF 2QXHA 3RXOA 2W6ID 1O3NA 1PQ7A 1OYQA 4NIVA 2BZ6H 2W26A 3NK8A 2GTBA 1JIMA 1C1UH 4OGQC 2R0LA 1BGYE 2J98B 2QVAA 1NN6A 2E74D 1JEKA 4X0WU 2SNVA 1SQRA 2UWPA 2LKMA 1K1MA 2BQ6B 4WXIA 4E05H 1V2WT 4UONA 2BASA 3T25A 1O5FH 1L0NG 5HMAA 1ELGA 1YCPM 1NM6A 3MTUE 2G5VA 3ATLA 4A1XA 2D8WA 3PROA 1GU5A 3LU9B 2R0KA 4HGCA 1HAGE 5GTIH 3CCQP 1IC2A 5AF9H 1LTOA 1S2EA 3CWBG 1TNGA 4F48B 3M5OA 3HPTB 2P58A 1GMCF 4K1TA 2FS8A 3KGPA 5C5OA 3E3TA 2A5IA 2OQUA 5C17A 3TYYA 1AKSB 5DKMA 1P05A 1TABE 1ZLRA 2QY0B 1R5SA 3UB0A 3SSUA 3Q77A 3H1JE 2GGVB 3BTKE 1G3CA 1WUNH 1URQC 1CQQA 4I8KA 2KZ4A 1TONA 2ZWLH 1MBQA 3H25A 2IYOA 3MGNA 1L2PA 1PIXA 2G8YA 2VIOA 1JY2O 1A0JA 4DZOA 1ETSH 1F0RA 3ODFA 3GY8A 1C5OH 1JB0J 1XXFA 3M3VA 1DLKB 3ZZAA 2PKSB 1MZAA 2FFDB 1S4XA 4FUEA 2ZTYA 3N4XA 1GI2A 3BEIB 3W67A 4IFMA 1FUJA 5CCHD 1SGYE 4WH8A 2P93A 2YO2A 2ZDLA 3OSYA 3B4SA 1AU8A 1W0JD 1S0RA 1JMBA 1IHTH 4NGAH 3DA9B 1NROH 4TYDA 3SUEA 5FCKA 1N1LA 1YYCA 4WMDA 3NXSA 5FAHA 3JZ2B 5EOKA 3HD7A 3DFJA 3NKKA 3AECC 1SQQJ 3M06A 3A5TA 4TWWA 1GMDG 1P9SA 1VZQH 5B66E 1CA0C 1PZQA 1RIWC 3L75J 2ZDAH 4U30A 5B6LA 1L0LG 2FOCA 3AEFC 1EPTB 3GCHB 5TJHA 3TGUE 1UO6A 4INLA 3F89A 1ZMNA 3T62A 1IQGA 1W13U 3CXHE 3N7NA 4C7RA 2FYUK 1JCDA 3RXAA 1MTSA 1FY8E 2GZ9A 5JBAS 2A45G 5DSFA 5FL7D 3BN9A 2FFDA 3CWBE 2FYRA 4XBBA 3WUVA 1O37A 2VU8E 1VQOP 5GIBA 1A1RA 1P03A 5E2OA 2C8ZB 2PV9B 1RIWB 1Z7KA 3VOPA 5H2FE 1HYLA 1RGQA 2DUCA 2NZ2A 2A2QH 2HWLB 3AVZA 3H1KE 3KQGA 3P8CD 1CW5A 1VITH 4NFFA 5SGAE 1P06A 2C8WB 3WW7A 2JEEA 3N7DA 1HIAB 1XUKA 5KJ7D 2LPRA 1OYTH 1KXFA 2YKPA 1Y5AT 1O3BA 4I2LC 2CPBA 1EATA 3ZVEA 3Q2YA 1AB9B 2FTMA 2PGQB 1L0LD 1S5LE 3A8DA 3DCLA 1DEEG 4C7NA 1JRTA 3LKWA 4MPWA 1A4WH 2M3BA 1OIPA 1C5LH 4YT6H 1O5EH 2HLOA 1GMDF 5AW9B 1NGMB 3F9HA 4TT3D 3L72E 1NS3A 1ZOYC 1ZSLA 1SQVG 4ABAA 2N1TB 5A2MH 4UB6H 3ATIA 4X1QU 1NO9H 1A02J 1OWIA 1MD8A 3O6QB 1OMIA 1FY1A 3HD7B 2O8UA 2YNBA 1EZSC 5LPEA 4HKZH 1O2XA 1SQPJ 1GJCB 3SV7A 1DSUA 3F2GA 1JNMA 1VQ6P 2J95A 1VPCA 1NWQA 2J38A 3KHUA 5I46H 2FX6A 1SGQE 1CBWC 4MNXA 2Y0EA 3U9AH 3BTGE 4GOEA 3HK3B 2VIVA 3ZZ4A 1THSH 4AB8A 1DANH 1C5ZB 5EIYA 4XBCA 2C9LY 3TNUA 2XNIA 1BJVA 1C9PA 1XM1A 2C4FH 1P2NA 1QX8A 3GHGA 1PPHE 2VH6A 2ZGHA 4ZMAH 8GCHF 3JC22 3S7HB 2OTKE 1O39A 2FXOA 3F1SB 1JRSA 5APUA 3E91A 1J14A 3H1IE 2A7JA 4HI3A 3AE1C 1COWD 1D3DB 3RP2A 1O5CB 5DPAA 3BG4C 1BRBE 1NFWA 1UHBB 1MFTA 2Z4EA 3ZVDA 2FYUD 1V2KT 1LKAA 1TAWA 1M90Q 2BQWB 5APXA 5E2PA 4Y99B 2BY5X 1C1TA 1GDQA 2ZC9H 3M5NA 1ZMLA 2WMMA 1YLDA 1RF1C 3D70A 1OXZA 3ATWA 1A0LA 4OGQD 5DJTB 1R5LA 1W10U 2IBZE 2BQ7B 3ZZDA 5JBBS 2QF0A 5M1BA 3RXHA 1WBGB 1G37A 1NU9A 1PP9J 6LPRA 1LHEH 3SJIA 3CCMP 4YT7H 2RDLA 3SQEE 1RTKA 2A06D 2FP7B 4AORA 2HNTC 1LVOA 2F91A 3OTPA 3RXJA 2G4UA 3SUDA 3PRBA 2H5DA 4YZUA 5KLIB 5GNDA 4ISOA 1TX8A 3M3TA 4KELA 3F9GA 1W7GH 3AE4C 1SMFE 3BRVB 3E16B 1GGDB 2Y9ZA 5GDSH 1SQAA 2A7CA 3FWLA 1NRPH 3PMHB 1M7LA 2A31A 3E6PH 2FOAA 3PTBA 1O2HA 1MZDA 1BA8B 2BDGA 5CHBA 3ZV8A 5HYOA 3D71A 4P00A 2Q9IA 3T27A 1VQKP 1O2PA 2H8PD 1LVBA 1B0EA 1INCA 2FFDC 1B7XB 2M5TA 1QQUA 3H1LJ 1TPSA 1QFKH 3L75G 1SQVJ 1ELEE 1MCVA 1O5BB 1SQBE 2AXTH 1SGEE 2FOBA 4K35A 1ACBE 1EPTA 4Y0ZE 2J97A 4FUDA 5ESBA 1N73B 3CMEP 2BZAA 4Y71A 1V2PT 2GA1A 3L75D 5HIYA 1EJNA 1S5LX 3F0OA 3IWMA 2FI5E 3MWIU 3NFQA 1JMOH 4FETA 2QE7H 2LXCB 1SQBK 2BD9A 2BLVA 1MAXA 2XC5A 2IFMA 3U59A 1KLJH 2KB7P 2KS1A 1O3JA 3CWBJ 4MPUA 4NA8A 3S9AA 2KM0A 2NU2E 2P67A 1H89A 2FOMB 4YESB 3KF2A 3SFEC 1W2EA 3M0DC 1EASA 1MAYA 4ISHH 4NFEA 1EUFA 1FXYA 2AGEX 3OAAD 1UTOA 1HDTH 1G9IE 1ZTJA 3KIDU 4JYTA 1FN6A 1UTJA 1GCDA 3SNCA 5B5EE 3SO3A 2WSFH 1YTZT 1CSOE 1IK9A 3TGIE 1VF5D 5BRRE 2A06G 4A7PA 1SQXD 4KTUA 3U1IB 4IFDK 3U8OH 1MUUA 2ZCKP 3DHKH 2K1QA 3USSA 3M9HA 2BDIA 1Q82Q 2GDDA 2XV5A 1SQOA 3BV9B 1HJ0A 3F9EA 4A6LA 1D3TB 1OVUA 2ZFFH 4UE7H 2A4GA 3OFND 1H1BA 3RK3C 3BEUA 4XFQA 1SSXA 4DT7B 1KTTB 1QB6A 1OVVA 1AZ8A 4M7GA 2LR2A 3MIWA 1XUGA 1AB9C 5JBTA 1DXWA 3F2FA 1C1SA 4ABFA 1IFJA 2G3AA 1CGHA 1MH0A 3FXDA 2XNDH 5E0HA 2W3IA 1O3FA 1KYOH 1O2GH 4GPGA 2YIUC 1J15A 5HM2A 4N3YB 1ZPCA 2ZPQA 2BDYA 1AJYA 4B75A 3TDKA 1O3KA 1V6DA 2R9PA 3RMNH 3M36A 4Y8YA 1BSNA 4A92A 3FP8E 4Q2KA 3GY5A 3H32B 5AVZB 1EZVD 1LTJB 1RE4A 2RKLA 1PPCE 1Y3WA 1O35A 5EQRA 3ZYDA 1EXIA 2QG4A 2PTNA 5FX5A 3H1HJ 2Z9JA 1A3BH 4GUXA 1S6FA 1QL1A 4FUCA 4QT8C 2C90B 5L30H 1L4DA 1AFEH 3RL0g 3H1IJ 1O30A 1LTIC 1IQIA 1C5PA 5KJ7A 4IMZA 3UWIA 1DD4A 5HIZA 2B8OH 4CRAA 1A2CH 1CGIE 1EB2A 2AEMA 4VGCB 2W6JD 1ZMEC 1ETRH 2Y7XA 3L4FA 1FC2C 3GW6A 4ACBA 1GBCA 4CRFA 1E34B 1ZJDA 2AHME 1Z8JB 2B7DH 3S4RA 1FDMA 1EAXA 4TSFD 2GUVA 1C2HA 1Q2WA 5L8RJ 1KFNA 4LK4A 5L6NH 3M61U 1W0YH 2H9EH 3CI9A 3SZNA 3U69H 1SFCB 2NPSB 1JOUB 1GCTC 1FE6A 2XNDD 3UWJH 1LKBA 5FPYA 1MTNC 1AN1E 2UUKB 4HB1A 2KCOA 1X7AC 3PLPA 3OY5U 3GCTF 3BG4B 4WVZA 1GG6C 3SU0A 1ZSJA 2FYUE 1O33A 1NFXA 1SGCA 1IFPA 3RL0D 1Q2NA 2XBWA 1PGOA 1BUIA 3PTZA 3MH5A 1DWDH 2XOKD 1GBAA 1RF0C 5L2YH 1FU1A 3N7OA 2QJPB 1P3EA 3IAOA 5T6GA 1N7SC 4X2YA 2W5EA 2FIRH 1SGFA 1VQ5P 5AVTB 4D6TE 2F9UA 3KQEA 2RFKC 3PYHA 2QXJA 3HRNA 1N86A 3ATKA 3V4QA 1YTZI 2WSSH 5B66H 4R4MA 2PKSC 1BMAA 2H1UA 5AFYH 2ZGCA 1BGYD 1S0QA 1FV9A 3RLYH 3GYMA 5AW5B 3VB6A 2FYNC 1YCPH 1Z6JH 5HM9A 1WOFA 2STBE 2OTVA 4JQ0D 4U3FJ 2OYHA 1A02F 4IBLH 2SPZA 3T97A 3LH1A 4TY6A 3RXBA 8LPRA 2OXSA 3UNRA 4C46A 4MN4C 3SJOA 1PV3A 1GI5A 1GBIA 3TPIZ 3EA8A 1LWUC 4FXGH 3SNAA 2JJ1D 3RDZA 2Q6QA 2PGDA 1UK4A 2PR3A 3KYQA 4CBNA 4B6FA 1CHOF 2CXVA 2O8LA 3L6PA 1NVOA 1YPHE 4D6TJ 4GSOA 3UR9A 4E7NA 4NZQA 2B87B 2H9TH 1W0ZU 1CT4E 2Q3EA 2Q5UA 1A5HA 2Q1KA 2C93B 2F9PA 2IZ1A 1TNKA 3RXLA 3GICB 1AFQC 1GVZA 2Z9GA 3CPWO 3CCUP 4AB9A 1ZRTE 2PFXA 1P04A 3JCUH 3A8AA 1VQ4P 1AZZA 1YM0A 2A45B 2GZ8A 4I32A 3CXHD 2KR7A 3SGAE 4WBAA 3H1KG 3AE7C 1F0SA 3M7TA 1LT1A 1PQ5A 1UVSH 3TSIA 1EDIA 2BDHA 4FU9A 1NOHA 1VDFA 2L91A 1SQQD 1GL2C 1KQGB 1O3IA 1NRRH 3N7EA 2BOHB 4ISLA 3TNSA 2O01H 4DT0A 3A84A 1OS8A 2RH0A 3S1KA 1KMIZ 2A0QB 3RXKA 1OWHA 3L71D 2VIPA 2IPQX 5TCCA 4AN7A 2BD7A 3PMBB 2WINI 4A1TA 3MU1A 1P84H 2IZ0A 2OYHB 1ZSKA 3GCOA 3QN7A 4BTIB 2VVVA 1NKNA 2NRGA 1N8OC 1ZHPA 2JP3A 4D6TG 1BZXE 2CV3A 4FUHA 2SNWA 2FOEA 3GCTG 1NTMG 3TNUB 2JKVA 1L4AB 3HE5B 3TK1A 2KSEA 3O8ZA 3FWNA 3A0BE 3AEDC 2WZQA 2R5DA 1FI8A 4VGCC 3STIA 1H8HD 2Z9IA 1IFMA 2ZFCA 1T3UA 9LPRA 2BD3A 3ZZ3A 4XBDA 1T2KD 1TNJA 3RXGA 4DG4A 1BT7A 1KTMA 2TIOA 1Z6EA 4DGJA 3GF7A 2Z6BD 3U98H 3A0BH 3MFJA 5A0BA 2WSFJ 3A3YB 2J34A 1OHHD 1IOEA 2J92A 3SJ8A 3SV2H 2E5YA 1USEA 1O2YA 3QGJA 4OS1A 3SBKA 1ZRTD 4JPZB 2VWLA 3HUSC 1CSBA 3GHGC 3BTQE 3KHVA 4I31A 5G4BA 4ZKSU 1KILA 1ZTLA 3RK3E 2Q6DA 4WY3A 3D49H 5DN6D 1L0ND 3C1KA 3EYDA 2HPCA 1EDKA 3ITKA 3MMGA 5AVYB 2BDAA 1QL7A 3BTEE 2ZA5A 4FUFA 1EZXC 4X1RU 1DSTA 1KB9H 3SI3H 1CT0E 2XCNA 3KQ5A 1O2MA 2HALA 1GHVH 1O5DH 1QCPA 5DP6A 1JM0A 2RDEA 1YQ4C 4IFFA 1YJWP 4NWKA 3RXDA 3R0FA 1AY6H 1TMBH 3GF3A 4CR9A 3PWCA 3H1JG 1O31A 4O3TA 2VWMA 1T4UH 1O3LA 2O01N 1KN7A 5FXLA 2P1JA 1QRZA 1V2NT 2FI3E 2AERH 1X8YA 1JY3O 4K60A 1IQHA 1LTAC 3WWBA 2JDID 3K9XB 1SBWA 3H1HG 2R3UA 2W83C 1GJ7B 2BY6X 4ZAEA 3ZYEA 1N6YA 4JK5A 1PPEE 3L70J 1ZN5A 1NTPA 3BSQA 2WUCA 1ZHRA 2H6MA 3MU0A 2UUJB 2IJD1 4Z1MD 1TU3F 1P2OA 2YKOA 3PMAB 2TGDA 1NO4A 2AIPA 2Y5GA 2HG5D 1AFQB 2VIWA 2WV9A 1UCYE 3VFEA 1XTCC 4OGQB 2WWWA 3GG2A 1NU1J 4AQRD 2P7JA 3FANA 2ZPSA 4R8TB 4WXVA 1BB0B 1X22A 1WRGA 1YLCA 3SQHE 2H43A 1AVXA 1OWJA 3SUFA 4DY7B 2O1KA 1KDQA 2ZHDA 1JY2P 2ZTZA 1L0NJ 1CU1A 1O2SA 3EE7A 4CHAB 3WU2E 1BE3J 3V4WA 4KKDA 1FY5A 2KUBA 2ZQ1A 3A7TA 2ANKH 1DWBH 3OY6U 1HB0B 1N7SD 3UIRA 4YO9A 4YXWH 1IQLA 4ZROA 1ELCA 1D3QB 1N7LA 1SQVK 2AEJA 3RXEA 4XOJA 3AW0A 1KQLA 1Z56A 1O3EA 3SU3A 1T3JA 1D7MA 2P94A 1ESAA 1GJ6A 5AVSB 5KLVG 3U1CA 2XYAA 3STJA 2SGDE 4JCNA 3B5NB 2QC2A 2TPIZ 3A2AA 1AVOA 2Z3EA 3O8DA 1ZMJA 3ZZCA 5C0UA 2OLGA 1YPLH 2ZKSA 4K5ZA 4AC9A 3S0NA 2OK5A 3JCUE 3AE2C 3AE3C 1O0DH 2PTCE 3LOXA 3T97B 5LPFA 1GHAF 3LJJA 3L75E 1Z8RA 3FX0A 2D26C 3A88A 3D23A 4X6NA 4JYBA 1GBKA 1SQQE 4HTCH 1BE3E 1J8AA 4WB4A 1ZLLA 1NTMK 1SHHB 1ZGIA 5H2FH 2Y0DA 2A2XH 3H1IG 3HD7D 1ETTH 1GJ9B 1SQBD 3WWFA 4ZUHA 1C1RA 1AO5A 3RM2H 1R8EA 5CCHC 2GVFA 5FPSA 1DX7A 2W3KA 2L5GB 4M3LA 3OA7A 2ZGBH 2P10A 1NRNH 2K8IA 1BBRK 1DICA 7GCHG 1AQTA 1S9KD 2ZU3A 2HNTE 3GDVA 1KXEA 5EODA 4ACAA 1V2UT 4FVBA 1N2DC 1LT9B 2BD2A 1E38B 2Q7CA 4DCKA 4NA7A 2BY9X 2ANYA 1O32A 4OS2A 3UY9A 1GBJA 4YOIA 4KTSA 1DLEA 3BCCD 3RC6A 1URQD 2LNCA 2R3YA 2VH0A 2IBZI 3RK2B 1FZCC 1IQMA 2GM4A 1QIXB 1HUTH 4PD4I 1WQSA 4O9BA 2A5KA 2P8OB 3OEHD 4X8SH 1MKXH 4AFZA 3S9OA 5KAFE 3RK3D 4PJ0H 3L72G 1YPMH 3SYJA 4DCDA 1Z71A 5C67A 1F5LA 2WPVB 1RE3A 3L37A 3HE5A 5B5EH 1ELTA 2AXCA 1H88A 1P09A 1UJ1A 3RBXA 5CBOA 2V3MA 5LPRA 1LDTT 1O2LA 1GMHF 5C2ZA 2GP9B 1GBMA 3L3TA 2XW9A 3URCA 4D8NA 1TB6H 2FY8A 1KXBA 3BG8A 1Z8GA 4X2WA 1VQLP 1NTKE 3Q00A 5K5GB 1SGFG 1NTZD 3NPSA 2OC0A 5C0TA 4X2XA 1H9HE 1ZXGA 5CCGD 5DP3A 2JWAA 1RQUA 4O3UA 3VTPC 1HGZA 3H7TA 1J1DC 1M56D 1BTHH 2XCFA 1E5WA 4ASVA 2HPCB 1LTBC 4NIWA 3A81A 3LGTA 3L72J 1THRH 3RC5A 4ABHA 2KX4A 5E79E 4IGDA 4XDEA 1A46H 1VKYA 2YMSB 3D6YA 4UFFH 5CJ0A 3ZVAA 5APQA 2OYIA 1VL2A 2RG3A 4I8GA 2W27A 5IK2D 3U8RH 1QBVH 1PGPA 2LELA 3V5BA 1C2FA 1G2MA 1Y3VA 1GK4A 2OYHC 2K9JB 3PO1C 1LVMA 3TGUG 2GJGA 1G3DA 4FOUC 3SUGA 1NU1E 1YJNP 3SFDC 4CR5A 3DD2H 3F3BA 2STAE 1A0HB 3L73J 1MKWH 1NTZJ 1VR1H 2CHAC 4MDSA 7GCHF 3RLWH 3VMAA 1WCZA 1PYTD 4DOQA 2W90A 1PYTC 4GOFA 1JWTA 1IK7A 1L4AA 1HUCA 2A1DB 2I1KA 1YWUA 3PLNA 2VIQA 3TK5A 2TGPZ 2W7SA 2L6OA 5KEDA 4AYCA 1NRSH 3U1JB 4HH2A 1BE3D 4RSPA 2AMDA 5AW6B
chains in the Genus database with same CATH topology
2QSIA 4GDOA 5ESBA 1W0KD 3R4YA 1S5LX 3F0OA 4FETA 3SZEA 2FBWC 3LW5J 2HLDD 4Q63A 4ASUD 3KN2A 3VG8A 2KM0A 2FOMB 3KF2A 3SFEC 1KILE 3SV9A 2M2AA 2ZT9C 3OAAD 2A4RA 4XFJA 1OW8A 1DY8A 2E75D 3PV5A 3LONA 3AE9C 4Z1MH 1VF5D 4B74A 1DD3A 2YMSC 3U1IB 2E75B 2K1QA 4Y28J 2F43B 2KCYA 1HJ0A 2MKVA 4ZCNA 3SU1A 2A4GA 4TT3H 2YOLA 3OFND 3F2HA 2OBOA 2H89C 4PV1D 1DXWA 3F2FA 1ZP0C 2G3AA 3O8BA 5CDFE 1E79D 2YIUC 3ABVC 1AJYA 4B75A 2D2CC 4A92A 1FDIA 3PV2A 3FOAA 1FDOA 5EQRA 1EXIA 2JIZD 1S6LA 2KFWA 5GPIB 4YXDC 2K9YA 3RL0g 3PRDA 1DD4A 3IN6A 2W6JD 2F9VA 4YTPC 1ZMEC 2QV1A 1NYHA 3DSOA 5T1VA 2AHME 4KT0J 4H0LB 4TSFD 2ZT9B 5H4IB 2D2CB 5L8RJ 3OYPA 3H09A 3AEBC 2OC1A 2XNDD 2JO1A 1SKYE 5FPYA 2O8MA 2KCOA 4H13D 3WW7A 3SU0A 1YQ3C 4H13C 5EPYA 1DXPA 4PV1B 1KMHB 2XOKD 2FXPA 4WF8A 3IAOA 3M5MA 2WSEJ 2QF4A 2OINA 1OW7A 2F9UA 2P59A 1VF5C 3D6ZA 4JMYA 5IDKA 1MABB 4R4MA 3SV6A 3F0PA 2FYNC 4PV1C 3E90B 3FN8A 2WHXA 1PV3A 1BMFD 2JJ1D 1PL5A 2D2CD 4B6FA 3L6PA 1RQVA 1VF5B 3EWKA 1NBMD 3OE7D 1RTLA 1ZRTE 4H0LC 3O8CA 4I32A 2KR7A 3AE7C 2KCAA 2BEQD 2WPDD 1E1RD 1KQGB 3N7EA 3B71A 1KMIZ 4H44B 1EXJA 4B6EA 2OQQA 4I7ZB 2E76D 4DT4A 4A1TA 3NRLA 2JP3A 1UIXA 4H44D 3GLMA 4I7ZC 2WZQA 3AEDC 1H8HD 3ZIAD 2BEZF 3P8OA 2W6ID 3Q5RA 1BT7A 1KTMA 2KCPA 4OGQC 1U57A 3GF7A 2QIWA 2WSFJ 1OHHD 2E74D 3O8RA 3SU2A 5F53A 3SU5A 4I31A 3RK3E 5DN6D 3EYDA 2WSCJ 4A1XA 3FKSD 2QJKC 3M5OA 4RI0A 4U01A 2XCNA 5C17A 4Q4LA 3SU6A 1YQ4C 4NWKA 3UB0A 3Q1MA 4B71A 2GGVB 3GF3A 2KZ4A 2QJPC 3H25A 1PIXA 2QE7D 2G8YA 3FGAD 3WWBA 1NBME 2JDID 4WH6A 3C8VA 1MKMA 1JB0J 1S1CX 3RC4A 5EPNA 3FO8D 3G9RA 2IJD1 4Z1MD 1TU3F 4WH8A 2IDBA 4OM9A 1W0JD 1Q90D 4TYDA 2WV9A 3SUEA 2H88C 1N1LA 4OGQB 1OW6A 4KTCA 3AECC 4R4LA 3KNXA 4R8TB 5B6LA 3AE6C 3SUFA 2OC7A 3AEFC 4U7JA 4I33A 1CU1A 2JJ2D 1HF9A 3GS9A 1DIPA 1DY9A 5EQQA 5DSFA 4NWLA 5FL7D 3SU4A 3SU3A 3AEGC 1W3CA 4M9FA 2J5UA 1A1RA 3O8DA 2YMKA 2QJYC 2VBCA 1RGQA 5C0UA 2NZ2A 4B76A 5HKKD 2OK5A 3AE2C 3LOXA 3AE3C 3T97B 2CK3D 2FM2A 3N7DA 4H13B 2OC8A 2WQYC 4B73A 2YMSD 3Q2YA 3DCLA 3LKWA 3AE8C 3WWFA 4A1VA 3SV8A 1JXPA 3OEED 4TT3D 1R8EA 1NGMB 1H8ED 2GVFA 2WSSD 5FPSA 1NS3A 1ZOYC 2V7QD 1K04A 5ETXA 2V7QJ 2P10A 2K8IA 3AEEC 1OMIA 5KKZC 3SV7A 1Y9BA 3F2GA 1KQFB 3AE5C 5EQSA 1FX0B 3RC6A 3DSPA 3AEAC 3OEHD 2XNIA 2K0QA 4K8BA 3S9OA 2QF5A 3SYJA 2WPVB 3AE1C 4RKUJ 1COWD 4F55A 4YXWD 4XD7D 3O6QA 3M5NA 2F4LA 4H44C 2OC0A 5C0TA 3AK5A 3D70A 3Q3DA 1K05A 4OGQD 1RQUA 2E74B 5M1BA 2E76C 2XCFA 1E1QD 4IL6X 3N99A 3P8NA 3RC5A 3Q5PA 2FP7B 2YMSB 3D6YA 3SUDA 3OTPA 5FPTA 3PRBA 5IK2D 1VL2A 2E75C 1KORA 1EFRD 2E76B 5GNDA 2A4QA 2LELA 1WXRA 2ZT9D 3AE4C 3KEEA 4H0LD 3SUGA 3SFDC 1GMJA 3F3BA 5KLIC 5CHBA 2E74C 3GMAA 5GJ4B 3D71A 3Q5SA 2IJOB 1IK7A 2OBQA 3W1EA 2L6OA 3M5LA 3U1JB 1WMKA 2O01J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DIP A;  1R8E A;  2J5U A;  4R4L A;  3D70 A;  3Q3D A;  3IAO A;  2QF4 A;  2QF5 A;  3Q5R A;  3D71 A;  3Q5S A;  3T97 B;  1EXJ A;  2OQQ A;  3D6Z A;  1EXI A;  3G9R A;  3Q5P A;  3Q1M A;  3D6Y A;  4R4M A;  3Q2Y A; 
#chains in the Genus database with same CATH topology
 5APW A;  5EXL A;  1GHX H;  4OVN F;  1AGJ A;  1F2S E;  4GDO A;  1BIO A;  4HG6 A;  3GY6 A;  2PW8 H;  2PP6 A;  3L73 D;  3AAV A;  3TJN A;  4BXS A;  2V0B A;  1VGC C;  3A7Y A;  1XX9 A;  1C2K A;  1ANC A;  3NTN A;  1IHS H;  3EQ2 A;  2FBW C;  3CC7 P;  2B89 A;  2CHA B;  2HLD D;  4ASU D;  5BVZ A;  1EZU C;  1S81 A;  3V13 A;  1DWC H;  1C5R A;  4ABD A;  2K88 A;  2B0F A;  3JZ1 B;  3WMM 0;  5B6O A;  1KLI H;  2CF8 H;  3V12 A;  3SV9 A;  1GMH G;  2C3S A;  1SLQ A;  3UOP A;  2XZR A;  1HBW A;  1FZZ A;  1RE3 C;  1BHX F;  3MI4 A;  1DY8 A;  1FBM A;  2E75 D;  3KXD A;  4FUB A;  2IOT A;  5T6D A;  1Y3Y A;  4JF7 A;  1O36 A;  4Z1M H;  3HD7 C;  4LLH A;  1UVP A;  5JPM H;  4AG1 A;  1BOQ A;  1KTS B;  2V4H A;  4FU8 A;  4X1N U;  3E1X B;  4LOY H;  1DOJ A;  3SN8 A;  1SB1 H;  1GL2 A;  4HFP B;  1KQS O;  1F5R A;  1H9L B;  1OP0 A;  3QLP H;  2HRV A;  5KTB A;  1BSH A;  3K65 B;  2XWB I;  2ZFR H;  5CHA C;  3RBZ A;  2MKV A;  1K1O A;  2ZO3 H;  3FVF B;  4ZCN A;  1QL9 A;  5JDU B;  2YOL A;  7EST E;  1K8A Q;  2HPP H;  3WUU A;  4L75 A;  1S9K E;  4ZXX H;  4D6T D;  5DP7 A;  1FY4 A;  1F0U A;  4IN2 A;  2ZPR A;  7LPR A;  3UR6 A;  5DP8 A;  3UTU H;  3EDX B;  4QMA A;  2FDA A;  3GDU A;  3P92 A;  3S9C A;  3LIE A;  5KAI H;  1FLE E;  1E79 D;  2ZG0 H;  3ABV C;  5BU5 A;  1OWK A;  1QJ6 B;  2E42 A;  2ZCH P;  3KQC A;  1XUJ A;  2D2C C;  2OUA A;  1NU1 G;  1ZOM A;  3L74 E;  1FZF A;  1HJA B;  2A5A A;  3PMJ A;  3W95 A;  1FDI A;  3MOC A;  3FOA A;  3PV2 A;  1GHB F;  3UAI C;  1O34 A;  1BGY J;  3BTM E;  2JIZ D;  1C4Y 2;  1S6L A;  3TH4 H;  4Y99 C;  1YJ9 P;  1BTZ A;  2EA3 A;  4GHQ A;  4ZHA A;  3CCJ P;  2KSJ A;  4YXD C;  2NU0 E;  3FP7 E;  1DDJ A;  3P8F A;  5EU8 A;  2WT7 B;  1AWF H;  2K9Y A;  4XE5 B;  5A8Z A;  1RF1 B;  3H5C B;  1GW4 A;  3CEN A;  4X8V H;  1JY2 N;  1PPB H;  2EI8 A;  2GV7 A;  2VB0 A;  2ZHQ H;  2A45 I;  4E7R G;  5AFZ H;  3UFA A;  3M0D A;  3UUZ A;  1LTG C;  1HVV A;  3MHV A;  2I8D A;  3M7Q A;  1QA0 A;  1SI5 H;  4Q7X A;  2D2C B;  3EQ0 H;  1HH0 A;  3H09 A;  4NSY A;  3W94 A;  1GWA A;  3EFF K;  1HFD A;  1UTP A;  1V2Q T;  1SGI B;  1TYN A;  1P10 A;  1SKY E;  3A0H E;  1NU7 B;  1HRT H;  4DJZ B;  2O8M A;  2ODQ A;  4D76 A;  1BGY G;  3QWO C;  3RXT A;  3BAT A;  5APS A;  1GZL A;  3LC5 A;  4GT1 A;  2AIQ A;  1YPE H;  3KQB A;  3B5N A;  5EPY A;  1L1N A;  5AW7 B;  4O03 A;  1TWX B;  1D3P B;  1YPH C;  5A0C A;  4ZKO U;  3EE0 B;  1UHB A;  1VJA U;  2ZFP H;  1XMN B;  1VQP P;  1GMC G;  3QDZ B;  5JYI A;  2JR8 A;  5EXN A;  4OGX A;  4WF8 A;  5ABW A;  5KKZ B;  4ZKU A;  4Y6D A;  1L0N K;  2R44 A;  2OIN A;  4UFG H;  5EGM A;  4RT1 A;  3V3M A;  1T8O A;  3B23 B;  3RGU A;  2YXR B;  1QRX A;  3FAO A;  2P59 A;  2ZP0 H;  1S84 A;  2SFA A;  3ZZ6 A;  4JMY A;  3VEQ B;  3H1L D;  4TPY A;  1OPH B;  1MV8 A;  5A0A E;  1Q7Y Q;  5AW1 B;  5GTH E;  2ILN A;  3LPR A;  3GCN A;  3MTY A;  2JJL A;  3SV6 A;  3VB3 A;  4NSV A;  3F0P A;  1AI8 H;  2FYQ A;  3U8T H;  5A09 A;  2O1J A;  1RXP A;  4H4F A;  1MCT A;  3E90 B;  4FUI A;  4IW4 E;  3FN8 A;  3SJK A;  2ZYD A;  1RF1 A;  4U3F D;  1NU1 D;  3LJO A;  2Q6G A;  4NPD A;  1W5C E;  4FUG A;  3ENS B;  1C4U 2;  1HAH H;  2FOD A;  2N1T D;  3ZZ7 A;  1VF5 B;  1QA7 A;  1V2S T;  3CNR A;  3EWK A;  1C1P A;  4AGJ A;  1TBQ H;  1GJD B;  1PPJ E;  2ZEB A;  1O2K A;  1ZRB A;  3TH3 H;  1HTL C;  1VCW A;  2HOD A;  2XTT B;  1L4Z A;  2WZ7 A;  1T6A A;  1GJB B;  2K37 A;  1TGN A;  2OTL P;  2KI7 B;  2FEQ H;  1J1E C;  4CBO A;  1Y3U A;  3IG6 B;  3BCC G;  1WU1 A;  2AH4 X;  4H44 B;  2GCT C;  3PM3 A;  2JKH A;  4PRO A;  4B6E A;  2OQQ A;  4GLY A;  2E76 D;  1XUF A;  4DT4 A;  3C1L A;  1G2L A;  2FXM A;  1E36 B;  1H8I H;  1UTQ A;  3P95 A;  1KYO D;  1GL2 B;  1OVR A;  4PD4 D;  3VMZ A;  1GI7 B;  1OP8 A;  1JCC A;  1UIX A;  1URQ A;  1D6R A;  1EJA A;  2OD3 B;  1FZG A;  3W68 A;  3PV4 A;  4CH2 B;  4DJG A;  2GX4 A;  1ZR2 A;  2Q3I A;  2BCC G;  1MU8 B;  2YXQ B;  3GY2 A;  3L73 G;  3U1A A;  2J2U A;  3TK9 A;  3RML H;  1TGS Z;  2WSE H;  3A8B A;  1CO7 E;  5HGG A;  3BRT B;  1F92 A;  2Z94 A;  3D62 A;  3GIS B;  4K3J A;  1TRY A;  5F03 A;  2AXT E;  3Q5R A;  4CRG A;  1YY3 A;  3ZDM A;  2Y9Y A;  5APY A;  1UTN A;  1CI6 B;  1NAY A;  3H1I D;  3A7V A;  2GCH F;  3MYW A;  4RKO B;  4W80 A;  2JH0 D;  1U57 A;  4Y76 A;  1C5N H;  2G55 A;  1YYY 1;  1FY3 A;  2FYN B;  1T4V H;  3L74 J;  1Y3X A;  2W6J H;  4Y8X A;  3SU2 A;  2QIQ A;  4Q7Y A;  4BAM B;  1B5G H;  2EI7 A;  3SU5 A;  3CX5 E;  2BM2 A;  2Z7F E;  2EY4 C;  5C94 A;  1YPG H;  1IJD B;  4LXB H;  4TY7 A;  4X6O A;  2WSC J;  2OAR A;  5IYT A;  4W7Z A;  2ZGX H;  3L36 A;  5AHG H;  4DOJ A;  1O2U A;  1SPJ A;  3BEF B;  5AW8 B;  1ZRK A;  1X79 B;  3SNB A;  1LNQ A;  3BCC J;  3OU0 A;  1MBM A;  4U01 A;  2AYW A;  1NFU A;  3MUD C;  2WV4 A;  2ZEC A;  4Q80 A;  1KYO E;  1C1O A;  1SQV D;  3Q1M A;  4B71 A;  1QGF A;  1LPK B;  1GL2 D;  1KSN A;  2VVC A;  2XC0 A;  3I5C A;  3E8L A;  1SLW B;  1THP B;  1EAW A;  1HGT H;  1L1J A;  4N78 D;  1CBW B;  2BY7 X;  2CN0 H;  2QJP C;  2KLV A;  1TRN A;  3R3G B;  5KGO A;  4I86 A;  2QE7 D;  3FGA D;  1QZ8 A;  3R2P A;  4KP0 A;  1A61 H;  1V2J T;  2E5T A;  4LC1 A;  4WH6 A;  4AFS A;  5APT A;  2WPH S;  5TCA A;  2OYI B;  1MKM A;  1O3M A;  1FZB A;  1S1C X;  1VCQ A;  2P3T B;  2BX3 A;  3A7W A;  2FI4 E;  1L1G A;  1VCP A;  3KDP B;  1DT2 A;  1HGV A;  5EPN A;  2A32 A;  2G81 E;  3FO8 D;  1XVM A;  1OP2 A;  4NCY A;  5EFW B;  3OW2 O;  2N9B A;  2GV6 A;  2VJ1 A;  1TE0 A;  2UWO A;  4EIJ A;  1BTW A;  1QUR H;  4OM9 A;  4UB6 E;  3LW5 H;  4GCH F;  1KB9 E;  2R5B A;  3E0N B;  4MNV A;  3CCV P;  2O8T A;  4L74 A;  1E0F D;  4XRN A;  1SFQ B;  2H5C A;  4KTC A;  4ZH8 A;  1N7S A;  4R4L A;  3ZZ8 A;  2ZJS E;  1AUJ A;  1P02 A;  1Y5B T;  3M9B A;  2BOK A;  2HPQ H;  1SVP A;  3KNX A;  1RF0 A;  1ELD E;  3AE6 C;  3A86 A;  1TNL A;  2WTY A;  2J58 A;  1QTF A;  2FOF A;  3HUS B;  1CZQ A;  4U7J A;  1LCY A;  8KME 2;  1O2T A;  3L35 A;  2Y0C A;  2OP9 A;  4I33 A;  1QRW A;  2JJ2 D;  2G00 A;  9EST A;  2M5A B;  2JH5 D;  4JZE H;  1HF9 A;  1C5S A;  3E7K A;  3CCE P;  3UOU A;  1TOC B;  1Q81 Q;  2ZU1 A;  2AEI H;  3BTT E;  1YPK H;  1F7Z A;  2PAJ A;  1LO6 A;  1YC0 A;  2QM8 A;  1P84 D;  2FLR H;  3K6Z A;  1DIP A;  1DY9 A;  1FOS E;  1AMH A;  5EQQ A;  1A3E H;  1G2C A;  1WAY B;  1XKA C;  3MH7 A;  4M9F A;  1E37 B;  1EAU A;  4BOH A;  2YO3 A;  1M9U A;  4AX9 H;  3EFG A;  1HAV B;  1GW3 A;  1TAL A;  2BVX H;  2YMK A;  4MPV A;  1K22 H;  2B9L A;  2QJY C;  2BCC J;  2VBC A;  1BBR H;  1L0N E;  2WSC H;  4BAQ B;  2EC9 H;  1YPJ H;  1ARB A;  1MTN B;  1ID5 H;  1TBZ H;  2FM2 A;  1GJA B;  1RTF B;  4Z6A H;  4ABJ A;  1KV4 A;  4U2W A;  1ANB A;  2ZYG A;  1L0L J;  1AWH B;  2OC8 A;  1QY6 A;  4UDW H;  4YLU A;  1UK2 A;  4GCH G;  4B73 A;  3MD0 A;  3MP7 B;  3BIV H;  1FZA A;  2VVU A;  4D9Q A;  1C9T A;  2EEK A;  4Y0Y E;  1PP9 D;  1BBR E;  1O2V A;  1OFC X;  3CMA P;  3AE8 C;  1O2I A;  2ZHW H;  3ATM A;  3SV8 A;  3RMM H;  1JXP A;  1XUH A;  1T8L A;  1H4W A;  1TIO A;  2WSS D;  3TNT A;  2JWD A;  4X6P A;  1C2D A;  1OXG A;  2PKA A;  1OOK B;  1EST A;  3GDS A;  1ANE A;  3RXI A;  4OH8 B;  5ETX A;  2KZJ A;  1W12 U;  2POH A;  4W7Y A;  1YI2 P;  5DG6 A;  3CC2 P;  1DE7 H;  4AFU A;  3T26 A;  1W8B H;  5KKZ C;  2FYU J;  4KHX A;  1Y9B A;  1SGN E;  1UCY K;  3TGK E;  4ZNC A;  1SFC D;  2NPS D;  3H1L G;  2UUF B;  2ZTX A;  4LZ4 B;  3AE5 C;  1AUT C;  1UMA H;  2XKM A;  1LPG B;  3QWC H;  2KYV A;  1PJP A;  4X6M A;  2ZQ2 A;  4RT0 A;  4IL6 E;  1C2L A;  1E35 B;  1CI6 A;  1P57 B;  1UVT H;  3UPE A;  3F68 H;  4Y79 A;  2VIN A;  1EOL A;  1N8R Q;  1EAI A;  3CXH I;  3DSP A;  4ZKN U;  3AEA C;  2JDI H;  1TGC A;  1BTX A;  4C7N B;  4I6M C;  4GHT A;  3CC4 P;  1MQ6 A;  2QF5 A;  1VIT G;  3M7U A;  2GT7 A;  2ZF0 H;  3DT0 H;  4ZHM U;  1BTP A;  1K1P A;  3NXP A;  3VMX A;  1HXF H;  1DX5 M;  1GJ5 H;  3H1J J;  3IR9 A;  1TX7 A;  3CLQ A;  3MHW U;  4ZKR U;  3RXP A;  1G30 B;  1TOM H;  4MNW A;  3A83 A;  3KCG H;  1KDQ B;  5DP9 A;  2ZZU H;  1BCC D;  3L74 D;  1V2R T;  5PTP A;  1YP9 A;  3MU5 A;  1NT1 A;  2GZ7 A;  1BE3 G;  1BHX B;  1LVY A;  5CJ4 A;  1HCG A;  3ODD A;  1NY2 2;  3HKJ B;  5JBC S;  6CHA C;  3UNQ A;  1KB9 I;  1KB9 D;  3CCR P;  1YIT P;  4BTU B;  2CGA A;  3VMY A;  1HBT H;  1M8O B;  3O6Q A;  4A7I B;  2BD8 A;  1VQM P;  2QA9 E;  2HVY B;  1TX6 A;  1K05 A;  5L2Z H;  2J94 A;  2LP6 A;  3SJ9 A;  2E74 B;  1EC5 A;  1AVG H;  1QL8 A;  1SC8 U;  2FOH A;  2WPL S;  3WY8 A;  1TQ0 B;  1ELV A;  1EPT C;  2A4O A;  4I8L A;  4B2B A;  3GOV B;  3QTV H;  1TNI A;  3ZV9 A;  1NTK K;  4IL6 X;  1YGC H;  3N99 A;  1TPA E;  3T2N A;  3VGC B;  1FAK H;  4Y10 E;  1L4A C;  3P8N A;  2TGT A;  2VGC B;  4BAK B;  1W11 U;  3WUT A;  1WQV H;  4I8J A;  1J17 T;  5E0G A;  3DSG A;  5FPT A;  1N6X A;  1SOZ A;  2E75 C;  3H1J D;  1J16 A;  4WY4 C;  4WWI A;  1EFR D;  2E76 B;  2VWN A;  3T28 A;  1IQK A;  3ZZ9 A;  2ZYA A;  3NMD A;  3E0P B;  2V3O H;  3KPE A;  1RS0 A;  1IFN A;  1P2I A;  3KEE A;  2BCC D;  4H0L D;  3EST A;  3Q3Y A;  4MPX A;  5C39 A;  1BTU A;  2ZCL P;  5EXM A;  3VP9 A;  1UK3 A;  3PWB A;  5AW4 B;  4ISN A;  1WTG H;  1IZN B;  2E74 C;  2OYI C;  3GMA A;  1A5G H;  1FNI A;  2N1T C;  1NTZ G;  1QGK B;  5CCG C;  1MUE B;  1P01 A;  1V2M T;  2C9N Y;  3GY3 A;  2IJO B;  3TIT A;  3VGC C;  2OBQ A;  4NPF X;  3T5F H;  3W1E A;  3M5L A;  1JY3 N;  1PPG E;  3M35 A;  1VGC B;  4BRY A;  2G8T A;  1L2E A;  4MQA A;  2QJK B;  1K04 A;  2SGE E;  2M8R A;  2IPP A;  2J4I A;  2Y5H A;  3FZZ A;  3A8C A;  1UII A;  3AW1 A;  2DE9 A;  3MNS A;  2FTL E;  5TJX A;  3SGB E;  3EA7 A;  5E0J A;  3LGU A;  1AQ5 A;  2NU1 E;  3F5H A;  1YF4 A;  1ABI H;  2QA4 P;  2PUX B;  5KLV E;  1U7J A;  3R4Y A;  3V6I A;  3H1H E;  1VQ9 P;  2F9O A;  3V0X A;  2VWO A;  2V7Q H;  1PP9 G;  3I77 A;  2FZZ A;  1MKW K;  1TGB A;  2N9Y B;  3TF5 A;  3S69 A;  4Q63 A;  8EST E;  3RMO H;  5AW3 B;  3KN2 A;  2V35 A;  4NA9 H;  3VG8 A;  1L0L K;  1C5Y B;  2HOD B;  1ORF A;  3L70 E;  1QR3 E;  2RMZ A;  2FYZ A;  3L71 G;  1VQ7 P;  1G2C B;  2AFQ B;  2WPJ S;  3A7Z A;  3TU7 H;  1KIL E;  3A89 A;  4F4O C;  1RH5 B;  2ZDN A;  1AFO A;  3PP5 A;  1G32 B;  4B2C A;  1EKB B;  1XUI A;  2SGF E;  4WY4 D;  1D9I A;  1O2N A;  2XRC A;  4Y7A A;  2VID A;  5E8E H;  5LH8 A;  4Q7Z A;  1AIX H;  2PSY A;  3DFL A;  2RN0 A;  1AA0 A;  2M5A A;  1W2B O;  3RXU A;  1IQF A;  2HGT H;  4CPG A;  1WV7 H;  5F6M A;  1DD3 A;  2YMS C;  4X8T H;  4L73 A;  1GI8 B;  1K1I A;  2GKV E;  4H42 U;  3LGY A;  3VB5 A;  4BAO B;  4Y28 J;  4ZMD A;  4GIF A;  5KJ7 C;  2F43 B;  2BYA X;  1J1E B;  3TJV A;  3P17 H;  4OS7 A;  1DUE A;  3RU4 E;  5DO4 H;  1FS0 E;  2K9J A;  1AND A;  4DUR A;  2VRS A;  4TT3 H;  2Z5H A;  2W6B A;  1GBB A;  1Q3X A;  1SL3 A;  4BXW A;  2J59 M;  1O2J A;  1FMG A;  2P8O C;  2N1T A;  2WPI S;  4PV1 D;  2HLC A;  1UTL M;  1NTZ E;  1ZP0 C;  4GOD A;  3RL0 B;  2ZU4 A;  3O8B A;  3ZZ5 A;  5CDF E;  4UFD H;  4OS6 A;  3S9B A;  1NAF A;  4GVU A;  1DEB A;  3TJO A;  1BCC G;  1RJX B;  1T7C A;  5TIS H;  3SOR A;  1EX3 A;  3K2U A;  1DFP A;  1AVY A;  1SG8 B;  5AVX B;  2GT8 A;  4JYV H;  2C0W A;  3RXF A;  1FDO A;  4OWF A;  4Y11 E;  1SS1 A;  4K1E A;  4SGB E;  1H8A A;  4U3F E;  1H0T A;  4FVD A;  1C1W H;  4X8U H;  3A82 A;  5DGJ A;  5GPI B;  1H8D H;  4X2V A;  3T29 A;  2CK3 H;  4WY4 B;  1KIG H;  1GDT A;  3B5N C;  4EOT A;  1ARC A;  1BIT A;  1TBR H;  3BF6 H;  5AW0 B;  1HAZ B;  3FXE A;  1JIR A;  1W7X H;  2PRR A;  2P3F H;  3IN6 A;  3RL0 C;  1GHB G;  2XDJ A;  4B86 A;  4BXL A;  4YTP C;  1GHZ A;  2F9V A;  2KAI B;  2NU3 E;  2CPS A;  2BLQ A;  4HYT B;  1BTY A;  4ABB A;  2R3S A;  2QV1 A;  1F5K U;  1TA6 A;  5T1V A;  1FZC A;  4KT0 J;  2LXB A;  1DVA H;  2ZT9 B;  1KXC A;  2PSX A;  3LGV A;  1FPC H;  2P3U B;  1O3H A;  1HAP H;  2OCV B;  3PH0 A;  2P16 A;  1DUA A;  3AEB C;  4CRE A;  2E43 A;  5A8X A;  1FIZ A;  2JO1 A;  1CHO G;  1SGD E;  4TLF A;  2GD4 B;  2NWN A;  1GVK B;  1NRQ H;  1HJB A;  1TLD A;  5KAF H;  2W7U A;  1GVL A;  1PPZ A;  1HAV A;  1TPO A;  1DXP A;  2CMY A;  1IQJ A;  2ANM H;  1C5X B;  1FPH H;  2IN2 A;  3V2N A;  1KMH B;  2F9B H;  1EB1 H;  2B5T B;  2HFE D;  3IF4 A;  1OSS A;  2ZAE B;  3L33 A;  2G51 A;  2WSE J;  3JSV C;  1EZV E;  3PHL A;  2RCE A;  2KZI A;  2XWA A;  1OW7 A;  4BRY B;  1IQN A;  4MNY A;  3CX5 D;  1OWE A;  2ZU5 A;  2FWW A;  3D6Z A;  1FOS F;  4X1S U;  2FKW B;  5IDK A;  5HXF A;  5LGO A;  1GI6 A;  3F9F A;  3HUS A;  5AVW B;  3RK2 C;  1FZC B;  2ALP A;  3BTD E;  1QL2 A;  5BU8 B;  2B87 A;  4JYU H;  4D7F A;  4JBZ A;  4IC6 A;  1Z1I A;  3CX5 I;  2J98 A;  1L0Z A;  1EZV G;  4PD4 H;  1ZZZ A;  2FPZ A;  3I29 A;  4OS5 A;  1O2Z A;  2R32 A;  3A7O A;  2A7H A;  2WHX A;  2FO9 A;  4UB8 H;  4ABG A;  1U7M A;  3VB4 A;  3SWY A;  1BMF D;  5AVD A;  2D2C D;  3RU4 T;  1OZH A;  2YKQ A;  3B8E B;  2XXL A;  3BAS A;  1RRK A;  3MZW B;  1GJ8 B;  1LTJ C;  1O3C A;  1Y8T A;  2WPQ A;  1BDD A;  1RTL A;  2ODP A;  2RA0 A;  3ZVC A;  4MTB A;  4INH A;  1PQA A;  1Y47 A;  1C5Q A;  1GTW A;  2PKA B;  5T3H A;  1DPO A;  4H0L C;  4BWN A;  1QJ1 B;  1QVG O;  3E1R A;  1MTU A;  1AE8 H;  3CS0 A;  2ASU B;  1HWT C;  4I1L A;  1AVW A;  2KCA A;  1JMM A;  2BEQ D;  3C27 B;  1GDU A;  4ZHL U;  5C20 A;  6CHA B;  1C2G A;  2NU4 E;  2HVX A;  1IQE A;  1E1R D;  1JO5 A;  4JZF H;  2WYJ A;  3B71 A;  4IOI H;  1VQ8 P;  1C1Q A;  1EJM A;  1EXJ A;  1GBF A;  5FCR A;  3G4S P;  2XBV A;  3UNS A;  2Y81 A;  1QLE D;  3BTF E;  1VIT F;  5GTI E;  3LH3 A;  4UD9 H;  3BTW E;  3GHG B;  3P8C E;  4U3F G;  4NIY A;  3HE4 A;  3GLM A;  1EDJ A;  2BDB A;  4I7Z C;  1EZQ A;  1ZW0 A;  1LHC H;  1Q86 Q;  2G4T A;  1K21 H;  2KNC A;  1L0L E;  5EST E;  5GCH G;  1NH4 A;  1X0T A;  3I55 P;  3ZIA D;  5CMX H;  2QYI A;  1LP1 B;  1WT6 A;  3BIU H;  3P8O A;  4D9R A;  2KXP B;  2Q1J A;  7KME H;  2K1A A;  1SQX E;  2QGR A;  2KCP A;  1X9V A;  1HJ8 A;  4RO0 A;  2WT7 A;  2O9Q A;  5APV A;  2EQN A;  3H1K D;  2Y5F A;  4K8Y A;  3SHA H;  3ZVF A;  5CBN A;  2QIW A;  2XBY A;  5J4S A;  2F9N A;  3ZZB A;  3TLO A;  1ZPB A;  3O8R A;  1FDP A;  2AMQ A;  2ITA A;  3K6Y A;  3SHC H;  1NHL A;  1KXD A;  2EI6 A;  2IFN A;  3GCH C;  5F53 A;  1AKS A;  1C5M D;  1LQE A;  1PFI A;  3AAU A;  1PPF E;  3HKI B;  4MLF B;  1NTM J;  1LHF H;  5BPE A;  3EA9 A;  3P6Z B;  2IX7 C;  3B8J A;  3WU2 H;  1H0T B;  2H9H A;  2C8Y B;  3FKS D;  4JK6 A;  2FS9 A;  4JZ1 A;  4K3A A;  2QJK C;  3M9Q A;  1LTJ A;  1GI3 A;  2SGQ E;  3LDX H;  4YM9 A;  5CHX A;  2C8X B;  2AGG X;  1HNE E;  2GMT C;  1BML A;  2G5N A;  3V2R A;  4RI0 A;  1ELF A;  1ZJK A;  1J9C H;  3H7O A;  3RXV A;  1GBL A;  1O5A B;  1V2V T;  2ZFS A;  3SNE A;  4Q4L A;  1DS2 E;  1NZQ H;  1SHY A;  4I8H A;  3SU6 A;  3SW2 B;  2AS9 A;  4OS4 A;  1SQT A;  5KAI E;  4K1S A;  4YOG A;  4AGK A;  1EQ7 A;  1SQP D;  3NZI A;  3QK1 A;  1K2I 1;  2FES H;  2P2U A;  3PJS K;  2GUS A;  1KIL C;  4K2Y A;  3L70 G;  1SGR E;  4LGD E;  1QEX A;  3P8G A;  3VN0 A;  1JBU H;  1ELA A;  4RES B;  1LHG H;  1NBM E;  2ZHF H;  2KP8 A;  1SLX B;  3C8V A;  2ZHE H;  2XNX A;  1PP9 E;  1JUN A;  1P2K A;  3LGI A;  2ZXE B;  2M3E A;  2BVR H;  4DVA U;  5C1U A;  1LT9 C;  2YMY A;  3RC4 A;  3VP8 A;  1NC6 A;  5GXP A;  1V3X A;  3LT3 A;  2CJI A;  3G9R A;  1SR5 C;  2R2W U;  1ESB A;  1GK6 A;  2IBZ D;  3M0A A;  1LHD H;  3NWU A;  1QJ7 B;  2IDB A;  3EAJ A;  5AW2 B;  1G1J A;  3QTO H;  4IMQ A;  5JB8 S;  1Q90 D;  2J9N A;  1IAU A;  1NTK D;  2H88 C;  1N8O B;  1LT9 A;  1O38 A;  2R3C A;  1FAX A;  1OW6 A;  3PB1 E;  3KZI H;  5EW1 H;  3CXH H;  1VQN P;  1C1M A;  5DJU B;  1XXD A;  3RK2 D;  4O9V A;  2Z3D A;  5CMZ A;  2WPM S;  1O3D A;  2M0B A;  2OC7 A;  1RD3 B;  1GGD C;  3LC3 A;  1IFI A;  3K5B A;  2BCC E;  1S82 A;  3OJA B;  2O3J A;  2H2Z A;  1HAO H;  3URD A;  4X1P U;  4PD4 E;  2P95 A;  1O2O A;  4HZH A;  3NUM A;  5DJ7 A;  1SLU B;  3EGK H;  3L71 E;  1JTH A;  4UB8 E;  1S83 A;  1JOC A;  1K1J A;  3VPK A;  3GS9 A;  1P0S H;  3V2Q A;  1TQ7 B;  2CF9 H;  4N6J A;  2V6N A;  1FZE A;  3G6E P;  1GDN A;  4NWL A;  3SU4 A;  2IPH A;  4BAH B;  4J1Y A;  1K0H A;  2ANW A;  4YPC A;  3BCC E;  3AEG C;  1C5W B;  1W3C A;  2TGA A;  2J5U A;  3GY7 A;  5E79 H;  2IBZ G;  3MU4 A;  5DP5 A;  1SGT A;  3OAK A;  1V2T T;  4I7Y H;  4P02 A;  1JY3 P;  1QQ4 A;  4B1T A;  2BHG A;  5GCH F;  4B76 A;  1KZU B;  5HKK D;  1K1N A;  1NES E;  3ELA H;  1LWU A;  1SQB G;  2CK3 D;  2BB4 A;  3A7X A;  1TPP A;  4H13 B;  4GAW A;  1C4V 2;  3P32 A;  2WQY C;  2O8W A;  2YMS D;  2QJY B;  1DM4 B;  1TGT A;  3QZR A;  2ZVO B;  3V2P A;  1T31 A;  1PGJ A;  1SQX G;  1OWA A;  1ZGV A;  2PFE A;  3M3S A;  3Q3K A;  2Y82 A;  3L70 D;  1NU1 K;  1LMW B;  4A1V A;  1ZPZ A;  1KFM A;  1O2W A;  3OEE D;  1BMM H;  4FU7 A;  1H8E D;  5F8Z A;  1FAV A;  2TRM A;  2ZI2 H;  2V7Q D;  4N78 E;  1HJA C;  3VB7 A;  5EJZ A;  2HOB A;  5KLV D;  5GTH H;  2V7Q J;  5FX6 A;  3CCS P;  3SWF A;  1DIT H;  4DII H;  4LZ1 H;  3AEE C;  1NTM E;  3GY4 A;  5CE1 A;  2BVS H;  1AV1 A;  1LTT C;  3MO6 A;  4NPE A;  3S7K B;  3D65 E;  1BRU P;  1N7S B;  1KQF B;  4KJM A;  3PTN A;  2B9B A;  2ZFQ H;  4AUW A;  3MQK C;  1FIW A;  3RUO A;  3CL3 D;  3VYI A;  5EQS A;  8GCH G;  2UWL A;  1U6Q A;  1HLT H;  3A80 A;  1QBN A;  1C5V A;  2QXG A;  2HYN A;  1FX0 B;  4OGY A;  1FJS A;  1YIJ P;  1SVF A;  5F8T A;  4XA4 A;  3TGU D;  1C2E A;  1GBE A;  1P2Q A;  1C5U A;  1UVU H;  1QB9 A;  1KYN A;  2WYG A;  1O2R A;  1EP5 A;  2PHB A;  3PLK A;  4CH8 B;  2K0Q A;  1YBK A;  3P8M C;  1SQV E;  4HJG H;  3TGU J;  2W8Z A;  4K8B A;  4Y7B A;  3E1I A;  4SGA E;  1EQ9 A;  1HV7 A;  1URQ B;  1ELB A;  1FQ3 A;  3KYF A;  5AVQ B;  1UCY H;  2KAI A;  1E79 H;  3URE A;  1P12 E;  2WV5 A;  4RKU J;  3Q3X A;  3UQV A;  4J2Y B;  4ABI A;  1GL1 A;  2KK7 A;  4F55 A;  1TRM A;  3MO3 A;  4AZ2 B;  3F6U H;  2R2M B;  1RE4 C;  1YHQ P;  2ZVN B;  4YXW D;  4XD7 D;  1Y59 T;  2BX4 A;  2ZNK H;  1CA8 B;  5C3N A;  1GD2 E;  1AQ7 A;  2FLB H;  2XBX A;  1KIL D;  3DUX H;  5K0H A;  2F4L A;  4H44 C;  2GCT B;  1GI1 A;  3AK5 A;  2VGC C;  1NTZ K;  1P84 E;  2BTC E;  3Q3D A;  1O3G A;  1O3A A;  2BY8 X;  2PWX A;  3CS7 A;  4L76 A;  2THF B;  5EW2 H;  2JH6 D;  1MU6 B;  3HTK A;  3CCL P;  2E76 C;  5C5N A;  5AVV B;  1AD8 H;  1GHW H;  2BD5 A;  3UIA A;  1E1Q D;  1FON A;  3QUM P;  1M57 D;  3G71 P;  1IFD A;  4H6S B;  1Y8A A;  1G36 A;  2UWJ E;  3Q5P A;  4ISI H;  3RM0 H;  1HAI H;  4WME A;  3L72 D;  1BDA A;  1P84 I;  1P2J A;  1ZYO A;  5A8Y A;  1RHZ B;  1KOR A;  1Z1J A;  4F49 A;  1MTW A;  3CWB D;  2ZGJ A;  2A4Q A;  3MH6 A;  3RU4 D;  1MKX K;  1V2L T;  1WXR A;  2ZT9 D;  4UEH H;  1LJ2 A;  1D6W A;  2ODY B;  1YLN A;  3RK3 B;  4Y8Z A;  2ZFT A;  1GMJ A;  5FBI A;  1OX3 A;  2F3C E;  3FFG A;  4JZI A;  1S5L H;  5KLI C;  1TNH A;  1M1J B;  1K9M Q;  2Y80 A;  2FYU G;  5GJ4 B;  3Q5S A;  4IL6 H;  2G52 A;  3AAS A;  2B88 A;  1Q31 A;  3HE4 B;  1GBH A;  3TK6 A;  1SQP K;  4JYC A;  1T2K C;  1GHA G;  1WMK A;  3MU8 A;  2O01 J;  5EG4 A;  3G3Z A;  2ZU2 A;  2QSI A;  3BTH E;  3HTK B;  3QH9 A;  2KLU A;  1C2J A;  1M1K Q;  1CT2 E;  2QCY A;  2Q6F A;  3SWK A;  1W0K D;  1XTG B;  1KXA A;  3HK6 B;  1PGQ A;  5KLV K;  5CCG A;  1QBO A;  3LIW A;  2ZIQ H;  4H6T A;  4TPI Z;  4BTT B;  2HR3 A;  3QX5 H;  1DWE H;  2XC4 A;  1TFX A;  1K1L A;  4AG2 A;  4O97 A;  3SZE A;  4CRC A;  1BMN H;  1K73 Q;  3KQD A;  3LW5 J;  1S6H A;  3I78 A;  5I25 A;  3MNC A;  2D1J A;  2C0X A;  5J4Q A;  5CHA B;  5DK1 A;  3VXF H;  1A7S A;  1NTM D;  3QO6 A;  3SGQ E;  2GMT B;  1EP6 A;  1CE5 A;  1P2M A;  4R0I A;  3BVH A;  4NZL A;  4WWY A;  3ZVG A;  1W14 U;  4BAN B;  4CHA C;  1SP4 A;  1K28 D;  4XE4 A;  1PQ8 A;  2M2A A;  3B9F H;  3OTJ E;  2ZT9 C;  1EXF A;  4NG9 H;  2BLW A;  1GBT A;  2A4R A;  4XFJ A;  1BRC E;  1OW8 A;  4ZKP A;  1LP1 A;  2QAA A;  1M1J A;  2MJZ A;  3PV5 A;  5KEC A;  2OTJ P;  1BJU A;  1SGP E;  2ALV A;  1SFC C;  2NPS C;  3ITI A;  3LON A;  5CCH A;  1WSS H;  4FUJ A;  3AE9 C;  3MUD A;  1BCC E;  5AVR B;  5AVU B;  1CGJ E;  1UVO A;  6GCH G;  2KOG A;  3SND A;  5KLV J;  4B74 A;  2K3R A;  3Q76 A;  5K7R A;  2E75 B;  1D4P B;  2FX4 A;  1DH3 A;  1BRA A;  2WUB A;  1XVO A;  4IN1 A;  1USD A;  1MQ5 A;  2KCY A;  4BNR A;  1OKX A;  2BXT H;  4CRB A;  1TMT H;  3SU1 A;  3OX7 U;  1P3C A;  4CRD A;  2RA3 A;  3TVJ B;  1AE5 A;  2DE8 A;  3G01 A;  4IS5 A;  3FP6 E;  1KC8 Q;  4E06 H;  2JET C;  2QRX A;  1V2O T;  3F2H A;  4DIH H;  2OBO A;  2H89 C;  2ZDM A;  1BQY A;  4EYY Q;  1Y5U T;  2A06 E;  3RXS A;  3UQO A;  1SLV B;  2V3H H;  3B5N D;  5C1Y A;  1WTH D;  2Z9K A;  1KLT A;  1MD7 A;  3PO1 B;  1S5S A;  1SQX K;  4RKJ B;  1FJP A;  1ZR0 A;  3IFM A;  2BD4 A;  4Z0K A;  1MTV A;  1C1N A;  2QM7 A;  1J1D B;  3QGN B;  4AYV B;  5GWZ A;  1MZ9 A;  1RFN A;  2L74 A;  4UFE H;  4B2A A;  4D7G A;  1N73 C;  2YIU B;  2BMG B;  1S3J A;  3MNB A;  2KFW A;  3RXM A;  1EDL A;  1HAY B;  1QHR B;  3H1H D;  4MG3 A;  1LWU B;  1CVW H;  2QXI A;  1KYO I;  2TBS A;  4XSK U;  2AMP A;  2ULL A;  3RXQ A;  2AGI X;  4KGA A;  1SFC A;  2NPS A;  1FN8 A;  2JET B;  2Z3C A;  3PRD A;  3V7T A;  3VXE H;  2WPS A;  2PLX A;  2WPK S;  1GL0 E;  4YLQ H;  5DP4 A;  1HAX B;  1MFZ A;  2QN5 T;  3RXC A;  3SOS A;  2SGA A;  2FOG A;  2FXR A;  2HNT F;  3IIT A;  2OQ5 A;  1NYH A;  3A87 A;  3DSO A;  1G3B A;  2GCH G;  4AYY B;  4TWY A;  4MVN A;  1BDC A;  4H0L B;  4ZXY H;  5H4I B;  2PGB B;  1PFX C;  3OYP A;  1NTK G;  1LGH B;  3HAT H;  1M1J C;  4ASH A;  1EZV I;  1TMU H;  1NPM A;  3CP7 A;  1UTK A;  3C9I A;  2DW3 A;  3II6 A;  1WYK A;  2OC1 A;  2QF3 A;  1NFY A;  2BXU H;  1GBD A;  1WDI A;  4JZD H;  1G3E A;  1O3O A;  4ASW A;  1W2K H;  1PPJ G;  2XU6 A;  1LPZ B;  5TIS E;  1UTM A;  1LTS C;  1PPJ D;  4H13 D;  4RJT A;  1YQ3 C;  4H13 C;  2KIK A;  1MMJ N;  4GKG A;  4PV1 B;  2ZXX A;  2Z5I A;  1HJ9 A;  3NCL A;  1GCT B;  1NJI Q;  1XKB C;  2BLO A;  2WVR A;  1SQX J;  2FXP A;  3H32 A;  6GCH F;  2WIT A;  1GI9 B;  3QZQ A;  3L73 E;  2ZDK A;  5F8X A;  3M5M A;  1QB1 A;  3SI4 H;  1T8N A;  4YOJ A;  1GG6 B;  1GI4 A;  4AFQ A;  1T8M A;  2QF4 A;  3FZD A;  3TH2 H;  3CX5 H;  1JTH B;  3HGP A;  4EI2 A;  1SFI A;  3MO9 A;  1SQB J;  1TA2 A;  4WMF A;  1OWD A;  1C1V H;  2H7H A;  1VF5 C;  2VNT A;  3KZI E;  3KL6 A;  4A5T S;  5FBE A;  1FJK A;  1HXE H;  3LID A;  1BCU H;  1QNJ A;  1MAB B;  4U32 A;  1B0F A;  2A45 H;  4PJ0 E;  1G1I A;  2GDE H;  3GYL B;  1CHG A;  3HGN A;  2WPR A;  1P11 E;  1Z8I B;  2I6S A;  1C2I A;  1T8Z A;  4PV1 C;  1GI0 A;  1HIA A;  5EJL A;  2Y6T A;  1NKZ B;  2W6A A;  3P7K A;  1GPZ A;  4NIX A;  1EOJ A;  2ZDV H;  4WY4 A;  1GU4 A;  4WVP E;  1KD1 Q;  1ZV8 A;  2SGP E;  2BDC A;  2Z9L A;  1C5T A;  4THN H;  1NTK J;  4WJG 2;  1SQP E;  1PL5 A;  2KNC B;  3A85 A;  6EST A;  2YNY A;  1VJ9 U;  5C1X A;  1OX1 A;  3TJU A;  1KY9 A;  1N73 A;  1RQV A;  2Y7Z A;  3RXR A;  1ABJ H;  3U28 C;  1P8V C;  4DW2 U;  1QVF O;  1AHT H;  1NBM D;  4AOQ A;  3OE7 D;  2UUY A;  3L71 J;  4ABE A;  3TIU A;  1SQQ G;  3P70 B;  1SQP G;  1P9U A;  3H1K J;  1RY3 A;  3O8C A;  1T32 A;  2FMJ A;  2YNA A;  1SQQ K;  1UW7 A;  4RN6 A;  3ZVB A;  2OGU A;  2KS1 B;  4INK A;  1IO4 A;  3M37 A;  1ZTK A;  2F83 A;  2QEX P;  3MH4 A;  4EST E;  1LQD B;  3A0H H;  2WPD D;  5FHT A;  1O5G H;  1YKT A;  3LGW A;  1KIL B;  1YBW A;  1J2J B;  1L4A D;  1S72 P;  3PRJ A;  2AEF A;  1F0T A;  3H1L E;  4I7Z B;  1C2M A;  1O2Q A;  5JB9 S;  1BCC J;  1GHY H;  2PUQ H;  4IC5 A;  1S85 A;  4K69 A;  2IYP A;  1H9I E;  1ZHM A;  1A5I A;  5T6F A;  3NRL A;  3I56 P;  3MNX A;  4H44 D;  3M91 A;  3CD6 P;  4EDF A;  5EJ1 A;  3KYG A;  2EST E;  4YTA A;  1HPG A;  3PLB A;  1CA0 B;  2I1J A;  2D2D A;  3H6P A;  1O3P B;  3L74 G;  2OYO A;  1YCP K;  2I6Q A;  1GJ4 H;  1K9O E;  1SOT A;  3TGJ E;  1ZR4 A;  2BEZ F;  2QXH A;  3RXO A;  2W6I D;  1O3N A;  1PQ7 A;  1OYQ A;  4NIV A;  2BZ6 H;  2W26 A;  3NK8 A;  2GTB A;  1JIM A;  1C1U H;  4OGQ C;  2R0L A;  1BGY E;  2J98 B;  2QVA A;  1NN6 A;  2E74 D;  1JEK A;  4X0W U;  2SNV A;  1SQR A;  2UWP A;  2LKM A;  1K1M A;  2BQ6 B;  4WXI A;  4E05 H;  1V2W T;  4UON A;  2BAS A;  3T25 A;  1O5F H;  1L0N G;  5HMA A;  1ELG A;  1YCP M;  1NM6 A;  3MTU E;  2G5V A;  3ATL A;  4A1X A;  2D8W A;  3PRO A;  1GU5 A;  3LU9 B;  2R0K A;  4HGC A;  1HAG E;  5GTI H;  3CCQ P;  1IC2 A;  5AF9 H;  1LTO A;  1S2E A;  3CWB G;  1TNG A;  4F48 B;  3M5O A;  3HPT B;  2P58 A;  1GMC F;  4K1T A;  2FS8 A;  3KGP A;  5C5O A;  3E3T A;  2A5I A;  2OQU A;  5C17 A;  3TYY A;  1AKS B;  5DKM A;  1P05 A;  1TAB E;  1ZLR A;  2QY0 B;  1R5S A;  3UB0 A;  3SSU A;  3Q77 A;  3H1J E;  2GGV B;  3BTK E;  1G3C A;  1WUN H;  1URQ C;  1CQQ A;  4I8K A;  2KZ4 A;  1TON A;  2ZWL H;  1MBQ A;  3H25 A;  2IYO A;  3MGN A;  1L2P A;  1PIX A;  2G8Y A;  2VIO A;  1JY2 O;  1A0J A;  4DZO A;  1ETS H;  1F0R A;  3ODF A;  3GY8 A;  1C5O H;  1JB0 J;  1XXF A;  3M3V A;  1DLK B;  3ZZA A;  2PKS B;  1MZA A;  2FFD B;  1S4X A;  4FUE A;  2ZTY A;  3N4X A;  1GI2 A;  3BEI B;  3W67 A;  4IFM A;  1FUJ A;  5CCH D;  1SGY E;  4WH8 A;  2P93 A;  2YO2 A;  2ZDL A;  3OSY A;  3B4S A;  1AU8 A;  1W0J D;  1S0R A;  1JMB A;  1IHT H;  4NGA H;  3DA9 B;  1NRO H;  4TYD A;  3SUE A;  5FCK A;  1N1L A;  1YYC A;  4WMD A;  3NXS A;  5FAH A;  3JZ2 B;  5EOK A;  3HD7 A;  3DFJ A;  3NKK A;  3AEC C;  1SQQ J;  3M06 A;  3A5T A;  4TWW A;  1GMD G;  1P9S A;  1VZQ H;  5B66 E;  1CA0 C;  1PZQ A;  1RIW C;  3L75 J;  2ZDA H;  4U30 A;  5B6L A;  1L0L G;  2FOC A;  3AEF C;  1EPT B;  3GCH B;  5TJH A;  3TGU E;  1UO6 A;  4INL A;  3F89 A;  1ZMN A;  3T62 A;  1IQG A;  1W13 U;  3CXH E;  3N7N A;  4C7R A;  2FYU K;  1JCD A;  3RXA A;  1MTS A;  1FY8 E;  2GZ9 A;  5JBA S;  2A45 G;  5DSF A;  5FL7 D;  3BN9 A;  2FFD A;  3CWB E;  2FYR A;  4XBB A;  3WUV A;  1O37 A;  2VU8 E;  1VQO P;  5GIB A;  1A1R A;  1P03 A;  5E2O A;  2C8Z B;  2PV9 B;  1RIW B;  1Z7K A;  3VOP A;  5H2F E;  1HYL A;  1RGQ A;  2DUC A;  2NZ2 A;  2A2Q H;  2HWL B;  3AVZ A;  3H1K E;  3KQG A;  3P8C D;  1CW5 A;  1VIT H;  4NFF A;  5SGA E;  1P06 A;  2C8W B;  3WW7 A;  2JEE A;  3N7D A;  1HIA B;  1XUK A;  5KJ7 D;  2LPR A;  1OYT H;  1KXF A;  2YKP A;  1Y5A T;  1O3B A;  4I2L C;  2CPB A;  1EAT A;  3ZVE A;  3Q2Y A;  1AB9 B;  2FTM A;  2PGQ B;  1L0L D;  1S5L E;  3A8D A;  3DCL A;  1DEE G;  4C7N A;  1JRT A;  3LKW A;  4MPW A;  1A4W H;  2M3B A;  1OIP A;  1C5L H;  4YT6 H;  1O5E H;  2HLO A;  1GMD F;  5AW9 B;  1NGM B;  3F9H A;  4TT3 D;  3L72 E;  1NS3 A;  1ZOY C;  1ZSL A;  1SQV G;  4ABA A;  2N1T B;  5A2M H;  4UB6 H;  3ATI A;  4X1Q U;  1NO9 H;  1A02 J;  1OWI A;  1MD8 A;  3O6Q B;  1OMI A;  1FY1 A;  3HD7 B;  2O8U A;  2YNB A;  1EZS C;  5LPE A;  4HKZ H;  1O2X A;  1SQP J;  1GJC B;  3SV7 A;  1DSU A;  3F2G A;  1JNM A;  1VQ6 P;  2J95 A;  1VPC A;  1NWQ A;  2J38 A;  3KHU A;  5I46 H;  2FX6 A;  1SGQ E;  1CBW C;  4MNX A;  2Y0E A;  3U9A H;  3BTG E;  4GOE A;  3HK3 B;  2VIV A;  3ZZ4 A;  1THS H;  4AB8 A;  1DAN H;  1C5Z B;  5EIY A;  4XBC A;  2C9L Y;  3TNU A;  2XNI A;  1BJV A;  1C9P A;  1XM1 A;  2C4F H;  1P2N A;  1QX8 A;  3GHG A;  1PPH E;  2VH6 A;  2ZGH A;  4ZMA H;  8GCH F;  3JC2 2;  3S7H B;  2OTK E;  1O39 A;  2FXO A;  3F1S B;  1JRS A;  5APU A;  3E91 A;  1J14 A;  3H1I E;  2A7J A;  4HI3 A;  3AE1 C;  1COW D;  1D3D B;  3RP2 A;  1O5C B;  5DPA A;  3BG4 C;  1BRB E;  1NFW A;  1UHB B;  1MFT A;  2Z4E A;  3ZVD A;  2FYU D;  1V2K T;  1LKA A;  1TAW A;  1M90 Q;  2BQW B;  5APX A;  5E2P A;  4Y99 B;  2BY5 X;  1C1T A;  1GDQ A;  2ZC9 H;  3M5N A;  1ZML A;  2WMM A;  1YLD A;  1RF1 C;  3D70 A;  1OXZ A;  3ATW A;  1A0L A;  4OGQ D;  5DJT B;  1R5L A;  1W10 U;  2IBZ E;  2BQ7 B;  3ZZD A;  5JBB S;  2QF0 A;  5M1B A;  3RXH A;  1WBG B;  1G37 A;  1NU9 A;  1PP9 J;  6LPR A;  1LHE H;  3SJI A;  3CCM P;  4YT7 H;  2RDL A;  3SQE E;  1RTK A;  2A06 D;  2FP7 B;  4AOR A;  2HNT C;  1LVO A;  2F91 A;  3OTP A;  3RXJ A;  2G4U A;  3SUD A;  3PRB A;  2H5D A;  4YZU A;  5KLI B;  5GND A;  4ISO A;  1TX8 A;  3M3T A;  4KEL A;  3F9G A;  1W7G H;  3AE4 C;  1SMF E;  3BRV B;  3E16 B;  1GGD B;  2Y9Z A;  5GDS H;  1SQA A;  2A7C A;  3FWL A;  1NRP H;  3PMH B;  1M7L A;  2A31 A;  3E6P H;  2FOA A;  3PTB A;  1O2H A;  1MZD A;  1BA8 B;  2BDG A;  5CHB A;  3ZV8 A;  5HYO A;  3D71 A;  4P00 A;  2Q9I A;  3T27 A;  1VQK P;  1O2P A;  2H8P D;  1LVB A;  1B0E A;  1INC A;  2FFD C;  1B7X B;  2M5T A;  1QQU A;  3H1L J;  1TPS A;  1QFK H;  3L75 G;  1SQV J;  1ELE E;  1MCV A;  1O5B B;  1SQB E;  2AXT H;  1SGE E;  2FOB A;  4K35 A;  1ACB E;  1EPT A;  4Y0Z E;  2J97 A;  4FUD A;  5ESB A;  1N73 B;  3CME P;  2BZA A;  4Y71 A;  1V2P T;  2GA1 A;  3L75 D;  5HIY A;  1EJN A;  1S5L X;  3F0O A;  3IWM A;  2FI5 E;  3MWI U;  3NFQ A;  1JMO H;  4FET A;  2QE7 H;  2LXC B;  1SQB K;  2BD9 A;  2BLV A;  1MAX A;  2XC5 A;  2IFM A;  3U59 A;  1KLJ H;  2KB7 P;  2KS1 A;  1O3J A;  3CWB J;  4MPU A;  4NA8 A;  3S9A A;  2KM0 A;  2NU2 E;  2P67 A;  1H89 A;  2FOM B;  4YES B;  3KF2 A;  3SFE C;  1W2E A;  3M0D C;  1EAS A;  1MAY A;  4ISH H;  4NFE A;  1EUF A;  1FXY A;  2AGE X;  3OAA D;  1UTO A;  1HDT H;  1G9I E;  1ZTJ A;  3KID U;  4JYT A;  1FN6 A;  1UTJ A;  1GCD A;  3SNC A;  5B5E E;  3SO3 A;  2WSF H;  1YTZ T;  1CSO E;  1IK9 A;  3TGI E;  1VF5 D;  5BRR E;  2A06 G;  4A7P A;  1SQX D;  4KTU A;  3U1I B;  4IFD K;  3U8O H;  1MUU A;  2ZCK P;  3DHK H;  2K1Q A;  3USS A;  3M9H A;  2BDI A;  1Q82 Q;  2GDD A;  2XV5 A;  1SQO A;  3BV9 B;  1HJ0 A;  3F9E A;  4A6L A;  1D3T B;  1OVU A;  2ZFF H;  4UE7 H;  2A4G A;  3OFN D;  1H1B A;  3RK3 C;  3BEU A;  4XFQ A;  1SSX A;  4DT7 B;  1KTT B;  1QB6 A;  1OVV A;  1AZ8 A;  4M7G A;  2LR2 A;  3MIW A;  1XUG A;  1AB9 C;  5JBT A;  1DXW A;  3F2F A;  1C1S A;  4ABF A;  1IFJ A;  2G3A A;  1CGH A;  1MH0 A;  3FXD A;  2XND H;  5E0H A;  2W3I A;  1O3F A;  1KYO H;  1O2G H;  4GPG A;  2YIU C;  1J15 A;  5HM2 A;  4N3Y B;  1ZPC A;  2ZPQ A;  2BDY A;  1AJY A;  4B75 A;  3TDK A;  1O3K A;  1V6D A;  2R9P A;  3RMN H;  3M36 A;  4Y8Y A;  1BSN A;  4A92 A;  3FP8 E;  4Q2K A;  3GY5 A;  3H32 B;  5AVZ B;  1EZV D;  1LTJ B;  1RE4 A;  2RKL A;  1PPC E;  1Y3W A;  1O35 A;  5EQR A;  3ZYD A;  1EXI A;  2QG4 A;  2PTN A;  5FX5 A;  3H1H J;  2Z9J A;  1A3B H;  4GUX A;  1S6F A;  1QL1 A;  4FUC A;  4QT8 C;  2C90 B;  5L30 H;  1L4D A;  1AFE H;  3RL0 g;  3H1I J;  1O30 A;  1LTI C;  1IQI A;  1C5P A;  5KJ7 A;  4IMZ A;  3UWI A;  1DD4 A;  5HIZ A;  2B8O H;  4CRA A;  1A2C H;  1CGI E;  1EB2 A;  2AEM A;  4VGC B;  2W6J D;  1ZME C;  1ETR H;  2Y7X A;  3L4F A;  1FC2 C;  3GW6 A;  4ACB A;  1GBC A;  4CRF A;  1E34 B;  1ZJD A;  2AHM E;  1Z8J B;  2B7D H;  3S4R A;  1FDM A;  1EAX A;  4TSF D;  2GUV A;  1C2H A;  1Q2W A;  5L8R J;  1KFN A;  4LK4 A;  5L6N H;  3M61 U;  1W0Y H;  2H9E H;  3CI9 A;  3SZN A;  3U69 H;  1SFC B;  2NPS B;  1JOU B;  1GCT C;  1FE6 A;  2XND D;  3UWJ H;  1LKB A;  5FPY A;  1MTN C;  1AN1 E;  2UUK B;  4HB1 A;  2KCO A;  1X7A C;  3PLP A;  3OY5 U;  3GCT F;  3BG4 B;  4WVZ A;  1GG6 C;  3SU0 A;  1ZSJ A;  2FYU E;  1O33 A;  1NFX A;  1SGC A;  1IFP A;  3RL0 D;  1Q2N A;  2XBW A;  1PGO A;  1BUI A;  3PTZ A;  3MH5 A;  1DWD H;  2XOK D;  1GBA A;  1RF0 C;  5L2Y H;  1FU1 A;  3N7O A;  2QJP B;  1P3E A;  3IAO A;  5T6G A;  1N7S C;  4X2Y A;  2W5E A;  2FIR H;  1SGF A;  1VQ5 P;  5AVT B;  4D6T E;  2F9U A;  3KQE A;  2RFK C;  3PYH A;  2QXJ A;  3HRN A;  1N86 A;  3ATK A;  3V4Q A;  1YTZ I;  2WSS H;  5B66 H;  4R4M A;  2PKS C;  1BMA A;  2H1U A;  5AFY H;  2ZGC A;  1BGY D;  1S0Q A;  1FV9 A;  3RLY H;  3GYM A;  5AW5 B;  3VB6 A;  2FYN C;  1YCP H;  1Z6J H;  5HM9 A;  1WOF A;  2STB E;  2OTV A;  4JQ0 D;  4U3F J;  2OYH A;  1A02 F;  4IBL H;  2SPZ A;  3T97 A;  3LH1 A;  4TY6 A;  3RXB A;  8LPR A;  2OXS A;  3UNR A;  4C46 A;  4MN4 C;  3SJO A;  1PV3 A;  1GI5 A;  1GBI A;  3TPI Z;  3EA8 A;  1LWU C;  4FXG H;  3SNA A;  2JJ1 D;  3RDZ A;  2Q6Q A;  2PGD A;  1UK4 A;  2PR3 A;  3KYQ A;  4CBN A;  4B6F A;  1CHO F;  2CXV A;  2O8L A;  3L6P A;  1NVO A;  1YPH E;  4D6T J;  4GSO A;  3UR9 A;  4E7N A;  4NZQ A;  2B87 B;  2H9T H;  1W0Z U;  1CT4 E;  2Q3E A;  2Q5U A;  1A5H A;  2Q1K A;  2C93 B;  2F9P A;  2IZ1 A;  1TNK A;  3RXL A;  3GIC B;  1AFQ C;  1GVZ A;  2Z9G A;  3CPW O;  3CCU P;  4AB9 A;  1ZRT E;  2PFX A;  1P04 A;  3JCU H;  3A8A A;  1VQ4 P;  1AZZ A;  1YM0 A;  2A45 B;  2GZ8 A;  4I32 A;  3CXH D;  2KR7 A;  3SGA E;  4WBA A;  3H1K G;  3AE7 C;  1F0S A;  3M7T A;  1LT1 A;  1PQ5 A;  1UVS H;  3TSI A;  1EDI A;  2BDH A;  4FU9 A;  1NOH A;  1VDF A;  2L91 A;  1SQQ D;  1GL2 C;  1KQG B;  1O3I A;  1NRR H;  3N7E A;  2BOH B;  4ISL A;  3TNS A;  2O01 H;  4DT0 A;  3A84 A;  1OS8 A;  2RH0 A;  3S1K A;  1KMI Z;  2A0Q B;  3RXK A;  1OWH A;  3L71 D;  2VIP A;  2IPQ X;  5TCC A;  4AN7 A;  2BD7 A;  3PMB B;  2WIN I;  4A1T A;  3MU1 A;  1P84 H;  2IZ0 A;  2OYH B;  1ZSK A;  3GCO A;  3QN7 A;  4BTI B;  2VVV A;  1NKN A;  2NRG A;  1N8O C;  1ZHP A;  2JP3 A;  4D6T G;  1BZX E;  2CV3 A;  4FUH A;  2SNW A;  2FOE A;  3GCT G;  1NTM G;  3TNU B;  2JKV A;  1L4A B;  3HE5 B;  3TK1 A;  2KSE A;  3O8Z A;  3FWN A;  3A0B E;  3AED C;  2WZQ A;  2R5D A;  1FI8 A;  4VGC C;  3STI A;  1H8H D;  2Z9I A;  1IFM A;  2ZFC A;  1T3U A;  9LPR A;  2BD3 A;  3ZZ3 A;  4XBD A;  1T2K D;  1TNJ A;  3RXG A;  4DG4 A;  1BT7 A;  1KTM A;  2TIO A;  1Z6E A;  4DGJ A;  3GF7 A;  2Z6B D;  3U98 H;  3A0B H;  3MFJ A;  5A0B A;  2WSF J;  3A3Y B;  2J34 A;  1OHH D;  1IOE A;  2J92 A;  3SJ8 A;  3SV2 H;  2E5Y A;  1USE A;  1O2Y A;  3QGJ A;  4OS1 A;  3SBK A;  1ZRT D;  4JPZ B;  2VWL A;  3HUS C;  1CSB A;  3GHG C;  3BTQ E;  3KHV A;  4I31 A;  5G4B A;  4ZKS U;  1KIL A;  1ZTL A;  3RK3 E;  2Q6D A;  4WY3 A;  3D49 H;  5DN6 D;  1L0N D;  3C1K A;  3EYD A;  2HPC A;  1EDK A;  3ITK A;  3MMG A;  5AVY B;  2BDA A;  1QL7 A;  3BTE E;  2ZA5 A;  4FUF A;  1EZX C;  4X1R U;  1DST A;  1KB9 H;  3SI3 H;  1CT0 E;  2XCN A;  3KQ5 A;  1O2M A;  2HAL A;  1GHV H;  1O5D H;  1QCP A;  5DP6 A;  1JM0 A;  2RDE A;  1YQ4 C;  4IFF A;  1YJW P;  4NWK A;  3RXD A;  3R0F A;  1AY6 H;  1TMB H;  3GF3 A;  4CR9 A;  3PWC A;  3H1J G;  1O31 A;  4O3T A;  2VWM A;  1T4U H;  1O3L A;  2O01 N;  1KN7 A;  5FXL A;  2P1J A;  1QRZ A;  1V2N T;  2FI3 E;  2AER H;  1X8Y A;  1JY3 O;  4K60 A;  1IQH A;  1LTA C;  3WWB A;  2JDI D;  3K9X B;  1SBW A;  3H1H G;  2R3U A;  2W83 C;  1GJ7 B;  2BY6 X;  4ZAE A;  3ZYE A;  1N6Y A;  4JK5 A;  1PPE E;  3L70 J;  1ZN5 A;  1NTP A;  3BSQ A;  2WUC A;  1ZHR A;  2H6M A;  3MU0 A;  2UUJ B;  2IJD 1;  4Z1M D;  1TU3 F;  1P2O A;  2YKO A;  3PMA B;  2TGD A;  1NO4 A;  2AIP A;  2Y5G A;  2HG5 D;  1AFQ B;  2VIW A;  2WV9 A;  1UCY E;  3VFE A;  1XTC C;  4OGQ B;  2WWW A;  3GG2 A;  1NU1 J;  4AQR D;  2P7J A;  3FAN A;  2ZPS A;  4R8T B;  4WXV A;  1BB0 B;  1X22 A;  1WRG A;  1YLC A;  3SQH E;  2H43 A;  1AVX A;  1OWJ A;  3SUF A;  4DY7 B;  2O1K A;  1KDQ A;  2ZHD A;  1JY2 P;  2ZTZ A;  1L0N J;  1CU1 A;  1O2S A;  3EE7 A;  4CHA B;  3WU2 E;  1BE3 J;  3V4W A;  4KKD A;  1FY5 A;  2KUB A;  2ZQ1 A;  3A7T A;  2ANK H;  1DWB H;  3OY6 U;  1HB0 B;  1N7S D;  3UIR A;  4YO9 A;  4YXW H;  1IQL A;  4ZRO A;  1ELC A;  1D3Q B;  1N7L A;  1SQV K;  2AEJ A;  3RXE A;  4XOJ A;  3AW0 A;  1KQL A;  1Z56 A;  1O3E A;  3SU3 A;  1T3J A;  1D7M A;  2P94 A;  1ESA A;  1GJ6 A;  5AVS B;  5KLV G;  3U1C A;  2XYA A;  3STJ A;  2SGD E;  4JCN A;  3B5N B;  2QC2 A;  2TPI Z;  3A2A A;  1AVO A;  2Z3E A;  3O8D A;  1ZMJ A;  3ZZC A;  5C0U A;  2OLG A;  1YPL H;  2ZKS A;  4K5Z A;  4AC9 A;  3S0N A;  2OK5 A;  3JCU E;  3AE2 C;  3AE3 C;  1O0D H;  2PTC E;  3LOX A;  3T97 B;  5LPF A;  1GHA F;  3LJJ A;  3L75 E;  1Z8R A;  3FX0 A;  2D26 C;  3A88 A;  3D23 A;  4X6N A;  4JYB A;  1GBK A;  1SQQ E;  4HTC H;  1BE3 E;  1J8A A;  4WB4 A;  1ZLL A;  1NTM K;  1SHH B;  1ZGI A;  5H2F H;  2Y0D A;  2A2X H;  3H1I G;  3HD7 D;  1ETT H;  1GJ9 B;  1SQB D;  3WWF A;  4ZUH A;  1C1R A;  1AO5 A;  3RM2 H;  1R8E A;  5CCH C;  2GVF A;  5FPS A;  1DX7 A;  2W3K A;  2L5G B;  4M3L A;  3OA7 A;  2ZGB H;  2P10 A;  1NRN H;  2K8I A;  1BBR K;  1DIC A;  7GCH G;  1AQT A;  1S9K D;  2ZU3 A;  2HNT E;  3GDV A;  1KXE A;  5EOD A;  4ACA A;  1V2U T;  4FVB A;  1N2D C;  1LT9 B;  2BD2 A;  1E38 B;  2Q7C A;  4DCK A;  4NA7 A;  2BY9 X;  2ANY A;  1O32 A;  4OS2 A;  3UY9 A;  1GBJ A;  4YOI A;  4KTS A;  1DLE A;  3BCC D;  3RC6 A;  1URQ D;  2LNC A;  2R3Y A;  2VH0 A;  2IBZ I;  3RK2 B;  1FZC C;  1IQM A;  2GM4 A;  1QIX B;  1HUT H;  4PD4 I;  1WQS A;  4O9B A;  2A5K A;  2P8O B;  3OEH D;  4X8S H;  1MKX H;  4AFZ A;  3S9O A;  5KAF E;  3RK3 D;  4PJ0 H;  3L72 G;  1YPM H;  3SYJ A;  4DCD A;  1Z71 A;  5C67 A;  1F5L A;  2WPV B;  1RE3 A;  3L37 A;  3HE5 A;  5B5E H;  1ELT A;  2AXC A;  1H88 A;  1P09 A;  1UJ1 A;  3RBX A;  5CBO A;  2V3M A;  5LPR A;  1LDT T;  1O2L A;  1GMH F;  5C2Z A;  2GP9 B;  1GBM A;  3L3T A;  2XW9 A;  3URC A;  4D8N A;  1TB6 H;  2FY8 A;  1KXB A;  3BG8 A;  1Z8G A;  4X2W A;  1VQL P;  1NTK E;  3Q00 A;  5K5G B;  1SGF G;  1NTZ D;  3NPS A;  2OC0 A;  5C0T A;  4X2X A;  1H9H E;  1ZXG A;  5CCG D;  5DP3 A;  2JWA A;  1RQU A;  4O3U A;  3VTP C;  1HGZ A;  3H7T A;  1J1D C;  1M56 D;  1BTH H;  2XCF A;  1E5W A;  4ASV A;  2HPC B;  1LTB C;  4NIW A;  3A81 A;  3LGT A;  3L72 J;  1THR H;  3RC5 A;  4ABH A;  2KX4 A;  5E79 E;  4IGD A;  4XDE A;  1A46 H;  1VKY A;  2YMS B;  3D6Y A;  4UFF H;  5CJ0 A;  3ZVA A;  5APQ A;  2OYI A;  1VL2 A;  2RG3 A;  4I8G A;  2W27 A;  5IK2 D;  3U8R H;  1QBV H;  1PGP A;  2LEL A;  3V5B A;  1C2F A;  1G2M A;  1Y3V A;  1GK4 A;  2OYH C;  2K9J B;  3PO1 C;  1LVM A;  3TGU G;  2GJG A;  1G3D A;  4FOU C;  3SUG A;  1NU1 E;  1YJN P;  3SFD C;  4CR5 A;  3DD2 H;  3F3B A;  2STA E;  1A0H B;  3L73 J;  1MKW H;  1NTZ J;  1VR1 H;  2CHA C;  4MDS A;  7GCH F;  3RLW H;  3VMA A;  1WCZ A;  1PYT D;  4DOQ A;  2W90 A;  1PYT C;  4GOF A;  1JWT A;  1IK7 A;  1L4A A;  1HUC A;  2A1D B;  2I1K A;  1YWU A;  3PLN A;  2VIQ A;  3TK5 A;  2TGP Z;  2W7S A;  2L6O A;  5KED A;  4AYC A;  1NRS H;  3U1J B;  4HH2 A;  1BE3 D;  4RSP A;  2AMD A;  5AW6 B; 
#chains in the Genus database with same CATH homology
 2QSI A;  4GDO A;  5ESB A;  1W0K D;  3R4Y A;  1S5L X;  3F0O A;  4FET A;  3SZE A;  2FBW C;  3LW5 J;  2HLD D;  4Q63 A;  4ASU D;  3KN2 A;  3VG8 A;  2KM0 A;  2FOM B;  3KF2 A;  3SFE C;  1KIL E;  3SV9 A;  2M2A A;  2ZT9 C;  3OAA D;  2A4R A;  4XFJ A;  1OW8 A;  1DY8 A;  2E75 D;  3PV5 A;  3LON A;  3AE9 C;  4Z1M H;  1VF5 D;  4B74 A;  1DD3 A;  2YMS C;  3U1I B;  2E75 B;  2K1Q A;  4Y28 J;  2F43 B;  2KCY A;  1HJ0 A;  2MKV A;  4ZCN A;  3SU1 A;  2A4G A;  4TT3 H;  2YOL A;  3OFN D;  3F2H A;  2OBO A;  2H89 C;  4PV1 D;  1DXW A;  3F2F A;  1ZP0 C;  2G3A A;  3O8B A;  5CDF E;  1E79 D;  2YIU C;  3ABV C;  1AJY A;  4B75 A;  2D2C C;  4A92 A;  1FDI A;  3PV2 A;  3FOA A;  1FDO A;  5EQR A;  1EXI A;  2JIZ D;  1S6L A;  2KFW A;  5GPI B;  4YXD C;  2K9Y A;  3RL0 g;  3PRD A;  1DD4 A;  3IN6 A;  2W6J D;  2F9V A;  4YTP C;  1ZME C;  2QV1 A;  1NYH A;  3DSO A;  5T1V A;  2AHM E;  4KT0 J;  4H0L B;  4TSF D;  2ZT9 B;  5H4I B;  2D2C B;  5L8R J;  3OYP A;  3H09 A;  3AEB C;  2OC1 A;  2XND D;  2JO1 A;  1SKY E;  5FPY A;  2O8M A;  2KCO A;  4H13 D;  3WW7 A;  3SU0 A;  1YQ3 C;  4H13 C;  5EPY A;  1DXP A;  4PV1 B;  1KMH B;  2XOK D;  2FXP A;  4WF8 A;  3IAO A;  3M5M A;  2WSE J;  2QF4 A;  2OIN A;  1OW7 A;  2F9U A;  2P59 A;  1VF5 C;  3D6Z A;  4JMY A;  5IDK A;  1MAB B;  4R4M A;  3SV6 A;  3F0P A;  2FYN C;  4PV1 C;  3E90 B;  3FN8 A;  2WHX A;  1PV3 A;  1BMF D;  2JJ1 D;  1PL5 A;  2D2C D;  4B6F A;  3L6P A;  1RQV A;  1VF5 B;  3EWK A;  1NBM D;  3OE7 D;  1RTL A;  1ZRT E;  4H0L C;  3O8C A;  4I32 A;  2KR7 A;  3AE7 C;  2KCA A;  2BEQ D;  2WPD D;  1E1R D;  1KQG B;  3N7E A;  3B71 A;  1KMI Z;  4H44 B;  1EXJ A;  4B6E A;  2OQQ A;  4I7Z B;  2E76 D;  4DT4 A;  4A1T A;  3NRL A;  2JP3 A;  1UIX A;  4H44 D;  3GLM A;  4I7Z C;  2WZQ A;  3AED C;  1H8H D;  3ZIA D;  2BEZ F;  3P8O A;  2W6I D;  3Q5R A;  1BT7 A;  1KTM A;  2KCP A;  4OGQ C;  1U57 A;  3GF7 A;  2QIW A;  2WSF J;  1OHH D;  2E74 D;  3O8R A;  3SU2 A;  5F53 A;  3SU5 A;  4I31 A;  3RK3 E;  5DN6 D;  3EYD A;  2WSC J;  4A1X A;  3FKS D;  2QJK C;  3M5O A;  4RI0 A;  4U01 A;  2XCN A;  5C17 A;  4Q4L A;  3SU6 A;  1YQ4 C;  4NWK A;  3UB0 A;  3Q1M A;  4B71 A;  2GGV B;  3GF3 A;  2KZ4 A;  2QJP C;  3H25 A;  1PIX A;  2QE7 D;  2G8Y A;  3FGA D;  3WWB A;  1NBM E;  2JDI D;  4WH6 A;  3C8V A;  1MKM A;  1JB0 J;  1S1C X;  3RC4 A;  5EPN A;  3FO8 D;  3G9R A;  2IJD 1;  4Z1M D;  1TU3 F;  4WH8 A;  2IDB A;  4OM9 A;  1W0J D;  1Q90 D;  4TYD A;  2WV9 A;  3SUE A;  2H88 C;  1N1L A;  4OGQ B;  1OW6 A;  4KTC A;  3AEC C;  4R4L A;  3KNX A;  4R8T B;  5B6L A;  3AE6 C;  3SUF A;  2OC7 A;  3AEF C;  4U7J A;  4I33 A;  1CU1 A;  2JJ2 D;  1HF9 A;  3GS9 A;  1DIP A;  1DY9 A;  5EQQ A;  5DSF A;  4NWL A;  5FL7 D;  3SU4 A;  3SU3 A;  3AEG C;  1W3C A;  4M9F A;  2J5U A;  1A1R A;  3O8D A;  2YMK A;  2QJY C;  2VBC A;  1RGQ A;  5C0U A;  2NZ2 A;  4B76 A;  5HKK D;  2OK5 A;  3AE2 C;  3LOX A;  3AE3 C;  3T97 B;  2CK3 D;  2FM2 A;  3N7D A;  4H13 B;  2OC8 A;  2WQY C;  4B73 A;  2YMS D;  3Q2Y A;  3DCL A;  3LKW A;  3AE8 C;  3WWF A;  4A1V A;  3SV8 A;  1JXP A;  3OEE D;  4TT3 D;  1R8E A;  1NGM B;  1H8E D;  2GVF A;  2WSS D;  5FPS A;  1NS3 A;  1ZOY C;  2V7Q D;  1K04 A;  5ETX A;  2V7Q J;  2P10 A;  2K8I A;  3AEE C;  1OMI A;  5KKZ C;  3SV7 A;  1Y9B A;  3F2G A;  1KQF B;  3AE5 C;  5EQS A;  1FX0 B;  3RC6 A;  3DSP A;  3AEA C;  3OEH D;  2XNI A;  2K0Q A;  4K8B A;  3S9O A;  2QF5 A;  3SYJ A;  2WPV B;  3AE1 C;  4RKU J;  1COW D;  4F55 A;  4YXW D;  4XD7 D;  3O6Q A;  3M5N A;  2F4L A;  4H44 C;  2OC0 A;  5C0T A;  3AK5 A;  3D70 A;  3Q3D A;  1K05 A;  4OGQ D;  1RQU A;  2E74 B;  5M1B A;  2E76 C;  2XCF A;  1E1Q D;  4IL6 X;  3N99 A;  3P8N A;  3RC5 A;  3Q5P A;  2FP7 B;  2YMS B;  3D6Y A;  3SUD A;  3OTP A;  5FPT A;  3PRB A;  5IK2 D;  1VL2 A;  2E75 C;  1KOR A;  1EFR D;  2E76 B;  5GND A;  2A4Q A;  2LEL A;  1WXR A;  2ZT9 D;  3AE4 C;  3KEE A;  4H0L D;  3SUG A;  3SFD C;  1GMJ A;  3F3B A;  5KLI C;  5CHB A;  2E74 C;  3GMA A;  5GJ4 B;  3D71 A;  3Q5S A;  2IJO B;  1IK7 A;  2OBQ A;  3W1E A;  2L6O A;  3M5L A;  3U1J B;  1WMK A;  2O01 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...