2J5UA

Mrec lysteria monocytogenes
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
210
structure length
210
Chain Sequence
TENQHLKERLEELAQLESEVADLKKENKDLKESLDITDSIRDYDPLNASVISRNPTNWNDQVEIDKGSSDGVKPDMAVTTPSGLIGKVTTTGAKSATVELLTSSDVKNRVSAKVQGKENAFGIINGYDSDTKLLELKQLPYDMKFKKGQKVVTSGLGGKFPAGIFIGTIEKVETDKMGLSQTAFIKPGADMYDLNHVTVLKRSAEAGTTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell shape regulation
molecule keywords MREC PROTEIN
publication title Dimeric Structure of the Cell Shape Protein Mrec and its Functional Implications.
pubmed doi rcsb
source organism Listeria monocytogenes
total genus 47
structure length 210
sequence length 210
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04085 MreC rod shape-determining protein MreC
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.490 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 2j5uA01
2.40.10.340 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2j5uA02
2.40.10.350 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2j5uA03
2QF5A 1DIPA 1R8EA 2QF4A 3D71A 2OQQA 3IAOA 3Q5SA 3Q3DA 3Q2YA 4R4LA 3D6YA 3Q5RA 3Q1MA 3Q5PA 2J5UA 1EXJA 3T97B 3D6ZA 3G9RA 1EXIA 4R4MA 3D70A
chains in the Genus database with same CATH superfamily
3SNDA 2W5EA 3GY5A 2WZQA 3KQ5A 2ZZUH 5EPYA 1GMCG 3RL0g 2SFAA 1L4DA 3I5CA 4RN6A 2BXTH 3RMNH 5EW1H 2H9HA 3VP8A 1UVSH 4WMEA 2KCYA 3NZIA 2K8IA 4OS6A 5APXA 3O6QA 2ZI2H 4Y71A 3VB3A 1AZ8A 1FAKH 1YTZT 2GMTC 2ODPA 1Z8JB 2J5UA 1CZQA 4JPZB 1SI5H 4GKGA 3V2NA 3D6ZA 5AVUB 3ODFA 2N1TB 3MD0A 2ZVOB 5KLIB 1N73A 2LP6A 4SGAE 2C0XA 1HJBA 2ZJSE 1O2UA 4KJMA 1EDIA 2QA4P 3RBZA 1JUNA 3H1KD 1Q7YQ 1JM0A 1NO9H 5AW2B 1TOCB 2B8OH 1BTZA 4LOYH 4YTAA 4IC5A 1LTGC 3B5NB 3H1HG 1TPOA 3L6PA 4JK5A 1NWQA 2ANKH 3SU3A 1O2YA 5H2FH 2DE8A 1BRUP 4NCYA 1GI7B 4BTTB 3L74E 1OP8A 1URQD 2FEQH 1KILA 1O33A 3TJUA 4XDEA 1IQHA 2D8WA 3P8CE 4XFQA 1N7SD 2WPRA 1GL2C 1BE3J 1OW6A 4YT7H 1HGVA 1NTMJ 2PP6A 4IC6A 5FPYA 1M1JB 1N86A 3P95A 1SHHB 3FWLA 3WUUA 1KXAA 2H5CA 3M7TA 2FLBH 4UDWH 2A06E 1KTSB 3A5TA 1MABB 1RY3A 1GHAG 1GJ5H 5E79H 1F0SA 2EI7A 2JDID 1NTPA 5E0HA 2G5VA 2AXCA 1YI2P 2GP9B 1OIPA 3TIUA 4CRAA 4PJ0H 4X2XA 1NKNA 4EI2A 1AGJA 2FYUG 1GD2E 3CCRP 1PPFE 1GL0E 1W14U 2VB0A 2VWLA 1P84H 5LPEA 2WMMA 3A83A 5TJXA 1E79H 4ISOA 5FBIA 3M5NA 1ID5H 1O0DH 5GIBA 5GCHF 1MCTA 2NU3E 4OS2A 2IZ0A 1P0SH 2BY9X 1A5GH 1IQLA 1BDCA 4NPFX 1UIXA 2QF4A 3H1JD 2FOCA 5SGAE 3SJ8A 3ENSB 2IZ1A 1HDTH 1P09A 3E0NB 3L70D 1EUFA 2F4LA 2P59A 4INLA 4D6TE 3V6IA 3KYGA 4D8NA 1EAIA 1VJ9U 1L4AD 1ZHPA 2EA3A 1YBKA 3S9CA 1XX9A 1S0QA 2P3TB 2ZQ2A 3R0FA 1BUIA 3IG6B 3SO3A 1WDIA 3RXCA 1VCWA 1IK7A 3KYFA 1D3TB 4U3FG 3GISB 2BTCE 4THNH 1G32B 1F2SE 2D1JA 4KTSA 1FDPA 1JO5A 3Q3YA 1F0UA 4YOIA 3CXHH 2V7QD 3EWKA 1C5WB 2L6OA 4PV1D 2FOFA 2YNAA 1FOSF 3MH4A 3T27A 1A02J 1V2WT 5A8XA 4AGJA 1PQ5A 1YQ3C 1OZHA 2RKLA 1A61H 1TONA 2W7UA 3H09A 4VGCB 3VTPC 4DCKA 2ZG0H 1MAXA 3S69A 1LTJB 1C2FA 1W0ZU 2FS8A 2XC5A 1NTZE 1C2DA 4LGDE 5AVWB 1N7SB 1BTUA 1LQEA 1MZDA 1HCGA 1Y8TA 5T1VA 5C5NA 3OTJE 2IPPA 1GBDA 2HALA 2GDEH 2A5AA 2OC1A 2O8UA 2R32A 5TCAA 1QA0A 4B1TA 2JKHA 3M61U 2F91A 3RU4E 3OY5U 1L0LE 2Z9JA 4ZROA 2BB4A 1SOZA 3KHUA 1BMLA 4HYTB 5L2ZH 2YNYA 2CPBA 3P8MC 2KX4A 2B9BA 2VBCA 3RXBA 1YITP 5J4QA 1OW7A 2CF8H 4JYCA 5AW4B 1VF5C 1C1OA 3OFND 3VMZA 1O3FA 1DT2A 4UFFH 1JY2P 1NTKJ 2R3YA 5BU8B 2CPSA 1OXZA 1EAUA 1Z7KA 4AN7A 3CPWO 3CX5E 2MKVA 3TNUA 1RS0A 1ANEA 1C5ZB 5A0BA 1WTGH 4UFGH 1O5EH 4HG6A 1XXFA 4NSYA 1SQXJ 5HIZA 2SPZA 2ZNKH 3EQ2A 3QWCH 1ZYOA 4K60A 1SVFA 1CGIE 2O01N 1ZHRA 1SQPK 4KELA 1L0NE 1SFCA 5T6DA 1PQ8A 3M9QA 3CWBJ 3F5HA 5KJ7A 1J9CH 7GCHF 1O3KA 3H1JG 1CA0C 2SGAA 2OYHB 1AFQC 5AW5B 1W5CE 1L1GA 3C9IA 1OP0A 1YLNA 1NN6A 2FX6A 5K5GB 3GCNA 2KB7P 1KV4A 1EZUC 1V2VT 3BTDE 2YIUC 1SGQE 1BHXB 1YPKH 1ORFA 4CRFA 3FZDA 2OQUA 2GMTB 3LW5J 2QIWA 1G2MA 4TY7A 4OS1A 1GJ9B 3TYYA 3E1XB 3M3TA 4JYBA 1FPCH 1HV7A 5CCGD 1ZSKA 2A5IA 2GCHG 3ITKA 2NZ2A 2QA9E 4JCNA 4H13D 1RF1C 1M1KQ 1Y59T 1KDQB 2SGFE 1V2TT 2YKOA 1ZR4A 4JYTA 3F9FA 2RN0A 4IW4E 2QE7H 2M5AB 1G1IA 4BRYB 3VB5A 3O8RA 4X2WA 3D71A 1AE8H 2BMGB 1HAIH 1BGYE 1QTFA 3FN8A 4AUWA 1GK4A 2QYIA 2Z3DA 4P02A 3UIRA 2I6QA 1UVTH 5CMXH 2XU6A 4AYVB 2Q1KA 4X1PU 2A5KA 1IZNB 2FBWC 5C0UA 1Z6EA 2AERH 2WTYA 1UHBB 1UO6A 3ATKA 1NZQH 2RDEA 1FUJA 4X1QU 2V3OH 3FP7E 1ELCA 2WYJA 4A1XA 1GL2B 5B6LA 2J4IA 1H8IH 2W6BA 3AEFC 5CCHA 3L73E 4XE5B 2AS9A 3E8LA 1DEEG 3MHWU 1IQFA 1ZHMA 1FLEE 4W7ZA 6LPRA 3V7TA 5FX5A 4YOJA 1XUGA 4MG3A 2NWNA 2W27A 1V2KT 2FI3E 1GBMA 4D76A 2FXOA 3DCLA 1HF9A 1ELAA 1L0NJ 4ZKNU 1Q2NA 1QRZA 2FFDC 4LC1A 1CA8B 2XBXA 2ZFTA 3UQOA 1GHXH 1T8LA 1OWKA 1H9LB 1LHEH 1MUEB 4LXBH 3W95A 1V2OT 3C8VA 1GVLA 3KDPB 3RUOA 1AKSA 3UY9A 1T8NA 3H1IE 1S9KD 5HIYA 1UJ1A 4X1RU 3QGNB 1O36A 1N8OC 4GDOA 2ZU5A 1Z71A 4JQ0D 1B7XB 1P9SA 3M3SA 4A6LA 3BTKE 2WPQA 3R2PA 2XZRA 3UWIA 1O37A 4LZ4B 3SQHE 2IX7C 2LKMA 3P8FA 4FUEA 1FONA 4IL6X 1K8AQ 2HNTC 4GIFA 1ELDE 2XC0A 1O2ZA 1EDLA 3PMBB 3W67A 3EYDA 3CL3D 1PGJA 1P84D 1MMJN 2BDCA 4FUBA 4R8TB 1X0TA 1T7CA 2STAE 3ZZ8A 5AW6B 1VQ4P 1CU1A 2FI5E 2LXBA 4I7ZB 3FVFB 1FBMA 3D23A 2VVUA 1D3PB 2GD4B 4FUFA 5DP9A 4INHA 4O03A 1FY4A 2M2AA 4JZ1A 1Q2WA 2KCAA 1A46H 3NXPA 1CO7E 2L91A 2RA3A 4MNYA 4O3TA 1QL7A 5LPRA 1S72P 1YGCH 2GUVA 1QHRB 2ZA5A 5HM9A 3I78A 4DIHH 3HTKA 1GTWA 2GT7A 3I56P 4HKZH 1OW8A 1C5UA 1SC8U 4DOQA 5BVZA 1TE0A 5DJ7A 1ZPCA 1VQNP 3P8OA 1ZJDA 4J2YB 2ZO3H 1YPJH 1H89A 3A87A 5DJTB 2WT7B 1TGNA 3PB1E 1EP6A 1PP9E 4H44D 1AUTC 1O2SA 1LVYA 2BDHA 3E90B 1RIWB 1SQPG 3P92A 1A5HA 1C2IA 1H1BA 3F9EA 3H1HJ 1GMHG 4ABGA 1QA7A 3U28C 1TYNA 1AHTH 2G5NA 3CX5H 2F83A 2BD4A 4C7NB 3F2FA 2OC8A 1CSBA 2A45B 3V4QA 2HVXA 3I77A 2VIQA 3H1IJ 1VF5B 2R3SA 3HGNA 4I8JA 2ZHQH 4Y6DA 3MUDA 1HJ8A 1LPKB 2O01J 3K5BA 2HOBA 2AGEX 1X8YA 2C4FH 1Y3UA 1GGDC 8GCHF 4Y7BA 2HR3A 2ZPRA 2ZPQA 3MU4A 6ESTA 2YMSD 4ABJA 1YPHC 2FOEA 3FFGA 1O2KA 3BTQE 4XBBA 3TH2H 2P10A 5TISE 1URQA 1SS1A 1PYTC 1CBWC 1R5LA 2KZ4A 3AASA 3PRJA 3P70B 1D3QB 3A82A 2JJLA 1CA0B 2PSXA 4Q4LA 1AFQB 1VCQA 2WUBA 3PMAB 2R44A 2K9JB 2PGQB 3DSGA 1IQKA 5GTHE 3LC5A 1QL9A 3PTNA 2YIUB 2AMDA 4AFSA 5FX6A 6CHAC 4XFJA 3VMYA 5DN6D 1G2CB 1G9IE 1OVRA 3LIDA 3CD6P 5F8XA 2AEJA 2KNCA 1EPTC 4DURA 3HD7D 4L76A 4AYCA 1TMUH 3UNQA 4DT4A 4X6OA 1JY2N 1JBUH 1LHDH 4UB6E 4PD4I 3L71D 4X6PA 2CJIA 3SWYA 5F6MA 1H4WA 1NRNH 2ZHDA 3CENA 2C93B 1RF1B 4I7YH 4GOFA 3TGUE 1P9UA 3QGJA 3IF4A 1BDDA 2WUCA 1P04A 3CS7A 1PP9J 3M5LA 1KILD 1BCCG 2C8ZB 1AU8A 1V2RT 2QJPC 1EP5A 3WU2E 1HAYB 4UB8E 1H0TA 2ZKSA 3ZZ6A 1KQLA 4H0LD 2YMYA 4U3FJ 4H6SB 1NOHA 3CC7P 2Y7ZA 1SQQE 2VIWA 4GUXA 5BU5A 1ELEE 1FE6A 3BIUH 3M3VA 1RRKA 3UOPA 2O9QA 3KZIE 3H7OA 3S0NA 1ZW0A 3G71P 3LONA 4N78E 3MI4A 1G3BA 2IPHA 5GDSH 1OOKB 3LJOA 4AQRD 1TNGA 3L74D 3M5OA 1O35A 3F2HA 1ZPBA 3BTGE 3DFJA 1FZAA 2P3UB 4X2YA 5AHGH 3P8CD 3VN0A 2BDYA 1AV1A 3KNXA 3P8GA 1SB1H 1IHTH 2PKAA 1RTLA 3GS9A 1BTXA 3LH1A 1C1TA 2XNDD 2ZDLA 3GF7A 2ZECA 3SNAA 1FZCA 4ASHA 2C9LY 3U1CA 1KYOI 3L72G 1PGOA 1C5YB 1VDFA 1S84A 1GK6A 1W2EA 1EFRD 5A2MH 4Y0ZE 2ZQ1A 3O6QB 1N6YA 5GCHG 3SWFA 2E75C 2JIZD 1PPBH 4X0WU 2O01H 3OA7A 2BDIA 1EZSC 4MDSA 2QG4A 4E7NA 1PGPA 1GG6C 3QK1A 3LPRA 1DANH 1KXFA 2BY6X 2C8YB 1N8OB 4AG1A 1SQOA 2ZYDA 1RJXB 5C2ZA 2ANWA 1MAYA 1N73B 4RT1A 1MTUA 3BRTB 1ZXGA 1PYTD 2PR3A 1NTZK 8LPRA 2QM7A 4RJTA 2XCFA 5KLVE 2A31A 3OE7D 4JMYA 3UUZA 3BV9B 2Y0EA 2VVCA 2PSYA 1KXBA 3GCHC 3LGYA 2WQYC 3IAOA 3RBXA 5B66E 4IN2A 4D6TD 1AVWA 1Y3XA 5FHTA 3O8ZA 1O3HA 3GW6A 2J98A 2WPMS 2GVFA 4YM9A 4ACAA 2WSEJ 1P06A 1JY3P 4MPUA 2QAAA 1YQ4C 3L71G 4YXWH 1XTCC 1LP1A 1PPHE 1QY6A 1KILB 2FO9A 2VIVA 3A85A 4O97A 1HVVA 1O2OA 1ZZZA 6GCHF 1AY6H 1K05A 4RKUJ 2K9YA 1KTTB 1JRTA 5AW7B 1NRQH 1Z1IA 4CRCA 2KXPB 3V3MA 1WMKA 1SGNE 2DE9A 2FOMB 1AD8H 2F3CE 1F5LA 1QIXB 3K9XB 2BM2A 2RDLA 1JOUB 2QRXA 2NPSD 1MTSA 3RK3C 1CT2E 1UMAH 5IK2D 3RXSA 1DS2E 1GJBB 2K0QA 4K2YA 3SV7A 1A7SA 5KLIC 5EIYA 1OKXA 3SUEA 3BCCE 1GI6A 1O2WA 2TGAA 1NTZD 3JZ2B 4UD9H 1VR1H 5AVQB 3SU0A 3VXFH 1KC8Q 3EQ0H 3GYLB 1MFZA 2J92A 1FIZA 4BAMB 2ALPA 2FOHA 3NKKA 3QZQA 3DSPA 3FANA 1L0LD 1C2KA 4X2VA 3SV6A 1IQEA 3B23B 4UEHH 2JETB 3VPKA 4DCDA 5JB8S 1JB0J 3ESTA 1O2XA 4JF7A 1V2JT 1UVOA 2BXUH 1O30A 4Q80A 1SFCD 2OBOA 5TISH 2IYOA 2A32A 5KJ7D 2BD9A 3MU8A 2Q5UA 1D4PB 1H8ED 1GGDB 1XXDA 2BD2A 4FUJA 5G4BA 4DT7B 2FP7B 2H5DA 3MNBA 1NAFA 5GTHH 1QBVH 3II6A 3JZ1B 7GCHG 3CX5D 3LKWA 1JIRA 2ZGCA 1CBWB 1AMHA 2AIPA 2M8RA 5APSA 4YLUA 2O8LA 4K5ZA 1O2PA 1TX7A 3ZVAA 4UB6H 4Z0KA 3PWCA 4L73A 1CHGA 2PUXB 3FGAD 1U6QA 2G52A 4W80A 2GUSA 5KTBA 1FC2C 4INKA 5E0GA 1ABJH 6CHAB 2BCCG 5PTPA 1DLKB 1WOFA 1HGTH 5JBCS 2F9UA 3RXFA 1EPTB 1TX6A 1ANBA 1DWCH 1GMDF 3EGKH 1UCYK 1SQVE 1V2UT 2F43B 1LPGB 5EODA 1P84I 4UB8H 3MNXA 3LU9B 2QY0B 1QRXA 2WSEH 1YCPH 1O3IA 4NIWA 3KZIH 1Q3XA 1RE3A 3L75G 2QJPB 2FMJA 4IMZA 5CCHD 4NIXA 1PPJE 1J17T 1HJ9A 2KLUA 2ZHWH 3PM3A 1CGHA 3TH3H 2A2QH 2ZU1A 1SGYE 3CP7A 3ZZDA 2RFKC 1GW3A 2R0LA 3KPEA 1S2EA 1J16A 3SUGA 4X6NA 3FP6E 5AVZB 2KM0A 1BGYD 2HYNA 1TIOA 1ZGIA 5H4IB 3MUDC 1MFTA 3ZV8A 3TNUB 1FPHH 1SOTA 1EDKA 1GMJA 1JTHA 2ZU2A 1DM4B 2YO2A 1O38A 2F9BH 2K1AA 1HIAA 2JEEA 1SHYA 2TGDA 1EZVI 1IAUA 3MGNA 3CXHI 1ZSJA 1QZ8A 3L73D 1GHYH 4WWYA 4A5TS 2F9OA 1JMMA 3I29A 3OJAB 2JKVA 1BIOA 5AVXB 2JJ1D 1URQC 3T62A 3BTHE 5DG6A 4WMDA 1EZVE 1BCCE 1M8OB 4NZQA 2BZ6H 1RXPA 2W6JH 1SQPJ 4CR5A 2LXCB 1SQBG 3PLKA 3G3ZA 2QF5A 3T2NA 2E75B 3OU0A 3U69H 1GBFA 1KXCA 3TU7H 3ZYEA 5A0AE 1EZXC 3KYQA 2ZU4A 7ESTE 5AVDA 1USEA 3TF5A 2HPCA 3PLPA 1AI8H 3FWNA 4WVZA 4XE4A 4DIIH 1RE4A 2PAJA 2H43A 3ATIA 3H1LE 4IBLH 1CI6A 1MBMA 5B66H 1BJUA 3GY4A 4MTBA 3RXRA 1SPJA 1SGRE 2AYWA 2VINA 2WINI 4J1YA 2BLWA 3PLBA 1FXYA 1BE3E 3MU0A 4GT1A 1NTME 1Q86Q 4OGYA 1FY8E 2Q6GA 3B71A 2R2MB 2P1JA 4L74A 2R0KA 2SGPE 4U7JA 2G51A 3GCHB 5GWZA 3KHVA 5J4SA 2BEZF 1TRMA 1NRRH 2E5TA 4AX9H 1O3OA 1UIIA 2GT8A 3AE2C 4MPVA 3SZEA 3BTWE 3QX5H 3V0XA 3GCTG 3NK8A 3C1KA 3W68A 1CSOE 1L4AC 1QVGO 2C9NY 3KCGH 2OYHC 2JO1A 4Q7YA 1GW4A 1XTGB 2E76D 4DJGA 5E8EH 4K35A 1C2EA 2EI6A 3V2QA 2IN2A 1KFNA 1G3CA 2FODA 3SNEA 4KT0J 3RL0D 1KLIH 2XOKD 2PFXA 2ULLA 3RK3B 2CXVA 1BCUH 4NA8A 1E34B 1FZCC 1GI5A 5B5EE 4WXVA 2GV7A 2IBZG 2D2CD 4YXWD 1UTPA 1E35B 4I32A 1BCCJ 1NU1E 4PV1C 1O3LA 1HFDA 1PL5A 2ZFSA 3EA8A 1JY3N 2FESH 3HD7A 3PJSK 1U7MA 1GU5A 1BSHA 2N9YB 1AKSB 1SGEE 2GKVE 1GHWH 3A7YA 3O8BA 5EQRA 4ABAA 2G4UA 1O34A 1ETRH 1HYLA 3E1RA 1LNQA 4FUGA 1RHZB 8GCHG 2FOGA 3A80A 3H1LJ 1J1EC 1Z1JA 4AB9A 1F7ZA 1TNLA 3TVJB 3VB4A 1IQGA 5EQSA 2NRGA 3S1KA 2FXPA 5DP6A 1EATA 2A4OA 1C5PA 5ABWA 1HAGE 3C27B 1ZLLA 2ZDAH 1LVMA 3ATWA 2W3KA 2LPRA 1K1MA 3T5FH 1UTLM 1VZQH 3L72J 3H25A 1KY9A 3E6PH 3F2GA 3AEBC 1ELVA 2W83C 1GDNA 2PWXA 3Q3KA 1O2VA 1CW5A 1XKBC 5L8RJ 5APVA 2Y5GA 1DVAH 1LHFH 1C1VH 4K1SA 2HGTH 1LT9A 1S5LX 3MHVA 3HTKB 2TIOA 4FVBA 4K1TA 3HKJB 3QO6A 1GJ4H 3SHAH 1JEKA 3W1EA 3PWBA 3SI3H 1TAWA 3KXDA 2KCOA 2WPHS 1JXPA 1QEXA 2A7HA 3FP8E 4X6MA 1EZQA 1P57B 3NMDA 2BOHB 4K8YA 2YMKA 5AW0B 4N3YB 1NTKE 1G3EA 2OC0A 1C5SA 1P12E 1UK4A 2G00A 1IQIA 5A0CA 3WMM0 1VQ9P 1NU1J 3CC4P 4SGBE 1THSH 2OBQA 4B73A 5KAFE 3RL0B 1SQXE 3TGUD 4PD4D 1EJMA 1YPHE 3SFDC 2QVAA 4RO0A 1GBCA 1LO6A 3LDXH 3QUMP 4K3JA 4X1NU 1TQ0B 5CCGC 1L1JA 4I7ZC 5HGGA 3GY3A 1LTAC 4ESTE 5IYTA 4H13C 3CWBE 3DD2H 1DDJA 2AH4X 3AE8C 1TMTH 1S5SA 4F55A 4ZCNA 2UWOA 1KXDA 4RKOB 1AB9C 3U98H 3KQEA 1SQQD 4AOQA 1SQAA 1ZSLA 4AORA 4O9BA 2V3MA 3M9HA 4K8BA 4Y8XA 1YF4A 3H1KG 4N78D 4ISLA 4OS5A 3ZZCA 2E43A 1CHOF 4WH6A 1VITH 1YP9A 4CH2B 5CBNA 1QB1A 1AVGH 1W0KD 2D2DA 1URQB 4Y8ZA 4CREA 2B87A 3H32A 4OM9A 1W3CA 1LTSC 1J15A 4ZUHA 1P3CA 3TSIA 2ANYA 1BBRK 1OVUA 1ZMJA 3TITA 1THRH 1GI3A 3DA9B 2Z3CA 1RIWC 5EXLA 2W90A 2ZCKP 4CBOA 1WAYB 3WW7A 1PV3A 1H8HD 2KNCB 1DSUA 2K3RA 3I55P 2QSIA 3P6ZB 1GJ6A 2NPSA 4TLFA 2OINA 3BEFB 1KYOD 5K0HA 2O1KA 3RMMH 2JWDA 2KS1A 3CCMP 1HTLC 5EXMA 1BMFD 3DFLA 1H88A 4GHTA 3CX5I 1O2IA 3V13A 2H7HA 1ZN5A 2GX4A 2W6JD 4NA9H 3SW2B 1IFJA 1NKZB 4YESB 2BASA 1TGSZ 1QX8A 3TK1A 5AFYH 5EU8A 1GBIA 2KSJA 3WWFA 3SFEC 1ZMLA 1H0TB 1N8RQ 5KLVD 3MFJA 6GCHG 1KFMA 4TWWA 1CT4E 1ZTKA 1F0TA 5F8TA 4FU8A 1MU8B 3BATA 1QJ6B 3S9BA 2WITA 4HI3A 4GHQA 1R5SA 1MKWH 5BRRE 1NHLA 1V2ST 1OWIA 5EJZA 1JIMA 1M9UA 1KQGB 1L4AB 4GODA 4WWIA 4GCHF 5B5EH 5DP3A 2XNIA 1C4Y2 1SL3A 3LGWA 2AFQB 5FL7D 4ZXXH 2P7JA 3BTTE 1OS8A 3L70G 1W8BH 2NU1E 1FJKA 3EDXB 2ZXEB 1P02A 3GG2A 2A4GA 2J2UA 2ZTZA 4FVDA 5L6NH 2ALVA 1FV9A 1NRSH 4AZ2B 2QGRA 4CR9A 2O8TA 4MNWA 3UFAA 4DW2U 1RFNA 1FZCB 1ZR2A 5AVVB 3A84A 1EXJA 1EDJA 4AB8A 1P11E 2YKQA 2RA0A 2ZWLH 1C1RA 2PHBA 1V2NT 3L3TA 1EXIA 1C5QA 3GHGA 3AEGC 2ZP0H 3L75J 4PV1B 2CK3H 1GDUA 1FMGA 1C4U2 4ABIA 1DFPA 4QT8C 1OWHA 3EA7A 2R3CA 3MO9A 3BCCD 4NGAH 1GHBF 5DP8A 2OTJP 1WT6A 1GBTA 4TT3H 3MH6A 1IJDB 2IFNA 1RE4C 1OMIA 2G8TA 2GDDA 4YXDC 1T8ZA 1S5LE 4H44C 5GTIE 2YOLA 1J1EB 2WHXA 3QTOH 3ZZ9A 2FDAA 3BF6H 4B75A 3V5BA 3RXDA 3N4XA 1FN6A 3ZDMA 3N7NA 1ZMEC 3HUSC 1KB9I 2STBE 4K1EA 1GBKA 4ABBA 2J98B 5DP4A 1K1IA 4TYDA 1MTVA 1TMBH 1DWEH 1KB9E 4BOHA 1BRCE 2AMQA 1SQBJ 2GA1A 1EB1H 3MU5A 3M7QA 3F0OA 1YJNP 4ZXYH 3ZZAA 1A3EH 1O3EA 1FY1A 1C9PA 1GMDG 1DE7H 3H1HE 3CCEP 1ZGVA 4AGKA 3CCVP 2YMSC 1EJNA 3V2RA 3LIEA 1ZRBA 3A8BA 3D62A 4LZ1H 1O31A 1LHCH 1TGCA 1EAWA 1P10A 5KAFH 3MH7A 1FDMA 2TRMA 1B0EA 4OGQC 4Y99B 1TNHA 1N73C 3SU4A 4I8LA 3HE4B 2H2ZA 3GDSA 4UONA 2UWJE 1K1PA 1S6HA 1SQVD 9ESTA 3E16B 2ZC9H 2E42A 2ESTE 1K22H 1FDOA 3SU1A 1OHHD 1MZAA 1D6RA 3RXIA 4AFQA 2FOBA 5EG4A 3HD7C 4BXLA 2FM2A 5C1UA 2BY8X 2VIPA 5HXFA 1OX3A 3RK2D 1XUFA 3HATH 2E74D 3VB6A 5L30H 2W26A 1OPHB 3LW5H 1E79D 3AE3C 1ZR0A 2QF0A 1YBWA 4H13B 5DKMA 5E2OA 5F03A 3F6UH 1S6LA 3RLWH 1PPJD 2AMPA 2KZIA 2WWWA 1V6DA 1EASA 2OUAA 1JCDA 2FYUE 5FPSA 3EE7A 1HAVA 4D7GA 1AB9B 3BEUA 1FN8A 1KILC 1LDTT 3RXGA 2WSSH 4CPGA 1FZGA 2QM8A 1GI9B 3Q00A 1EKBB 1GJCB 1ESTA 1GWAA 4XD7D 3ZZBA 1H9IE 2BX4A 1U57A 3MTUE 4H0LC 3A8AA 3L35A 3MOCA 3RXUA 3KQDA 3RXVA 1OP2A 3UIAA 3TJVA 3TJNA 3RXOA 1NS3A 2JR8A 5C0TA 3RU4T 2ZDKA 3RDZA 3VGCC 1Y9BA 3OAKA 1HUCA 3ZZ7A 1UTMA 3UAIC 3RXTA 1EQ9A 1E1QD 2QV1A 4ZKPA 2Q7CA 3ABVC 2F9NA 1EZVD 2XBVA 3CXHD 2ZFPH 2AEMA 1GBJA 2OYIA 3QTVH 4U3FE 1GCTC 5M1BA 2BVXH 3N99A 5EW2H 1RQUA 4IS5A 4Y79A 1ARBA 4NIVA 2LR2A 3JCUE 2BOKA 1NY22 2OK5A 1SGIB 3JSVC 1C5NH 3URDA 4X8SH 1SVPA 1YCPM 2TBSA 2OTKE 2JETC 2WPIS 3UR9A 1MKXH 1UVPA 2TPIZ 3TNSA 1WUNH 2A45G 1TA2A 2A7CA 2HODB 4B2AA 1O3MA 4UFEH 1DY9A 1BE3D 1NTMD 3HE5A 1NT1A 2C8XB 2SGEE 2UUJB 2WVRA 3NTNA 2QJYC 1O2RA 1XUKA 3O8DA 2KIKA 4X1SU 1WSSH 1DX5M 1S81A 4U30A 3HK3B 5JBBS 3M0DA 2CN0H 3KL6A 5F8ZA 2FYUJ 4OGQD 3CCSP 3DUXH 2HPQH 5C1YA 1FZFA 4WBAA 1HIAB 5FAHA 2VH0A 5JDUB 2Q9IA 3NXSA 2ZGJA 1PIXA 1QCPA 4JK6A 3SV2H 4A92A 3K65B 3STIA 1SLQA 2ZT9D 3BTEE 2BY7X 1W2KH 2ZFRH 3CMAP 2XWAA 1ANCA 2WSFJ 2B88A 3S4RA 4EYYQ 1O2GH 3SORA 3SUFA 1P2IA 1N6XA 4Z6AH 5GXPA 2ANMH 1B0FA 1S5LH 5GTIH 1SBWA 1W11U 3VB7A 1GHAF 2KOGA 1O5FH 2ZPSA 3MU1A 1FX0B 1GPZA 3BIVH 2HPCB 2ZCHP 2Z5HA 2NPSC 5C17A 1MQ6A 1NJIQ 2ZYAA 2BEQD 5FBEA 3H1JE 5HYOA 3M35A 3ZZ4A 1CI6B 2W6AA 3GLMA 4H44B 1ESAA 2AIQA 1SGPE 3AEEC 1DY8A 2Q6FA 2Q1JA 4NFFA 2BD3A 1NC6A 2XYAA 1RF0A 1KB9H 1HBWA 2PW8H 1LVBA 2WPLS 2CK3D 2I6SA 3H1KJ 2FTLE 1IOEA 3ZZ5A 2QE7D 3VYIA 3HUSB 1DWBH 2Q6QA 1GBAA 3A7XA 1OWAA 1FAXA 2WV5A 1PFIA 2XRCA 4WY4A 3NCLA 3OEHD 5C20A 1KIGH 1KORA 4IL6E 1YHQP 4HB1A 1SFCC 4IN1A 2A06D 1TNJA 5KJ7C 1WV7H 2P93A 4B2CA 4FU7A 5AW9B 2OCVB 4DOJA 1Y3YA 2YMSB 3PLNA 4MVNA 3Q3XA 1JMOH 1W0JD 2ZDVH 4K3AA 3GDVA 2IFMA 2Q3EA 3PHLA 1LTIC 1HXEH 5AVYB 3PO1C 5HKKD 2DW3A 3A7TA 3PROA 5I25A 1W10U 3SSUA 3NPSA 4OGQB 2AGIX 5DPAA 4YT6H 2FKWB 3SU5A 1T32A 1S82A 1K2I1 2ZCLP 3C1LA 1FU1A 3OAAD 1VGCB 3U59A 1DIPA 3RXKA 1TOMH 3FO8D 3HD7B 1KDQA 2HVYB 1NTKD 1PZQA 1BQYA 2HFED 2XDJA 3A0HH 1O3AA 5KECA 3MYWA 4C7RA 1HLTH 1L0LK 1NBME 1V2QT 3IWMA 1VKYA 1VL2A 2J59M 2ZHEH 1BMNH 2TGPZ 1SQXD 2DUCA 4WXIA 1TWXB 3H1JJ 3CCJP 1C5XB 2K37A 5DJUB 4JYUH 4NSVA 1AN1E 3L70J 2QXGA 1CHOG 3CWBD 5CCHC 3S7KB 2VGCC 1SQTA 1GI0A 4H0LB 2VIOA 1GI1A 4Y7AA 4WF8A 1AJYA 4IFFA 1Z8RA 4B86A 1HAPH 2BLQA 1Z8IB 3A81A 1USDA 3WUTA 1QNJA 4DVAU 1GBBA 3VXEH 1IFIA 2Y82A 3VGCB 1NYHA 1UK3A 2J34A 1MV8A 1YM0A 2A0QB 3JCUH 1ARCA 3CCUP 3SJIA 4BTIB 1L0NK 1T6AA 4Y10E 2V4HA 4XBCA 2OGUA 4JZFH 2OXSA 2YNBA 3UNRA 2V7QJ 5AW3B 3Q5RA 2BLVA 3MQKC 3BASA 3NRLA 1DUAA 2WPVB 2N9BA 3SGBE 1GCTB 2CHAC 2GZ8A 3L74G 1OWDA 1XMNB 3GF3A 5C1XA 2I1KA 3RU4D 3LGVA 1NAYA 3M37A 4IMQA 1B5GH 1C5OH 1PPZA 2P8OB 2CGAA 5GNDA 5T6GA 3IITA 4Z1MH 3VOPA 1DICA 1P2KA 4OGXA 3VG8A 5LH8A 2A06G 2XV5A 2OTLP 1H8DH 3Q76A 2Z3EA 4D9RA 2SGDE 4I2LC 5IDKA 3EFFK 1BHXF 2FX4A 3NWUA 1SGDE 3OYPA 3AE6C 1TALA 3RMOH 2QJYB 1H9HE 4GCHG 1KZUB 2ZAEB 2KUBA 1ZP0C 2Z4EA 3AAUA 4I8GA 1SQPE 1K1OA 1ZMNA 1VQ8P 1FZEA 2PV9B 4IOIH 4YLQH 1O3NA 2GM4A 1GBEA 1WTHD 2R3UA 2H88C 3SGQE 2RH0A 1L0ND 1AIXH 5A8ZA 3A86A 4RT0A 1SLVB 3B4SA 1DD4A 3BVHA 1YPMH 4WJG2 1U7JA 2KI7B 1CE5A 3TK9A 5EJ1A 3LIWA 2B87B 3E3TA 2FPZA 2WPDD 3H32B 3NFQA 5L2YH 4D6TG 1YWUA 1NGMB 1EJAA 3BSQA 2P58A 1O3CA 1GZLA 1T8OA 3SJKA 3F89A 2QXHA 3CNRA 4BANB 4A1TA 2E76C 1FJPA 1GHBG 2K88A 2GGVB 4Q2KA 1O2JA 1O2HA 1X22A 1IK9A 4PROA 2XWBI 4ZKOU 3RL0C 4HZHA 2NPSB 1AVXA 3M0AA 3GCOA 1EQ7A 3ZV9A 3A7VA 4MLFB 2JP3A 3AEDC 2ZFQH 4TSFD 4OVNF 2J94A 3HK6B 1KQSO 2D2CC 3TNTA 2JJ2D 3CLQA 4I31A 2ODYB 1OYTH 4WMFA 1JRSA 2KAIA 1NFXA 4IL6H 1A0HB 1X7AC 3H5CB 4YOGA 1Y8AA 1C1NA 1O2MA 4XA4A 1TFXA 3AAVA 2V7QH 5KKZC 1NTZG 2VWNA 1PPEE 4TWYA 4ISHH 1EOLA 2M3EA 4GAWA 3AEAC 1AO5A 4Q7XA 4KHXA 1BMAA 1MTNB 1SFCB 3STJA 5EQQA 4AYYB 2GJGA 1L0LG 3PRBA 3MNCA 3M0DC 1XKAC 2H1UA 3UTUH 5CE1A 4QMAA 2EQNA 1K04A 1GL1A 1THPB 1KB9D 2ZTXA 3SYJA 5CHAC 3ATLA 1AQTA 2V35A 5ESBA 1UTOA 1P2QA 2XXLA 2N1TD 3F0PA 3ZVEA 1HH0A 4RESB 1K73Q 2R5BA 1VJAU 2B7DH 2O8MA 5DP5A 2I1JA 1NU9A 3PO1B 3EAJA 3H1HD 1A3BH 1G2CA 3RLYH 1QFKH 1TPSA 1LT1A 1YYCA 2FOAA 2C3SA 2WV9A 2YXQB 1GI2A 3BG8A 3AE1C 1OX1A 1IFNA 1MKMA 3TDKA 3H1ID 1GHVH 4ISIH 4Y28J 1C2HA 3SQEE 4WY3A 1S6FA 2BVSH 1GBHA 1QRWA 3SNCA 1SLWB 1L0NG 1SP4A 3T97A 3L72E 1O3DA 2YXRB 1RTKA 1ETTH 1MQ5A 5HM2A 1GJAB 2ASUB 1C1SA 1DOJA 4BAOB 2Z9IA 4HTCH 5C5OA 3HRNA 4ZKRU 3FKSD 5CMZA 3G01A 1C2LA 1RF0C 1G3DA 5ETXA 4GSOA 2P3FH 3GY8A 2VGCB 3VEQB 1DLEA 1E36B 1VQMP 1OXGA 1YPEH 2FYUD 3BTME 1L1NA 1VQ7P 1YPLH 3RXPA 5APWA 4I8HA 3MTYA 4TPIZ 1FY5A 1ANDA 1TBZH 2XW9A 1F92A 1A1RA 1NVOA 2PKSC 1J1DC 1IC2A 1WQSA 3MZWB 1Y47A 1OWEA 1HPGA 3QN7A 4EIJA 2FLRH 1ZJKA 1MZ9A 1HXFH 1BGYG 1DX7A 3RMLH 1ZV8A 1RD3B 2HNTE 3SNBA 2FFDA 3KQCA 2CHAB 4NG9H 2HG5D 1PP9D 1WRGA 1E0FD 3L71E 1E38B 3ZVDA 3UREA 1FOSE 1V3XA 2QXJA 3B8JA 1L2PA 2J38A 2VIDA 3AE5C 2V0BA 3L73G 2ZTYA 5KAIE 3DT0H 1CGJE 4U3FD 1AVOA 3U8RH 4FOUC 4GOEA 1G30B 1KILE 2O8WA 3D49H 5T3HA 1L2EA 4NPDA 3O8CA 3LH3A 3SJ9A 1O5CB 1UTJA 3D70A 3GY7A 1LKAA 2B9LA 1LCYA 2KZJA 2UUKB 3KN2A 3PV5A 4FUHA 1FNIA 1O39A 3FZZA 1QB9A 1ZRKA 2BX3A 2XKMA 1O2NA 4HH2A 1SKYE 3T26A 1HAOH 1K0HA 3MO3A 4YTPC 4IFDK 3A89A 1PJPA 1QR3E 1YCPK 2TGTA 3JC22 2SNWA 7KMEH 1HAVB 1SQQK 1YC0A 1ZTJA 4Z1MD 1GU4A 1FQ3A 4OS4A 2A45H 4ISNA 3PTZA 4CHAC 3ODDA 1WU1A 3H1IG 5EPNA 4X8VH 1K1JA 1INCA 1VITF 1HRTH 1T2KD 1LTOA 2C8WB 5DGJA 3WWBA 3WUVA 3M36A 2ZHFH 1C9TA 4Q7ZA 1TPAE 2F9VA 4WH8A 2HWLB 2Y7XA 1P2OA 2Y9YA 2HRVA 1JNMA 1NFYA 1KLTA 4Y99C 2VVVA 1M56D 4FUCA 2E76B 1BJVA 2ZFCA 4YPCA 1SGTA 2IYPA 2R5DA 3OX7U 4F48B 3PMHB 1TRNA 1UTQA 4BAHB 2XTTB 3ZIAD 2OYIB 1Z56A 1V2LT 1HJ0A 1LWUA 1EX3A 1Q81Q 2R2WU 3MIWA 1P8VC 1DUEA 1K1LA 2GV6A 3QLPH 1C2GA 1ZPZA 4KKDA 3QH9A 3TK5A 3L71J 2D2CB 4NIYA 4WY4D 1IQJA 2BD5A 2BCCE 2H8PD 4JYVH 2ZEBA 4ACBA 4A7PA 1P03A 1S4XA 2OQQA 2O3JA 2QEXP 1QL2A 1TA6A 4CBNA 5KKZB 5KLVK 2ZF0H 4UFDH 1VQPP 4CRDA 4HGCA 4E06H 3TJOA 3HE5B 4ZHAA 1N1LA 1FIWA 3AVZA 1J2JB 2BD7A 1A4WH 1LJ2A 1PP9G 4I1LA 2W6ID 1CVWH 2D26C 5AF9H 5JPMH 1N2DC 1QL8A 2XBWA 3L75E 3UPEA 2RCEA 5CHAB 2HNTF 4TY6A 4B76A 3U1JB 1GDTA 1IQMA 4LK4A 3L74J 1EOJA 1Y5UT 2YKPA 1YJ9P 1UTNA 5HMAA 2QJKC 1DPOA 4EOTA 3ATMA 3SJOA 1IFMA 2BZAA 1BRAA 1K21H 1OVVA 1BRBE 1O32A 2J9NA 3IR9A 1ELBA 2WV4A 3U1AA 2ZIQH 1C2MA 5APUA 1EPTA 3OY6U 1HJAB 3UR6A 4I6MC 2A4QA 3L4FA 4BAKB 1FY3A 4BXWA 1MCVA 4ZH8A 1GBLA 3RGUA 5CHBA 3RXMA 1LHGH 1J14A 3S7HB 3EFGA 2OLGA 1A02F 1RE3C 1X79B 5EGMA 4YO9A 4FETA 1NFUA 3Q77A 4JZEH 1XVOA 2BLOA 3QDZB 3IN6A 5CJ4A 1GL2D 2P95A 3KEEA 4XBDA 1SQBE 1SFQB 2FY8A 1KSNA 2A7JA 2ZGBH 1NBMD 1T4VH 3PV4A 2H9EH 2BCCJ 1NPMA 1WYKA 1OSSA 2EC9H 3B9FH 2YO3A 3UWJH 5KEDA 4B2BA 3F3BA 1O5AB 2IOTA 1HAZB 3RK2C 4K69A 3UQVA 3ITIA 1TNKA 2E74C 1F5RA 1UTKA 2WSCJ 2G4TA 1L0ZA 1AVYA 1RH5B 1GCDA 2PKSB 4WY4B 4D6TJ 1BA8B 3TGUG 2FZZA 1J1DB 2PKAB 1LVOA 9LPRA 2B89A 4YZUA 4O3UA 5DSFA 1AA0A 4GLYA 2Z5IA 1SQRA 2H9TH 3HKIB 3E7KA 1D9IA 3V4WA 1C4V2 1DXWA 1BTYA 3OSYA 1NU7B 1DEBA 4B74A 3AECC 2R9PA 1TU3F 1VCPA 2WYGA 4GPGA 3KF2A 1P2NA 2OTVA 1QLED 5KAIH 1ZOYC 2KR7A 1SQQG 2W7SA 3QWOC 1AWFH 2Y80A 1QGKB 2A1DB 2BHGA 1GVZA 2GCTC 2AEIH 3GICB 4F49A 2FYNC 2Z94A 2RG3A 3FXDA 5DP7A 1UW7A 4MNVA 1SGFA 1JMBA 1SQVK 2ZYGA 4IFMA 1S83A 3BG4C 4M7GA 2GTBA 1XUJA 3LT3A 1JY2O 4ZMDA 3SZNA 3AE7C 1NTZJ 1YJWP 1W13U 2IBZI 1MD7A 1UVUH 1O3BA 2FYRA 1D7MA 4ASVA 4DT0A 1QB6A 3BTFE 2IBZE 3TPIZ 2F9PA 2O1JA 1GI8B 5TJHA 1L0LJ 3HGPA 3V12A 3RK3E 1LQDB 3CCQP 1BDAA 1J8AA 1LP1B 2EEKA 2XNDH 3ZZ3A 1M7LA 1HUTH 4Y8YA 2ODQA 4CHAB 3MH5A 1O3GA 1KQFB 1KD1Q 2H6MA 1SQPD 4ZHMU 3S9OA 3SI4H 3AK5A 5CHXA 1P3EA 4DY7B 2ZGHA 3F1SB 4HFPB 3RC4A 4ASWA 4ZNCA 1ZRTE 2Z6BD 1UK2A 1FDIA 1Y5AT 2NU4E 1QGFA 1SLUB 1UCYE 5DO4H 3RXJA 5KLVG 5F53A 1LGHB 5GPIB 1MUUA 2ZFFH 2PGDA 1QJ1B 1H8AA 4JBZA 1P01A 3SUDA 4BXSA 1NM6A 1AFEH 3LJJA 4FUIA 4AFUA 2N1TA 1O3JA 5APTA 2VH6A 1VF5D 5CJ0A 1HBTH 1VGCC 2UWLA 1KLJH 1S1CX 2FXMA 4M3LA 1S85A 1NROH 1HB0B 2ZT9C 1E37B 4KTCA 2QCYA 2WSCH 2Y0DA 5APYA 1TRYA 2IJD1 3ZVFA 1T3JA 1XVMA 4AC9A 3ZVBA 1C2JA 1DITH 2ZU3A 1WXRA 3B5NA 2RMZA 3PH0A 3TGKE 2HLOA 3E0PB 3OEED 2P94A 4OWFA 1YIJP 4OS7A 3UB0A 4R4MA 3A0HE 5AVTB 1WBGB 1WQVH 4B71A 3SGAE 2ILNA 1NTMK 1QJ7B 1TX8A 3BEIB 4W7YA 3FX0A 4KTUA 3RP2A 1AQ5A 1YYY1 1M1JA 3TK6A 5CBOA 3BCCG 1MD8A 2GZ9A 3RM0H 3RXLA 4ABEA 1NESE 2JH6D 1BGYJ 1COWD 3CMEP 3PMJA 3R3GB 2FYZA 4Y0YE 4ZAEA 1DSTA 3PYHA 8ESTE 1BITA 1BCCD 1LT9C 2QJKB 3G6EP 1GVKB 1PPCE 1F5KU 1GMCF 3GCTF 3RM2H 1EC5A 1EXFA 3RC6A 3L73J 5E2PA 1D3DB 3SU6A 3A7OA 3L33A 1AE5A 1MKWK 3DSOA 2J97A 3U9AH 3ZVGA 1NFWA 2W3IA 2P8OC 1TGTA 2M3BA 4D7FA 3A8DA 3GDUA 1C1MA 3H1KE 1QQUA 2NU2E 3H1LD 2VNTA 2ITAA 1JCCA 1NU1K 4A7IB 4DG4A 1KMIZ 5JB9S 1LWUC 5C94A 7LPRA 3GYMA 1BT7A 4X8UH 4HJGH 1C5TA 3ELAH 1RTFB 2M5TA 1GJ8B 2E5YA 1G36A 2QC2A 1VQOP 4I33A 2BDBA 4BAQB 5A8YA 1K9OE 1SFIA 2PFEA 2KAIB 3W94A 1BB0B 2NU0E 3L72D 1K1NA 2K1QA 1GHZA 1SLXB 2Y6TA 2BD8A 2BY5X 1JTHB 3WY8A 1C1WH 5B6OA 1AUJA 1SQVG 3RK2B 1O5GH 1VQ6P 1Y3WA 2E74B 3M06A 3Q2YA 4MN4C 3PTBA 3E91A 2KK7A 1A2CH 1O3PB 2PTCE 3S9AA 1K9MQ 2BQ7B 2CF9H 4I86A 4RSPA 4FXGH 1SMFE 4FUDA 4NWKA 5E0JA 4ABFA 4Y76A 5T6FA 3AW0A 3M9BA 1LTJA 1PPJG 1V2PT 3R4YA 1GI4A 3SV9A 1P2MA 1AZZA 3GMAA 2A2XH 1OFCX 1N7SA 1S3JA 3G9RA 1V2MT 3T29A 1FAVA 1SG8B 3A3YB 2FI4E 2PGBB 3P17H 3P8NA 2XC4A 2EI8A 4DZOA 2Y5FA 3MO6A 1NU1D 4TPYA 2GCTB 1BZXE 3TH4H 3SWKA 1BTPA 2FXRA 4H42U 5EJLA 2FYNB 2LNCA 3EA9A 3F68H 3L37A 5AVRB 1LPZB 5C67A 1VQKP 2VWOA 3ZVCA 1MU6B 1QL1A 3MP7B 1ZOMA 3BG4B 2H89C 3L70E 2EY4C 5BPEA 1O2TA 5KGOA 1C5VA 2UUYA 1Q31A 5ESTE 4WB4A 1KXEA 3VFEA 1NTKK 4PD4E 4MPWA 3M7UA 3TGIE 3LGTA 1M90Q 1YPGH 1EZVG 2L5GB 3T97B 2PRRA 1SGCA 1IFDA 3N7EA 1SQXK 2WPKS 3N7DA 2OQ5A 3UNSA 4TT3D 3KQGA 4NFEA 4NZLA 3SOSA 1MTNC 2P16A 1VITG 2BQ6B 1PQ7A 3A0BE 1C1UH 2CV3A 1UCYH 3MMGA 2M0BA 1C5RA 5AW8B 4E7RG 1BTWA 5CDFE 1X9VA 2KFWA 1G1JA 5EFWB 1F0RA 3TLOA 2IDBA 1G37A 1O5BB 1L4AA 2ZDMA 3H1LG 4WVPE 2OYHA 1DH3A 1ETSH 2FWWA 2Z7FE 4CRGA 3AE9C 1ELGA 1YY3A 1BOQA 1ESBA 1BE3G 3H7TA 3LC3A 1NTMG 2G3AA 3Q5PA 4ABDA 1LTBC 1ACBE 2JH5D 4U2WA 1LTTC 3BRVB 4EDFA 3GHGC 2GZ7A 2PUQH 1MTWA 3KQBA 1YLCA 1C5LH 3T25A 3U8TH 2OARA 2AXTE 3E1IA 1TBRH 2FFDB 2HLDD 3VMXA 4E05H 5JYIA 2V6NA 4U32A 1AWHB 1T3UA 1SR5C 1TNIA 4Q63A 1KYOE 5AVSB 2ZT9B 2PLXA 2Y0CA 2M5AA 3Q5SA 1C1PA 1DWDH 1CQQA 4BRYA 3SV8A 3CI9A 4D9QA 1C1QA 5C39A 2IPQX 2LELA 2IJOB 2QIQA 2I8DA 1ELFA 4OH8B 5LGOA 3H6PA 4U01A 4ZHLU 3UOUA 2VU8E 2ZGXH 1UHBA 2WSFH 4AFZA 4ZKSU 1LKBA 3BN9A 2BCCD 5DK1A 3TGUJ 1P2JA 1Y5BT 2JH0D 1FS0E 1LMWB 1GL2A 1TB6H 1YKTA 2THFB 3ZYDA 2FS9A 4ABHA 1PQAA 1HAHH 3SN8A 1ZLRA 1QURH 1NU1G 2G8YA 1VQ5P 1FI8A 2Z9GA 4JZIA 1SQBK 1MKXK 4XSKU 1O2LA 3D6YA 1A0LA 1EAXA 1SQQJ 1BBRE 2QN5T 3V2PA 1Q82Q 1YLDA 3A7WA 4KGAA 4XOJA 3NUMA 2WSSD 1LT9B 3GY2A 3L75D 2XBYA 5EXNA 3D65E 2KP8A 3F9GA 2POHA 4F4OC 2CMYA 2KYVA 3DHKH 1ZTLA 2FIRH 3EE0B 3RXQA 2WPSA 3RXEA 3T28A 2QF3A 3GOVB 2VWMA 4BWNA 1E1RD 1S0RA 1YTZI 5TCCA 1IFPA 2Z9KA 5AFZH 4XRNA 4BTUB 1Y3VA 1VQLP 1QQ4A 1R8EA 2G81E 3P7KA 1HWTC 1W2BO 4R0IA 2N1TC 3VMAA 3G4SP 1PGQA 1O2QA 3QZRA 3HE4A 3F9HA 3TGJE 4Y11E 1KMHB 1PPGE 1LWUB 5FXLA 5GJ4B 1GDQA 3U8OH 2QXIA 2GCHF 5FCRA 3A7ZA 1CT0E 2ZXXA 2Z9LA 3FAOA 2VJ1A 5K7RA 3K6YA 2HPPH 1Z6JH 3LGUA 1IO4A 4AG2A 2B5TB 2VRSA 1JY3O 3AE4C 3B5NC 5CCGA 1TBQH 1W0YH 2JDIH 1TQ7B 2PTNA 1QBNA 4NA7A 1SQBD 3RXAA 5JBAS 1QVFO 2ZDNA 1EB2A 1A5IA 2AHME 2FYQA 3CC2P 2AGGX 2ZVNB 3M5MA 2A45I 4NPEA 5KLVJ 4O9VA 1RQVA 1NTKG 2WZ7A 4B6EA 1M1JC 3USSA 1DXPA 5H2FE 1IHSH 2E75D 3CS0A 3K6ZA 4H4FA 5EOKA 1MBQA 3SHCH 1G2LA 3SU2A 4A1VA 5C3NA 2A4RA 2OYOA 2Q6DA 2KSEA 4L75A 1NH4A 4N6JA 1SQXG 1GJDB 1RGQA 3Q1MA 1ELTA 2Y81A 3U1IB 5FCKA 1K28D 5FPTA 1BSNA 2WT7A 3SBKA 1TABE 4MQAA 3RC5A 1XUIA 3FXEA 3CWBG 2HLCA 4BNRA 2OYIC 4RKJB 1C5MD 1S9KE 2WPJS 1OYQA 3A88A 4PD4H 1KTMA 3AW1A 2OD3B 4FU9A 2SNVA 1HGZA 2G55A 5E79E 1FJSA 2KS1B 4UE7H 2KLVA 4H6TA 5I46H 1PFXC 1TGBA 4C7NA 3IFMA 3WU2H 1NRPH 1GJ7B 4NWLA 3CCLP 4DJZB 4PJ0E 1T31A 2OC7A 2SGQE 4KP0A 1NO4A 3A0BH 1P84E 1SSXA 1XM1A 4DGJA 1JOCA 4C46A 1N7LA 3BCCJ 2HODA 2BDAA 2BYAX 2J95A 3KGPA 3P32A 2J58A 2BDGA 3K2UA 3N7OA 2MJZA 3PV2A 1TPPA 2BVRH 1T8MA 1TLDA 1KN7A 2UWPA 3PRDA 4MNXA 1T4UH 1ABIH 1L4ZA 3OW2O 2UUFB 4RI0A 2IBZD 2XNXA 1HAXB 3LGIA 2FYUK 3RK3D 1A0JA 1O5DH 3MNSA 1BTHH 1E5WA 3L36A 4LLHA 1VPCA 2K9JA 3Q3DA 3FOAA 2AXTH 1JWTA 4R4LA 1DD3A 1QBOA 3HPTB 1HNEE 1KYOH 2BQWB 4VGCC 4M9FA 1HJAC 3M91A 5A09A 1LTJC 1ZRTD 3GHGB 2FTMA 4MPXA 3B5ND 1AFOA 3B8EB 3CXHE 1T2KC 1N7SC 2C0WA 4ASUD 1RF1A 2L74A 3GY6A 2KCPA 3LOXA 2Y5HA 3A2AA 3MWIU 4P00A 1P05A 2XCNA 1W7GH 4I8KA 3VP9A 4IGDA 2W8ZA 3RXHA 1GG6B 1KYNA 8KME2 4CH8B 1W12U 4JZDH 2P2UA 1W7XH 1GMHF 1D6WA 1Q90D 1SQVJ 1FZZA 1OWJA 4ZKUA 5AW1B 2AEFA 3OTPA 1M57D 1BMMH 4CRBA 1SGFG 3URCA 2JWAA 4X8TH 2B0FA 2Q3IA 4B6FA 1XUHA 1WCZA 1BBRH 1MH0A 2OP9A 5LPFA 4ZMAH 1Z8GA 2V3HH 3A8CA 1AQ7A 5JBTA 2Y9ZA 2P67A 4WY4C 1IQNA 1FZBA 3HUSA 3KIDU 3PP5A 2C90B 5APQA 4GVUA
chains in the Genus database with same CATH topology
2OK5A 5IK2D 2WZQA 1NBMD 5EPYA 2K0QA 3SV7A 3RL0g 5KLIC 3SUEA 2KCYA 3F3BA 2K8IA 2E74C 3O6QA 2WSCJ 1DY9A 3SU0A 2QJYC 5DSFA 3O8DA 2J5UA 3DSPA 3SV6A 1DXWA 3D6ZA 4B74A 1JB0J 3AECC 1TU3F 3KF2A 4OGQD 2OBOA 1ZOYC 2KR7A 1H8ED 1PIXA 2FP7B 4A92A 2FYNC 2ZT9D 3L6PA 3LKWA 3SU3A 2WSFJ 3SUFA 3AE7C 3FGAD 1OW6A 1FX0B 5FPYA 2F9UA 5C17A 2BEQD 3RK3E 1MABB 2F43B 3GLMA 4H44B 3AEEC 1DY8A 2JDID 1KQFB 3AK5A 3S9OA 2CK3D 2QE7D 3RC4A 1ZRTE 1FDIA 3OEHD 5F53A 3M5NA 5GPIB 1KORA 3SUGA 2KM0A 2QF4A 1UIXA 3SUDA 5H4IB 1VF5D 2P59A 2F4LA 2YMSB 1GMJA 1W0JD 1S1CX 2ZT9C 4KTCA 2IJD1 5HKKD 1WXRA 2JJ1D 4OGQB 1IK7A 3SU5A 3OEED 3UB0A 4R4MA 3OAAD 2QF5A 1DIPA 2E75B 3FO8D 2V7QD 3EWKA 2L6OA 4PV1D 1NBME 1VL2A 1YQ3C 3H09A 1COWD 5T1VA 3B71A 2OC1A 4H0LB 4U7JA 4WF8A 1AJYA 3RC6A 2BEZF 3SU6A 3DSOA 2VBCA 3AE2C 3SZEA 1OW7A 1NYHA 1VF5C 3OFND 2V7QJ 3Q5RA 1KMIZ 2JO1A 2E76D 3NRLA 2MKVA 2WPVB 1BT7A 3GF3A 4KT0J 2XOKD 4I33A 5GNDA 4Z1MH 2K1QA 2D2CD 3VG8A 4YXWD 4I32A 4PV1C 2E74B 1PL5A 5IDKA 3Q2YA 2YIUC 3OYPA 3AE6C 3O8BA 5EQRA 3LW5J 2QIWA 4NWKA 1ZP0C 3R4YA 2NZ2A 3SV9A 3GMAA 4H13D 3G9RA 2H88C 3P8NA 5EQSA 2FXPA 3O8RA 3D71A 1DD4A 3FN8A 2WPDD 3H25A 1NGMB 3F2GA 2H89C 3AEBC 2FBWC 5C0UA 4A1TA 2E76C 5L8RJ 4A1XA 2GGVB 5B6LA 3AEFC 1S5LX 3T97B 3N7EA 3W1EA 3N7DA 2KCOA 2JP3A 3AEDC 1JXPA 4TSFD 4TT3D 2D2CC 2JJ2D 4I31A 2YMKA 2OC0A 5CDFE 2KFWA 3DCLA 1HF9A 2IDBA 2OBQA 4B73A 5KKZC 3AE9C 3SFDC 3C8VA 2G3AA 3AEAC 3Q5PA 4I7ZC 5EQQA 4H13C 4GDOA 3PRBA 3AE8C 4F55A 4ZCNA 1K04A 2HLDD 3SYJA 5ESBA 4IL6X 3F0PA 4Q63A 2ZT9B 4K8BA 2O8MA 3Q5SA 3EYDA 3SV8A 4R8TB 1CU1A 4WH6A 2LELA 4I7ZB 2IJOB 1W0KD 2WV9A 4OM9A 2M2AA 3AE1C 4U01A 1W3CA 1MKMA 2KCAA 4Y28J 3WW7A 1PV3A 1H8HD 2QSIA 2OINA 1OW8A 2G8YA 3P8OA 1BMFD 3FKSD 3D6YA 2W6JD 5ETXA 2WSSD 4H44D 3E90B 3WWFA 3SFEC 1A1RA 3F2FA 2OC8A 1E1RD 1VF5B 1R8EA 1KQGB 1KMHB 2XNIA 5GJ4B 5FL7D 2O01J 2A4GA 2YMSD 3AE4C 3AE5C 2P10A 1EXJA 1KILE 2KZ4A 1EXIA 3O8CA 3AEGC 4Q4LA 4PV1B 3D70A 2AHME 3KN2A 3M5MA 3PV5A 4XFJA 4B6EA 5DN6D 1RQVA 1DXPA 1SKYE 2E75D 4TT3H 4DT4A 3SU2A 4A1VA 4YTPC 2A4RA 1OMIA 4YXDC 1RGQA 3Q1MA 2YOLA 4H44C 3U1IB 2WHXA 4Z1MD 5FPTA 4B75A 5EPNA 3RC5A 3M5LA 3WWBA 1ZMEC 1KTMA 2QJPC 4H0LD 2F9VA 4WH8A 4TYDA 4NWLA 2E76B 2OC7A 3F0OA 3LONA 3ZIAD 2YMSC 1HJ0A 3M5OA 3F2HA 3PV2A 3KNXA 2D2CB 3PRDA 1RTLA 3GS9A 4RI0A 2XNDD 3GF7A 4OGQC 3SU4A 1EFRD 2OQQA 1FDOA 3SU1A 1OHHD 3Q3DA 3FOAA 2E75C 2JIZD 4R4LA 2FM2A 1N1LA 1DD3A 2E74D 2W6ID 1E79D 3AE3C 4M9FA 4H13B 1S6LA 5FPSA 4ASUD 2XCFA 4B76A 2KCPA 4JMYA 3OE7D 3U1JB 4XD7D 3LOXA 2QJKC 2XCNA 1U57A 4H0LC 2WQYC 3IAOA 1NS3A 5C0TA 2GVFA 2A4QA 2WSEJ 1Y9BA 1Q90D 1YQ4C 3OTPA 5CHBA 1E1QD 2QV1A 1K05A 3ABVC 4RKUJ 2K9YA 4B6FA 4FETA 1WMKA 3IN6A 5M1BA 3N99A 1RQUA 2FOMB 3KEEA 4B71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QF5 A;  1DIP A;  1R8E A;  2QF4 A;  3D71 A;  2OQQ A;  3IAO A;  3Q5S A;  3Q3D A;  3Q2Y A;  4R4L A;  3D6Y A;  3Q5R A;  3Q1M A;  3Q5P A;  2J5U A;  1EXJ A;  3T97 B;  3D6Z A;  3G9R A;  1EXI A;  4R4M A;  3D70 A; 
#chains in the Genus database with same CATH topology
 3SND A;  2W5E A;  3GY5 A;  2WZQ A;  3KQ5 A;  2ZZU H;  5EPY A;  1GMC G;  3RL0 g;  2SFA A;  1L4D A;  3I5C A;  4RN6 A;  2BXT H;  3RMN H;  5EW1 H;  2H9H A;  3VP8 A;  1UVS H;  4WME A;  2KCY A;  3NZI A;  2K8I A;  4OS6 A;  5APX A;  3O6Q A;  2ZI2 H;  4Y71 A;  3VB3 A;  1AZ8 A;  1FAK H;  1YTZ T;  2GMT C;  2ODP A;  1Z8J B;  2J5U A;  1CZQ A;  4JPZ B;  1SI5 H;  4GKG A;  3V2N A;  3D6Z A;  5AVU B;  3ODF A;  2N1T B;  3MD0 A;  2ZVO B;  5KLI B;  1N73 A;  2LP6 A;  4SGA E;  2C0X A;  1HJB A;  2ZJS E;  1O2U A;  4KJM A;  1EDI A;  2QA4 P;  3RBZ A;  1JUN A;  3H1K D;  1Q7Y Q;  1JM0 A;  1NO9 H;  5AW2 B;  1TOC B;  2B8O H;  1BTZ A;  4LOY H;  4YTA A;  4IC5 A;  1LTG C;  3B5N B;  3H1H G;  1TPO A;  3L6P A;  4JK5 A;  1NWQ A;  2ANK H;  3SU3 A;  1O2Y A;  5H2F H;  2DE8 A;  1BRU P;  4NCY A;  1GI7 B;  4BTT B;  3L74 E;  1OP8 A;  1URQ D;  2FEQ H;  1KIL A;  1O33 A;  3TJU A;  4XDE A;  1IQH A;  2D8W A;  3P8C E;  4XFQ A;  1N7S D;  2WPR A;  1GL2 C;  1BE3 J;  1OW6 A;  4YT7 H;  1HGV A;  1NTM J;  2PP6 A;  4IC6 A;  5FPY A;  1M1J B;  1N86 A;  3P95 A;  1SHH B;  3FWL A;  3WUU A;  1KXA A;  2H5C A;  3M7T A;  2FLB H;  4UDW H;  2A06 E;  1KTS B;  3A5T A;  1MAB B;  1RY3 A;  1GHA G;  1GJ5 H;  5E79 H;  1F0S A;  2EI7 A;  2JDI D;  1NTP A;  5E0H A;  2G5V A;  2AXC A;  1YI2 P;  2GP9 B;  1OIP A;  3TIU A;  4CRA A;  4PJ0 H;  4X2X A;  1NKN A;  4EI2 A;  1AGJ A;  2FYU G;  1GD2 E;  3CCR P;  1PPF E;  1GL0 E;  1W14 U;  2VB0 A;  2VWL A;  1P84 H;  5LPE A;  2WMM A;  3A83 A;  5TJX A;  1E79 H;  4ISO A;  5FBI A;  3M5N A;  1ID5 H;  1O0D H;  5GIB A;  5GCH F;  1MCT A;  2NU3 E;  4OS2 A;  2IZ0 A;  1P0S H;  2BY9 X;  1A5G H;  1IQL A;  1BDC A;  4NPF X;  1UIX A;  2QF4 A;  3H1J D;  2FOC A;  5SGA E;  3SJ8 A;  3ENS B;  2IZ1 A;  1HDT H;  1P09 A;  3E0N B;  3L70 D;  1EUF A;  2F4L A;  2P59 A;  4INL A;  4D6T E;  3V6I A;  3KYG A;  4D8N A;  1EAI A;  1VJ9 U;  1L4A D;  1ZHP A;  2EA3 A;  1YBK A;  3S9C A;  1XX9 A;  1S0Q A;  2P3T B;  2ZQ2 A;  3R0F A;  1BUI A;  3IG6 B;  3SO3 A;  1WDI A;  3RXC A;  1VCW A;  1IK7 A;  3KYF A;  1D3T B;  4U3F G;  3GIS B;  2BTC E;  4THN H;  1G32 B;  1F2S E;  2D1J A;  4KTS A;  1FDP A;  1JO5 A;  3Q3Y A;  1F0U A;  4YOI A;  3CXH H;  2V7Q D;  3EWK A;  1C5W B;  2L6O A;  4PV1 D;  2FOF A;  2YNA A;  1FOS F;  3MH4 A;  3T27 A;  1A02 J;  1V2W T;  5A8X A;  4AGJ A;  1PQ5 A;  1YQ3 C;  1OZH A;  2RKL A;  1A61 H;  1TON A;  2W7U A;  3H09 A;  4VGC B;  3VTP C;  4DCK A;  2ZG0 H;  1MAX A;  3S69 A;  1LTJ B;  1C2F A;  1W0Z U;  2FS8 A;  2XC5 A;  1NTZ E;  1C2D A;  4LGD E;  5AVW B;  1N7S B;  1BTU A;  1LQE A;  1MZD A;  1HCG A;  1Y8T A;  5T1V A;  5C5N A;  3OTJ E;  2IPP A;  1GBD A;  2HAL A;  2GDE H;  2A5A A;  2OC1 A;  2O8U A;  2R32 A;  5TCA A;  1QA0 A;  4B1T A;  2JKH A;  3M61 U;  2F91 A;  3RU4 E;  3OY5 U;  1L0L E;  2Z9J A;  4ZRO A;  2BB4 A;  1SOZ A;  3KHU A;  1BML A;  4HYT B;  5L2Z H;  2YNY A;  2CPB A;  3P8M C;  2KX4 A;  2B9B A;  2VBC A;  3RXB A;  1YIT P;  5J4Q A;  1OW7 A;  2CF8 H;  4JYC A;  5AW4 B;  1VF5 C;  1C1O A;  3OFN D;  3VMZ A;  1O3F A;  1DT2 A;  4UFF H;  1JY2 P;  1NTK J;  2R3Y A;  5BU8 B;  2CPS A;  1OXZ A;  1EAU A;  1Z7K A;  4AN7 A;  3CPW O;  3CX5 E;  2MKV A;  3TNU A;  1RS0 A;  1ANE A;  1C5Z B;  5A0B A;  1WTG H;  4UFG H;  1O5E H;  4HG6 A;  1XXF A;  4NSY A;  1SQX J;  5HIZ A;  2SPZ A;  2ZNK H;  3EQ2 A;  3QWC H;  1ZYO A;  4K60 A;  1SVF A;  1CGI E;  2O01 N;  1ZHR A;  1SQP K;  4KEL A;  1L0N E;  1SFC A;  5T6D A;  1PQ8 A;  3M9Q A;  3CWB J;  3F5H A;  5KJ7 A;  1J9C H;  7GCH F;  1O3K A;  3H1J G;  1CA0 C;  2SGA A;  2OYH B;  1AFQ C;  5AW5 B;  1W5C E;  1L1G A;  3C9I A;  1OP0 A;  1YLN A;  1NN6 A;  2FX6 A;  5K5G B;  3GCN A;  2KB7 P;  1KV4 A;  1EZU C;  1V2V T;  3BTD E;  2YIU C;  1SGQ E;  1BHX B;  1YPK H;  1ORF A;  4CRF A;  3FZD A;  2OQU A;  2GMT B;  3LW5 J;  2QIW A;  1G2M A;  4TY7 A;  4OS1 A;  1GJ9 B;  3TYY A;  3E1X B;  3M3T A;  4JYB A;  1FPC H;  1HV7 A;  5CCG D;  1ZSK A;  2A5I A;  2GCH G;  3ITK A;  2NZ2 A;  2QA9 E;  4JCN A;  4H13 D;  1RF1 C;  1M1K Q;  1Y59 T;  1KDQ B;  2SGF E;  1V2T T;  2YKO A;  1ZR4 A;  4JYT A;  3F9F A;  2RN0 A;  4IW4 E;  2QE7 H;  2M5A B;  1G1I A;  4BRY B;  3VB5 A;  3O8R A;  4X2W A;  3D71 A;  1AE8 H;  2BMG B;  1HAI H;  1BGY E;  1QTF A;  3FN8 A;  4AUW A;  1GK4 A;  2QYI A;  2Z3D A;  4P02 A;  3UIR A;  2I6Q A;  1UVT H;  5CMX H;  2XU6 A;  4AYV B;  2Q1K A;  4X1P U;  2A5K A;  1IZN B;  2FBW C;  5C0U A;  1Z6E A;  2AER H;  2WTY A;  1UHB B;  1UO6 A;  3ATK A;  1NZQ H;  2RDE A;  1FUJ A;  4X1Q U;  2V3O H;  3FP7 E;  1ELC A;  2WYJ A;  4A1X A;  1GL2 B;  5B6L A;  2J4I A;  1H8I H;  2W6B A;  3AEF C;  5CCH A;  3L73 E;  4XE5 B;  2AS9 A;  3E8L A;  1DEE G;  3MHW U;  1IQF A;  1ZHM A;  1FLE E;  4W7Z A;  6LPR A;  3V7T A;  5FX5 A;  4YOJ A;  1XUG A;  4MG3 A;  2NWN A;  2W27 A;  1V2K T;  2FI3 E;  1GBM A;  4D76 A;  2FXO A;  3DCL A;  1HF9 A;  1ELA A;  1L0N J;  4ZKN U;  1Q2N A;  1QRZ A;  2FFD C;  4LC1 A;  1CA8 B;  2XBX A;  2ZFT A;  3UQO A;  1GHX H;  1T8L A;  1OWK A;  1H9L B;  1LHE H;  1MUE B;  4LXB H;  3W95 A;  1V2O T;  3C8V A;  1GVL A;  3KDP B;  3RUO A;  1AKS A;  3UY9 A;  1T8N A;  3H1I E;  1S9K D;  5HIY A;  1UJ1 A;  4X1R U;  3QGN B;  1O36 A;  1N8O C;  4GDO A;  2ZU5 A;  1Z71 A;  4JQ0 D;  1B7X B;  1P9S A;  3M3S A;  4A6L A;  3BTK E;  2WPQ A;  3R2P A;  2XZR A;  3UWI A;  1O37 A;  4LZ4 B;  3SQH E;  2IX7 C;  2LKM A;  3P8F A;  4FUE A;  1FON A;  4IL6 X;  1K8A Q;  2HNT C;  4GIF A;  1ELD E;  2XC0 A;  1O2Z A;  1EDL A;  3PMB B;  3W67 A;  3EYD A;  3CL3 D;  1PGJ A;  1P84 D;  1MMJ N;  2BDC A;  4FUB A;  4R8T B;  1X0T A;  1T7C A;  2STA E;  3ZZ8 A;  5AW6 B;  1VQ4 P;  1CU1 A;  2FI5 E;  2LXB A;  4I7Z B;  3FVF B;  1FBM A;  3D23 A;  2VVU A;  1D3P B;  2GD4 B;  4FUF A;  5DP9 A;  4INH A;  4O03 A;  1FY4 A;  2M2A A;  4JZ1 A;  1Q2W A;  2KCA A;  1A46 H;  3NXP A;  1CO7 E;  2L91 A;  2RA3 A;  4MNY A;  4O3T A;  1QL7 A;  5LPR A;  1S72 P;  1YGC H;  2GUV A;  1QHR B;  2ZA5 A;  5HM9 A;  3I78 A;  4DIH H;  3HTK A;  1GTW A;  2GT7 A;  3I56 P;  4HKZ H;  1OW8 A;  1C5U A;  1SC8 U;  4DOQ A;  5BVZ A;  1TE0 A;  5DJ7 A;  1ZPC A;  1VQN P;  3P8O A;  1ZJD A;  4J2Y B;  2ZO3 H;  1YPJ H;  1H89 A;  3A87 A;  5DJT B;  2WT7 B;  1TGN A;  3PB1 E;  1EP6 A;  1PP9 E;  4H44 D;  1AUT C;  1O2S A;  1LVY A;  2BDH A;  3E90 B;  1RIW B;  1SQP G;  3P92 A;  1A5H A;  1C2I A;  1H1B A;  3F9E A;  3H1H J;  1GMH G;  4ABG A;  1QA7 A;  3U28 C;  1TYN A;  1AHT H;  2G5N A;  3CX5 H;  2F83 A;  2BD4 A;  4C7N B;  3F2F A;  2OC8 A;  1CSB A;  2A45 B;  3V4Q A;  2HVX A;  3I77 A;  2VIQ A;  3H1I J;  1VF5 B;  2R3S A;  3HGN A;  4I8J A;  2ZHQ H;  4Y6D A;  3MUD A;  1HJ8 A;  1LPK B;  2O01 J;  3K5B A;  2HOB A;  2AGE X;  1X8Y A;  2C4F H;  1Y3U A;  1GGD C;  8GCH F;  4Y7B A;  2HR3 A;  2ZPR A;  2ZPQ A;  3MU4 A;  6EST A;  2YMS D;  4ABJ A;  1YPH C;  2FOE A;  3FFG A;  1O2K A;  3BTQ E;  4XBB A;  3TH2 H;  2P10 A;  5TIS E;  1URQ A;  1SS1 A;  1PYT C;  1CBW C;  1R5L A;  2KZ4 A;  3AAS A;  3PRJ A;  3P70 B;  1D3Q B;  3A82 A;  2JJL A;  1CA0 B;  2PSX A;  4Q4L A;  1AFQ B;  1VCQ A;  2WUB A;  3PMA B;  2R44 A;  2K9J B;  2PGQ B;  3DSG A;  1IQK A;  5GTH E;  3LC5 A;  1QL9 A;  3PTN A;  2YIU B;  2AMD A;  4AFS A;  5FX6 A;  6CHA C;  4XFJ A;  3VMY A;  5DN6 D;  1G2C B;  1G9I E;  1OVR A;  3LID A;  3CD6 P;  5F8X A;  2AEJ A;  2KNC A;  1EPT C;  4DUR A;  3HD7 D;  4L76 A;  4AYC A;  1TMU H;  3UNQ A;  4DT4 A;  4X6O A;  1JY2 N;  1JBU H;  1LHD H;  4UB6 E;  4PD4 I;  3L71 D;  4X6P A;  2CJI A;  3SWY A;  5F6M A;  1H4W A;  1NRN H;  2ZHD A;  3CEN A;  2C93 B;  1RF1 B;  4I7Y H;  4GOF A;  3TGU E;  1P9U A;  3QGJ A;  3IF4 A;  1BDD A;  2WUC A;  1P04 A;  3CS7 A;  1PP9 J;  3M5L A;  1KIL D;  1BCC G;  2C8Z B;  1AU8 A;  1V2R T;  2QJP C;  1EP5 A;  3WU2 E;  1HAY B;  4UB8 E;  1H0T A;  2ZKS A;  3ZZ6 A;  1KQL A;  4H0L D;  2YMY A;  4U3F J;  4H6S B;  1NOH A;  3CC7 P;  2Y7Z A;  1SQQ E;  2VIW A;  4GUX A;  5BU5 A;  1ELE E;  1FE6 A;  3BIU H;  3M3V A;  1RRK A;  3UOP A;  2O9Q A;  3KZI E;  3H7O A;  3S0N A;  1ZW0 A;  3G71 P;  3LON A;  4N78 E;  3MI4 A;  1G3B A;  2IPH A;  5GDS H;  1OOK B;  3LJO A;  4AQR D;  1TNG A;  3L74 D;  3M5O A;  1O35 A;  3F2H A;  1ZPB A;  3BTG E;  3DFJ A;  1FZA A;  2P3U B;  4X2Y A;  5AHG H;  3P8C D;  3VN0 A;  2BDY A;  1AV1 A;  3KNX A;  3P8G A;  1SB1 H;  1IHT H;  2PKA A;  1RTL A;  3GS9 A;  1BTX A;  3LH1 A;  1C1T A;  2XND D;  2ZDL A;  3GF7 A;  2ZEC A;  3SNA A;  1FZC A;  4ASH A;  2C9L Y;  3U1C A;  1KYO I;  3L72 G;  1PGO A;  1C5Y B;  1VDF A;  1S84 A;  1GK6 A;  1W2E A;  1EFR D;  5A2M H;  4Y0Z E;  2ZQ1 A;  3O6Q B;  1N6Y A;  5GCH G;  3SWF A;  2E75 C;  2JIZ D;  1PPB H;  4X0W U;  2O01 H;  3OA7 A;  2BDI A;  1EZS C;  4MDS A;  2QG4 A;  4E7N A;  1PGP A;  1GG6 C;  3QK1 A;  3LPR A;  1DAN H;  1KXF A;  2BY6 X;  2C8Y B;  1N8O B;  4AG1 A;  1SQO A;  2ZYD A;  1RJX B;  5C2Z A;  2ANW A;  1MAY A;  1N73 B;  4RT1 A;  1MTU A;  3BRT B;  1ZXG A;  1PYT D;  2PR3 A;  1NTZ K;  8LPR A;  2QM7 A;  4RJT A;  2XCF A;  5KLV E;  2A31 A;  3OE7 D;  4JMY A;  3UUZ A;  3BV9 B;  2Y0E A;  2VVC A;  2PSY A;  1KXB A;  3GCH C;  3LGY A;  2WQY C;  3IAO A;  3RBX A;  5B66 E;  4IN2 A;  4D6T D;  1AVW A;  1Y3X A;  5FHT A;  3O8Z A;  1O3H A;  3GW6 A;  2J98 A;  2WPM S;  2GVF A;  4YM9 A;  4ACA A;  2WSE J;  1P06 A;  1JY3 P;  4MPU A;  2QAA A;  1YQ4 C;  3L71 G;  4YXW H;  1XTC C;  1LP1 A;  1PPH E;  1QY6 A;  1KIL B;  2FO9 A;  2VIV A;  3A85 A;  4O97 A;  1HVV A;  1O2O A;  1ZZZ A;  6GCH F;  1AY6 H;  1K05 A;  4RKU J;  2K9Y A;  1KTT B;  1JRT A;  5AW7 B;  1NRQ H;  1Z1I A;  4CRC A;  2KXP B;  3V3M A;  1WMK A;  1SGN E;  2DE9 A;  2FOM B;  1AD8 H;  2F3C E;  1F5L A;  1QIX B;  3K9X B;  2BM2 A;  2RDL A;  1JOU B;  2QRX A;  2NPS D;  1MTS A;  3RK3 C;  1CT2 E;  1UMA H;  5IK2 D;  3RXS A;  1DS2 E;  1GJB B;  2K0Q A;  4K2Y A;  3SV7 A;  1A7S A;  5KLI C;  5EIY A;  1OKX A;  3SUE A;  3BCC E;  1GI6 A;  1O2W A;  2TGA A;  1NTZ D;  3JZ2 B;  4UD9 H;  1VR1 H;  5AVQ B;  3SU0 A;  3VXF H;  1KC8 Q;  3EQ0 H;  3GYL B;  1MFZ A;  2J92 A;  1FIZ A;  4BAM B;  2ALP A;  2FOH A;  3NKK A;  3QZQ A;  3DSP A;  3FAN A;  1L0L D;  1C2K A;  4X2V A;  3SV6 A;  1IQE A;  3B23 B;  4UEH H;  2JET B;  3VPK A;  4DCD A;  5JB8 S;  1JB0 J;  3EST A;  1O2X A;  4JF7 A;  1V2J T;  1UVO A;  2BXU H;  1O30 A;  4Q80 A;  1SFC D;  2OBO A;  5TIS H;  2IYO A;  2A32 A;  5KJ7 D;  2BD9 A;  3MU8 A;  2Q5U A;  1D4P B;  1H8E D;  1GGD B;  1XXD A;  2BD2 A;  4FUJ A;  5G4B A;  4DT7 B;  2FP7 B;  2H5D A;  3MNB A;  1NAF A;  5GTH H;  1QBV H;  3II6 A;  3JZ1 B;  7GCH G;  3CX5 D;  3LKW A;  1JIR A;  2ZGC A;  1CBW B;  1AMH A;  2AIP A;  2M8R A;  5APS A;  4YLU A;  2O8L A;  4K5Z A;  1O2P A;  1TX7 A;  3ZVA A;  4UB6 H;  4Z0K A;  3PWC A;  4L73 A;  1CHG A;  2PUX B;  3FGA D;  1U6Q A;  2G52 A;  4W80 A;  2GUS A;  5KTB A;  1FC2 C;  4INK A;  5E0G A;  1ABJ H;  6CHA B;  2BCC G;  5PTP A;  1DLK B;  1WOF A;  1HGT H;  5JBC S;  2F9U A;  3RXF A;  1EPT B;  1TX6 A;  1ANB A;  1DWC H;  1GMD F;  3EGK H;  1UCY K;  1SQV E;  1V2U T;  2F43 B;  1LPG B;  5EOD A;  1P84 I;  4UB8 H;  3MNX A;  3LU9 B;  2QY0 B;  1QRX A;  2WSE H;  1YCP H;  1O3I A;  4NIW A;  3KZI H;  1Q3X A;  1RE3 A;  3L75 G;  2QJP B;  2FMJ A;  4IMZ A;  5CCH D;  4NIX A;  1PPJ E;  1J17 T;  1HJ9 A;  2KLU A;  2ZHW H;  3PM3 A;  1CGH A;  3TH3 H;  2A2Q H;  2ZU1 A;  1SGY E;  3CP7 A;  3ZZD A;  2RFK C;  1GW3 A;  2R0L A;  3KPE A;  1S2E A;  1J16 A;  3SUG A;  4X6N A;  3FP6 E;  5AVZ B;  2KM0 A;  1BGY D;  2HYN A;  1TIO A;  1ZGI A;  5H4I B;  3MUD C;  1MFT A;  3ZV8 A;  3TNU B;  1FPH H;  1SOT A;  1EDK A;  1GMJ A;  1JTH A;  2ZU2 A;  1DM4 B;  2YO2 A;  1O38 A;  2F9B H;  2K1A A;  1HIA A;  2JEE A;  1SHY A;  2TGD A;  1EZV I;  1IAU A;  3MGN A;  3CXH I;  1ZSJ A;  1QZ8 A;  3L73 D;  1GHY H;  4WWY A;  4A5T S;  2F9O A;  1JMM A;  3I29 A;  3OJA B;  2JKV A;  1BIO A;  5AVX B;  2JJ1 D;  1URQ C;  3T62 A;  3BTH E;  5DG6 A;  4WMD A;  1EZV E;  1BCC E;  1M8O B;  4NZQ A;  2BZ6 H;  1RXP A;  2W6J H;  1SQP J;  4CR5 A;  2LXC B;  1SQB G;  3PLK A;  3G3Z A;  2QF5 A;  3T2N A;  2E75 B;  3OU0 A;  3U69 H;  1GBF A;  1KXC A;  3TU7 H;  3ZYE A;  5A0A E;  1EZX C;  3KYQ A;  2ZU4 A;  7EST E;  5AVD A;  1USE A;  3TF5 A;  2HPC A;  3PLP A;  1AI8 H;  3FWN A;  4WVZ A;  4XE4 A;  4DII H;  1RE4 A;  2PAJ A;  2H43 A;  3ATI A;  3H1L E;  4IBL H;  1CI6 A;  1MBM A;  5B66 H;  1BJU A;  3GY4 A;  4MTB A;  3RXR A;  1SPJ A;  1SGR E;  2AYW A;  2VIN A;  2WIN I;  4J1Y A;  2BLW A;  3PLB A;  1FXY A;  1BE3 E;  3MU0 A;  4GT1 A;  1NTM E;  1Q86 Q;  4OGY A;  1FY8 E;  2Q6G A;  3B71 A;  2R2M B;  2P1J A;  4L74 A;  2R0K A;  2SGP E;  4U7J A;  2G51 A;  3GCH B;  5GWZ A;  3KHV A;  5J4S A;  2BEZ F;  1TRM A;  1NRR H;  2E5T A;  4AX9 H;  1O3O A;  1UII A;  2GT8 A;  3AE2 C;  4MPV A;  3SZE A;  3BTW E;  3QX5 H;  3V0X A;  3GCT G;  3NK8 A;  3C1K A;  3W68 A;  1CSO E;  1L4A C;  1QVG O;  2C9N Y;  3KCG H;  2OYH C;  2JO1 A;  4Q7Y A;  1GW4 A;  1XTG B;  2E76 D;  4DJG A;  5E8E H;  4K35 A;  1C2E A;  2EI6 A;  3V2Q A;  2IN2 A;  1KFN A;  1G3C A;  2FOD A;  3SNE A;  4KT0 J;  3RL0 D;  1KLI H;  2XOK D;  2PFX A;  2ULL A;  3RK3 B;  2CXV A;  1BCU H;  4NA8 A;  1E34 B;  1FZC C;  1GI5 A;  5B5E E;  4WXV A;  2GV7 A;  2IBZ G;  2D2C D;  4YXW D;  1UTP A;  1E35 B;  4I32 A;  1BCC J;  1NU1 E;  4PV1 C;  1O3L A;  1HFD A;  1PL5 A;  2ZFS A;  3EA8 A;  1JY3 N;  2FES H;  3HD7 A;  3PJS K;  1U7M A;  1GU5 A;  1BSH A;  2N9Y B;  1AKS B;  1SGE E;  2GKV E;  1GHW H;  3A7Y A;  3O8B A;  5EQR A;  4ABA A;  2G4U A;  1O34 A;  1ETR H;  1HYL A;  3E1R A;  1LNQ A;  4FUG A;  1RHZ B;  8GCH G;  2FOG A;  3A80 A;  3H1L J;  1J1E C;  1Z1J A;  4AB9 A;  1F7Z A;  1TNL A;  3TVJ B;  3VB4 A;  1IQG A;  5EQS A;  2NRG A;  3S1K A;  2FXP A;  5DP6 A;  1EAT A;  2A4O A;  1C5P A;  5ABW A;  1HAG E;  3C27 B;  1ZLL A;  2ZDA H;  1LVM A;  3ATW A;  2W3K A;  2LPR A;  1K1M A;  3T5F H;  1UTL M;  1VZQ H;  3L72 J;  3H25 A;  1KY9 A;  3E6P H;  3F2G A;  3AEB C;  1ELV A;  2W83 C;  1GDN A;  2PWX A;  3Q3K A;  1O2V A;  1CW5 A;  1XKB C;  5L8R J;  5APV A;  2Y5G A;  1DVA H;  1LHF H;  1C1V H;  4K1S A;  2HGT H;  1LT9 A;  1S5L X;  3MHV A;  3HTK B;  2TIO A;  4FVB A;  4K1T A;  3HKJ B;  3QO6 A;  1GJ4 H;  3SHA H;  1JEK A;  3W1E A;  3PWB A;  3SI3 H;  1TAW A;  3KXD A;  2KCO A;  2WPH S;  1JXP A;  1QEX A;  2A7H A;  3FP8 E;  4X6M A;  1EZQ A;  1P57 B;  3NMD A;  2BOH B;  4K8Y A;  2YMK A;  5AW0 B;  4N3Y B;  1NTK E;  1G3E A;  2OC0 A;  1C5S A;  1P12 E;  1UK4 A;  2G00 A;  1IQI A;  5A0C A;  3WMM 0;  1VQ9 P;  1NU1 J;  3CC4 P;  4SGB E;  1THS H;  2OBQ A;  4B73 A;  5KAF E;  3RL0 B;  1SQX E;  3TGU D;  4PD4 D;  1EJM A;  1YPH E;  3SFD C;  2QVA A;  4RO0 A;  1GBC A;  1LO6 A;  3LDX H;  3QUM P;  4K3J A;  4X1N U;  1TQ0 B;  5CCG C;  1L1J A;  4I7Z C;  5HGG A;  3GY3 A;  1LTA C;  4EST E;  5IYT A;  4H13 C;  3CWB E;  3DD2 H;  1DDJ A;  2AH4 X;  3AE8 C;  1TMT H;  1S5S A;  4F55 A;  4ZCN A;  2UWO A;  1KXD A;  4RKO B;  1AB9 C;  3U98 H;  3KQE A;  1SQQ D;  4AOQ A;  1SQA A;  1ZSL A;  4AOR A;  4O9B A;  2V3M A;  3M9H A;  4K8B A;  4Y8X A;  1YF4 A;  3H1K G;  4N78 D;  4ISL A;  4OS5 A;  3ZZC A;  2E43 A;  1CHO F;  4WH6 A;  1VIT H;  1YP9 A;  4CH2 B;  5CBN A;  1QB1 A;  1AVG H;  1W0K D;  2D2D A;  1URQ B;  4Y8Z A;  4CRE A;  2B87 A;  3H32 A;  4OM9 A;  1W3C A;  1LTS C;  1J15 A;  4ZUH A;  1P3C A;  3TSI A;  2ANY A;  1BBR K;  1OVU A;  1ZMJ A;  3TIT A;  1THR H;  1GI3 A;  3DA9 B;  2Z3C A;  1RIW C;  5EXL A;  2W90 A;  2ZCK P;  4CBO A;  1WAY B;  3WW7 A;  1PV3 A;  1H8H D;  2KNC B;  1DSU A;  2K3R A;  3I55 P;  2QSI A;  3P6Z B;  1GJ6 A;  2NPS A;  4TLF A;  2OIN A;  3BEF B;  1KYO D;  5K0H A;  2O1K A;  3RMM H;  2JWD A;  2KS1 A;  3CCM P;  1HTL C;  5EXM A;  1BMF D;  3DFL A;  1H88 A;  4GHT A;  3CX5 I;  1O2I A;  3V13 A;  2H7H A;  1ZN5 A;  2GX4 A;  2W6J D;  4NA9 H;  3SW2 B;  1IFJ A;  1NKZ B;  4YES B;  2BAS A;  1TGS Z;  1QX8 A;  3TK1 A;  5AFY H;  5EU8 A;  1GBI A;  2KSJ A;  3WWF A;  3SFE C;  1ZML A;  1H0T B;  1N8R Q;  5KLV D;  3MFJ A;  6GCH G;  1KFM A;  4TWW A;  1CT4 E;  1ZTK A;  1F0T A;  5F8T A;  4FU8 A;  1MU8 B;  3BAT A;  1QJ6 B;  3S9B A;  2WIT A;  4HI3 A;  4GHQ A;  1R5S A;  1MKW H;  5BRR E;  1NHL A;  1V2S T;  1OWI A;  5EJZ A;  1JIM A;  1M9U A;  1KQG B;  1L4A B;  4GOD A;  4WWI A;  4GCH F;  5B5E H;  5DP3 A;  2XNI A;  1C4Y 2;  1SL3 A;  3LGW A;  2AFQ B;  5FL7 D;  4ZXX H;  2P7J A;  3BTT E;  1OS8 A;  3L70 G;  1W8B H;  2NU1 E;  1FJK A;  3EDX B;  2ZXE B;  1P02 A;  3GG2 A;  2A4G A;  2J2U A;  2ZTZ A;  4FVD A;  5L6N H;  2ALV A;  1FV9 A;  1NRS H;  4AZ2 B;  2QGR A;  4CR9 A;  2O8T A;  4MNW A;  3UFA A;  4DW2 U;  1RFN A;  1FZC B;  1ZR2 A;  5AVV B;  3A84 A;  1EXJ A;  1EDJ A;  4AB8 A;  1P11 E;  2YKQ A;  2RA0 A;  2ZWL H;  1C1R A;  2PHB A;  1V2N T;  3L3T A;  1EXI A;  1C5Q A;  3GHG A;  3AEG C;  2ZP0 H;  3L75 J;  4PV1 B;  2CK3 H;  1GDU A;  1FMG A;  1C4U 2;  4ABI A;  1DFP A;  4QT8 C;  1OWH A;  3EA7 A;  2R3C A;  3MO9 A;  3BCC D;  4NGA H;  1GHB F;  5DP8 A;  2OTJ P;  1WT6 A;  1GBT A;  4TT3 H;  3MH6 A;  1IJD B;  2IFN A;  1RE4 C;  1OMI A;  2G8T A;  2GDD A;  4YXD C;  1T8Z A;  1S5L E;  4H44 C;  5GTI E;  2YOL A;  1J1E B;  2WHX A;  3QTO H;  3ZZ9 A;  2FDA A;  3BF6 H;  4B75 A;  3V5B A;  3RXD A;  3N4X A;  1FN6 A;  3ZDM A;  3N7N A;  1ZME C;  3HUS C;  1KB9 I;  2STB E;  4K1E A;  1GBK A;  4ABB A;  2J98 B;  5DP4 A;  1K1I A;  4TYD A;  1MTV A;  1TMB H;  1DWE H;  1KB9 E;  4BOH A;  1BRC E;  2AMQ A;  1SQB J;  2GA1 A;  1EB1 H;  3MU5 A;  3M7Q A;  3F0O A;  1YJN P;  4ZXY H;  3ZZA A;  1A3E H;  1O3E A;  1FY1 A;  1C9P A;  1GMD G;  1DE7 H;  3H1H E;  3CCE P;  1ZGV A;  4AGK A;  3CCV P;  2YMS C;  1EJN A;  3V2R A;  3LIE A;  1ZRB A;  3A8B A;  3D62 A;  4LZ1 H;  1O31 A;  1LHC H;  1TGC A;  1EAW A;  1P10 A;  5KAF H;  3MH7 A;  1FDM A;  2TRM A;  1B0E A;  4OGQ C;  4Y99 B;  1TNH A;  1N73 C;  3SU4 A;  4I8L A;  3HE4 B;  2H2Z A;  3GDS A;  4UON A;  2UWJ E;  1K1P A;  1S6H A;  1SQV D;  9EST A;  3E16 B;  2ZC9 H;  2E42 A;  2EST E;  1K22 H;  1FDO A;  3SU1 A;  1OHH D;  1MZA A;  1D6R A;  3RXI A;  4AFQ A;  2FOB A;  5EG4 A;  3HD7 C;  4BXL A;  2FM2 A;  5C1U A;  2BY8 X;  2VIP A;  5HXF A;  1OX3 A;  3RK2 D;  1XUF A;  3HAT H;  2E74 D;  3VB6 A;  5L30 H;  2W26 A;  1OPH B;  3LW5 H;  1E79 D;  3AE3 C;  1ZR0 A;  2QF0 A;  1YBW A;  4H13 B;  5DKM A;  5E2O A;  5F03 A;  3F6U H;  1S6L A;  3RLW H;  1PPJ D;  2AMP A;  2KZI A;  2WWW A;  1V6D A;  1EAS A;  2OUA A;  1JCD A;  2FYU E;  5FPS A;  3EE7 A;  1HAV A;  4D7G A;  1AB9 B;  3BEU A;  1FN8 A;  1KIL C;  1LDT T;  3RXG A;  2WSS H;  4CPG A;  1FZG A;  2QM8 A;  1GI9 B;  3Q00 A;  1EKB B;  1GJC B;  1EST A;  1GWA A;  4XD7 D;  3ZZB A;  1H9I E;  2BX4 A;  1U57 A;  3MTU E;  4H0L C;  3A8A A;  3L35 A;  3MOC A;  3RXU A;  3KQD A;  3RXV A;  1OP2 A;  3UIA A;  3TJV A;  3TJN A;  3RXO A;  1NS3 A;  2JR8 A;  5C0T A;  3RU4 T;  2ZDK A;  3RDZ A;  3VGC C;  1Y9B A;  3OAK A;  1HUC A;  3ZZ7 A;  1UTM A;  3UAI C;  3RXT A;  1EQ9 A;  1E1Q D;  2QV1 A;  4ZKP A;  2Q7C A;  3ABV C;  2F9N A;  1EZV D;  2XBV A;  3CXH D;  2ZFP H;  2AEM A;  1GBJ A;  2OYI A;  3QTV H;  4U3F E;  1GCT C;  5M1B A;  2BVX H;  3N99 A;  5EW2 H;  1RQU A;  4IS5 A;  4Y79 A;  1ARB A;  4NIV A;  2LR2 A;  3JCU E;  2BOK A;  1NY2 2;  2OK5 A;  1SGI B;  3JSV C;  1C5N H;  3URD A;  4X8S H;  1SVP A;  1YCP M;  2TBS A;  2OTK E;  2JET C;  2WPI S;  3UR9 A;  1MKX H;  1UVP A;  2TPI Z;  3TNS A;  1WUN H;  2A45 G;  1TA2 A;  2A7C A;  2HOD B;  4B2A A;  1O3M A;  4UFE H;  1DY9 A;  1BE3 D;  1NTM D;  3HE5 A;  1NT1 A;  2C8X B;  2SGE E;  2UUJ B;  2WVR A;  3NTN A;  2QJY C;  1O2R A;  1XUK A;  3O8D A;  2KIK A;  4X1S U;  1WSS H;  1DX5 M;  1S81 A;  4U30 A;  3HK3 B;  5JBB S;  3M0D A;  2CN0 H;  3KL6 A;  5F8Z A;  2FYU J;  4OGQ D;  3CCS P;  3DUX H;  2HPQ H;  5C1Y A;  1FZF A;  4WBA A;  1HIA B;  5FAH A;  2VH0 A;  5JDU B;  2Q9I A;  3NXS A;  2ZGJ A;  1PIX A;  1QCP A;  4JK6 A;  3SV2 H;  4A92 A;  3K65 B;  3STI A;  1SLQ A;  2ZT9 D;  3BTE E;  2BY7 X;  1W2K H;  2ZFR H;  3CMA P;  2XWA A;  1ANC A;  2WSF J;  2B88 A;  3S4R A;  4EYY Q;  1O2G H;  3SOR A;  3SUF A;  1P2I A;  1N6X A;  4Z6A H;  5GXP A;  2ANM H;  1B0F A;  1S5L H;  5GTI H;  1SBW A;  1W11 U;  3VB7 A;  1GHA F;  2KOG A;  1O5F H;  2ZPS A;  3MU1 A;  1FX0 B;  1GPZ A;  3BIV H;  2HPC B;  2ZCH P;  2Z5H A;  2NPS C;  5C17 A;  1MQ6 A;  1NJI Q;  2ZYA A;  2BEQ D;  5FBE A;  3H1J E;  5HYO A;  3M35 A;  3ZZ4 A;  1CI6 B;  2W6A A;  3GLM A;  4H44 B;  1ESA A;  2AIQ A;  1SGP E;  3AEE C;  1DY8 A;  2Q6F A;  2Q1J A;  4NFF A;  2BD3 A;  1NC6 A;  2XYA A;  1RF0 A;  1KB9 H;  1HBW A;  2PW8 H;  1LVB A;  2WPL S;  2CK3 D;  2I6S A;  3H1K J;  2FTL E;  1IOE A;  3ZZ5 A;  2QE7 D;  3VYI A;  3HUS B;  1DWB H;  2Q6Q A;  1GBA A;  3A7X A;  1OWA A;  1FAX A;  2WV5 A;  1PFI A;  2XRC A;  4WY4 A;  3NCL A;  3OEH D;  5C20 A;  1KIG H;  1KOR A;  4IL6 E;  1YHQ P;  4HB1 A;  1SFC C;  4IN1 A;  2A06 D;  1TNJ A;  5KJ7 C;  1WV7 H;  2P93 A;  4B2C A;  4FU7 A;  5AW9 B;  2OCV B;  4DOJ A;  1Y3Y A;  2YMS B;  3PLN A;  4MVN A;  3Q3X A;  1JMO H;  1W0J D;  2ZDV H;  4K3A A;  3GDV A;  2IFM A;  2Q3E A;  3PHL A;  1LTI C;  1HXE H;  5AVY B;  3PO1 C;  5HKK D;  2DW3 A;  3A7T A;  3PRO A;  5I25 A;  1W10 U;  3SSU A;  3NPS A;  4OGQ B;  2AGI X;  5DPA A;  4YT6 H;  2FKW B;  3SU5 A;  1T32 A;  1S82 A;  1K2I 1;  2ZCL P;  3C1L A;  1FU1 A;  3OAA D;  1VGC B;  3U59 A;  1DIP A;  3RXK A;  1TOM H;  3FO8 D;  3HD7 B;  1KDQ A;  2HVY B;  1NTK D;  1PZQ A;  1BQY A;  2HFE D;  2XDJ A;  3A0H H;  1O3A A;  5KEC A;  3MYW A;  4C7R A;  1HLT H;  1L0L K;  1NBM E;  1V2Q T;  3IWM A;  1VKY A;  1VL2 A;  2J59 M;  2ZHE H;  1BMN H;  2TGP Z;  1SQX D;  2DUC A;  4WXI A;  1TWX B;  3H1J J;  3CCJ P;  1C5X B;  2K37 A;  5DJU B;  4JYU H;  4NSV A;  1AN1 E;  3L70 J;  2QXG A;  1CHO G;  3CWB D;  5CCH C;  3S7K B;  2VGC C;  1SQT A;  1GI0 A;  4H0L B;  2VIO A;  1GI1 A;  4Y7A A;  4WF8 A;  1AJY A;  4IFF A;  1Z8R A;  4B86 A;  1HAP H;  2BLQ A;  1Z8I B;  3A81 A;  1USD A;  3WUT A;  1QNJ A;  4DVA U;  1GBB A;  3VXE H;  1IFI A;  2Y82 A;  3VGC B;  1NYH A;  1UK3 A;  2J34 A;  1MV8 A;  1YM0 A;  2A0Q B;  3JCU H;  1ARC A;  3CCU P;  3SJI A;  4BTI B;  1L0N K;  1T6A A;  4Y10 E;  2V4H A;  4XBC A;  2OGU A;  4JZF H;  2OXS A;  2YNB A;  3UNR A;  2V7Q J;  5AW3 B;  3Q5R A;  2BLV A;  3MQK C;  3BAS A;  3NRL A;  1DUA A;  2WPV B;  2N9B A;  3SGB E;  1GCT B;  2CHA C;  2GZ8 A;  3L74 G;  1OWD A;  1XMN B;  3GF3 A;  5C1X A;  2I1K A;  3RU4 D;  3LGV A;  1NAY A;  3M37 A;  4IMQ A;  1B5G H;  1C5O H;  1PPZ A;  2P8O B;  2CGA A;  5GND A;  5T6G A;  3IIT A;  4Z1M H;  3VOP A;  1DIC A;  1P2K A;  4OGX A;  3VG8 A;  5LH8 A;  2A06 G;  2XV5 A;  2OTL P;  1H8D H;  3Q76 A;  2Z3E A;  4D9R A;  2SGD E;  4I2L C;  5IDK A;  3EFF K;  1BHX F;  2FX4 A;  3NWU A;  1SGD E;  3OYP A;  3AE6 C;  1TAL A;  3RMO H;  2QJY B;  1H9H E;  4GCH G;  1KZU B;  2ZAE B;  2KUB A;  1ZP0 C;  2Z4E A;  3AAU A;  4I8G A;  1SQP E;  1K1O A;  1ZMN A;  1VQ8 P;  1FZE A;  2PV9 B;  4IOI H;  4YLQ H;  1O3N A;  2GM4 A;  1GBE A;  1WTH D;  2R3U A;  2H88 C;  3SGQ E;  2RH0 A;  1L0N D;  1AIX H;  5A8Z A;  3A86 A;  4RT0 A;  1SLV B;  3B4S A;  1DD4 A;  3BVH A;  1YPM H;  4WJG 2;  1U7J A;  2KI7 B;  1CE5 A;  3TK9 A;  5EJ1 A;  3LIW A;  2B87 B;  3E3T A;  2FPZ A;  2WPD D;  3H32 B;  3NFQ A;  5L2Y H;  4D6T G;  1YWU A;  1NGM B;  1EJA A;  3BSQ A;  2P58 A;  1O3C A;  1GZL A;  1T8O A;  3SJK A;  3F89 A;  2QXH A;  3CNR A;  4BAN B;  4A1T A;  2E76 C;  1FJP A;  1GHB G;  2K88 A;  2GGV B;  4Q2K A;  1O2J A;  1O2H A;  1X22 A;  1IK9 A;  4PRO A;  2XWB I;  4ZKO U;  3RL0 C;  4HZH A;  2NPS B;  1AVX A;  3M0A A;  3GCO A;  1EQ7 A;  3ZV9 A;  3A7V A;  4MLF B;  2JP3 A;  3AED C;  2ZFQ H;  4TSF D;  4OVN F;  2J94 A;  3HK6 B;  1KQS O;  2D2C C;  3TNT A;  2JJ2 D;  3CLQ A;  4I31 A;  2ODY B;  1OYT H;  4WMF A;  1JRS A;  2KAI A;  1NFX A;  4IL6 H;  1A0H B;  1X7A C;  3H5C B;  4YOG A;  1Y8A A;  1C1N A;  1O2M A;  4XA4 A;  1TFX A;  3AAV A;  2V7Q H;  5KKZ C;  1NTZ G;  2VWN A;  1PPE E;  4TWY A;  4ISH H;  1EOL A;  2M3E A;  4GAW A;  3AEA C;  1AO5 A;  4Q7X A;  4KHX A;  1BMA A;  1MTN B;  1SFC B;  3STJ A;  5EQQ A;  4AYY B;  2GJG A;  1L0L G;  3PRB A;  3MNC A;  3M0D C;  1XKA C;  2H1U A;  3UTU H;  5CE1 A;  4QMA A;  2EQN A;  1K04 A;  1GL1 A;  1THP B;  1KB9 D;  2ZTX A;  3SYJ A;  5CHA C;  3ATL A;  1AQT A;  2V35 A;  5ESB A;  1UTO A;  1P2Q A;  2XXL A;  2N1T D;  3F0P A;  3ZVE A;  1HH0 A;  4RES B;  1K73 Q;  2R5B A;  1VJA U;  2B7D H;  2O8M A;  5DP5 A;  2I1J A;  1NU9 A;  3PO1 B;  3EAJ A;  3H1H D;  1A3B H;  1G2C A;  3RLY H;  1QFK H;  1TPS A;  1LT1 A;  1YYC A;  2FOA A;  2C3S A;  2WV9 A;  2YXQ B;  1GI2 A;  3BG8 A;  3AE1 C;  1OX1 A;  1IFN A;  1MKM A;  3TDK A;  3H1I D;  1GHV H;  4ISI H;  4Y28 J;  1C2H A;  3SQE E;  4WY3 A;  1S6F A;  2BVS H;  1GBH A;  1QRW A;  3SNC A;  1SLW B;  1L0N G;  1SP4 A;  3T97 A;  3L72 E;  1O3D A;  2YXR B;  1RTK A;  1ETT H;  1MQ5 A;  5HM2 A;  1GJA B;  2ASU B;  1C1S A;  1DOJ A;  4BAO B;  2Z9I A;  4HTC H;  5C5O A;  3HRN A;  4ZKR U;  3FKS D;  5CMZ A;  3G01 A;  1C2L A;  1RF0 C;  1G3D A;  5ETX A;  4GSO A;  2P3F H;  3GY8 A;  2VGC B;  3VEQ B;  1DLE A;  1E36 B;  1VQM P;  1OXG A;  1YPE H;  2FYU D;  3BTM E;  1L1N A;  1VQ7 P;  1YPL H;  3RXP A;  5APW A;  4I8H A;  3MTY A;  4TPI Z;  1FY5 A;  1AND A;  1TBZ H;  2XW9 A;  1F92 A;  1A1R A;  1NVO A;  2PKS C;  1J1D C;  1IC2 A;  1WQS A;  3MZW B;  1Y47 A;  1OWE A;  1HPG A;  3QN7 A;  4EIJ A;  2FLR H;  1ZJK A;  1MZ9 A;  1HXF H;  1BGY G;  1DX7 A;  3RML H;  1ZV8 A;  1RD3 B;  2HNT E;  3SNB A;  2FFD A;  3KQC A;  2CHA B;  4NG9 H;  2HG5 D;  1PP9 D;  1WRG A;  1E0F D;  3L71 E;  1E38 B;  3ZVD A;  3URE A;  1FOS E;  1V3X A;  2QXJ A;  3B8J A;  1L2P A;  2J38 A;  2VID A;  3AE5 C;  2V0B A;  3L73 G;  2ZTY A;  5KAI E;  3DT0 H;  1CGJ E;  4U3F D;  1AVO A;  3U8R H;  4FOU C;  4GOE A;  1G30 B;  1KIL E;  2O8W A;  3D49 H;  5T3H A;  1L2E A;  4NPD A;  3O8C A;  3LH3 A;  3SJ9 A;  1O5C B;  1UTJ A;  3D70 A;  3GY7 A;  1LKA A;  2B9L A;  1LCY A;  2KZJ A;  2UUK B;  3KN2 A;  3PV5 A;  4FUH A;  1FNI A;  1O39 A;  3FZZ A;  1QB9 A;  1ZRK A;  2BX3 A;  2XKM A;  1O2N A;  4HH2 A;  1SKY E;  3T26 A;  1HAO H;  1K0H A;  3MO3 A;  4YTP C;  4IFD K;  3A89 A;  1PJP A;  1QR3 E;  1YCP K;  2TGT A;  3JC2 2;  2SNW A;  7KME H;  1HAV B;  1SQQ K;  1YC0 A;  1ZTJ A;  4Z1M D;  1GU4 A;  1FQ3 A;  4OS4 A;  2A45 H;  4ISN A;  3PTZ A;  4CHA C;  3ODD A;  1WU1 A;  3H1I G;  5EPN A;  4X8V H;  1K1J A;  1INC A;  1VIT F;  1HRT H;  1T2K D;  1LTO A;  2C8W B;  5DGJ A;  3WWB A;  3WUV A;  3M36 A;  2ZHF H;  1C9T A;  4Q7Z A;  1TPA E;  2F9V A;  4WH8 A;  2HWL B;  2Y7X A;  1P2O A;  2Y9Y A;  2HRV A;  1JNM A;  1NFY A;  1KLT A;  4Y99 C;  2VVV A;  1M56 D;  4FUC A;  2E76 B;  1BJV A;  2ZFC A;  4YPC A;  1SGT A;  2IYP A;  2R5D A;  3OX7 U;  4F48 B;  3PMH B;  1TRN A;  1UTQ A;  4BAH B;  2XTT B;  3ZIA D;  2OYI B;  1Z56 A;  1V2L T;  1HJ0 A;  1LWU A;  1EX3 A;  1Q81 Q;  2R2W U;  3MIW A;  1P8V C;  1DUE A;  1K1L A;  2GV6 A;  3QLP H;  1C2G A;  1ZPZ A;  4KKD A;  3QH9 A;  3TK5 A;  3L71 J;  2D2C B;  4NIY A;  4WY4 D;  1IQJ A;  2BD5 A;  2BCC E;  2H8P D;  4JYV H;  2ZEB A;  4ACB A;  4A7P A;  1P03 A;  1S4X A;  2OQQ A;  2O3J A;  2QEX P;  1QL2 A;  1TA6 A;  4CBN A;  5KKZ B;  5KLV K;  2ZF0 H;  4UFD H;  1VQP P;  4CRD A;  4HGC A;  4E06 H;  3TJO A;  3HE5 B;  4ZHA A;  1N1L A;  1FIW A;  3AVZ A;  1J2J B;  2BD7 A;  1A4W H;  1LJ2 A;  1PP9 G;  4I1L A;  2W6I D;  1CVW H;  2D26 C;  5AF9 H;  5JPM H;  1N2D C;  1QL8 A;  2XBW A;  3L75 E;  3UPE A;  2RCE A;  5CHA B;  2HNT F;  4TY6 A;  4B76 A;  3U1J B;  1GDT A;  1IQM A;  4LK4 A;  3L74 J;  1EOJ A;  1Y5U T;  2YKP A;  1YJ9 P;  1UTN A;  5HMA A;  2QJK C;  1DPO A;  4EOT A;  3ATM A;  3SJO A;  1IFM A;  2BZA A;  1BRA A;  1K21 H;  1OVV A;  1BRB E;  1O32 A;  2J9N A;  3IR9 A;  1ELB A;  2WV4 A;  3U1A A;  2ZIQ H;  1C2M A;  5APU A;  1EPT A;  3OY6 U;  1HJA B;  3UR6 A;  4I6M C;  2A4Q A;  3L4F A;  4BAK B;  1FY3 A;  4BXW A;  1MCV A;  4ZH8 A;  1GBL A;  3RGU A;  5CHB A;  3RXM A;  1LHG H;  1J14 A;  3S7H B;  3EFG A;  2OLG A;  1A02 F;  1RE3 C;  1X79 B;  5EGM A;  4YO9 A;  4FET A;  1NFU A;  3Q77 A;  4JZE H;  1XVO A;  2BLO A;  3QDZ B;  3IN6 A;  5CJ4 A;  1GL2 D;  2P95 A;  3KEE A;  4XBD A;  1SQB E;  1SFQ B;  2FY8 A;  1KSN A;  2A7J A;  2ZGB H;  1NBM D;  1T4V H;  3PV4 A;  2H9E H;  2BCC J;  1NPM A;  1WYK A;  1OSS A;  2EC9 H;  3B9F H;  2YO3 A;  3UWJ H;  5KED A;  4B2B A;  3F3B A;  1O5A B;  2IOT A;  1HAZ B;  3RK2 C;  4K69 A;  3UQV A;  3ITI A;  1TNK A;  2E74 C;  1F5R A;  1UTK A;  2WSC J;  2G4T A;  1L0Z A;  1AVY A;  1RH5 B;  1GCD A;  2PKS B;  4WY4 B;  4D6T J;  1BA8 B;  3TGU G;  2FZZ A;  1J1D B;  2PKA B;  1LVO A;  9LPR A;  2B89 A;  4YZU A;  4O3U A;  5DSF A;  1AA0 A;  4GLY A;  2Z5I A;  1SQR A;  2H9T H;  3HKI B;  3E7K A;  1D9I A;  3V4W A;  1C4V 2;  1DXW A;  1BTY A;  3OSY A;  1NU7 B;  1DEB A;  4B74 A;  3AEC C;  2R9P A;  1TU3 F;  1VCP A;  2WYG A;  4GPG A;  3KF2 A;  1P2N A;  2OTV A;  1QLE D;  5KAI H;  1ZOY C;  2KR7 A;  1SQQ G;  2W7S A;  3QWO C;  1AWF H;  2Y80 A;  1QGK B;  2A1D B;  2BHG A;  1GVZ A;  2GCT C;  2AEI H;  3GIC B;  4F49 A;  2FYN C;  2Z94 A;  2RG3 A;  3FXD A;  5DP7 A;  1UW7 A;  4MNV A;  1SGF A;  1JMB A;  1SQV K;  2ZYG A;  4IFM A;  1S83 A;  3BG4 C;  4M7G A;  2GTB A;  1XUJ A;  3LT3 A;  1JY2 O;  4ZMD A;  3SZN A;  3AE7 C;  1NTZ J;  1YJW P;  1W13 U;  2IBZ I;  1MD7 A;  1UVU H;  1O3B A;  2FYR A;  1D7M A;  4ASV A;  4DT0 A;  1QB6 A;  3BTF E;  2IBZ E;  3TPI Z;  2F9P A;  2O1J A;  1GI8 B;  5TJH A;  1L0L J;  3HGP A;  3V12 A;  3RK3 E;  1LQD B;  3CCQ P;  1BDA A;  1J8A A;  1LP1 B;  2EEK A;  2XND H;  3ZZ3 A;  1M7L A;  1HUT H;  4Y8Y A;  2ODQ A;  4CHA B;  3MH5 A;  1O3G A;  1KQF B;  1KD1 Q;  2H6M A;  1SQP D;  4ZHM U;  3S9O A;  3SI4 H;  3AK5 A;  5CHX A;  1P3E A;  4DY7 B;  2ZGH A;  3F1S B;  4HFP B;  3RC4 A;  4ASW A;  4ZNC A;  1ZRT E;  2Z6B D;  1UK2 A;  1FDI A;  1Y5A T;  2NU4 E;  1QGF A;  1SLU B;  1UCY E;  5DO4 H;  3RXJ A;  5KLV G;  5F53 A;  1LGH B;  5GPI B;  1MUU A;  2ZFF H;  2PGD A;  1QJ1 B;  1H8A A;  4JBZ A;  1P01 A;  3SUD A;  4BXS A;  1NM6 A;  1AFE H;  3LJJ A;  4FUI A;  4AFU A;  2N1T A;  1O3J A;  5APT A;  2VH6 A;  1VF5 D;  5CJ0 A;  1HBT H;  1VGC C;  2UWL A;  1KLJ H;  1S1C X;  2FXM A;  4M3L A;  1S85 A;  1NRO H;  1HB0 B;  2ZT9 C;  1E37 B;  4KTC A;  2QCY A;  2WSC H;  2Y0D A;  5APY A;  1TRY A;  2IJD 1;  3ZVF A;  1T3J A;  1XVM A;  4AC9 A;  3ZVB A;  1C2J A;  1DIT H;  2ZU3 A;  1WXR A;  3B5N A;  2RMZ A;  3PH0 A;  3TGK E;  2HLO A;  3E0P B;  3OEE D;  2P94 A;  4OWF A;  1YIJ P;  4OS7 A;  3UB0 A;  4R4M A;  3A0H E;  5AVT B;  1WBG B;  1WQV H;  4B71 A;  3SGA E;  2ILN A;  1NTM K;  1QJ7 B;  1TX8 A;  3BEI B;  4W7Y A;  3FX0 A;  4KTU A;  3RP2 A;  1AQ5 A;  1YYY 1;  1M1J A;  3TK6 A;  5CBO A;  3BCC G;  1MD8 A;  2GZ9 A;  3RM0 H;  3RXL A;  4ABE A;  1NES E;  2JH6 D;  1BGY J;  1COW D;  3CME P;  3PMJ A;  3R3G B;  2FYZ A;  4Y0Y E;  4ZAE A;  1DST A;  3PYH A;  8EST E;  1BIT A;  1BCC D;  1LT9 C;  2QJK B;  3G6E P;  1GVK B;  1PPC E;  1F5K U;  1GMC F;  3GCT F;  3RM2 H;  1EC5 A;  1EXF A;  3RC6 A;  3L73 J;  5E2P A;  1D3D B;  3SU6 A;  3A7O A;  3L33 A;  1AE5 A;  1MKW K;  3DSO A;  2J97 A;  3U9A H;  3ZVG A;  1NFW A;  2W3I A;  2P8O C;  1TGT A;  2M3B A;  4D7F A;  3A8D A;  3GDU A;  1C1M A;  3H1K E;  1QQU A;  2NU2 E;  3H1L D;  2VNT A;  2ITA A;  1JCC A;  1NU1 K;  4A7I B;  4DG4 A;  1KMI Z;  5JB9 S;  1LWU C;  5C94 A;  7LPR A;  3GYM A;  1BT7 A;  4X8U H;  4HJG H;  1C5T A;  3ELA H;  1RTF B;  2M5T A;  1GJ8 B;  2E5Y A;  1G36 A;  2QC2 A;  1VQO P;  4I33 A;  2BDB A;  4BAQ B;  5A8Y A;  1K9O E;  1SFI A;  2PFE A;  2KAI B;  3W94 A;  1BB0 B;  2NU0 E;  3L72 D;  1K1N A;  2K1Q A;  1GHZ A;  1SLX B;  2Y6T A;  2BD8 A;  2BY5 X;  1JTH B;  3WY8 A;  1C1W H;  5B6O A;  1AUJ A;  1SQV G;  3RK2 B;  1O5G H;  1VQ6 P;  1Y3W A;  2E74 B;  3M06 A;  3Q2Y A;  4MN4 C;  3PTB A;  3E91 A;  2KK7 A;  1A2C H;  1O3P B;  2PTC E;  3S9A A;  1K9M Q;  2BQ7 B;  2CF9 H;  4I86 A;  4RSP A;  4FXG H;  1SMF E;  4FUD A;  4NWK A;  5E0J A;  4ABF A;  4Y76 A;  5T6F A;  3AW0 A;  3M9B A;  1LTJ A;  1PPJ G;  1V2P T;  3R4Y A;  1GI4 A;  3SV9 A;  1P2M A;  1AZZ A;  3GMA A;  2A2X H;  1OFC X;  1N7S A;  1S3J A;  3G9R A;  1V2M T;  3T29 A;  1FAV A;  1SG8 B;  3A3Y B;  2FI4 E;  2PGB B;  3P17 H;  3P8N A;  2XC4 A;  2EI8 A;  4DZO A;  2Y5F A;  3MO6 A;  1NU1 D;  4TPY A;  2GCT B;  1BZX E;  3TH4 H;  3SWK A;  1BTP A;  2FXR A;  4H42 U;  5EJL A;  2FYN B;  2LNC A;  3EA9 A;  3F68 H;  3L37 A;  5AVR B;  1LPZ B;  5C67 A;  1VQK P;  2VWO A;  3ZVC A;  1MU6 B;  1QL1 A;  3MP7 B;  1ZOM A;  3BG4 B;  2H89 C;  3L70 E;  2EY4 C;  5BPE A;  1O2T A;  5KGO A;  1C5V A;  2UUY A;  1Q31 A;  5EST E;  4WB4 A;  1KXE A;  3VFE A;  1NTK K;  4PD4 E;  4MPW A;  3M7U A;  3TGI E;  3LGT A;  1M90 Q;  1YPG H;  1EZV G;  2L5G B;  3T97 B;  2PRR A;  1SGC A;  1IFD A;  3N7E A;  1SQX K;  2WPK S;  3N7D A;  2OQ5 A;  3UNS A;  4TT3 D;  3KQG A;  4NFE A;  4NZL A;  3SOS A;  1MTN C;  2P16 A;  1VIT G;  2BQ6 B;  1PQ7 A;  3A0B E;  1C1U H;  2CV3 A;  1UCY H;  3MMG A;  2M0B A;  1C5R A;  5AW8 B;  4E7R G;  1BTW A;  5CDF E;  1X9V A;  2KFW A;  1G1J A;  5EFW B;  1F0R A;  3TLO A;  2IDB A;  1G37 A;  1O5B B;  1L4A A;  2ZDM A;  3H1L G;  4WVP E;  2OYH A;  1DH3 A;  1ETS H;  2FWW A;  2Z7F E;  4CRG A;  3AE9 C;  1ELG A;  1YY3 A;  1BOQ A;  1ESB A;  1BE3 G;  3H7T A;  3LC3 A;  1NTM G;  2G3A A;  3Q5P A;  4ABD A;  1LTB C;  1ACB E;  2JH5 D;  4U2W A;  1LTT C;  3BRV B;  4EDF A;  3GHG C;  2GZ7 A;  2PUQ H;  1MTW A;  3KQB A;  1YLC A;  1C5L H;  3T25 A;  3U8T H;  2OAR A;  2AXT E;  3E1I A;  1TBR H;  2FFD B;  2HLD D;  3VMX A;  4E05 H;  5JYI A;  2V6N A;  4U32 A;  1AWH B;  1T3U A;  1SR5 C;  1TNI A;  4Q63 A;  1KYO E;  5AVS B;  2ZT9 B;  2PLX A;  2Y0C A;  2M5A A;  3Q5S A;  1C1P A;  1DWD H;  1CQQ A;  4BRY A;  3SV8 A;  3CI9 A;  4D9Q A;  1C1Q A;  5C39 A;  2IPQ X;  2LEL A;  2IJO B;  2QIQ A;  2I8D A;  1ELF A;  4OH8 B;  5LGO A;  3H6P A;  4U01 A;  4ZHL U;  3UOU A;  2VU8 E;  2ZGX H;  1UHB A;  2WSF H;  4AFZ A;  4ZKS U;  1LKB A;  3BN9 A;  2BCC D;  5DK1 A;  3TGU J;  1P2J A;  1Y5B T;  2JH0 D;  1FS0 E;  1LMW B;  1GL2 A;  1TB6 H;  1YKT A;  2THF B;  3ZYD A;  2FS9 A;  4ABH A;  1PQA A;  1HAH H;  3SN8 A;  1ZLR A;  1QUR H;  1NU1 G;  2G8Y A;  1VQ5 P;  1FI8 A;  2Z9G A;  4JZI A;  1SQB K;  1MKX K;  4XSK U;  1O2L A;  3D6Y A;  1A0L A;  1EAX A;  1SQQ J;  1BBR E;  2QN5 T;  3V2P A;  1Q82 Q;  1YLD A;  3A7W A;  4KGA A;  4XOJ A;  3NUM A;  2WSS D;  1LT9 B;  3GY2 A;  3L75 D;  2XBY A;  5EXN A;  3D65 E;  2KP8 A;  3F9G A;  2POH A;  4F4O C;  2CMY A;  2KYV A;  3DHK H;  1ZTL A;  2FIR H;  3EE0 B;  3RXQ A;  2WPS A;  3RXE A;  3T28 A;  2QF3 A;  3GOV B;  2VWM A;  4BWN A;  1E1R D;  1S0R A;  1YTZ I;  5TCC A;  1IFP A;  2Z9K A;  5AFZ H;  4XRN A;  4BTU B;  1Y3V A;  1VQL P;  1QQ4 A;  1R8E A;  2G81 E;  3P7K A;  1HWT C;  1W2B O;  4R0I A;  2N1T C;  3VMA A;  3G4S P;  1PGQ A;  1O2Q A;  3QZR A;  3HE4 A;  3F9H A;  3TGJ E;  4Y11 E;  1KMH B;  1PPG E;  1LWU B;  5FXL A;  5GJ4 B;  1GDQ A;  3U8O H;  2QXI A;  2GCH F;  5FCR A;  3A7Z A;  1CT0 E;  2ZXX A;  2Z9L A;  3FAO A;  2VJ1 A;  5K7R A;  3K6Y A;  2HPP H;  1Z6J H;  3LGU A;  1IO4 A;  4AG2 A;  2B5T B;  2VRS A;  1JY3 O;  3AE4 C;  3B5N C;  5CCG A;  1TBQ H;  1W0Y H;  2JDI H;  1TQ7 B;  2PTN A;  1QBN A;  4NA7 A;  1SQB D;  3RXA A;  5JBA S;  1QVF O;  2ZDN A;  1EB2 A;  1A5I A;  2AHM E;  2FYQ A;  3CC2 P;  2AGG X;  2ZVN B;  3M5M A;  2A45 I;  4NPE A;  5KLV J;  4O9V A;  1RQV A;  1NTK G;  2WZ7 A;  4B6E A;  1M1J C;  3USS A;  1DXP A;  5H2F E;  1IHS H;  2E75 D;  3CS0 A;  3K6Z A;  4H4F A;  5EOK A;  1MBQ A;  3SHC H;  1G2L A;  3SU2 A;  4A1V A;  5C3N A;  2A4R A;  2OYO A;  2Q6D A;  2KSE A;  4L75 A;  1NH4 A;  4N6J A;  1SQX G;  1GJD B;  1RGQ A;  3Q1M A;  1ELT A;  2Y81 A;  3U1I B;  5FCK A;  1K28 D;  5FPT A;  1BSN A;  2WT7 A;  3SBK A;  1TAB E;  4MQA A;  3RC5 A;  1XUI A;  3FXE A;  3CWB G;  2HLC A;  4BNR A;  2OYI C;  4RKJ B;  1C5M D;  1S9K E;  2WPJ S;  1OYQ A;  3A88 A;  4PD4 H;  1KTM A;  3AW1 A;  2OD3 B;  4FU9 A;  2SNV A;  1HGZ A;  2G55 A;  5E79 E;  1FJS A;  2KS1 B;  4UE7 H;  2KLV A;  4H6T A;  5I46 H;  1PFX C;  1TGB A;  4C7N A;  3IFM A;  3WU2 H;  1NRP H;  1GJ7 B;  4NWL A;  3CCL P;  4DJZ B;  4PJ0 E;  1T31 A;  2OC7 A;  2SGQ E;  4KP0 A;  1NO4 A;  3A0B H;  1P84 E;  1SSX A;  1XM1 A;  4DGJ A;  1JOC A;  4C46 A;  1N7L A;  3BCC J;  2HOD A;  2BDA A;  2BYA X;  2J95 A;  3KGP A;  3P32 A;  2J58 A;  2BDG A;  3K2U A;  3N7O A;  2MJZ A;  3PV2 A;  1TPP A;  2BVR H;  1T8M A;  1TLD A;  1KN7 A;  2UWP A;  3PRD A;  4MNX A;  1T4U H;  1ABI H;  1L4Z A;  3OW2 O;  2UUF B;  4RI0 A;  2IBZ D;  2XNX A;  1HAX B;  3LGI A;  2FYU K;  3RK3 D;  1A0J A;  1O5D H;  3MNS A;  1BTH H;  1E5W A;  3L36 A;  4LLH A;  1VPC A;  2K9J A;  3Q3D A;  3FOA A;  2AXT H;  1JWT A;  4R4L A;  1DD3 A;  1QBO A;  3HPT B;  1HNE E;  1KYO H;  2BQW B;  4VGC C;  4M9F A;  1HJA C;  3M91 A;  5A09 A;  1LTJ C;  1ZRT D;  3GHG B;  2FTM A;  4MPX A;  3B5N D;  1AFO A;  3B8E B;  3CXH E;  1T2K C;  1N7S C;  2C0W A;  4ASU D;  1RF1 A;  2L74 A;  3GY6 A;  2KCP A;  3LOX A;  2Y5H A;  3A2A A;  3MWI U;  4P00 A;  1P05 A;  2XCN A;  1W7G H;  4I8K A;  3VP9 A;  4IGD A;  2W8Z A;  3RXH A;  1GG6 B;  1KYN A;  8KME 2;  4CH8 B;  1W12 U;  4JZD H;  2P2U A;  1W7X H;  1GMH F;  1D6W A;  1Q90 D;  1SQV J;  1FZZ A;  1OWJ A;  4ZKU A;  5AW1 B;  2AEF A;  3OTP A;  1M57 D;  1BMM H;  4CRB A;  1SGF G;  3URC A;  2JWA A;  4X8T H;  2B0F A;  2Q3I A;  4B6F A;  1XUH A;  1WCZ A;  1BBR H;  1MH0 A;  2OP9 A;  5LPF A;  4ZMA H;  1Z8G A;  2V3H H;  3A8C A;  1AQ7 A;  5JBT A;  2Y9Z A;  2P67 A;  4WY4 C;  1IQN A;  1FZB A;  3HUS A;  3KID U;  3PP5 A;  2C90 B;  5APQ A;  4GVU A; 
#chains in the Genus database with same CATH homology
 2OK5 A;  5IK2 D;  2WZQ A;  1NBM D;  5EPY A;  2K0Q A;  3SV7 A;  3RL0 g;  5KLI C;  3SUE A;  2KCY A;  3F3B A;  2K8I A;  2E74 C;  3O6Q A;  2WSC J;  1DY9 A;  3SU0 A;  2QJY C;  5DSF A;  3O8D A;  2J5U A;  3DSP A;  3SV6 A;  1DXW A;  3D6Z A;  4B74 A;  1JB0 J;  3AEC C;  1TU3 F;  3KF2 A;  4OGQ D;  2OBO A;  1ZOY C;  2KR7 A;  1H8E D;  1PIX A;  2FP7 B;  4A92 A;  2FYN C;  2ZT9 D;  3L6P A;  3LKW A;  3SU3 A;  2WSF J;  3SUF A;  3AE7 C;  3FGA D;  1OW6 A;  1FX0 B;  5FPY A;  2F9U A;  5C17 A;  2BEQ D;  3RK3 E;  1MAB B;  2F43 B;  3GLM A;  4H44 B;  3AEE C;  1DY8 A;  2JDI D;  1KQF B;  3AK5 A;  3S9O A;  2CK3 D;  2QE7 D;  3RC4 A;  1ZRT E;  1FDI A;  3OEH D;  5F53 A;  3M5N A;  5GPI B;  1KOR A;  3SUG A;  2KM0 A;  2QF4 A;  1UIX A;  3SUD A;  5H4I B;  1VF5 D;  2P59 A;  2F4L A;  2YMS B;  1GMJ A;  1W0J D;  1S1C X;  2ZT9 C;  4KTC A;  2IJD 1;  5HKK D;  1WXR A;  2JJ1 D;  4OGQ B;  1IK7 A;  3SU5 A;  3OEE D;  3UB0 A;  4R4M A;  3OAA D;  2QF5 A;  1DIP A;  2E75 B;  3FO8 D;  2V7Q D;  3EWK A;  2L6O A;  4PV1 D;  1NBM E;  1VL2 A;  1YQ3 C;  3H09 A;  1COW D;  5T1V A;  3B71 A;  2OC1 A;  4H0L B;  4U7J A;  4WF8 A;  1AJY A;  3RC6 A;  2BEZ F;  3SU6 A;  3DSO A;  2VBC A;  3AE2 C;  3SZE A;  1OW7 A;  1NYH A;  1VF5 C;  3OFN D;  2V7Q J;  3Q5R A;  1KMI Z;  2JO1 A;  2E76 D;  3NRL A;  2MKV A;  2WPV B;  1BT7 A;  3GF3 A;  4KT0 J;  2XOK D;  4I33 A;  5GND A;  4Z1M H;  2K1Q A;  2D2C D;  3VG8 A;  4YXW D;  4I32 A;  4PV1 C;  2E74 B;  1PL5 A;  5IDK A;  3Q2Y A;  2YIU C;  3OYP A;  3AE6 C;  3O8B A;  5EQR A;  3LW5 J;  2QIW A;  4NWK A;  1ZP0 C;  3R4Y A;  2NZ2 A;  3SV9 A;  3GMA A;  4H13 D;  3G9R A;  2H88 C;  3P8N A;  5EQS A;  2FXP A;  3O8R A;  3D71 A;  1DD4 A;  3FN8 A;  2WPD D;  3H25 A;  1NGM B;  3F2G A;  2H89 C;  3AEB C;  2FBW C;  5C0U A;  4A1T A;  2E76 C;  5L8R J;  4A1X A;  2GGV B;  5B6L A;  3AEF C;  1S5L X;  3T97 B;  3N7E A;  3W1E A;  3N7D A;  2KCO A;  2JP3 A;  3AED C;  1JXP A;  4TSF D;  4TT3 D;  2D2C C;  2JJ2 D;  4I31 A;  2YMK A;  2OC0 A;  5CDF E;  2KFW A;  3DCL A;  1HF9 A;  2IDB A;  2OBQ A;  4B73 A;  5KKZ C;  3AE9 C;  3SFD C;  3C8V A;  2G3A A;  3AEA C;  3Q5P A;  4I7Z C;  5EQQ A;  4H13 C;  4GDO A;  3PRB A;  3AE8 C;  4F55 A;  4ZCN A;  1K04 A;  2HLD D;  3SYJ A;  5ESB A;  4IL6 X;  3F0P A;  4Q63 A;  2ZT9 B;  4K8B A;  2O8M A;  3Q5S A;  3EYD A;  3SV8 A;  4R8T B;  1CU1 A;  4WH6 A;  2LEL A;  4I7Z B;  2IJO B;  1W0K D;  2WV9 A;  4OM9 A;  2M2A A;  3AE1 C;  4U01 A;  1W3C A;  1MKM A;  2KCA A;  4Y28 J;  3WW7 A;  1PV3 A;  1H8H D;  2QSI A;  2OIN A;  1OW8 A;  2G8Y A;  3P8O A;  1BMF D;  3FKS D;  3D6Y A;  2W6J D;  5ETX A;  2WSS D;  4H44 D;  3E90 B;  3WWF A;  3SFE C;  1A1R A;  3F2F A;  2OC8 A;  1E1R D;  1VF5 B;  1R8E A;  1KQG B;  1KMH B;  2XNI A;  5GJ4 B;  5FL7 D;  2O01 J;  2A4G A;  2YMS D;  3AE4 C;  3AE5 C;  2P10 A;  1EXJ A;  1KIL E;  2KZ4 A;  1EXI A;  3O8C A;  3AEG C;  4Q4L A;  4PV1 B;  3D70 A;  2AHM E;  3KN2 A;  3M5M A;  3PV5 A;  4XFJ A;  4B6E A;  5DN6 D;  1RQV A;  1DXP A;  1SKY E;  2E75 D;  4TT3 H;  4DT4 A;  3SU2 A;  4A1V A;  4YTP C;  2A4R A;  1OMI A;  4YXD C;  1RGQ A;  3Q1M A;  2YOL A;  4H44 C;  3U1I B;  2WHX A;  4Z1M D;  5FPT A;  4B75 A;  5EPN A;  3RC5 A;  3M5L A;  3WWB A;  1ZME C;  1KTM A;  2QJP C;  4H0L D;  2F9V A;  4WH8 A;  4TYD A;  4NWL A;  2E76 B;  2OC7 A;  3F0O A;  3LON A;  3ZIA D;  2YMS C;  1HJ0 A;  3M5O A;  3F2H A;  3PV2 A;  3KNX A;  2D2C B;  3PRD A;  1RTL A;  3GS9 A;  4RI0 A;  2XND D;  3GF7 A;  4OGQ C;  3SU4 A;  1EFR D;  2OQQ A;  1FDO A;  3SU1 A;  1OHH D;  3Q3D A;  3FOA A;  2E75 C;  2JIZ D;  4R4L A;  2FM2 A;  1N1L A;  1DD3 A;  2E74 D;  2W6I D;  1E79 D;  3AE3 C;  4M9F A;  4H13 B;  1S6L A;  5FPS A;  4ASU D;  2XCF A;  4B76 A;  2KCP A;  4JMY A;  3OE7 D;  3U1J B;  4XD7 D;  3LOX A;  2QJK C;  2XCN A;  1U57 A;  4H0L C;  2WQY C;  3IAO A;  1NS3 A;  5C0T A;  2GVF A;  2A4Q A;  2WSE J;  1Y9B A;  1Q90 D;  1YQ4 C;  3OTP A;  5CHB A;  1E1Q D;  2QV1 A;  1K05 A;  3ABV C;  4RKU J;  2K9Y A;  4B6F A;  4FET A;  1WMK A;  3IN6 A;  5M1B A;  3N99 A;  1RQU A;  2FOM B;  3KEE A;  4B71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...