5E79H

Macromolecular diffractive imaging using imperfect crystals
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 13
structure length 65
sequence length 65
chains with identical sequence h
ec nomenclature
pdb deposition date 2015-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5e79H01
3KZIH 5B5EH 2AXTH 5TISH 5KAFH 3JCUH 4UB8H 3A0BH 5B66H 3WU2H 5KAIH 5GTIH 4PJ0H 4UB6H 4IL6H 5H2FH 5E79H 1S5LH 3A0HH 5GTHH
chains in the Genus database with same CATH superfamily
2G8YA 2YO2A 3L74D 2FYUG 2LXCB 3AE3C 1AVYA 4GT1A 4NPDA 2OARA 3Q3DA 3RL0B 2Y0DA 4Y99B 4IL6X 2NZ2A 1FZGA 2CK3H 5CCGA 1EZVE 1SQQD 1YTZI 1T2KC 1NTMD 3CI9A 3L74E 1S9KD 1JTHB 1L4AC 3D6ZA 1AQTA 4H44D 4L74A 1JY3P 1M1KQ 1IJDB 1SQBG 3PTZA 1ZXGA 2C9NY 1SQQE 3SWFA 1EZVG 1RE3C 2IZ0A 1JTHA 3AEBC 1M90Q 2N9BA 3L74G 1S9KE 1LWUB 3M91A 3V2RA 2KUBA 4A7PA 3V2NA 3B71A 2KSJA 4RO0A 3CCRP 2C9LY 3KHUA 2XU6A 4HH2A 2QE7H 5AVUB 1WRGA 5CBNA 2H88C 3RBZA 2IYPA 1LWUA 1T8ZA 1NTMG 1NKZB 4PV1D 3IN6A 4EYYQ 3L75E 2K88A 3GHGC 2OYIB 1HJBA 2P1JA 4EDFA 5GTIH 4WY4A 1MUUA 3HE4B 2OYOA 1L0LD 2PAJA 2QJKC 1W2BO 2ZXXA 5GTIE 2OYIA 1G1IA 1ZRTD 1L0NK 3RK2D 1LTTC 4U3FD 3M06A 2YKPA 3S9OA 1VDFA 3D70A 3M9QA 2W8ZA 2MJZA 3MP7B 2N1TB 3M0DC 3P8CD 3HE4A 4HB1A 2KP8A 2H89C 3SSUA 4AUWA 3WMM0 2JJLA 1HWTC 1L0LE 2ZT9B 1SQQK 3D6YA 2QJYC 1GD2E 1PIXA 1ZRTE 3RL0g 2N1TA 2FFDC 4U3FE 1Y8AA 3C1LA 3P8CE 4JBZA 2SPZA 3SFEC 3MD0A 3E1RA 1LNQA 2JEEA 3L70J 4C7RA 1AV1A 4WBAA 1NKNA 1L0LG 3CX5D 4YTPC 2O1KA 3PJSK 2WSFH 3H1LG 2PRRA 4JF7A 1SS1A 3B5NB 2BEQD 3CCEP 1RHZB 2C0XA 3NMDA 2E75C 3CX5H 5AW1B 1GL2C 1SQXJ 2AEJA 2M0BA 1N73C 3B5NA 3CX5E 3KYQA 3P8MC 2BEZF 1K9MQ 1VQ8P 2B89A 2E76C 2QSIA 1BCCJ 2GUVA 3MUDC 1FBMA 1JO5A 2XZRA 1AJYA 3MTUE 1KQLA 1VQMP 3H1JJ 3H1KD 4H13D 1NGMB 1FDMA 1EQ7A 4C7NB 1EDKA 1K05A 3AE7C 1N7SD 1E5WA 1KQSO 1HVVA 4C7NA 1E79H 3R4YA 3H1KE 3I56P 3BCCD 1RE4C 2I1JA 1J2JB 4QMAA 3CCMP 2R5DA 2FYUJ 4EI2A 3HD7C 3E7KA 3AE2C 1GK6A 3RK3C 2FYNB 2V4HA 1VQPP 3VN0A 4OGQB 1JY3N 4PD4I 1KYOI 2E43A 3H1KG 3BCCE 3EFGA 5AVTB 4AQRD 4GODA 4C46A 1Q86Q 3OW2O 3FXEA 1L4AB 1IFDA 1QEXA 1KFNA 1SQBJ 5AW2B 1IC2A 5B5EH 3IF4A 2M3BA 1S2EA 1R8EA 2L91A 2BCCD 2KLVA 2B87B 4H0LD 1MKMA 1R5SA 2R3CA 3L74J 4WY4C 1ZLLA 5B5EE 1L4AA 3CXHD 2Q5UA 3MIWA 1LP1B 4YXDC 1W5CE 3GW6A 1Y9BA 1QGKB 2POHA 1GZLA 1YYCA 1KMIZ 1GW3A 2B87A 1SP4A 1W2EA 3CXHH 5DJTB 2Z4EA 3PH0A 1SQQJ 5CHXA 1NTMJ 4XA4A 1NAFA 1LP1A 2JP3A 3CXHE 1JOCA 3T97B 1URQB 5CJ4A 1EXIA 1KILC 4RJTA 3GHGB 2Q3EA 5B66H 1NAYA 2W27A 3RBXA 3CWBD 2NRGA 1SQXD 2BCCG 3AEEC 2QJKB 3T97A 5B66E 1URQA 1MZ9A 2V7QH 3GHGA 2IYOA 1EDJA 3JCUH 4W7ZA 2E74C 1BCCD 1S4XA 2WSEH 3JCUE 1ZW0A 3CWBE 3USSA 1EZVI 1FJPA 1FC2C 2J58A 3F5HA 1LTGC 1KQFB 2QJYB 5APUA 5KAIH 1KFMA 3AECC 3M0DA 2FFDB 1OIPA 1CW5A 2ZXEB 1YITP 5KAIE 3JSVC 1L0LJ 3CWBG 1SQXG 2QM7A 2FFDA 3G6EP 4U3FJ 5AVXB 2D2CD 1BCCG 3O8ZA 4XE5B 2E75B 1GL2B 1FZCC 5M1BA 4W80A 4MN4C 2W90A 3CD6P 1N73B 1KB9D 1PGOA 5AW7B 1JMBA 1YBKA 2BASA 2JKVA 1ZMEC 2FKWB 2YKOA 2H43A 1GL2A 1N7LA 2WSFJ 5APXA 1KB9H 4DJGA 1N73A 2KXPB 5KJ7C 3GMAA 4IL6H 3FGAD 2E42A 1KB9E 3L35A 1S1CX 1R5LA 1BDCA 1N86A 2WZ7A 2FY8A 3VOPA 4KHXA 3CCSP 1L0ND 2XNXA 2W6AA 5AW6B 2FYNC 3ABVC 1RF0C 3TYYA 4OGQC 1OW7A 4K35A 4O9BA 1PV3A 2XV5A 1LGHB 1Q81Q 4ZNCA 2M8RA 4ASVA 5KLIB 1USDA 5KLVE 3H1HD 3HD7B 2R3SA 1L0NE 3RK3B 1ZV8A 5C39A 1PGQA 4IFMA 1GW4A 1RE4A 3H1KJ 1LTBC 1JNMA 4JQ0D 5AVVB 3PHLA 4I7ZC 2QEXP 4GIFA 5AVSB 1LTAC 3HD7A 3MHVA 1ZOYC 2ZYGA 5K5GB 1EXJA 4HYTB 2GA1A 3H1HE 2WWWA 3EQ2A 1KZUB 1S5LH 4L75A 1L0NG 3L75D 4RESB 2OTKE 1G1JA 1OXZA 5AW5B 3AE5C 1KC8Q 4ZKUA 3BCCJ 1QL2A 1S5LE 2FYZA 3CX5I 3EWKA 1RY3A 4R4MA 4WY4B 1SQQG 1DD3A 2RKLA 3H1HG 3HUSC 3R2PA 4PV1C 1VF5D 1URQC 3KZIH 1OMIA 1S5LX 3CLQA 2O3JA 1SFCD 4GOEA 3KZIE 4GDOA 2OTLP 1PP9D 5KLVK 3F89A 4DCKA 1VQ6P 3M9HA 1Y47A 4L76A 1FZBA 3RK2C 1KILB 3HRNA 3L75G 1OVUA 1FDOA 2AEMA 1OVRA 5CBOA 2BCCJ 3U1AA 5AW4B 4JYBA 2KYVA 2W6BA 5APVA 3FXDA 1PP9E 4LGDE 3Q2YA 1IFPA 1AA0A 1KILA 1Q2NA 1YQ4C 2ZJSE 3O6QB 1X9VA 2PP6A 2E74B 3SFDC 3W68A 1BE3D 2Q7CA 3H32B 1Q7YQ 2KNCB 2WPVB 3O6QA 1PP9G 1NTZK 1OX3A 2FXMA 4ZMDA 5H2FH 3VMXA 2K9JB 4DZOA 4U3FG 2V7QJ 5BU8B 3H32A 4UB6E 3CWBJ 2KNCA 4GKGA 1HF9A 1BE3E 5AW3B 5H2FE 1JY2P 5TJHA 2WSEJ 3IFMA 3ITKA 3AE6C 1DEBA 2JWDA 1VQOP 2K9JA 1KN7A 3VP8A 4B86A 1FOSF 1SQPK 3H1IE 3HTKB 1FZCB 1DD4A 2Y9ZA 1BE3G 2M5AA 2NPSD 1IK7A 2E76D 1T6AA 4W7YA 1OWAA 1NYHA 1GK4A 1M56D 4U7JA 3CXHI 2ZVNB 2IZ1A 3BRVB 3HTKA 2YMYA 1FZCA 1N7SC 1LJ2A 2IBZD 3VMZA 3L4FA 1IK9A 5DJUB 1IFJA 3IR9A 2I8DA 1GTWA 1SVFA 2MKVA 2P2UA 5CCHC 2WSCH 1IFNA 3BASA 5CCGD 1Q90D 5KLIC 3RGUA 1YTZT 2IBZE 1PL5A 5KJ7A 2IDBA 1NTKD 3AE8C 3BATA 1HTLC 4N3YB 3RL0D 3W67A 2RN0A 5AVZB 3TK1A 4BWNA 4OH8B 2IPPA 2WTYA 4EOTA 1X8YA 3ZDMA 1D7MA 2WPRA 4N6JA 2KI7B 3WU2H 1EC5A 1RF0A 2IBZG 1N8RQ 2QVAA 1NTKE 3G9RA 4H44B 1NHLA 3WU2E 1TU3F 2J59M 2FXPA 3AEDC 3WUUA 4I7ZB 2AXCA 3BCCG 3GF3A 4UB8H 2XDJA 2WT7B 1LT9B 5KLVJ 4H0LC 3RK3E 2Q3IA 1VPCA 1WMKA 1L0NJ 1GMJA 4UB8E 3H6PA 2QG4A 1H0TB 1FOSE 2WT7A 1JY3O 1LT9A 2KK7A 4WY4D 4Z1MH 5GTHE 1BDDA 3H1HJ 1YIJP 1FZAA 1EDIA 3HUSB 1H89A 3TNUB 4D6TD 4YPCA 4PV1B 4KT0J 5AW8B 1MFZA 3G4SP 1H0TA 3E1IA 2Z5IA 3B8EB 5KTBA 2FXOA 3D71A 1SQVD 3PP5A 1KB9I 2LR2A 1T3UA 3HUSA 2R5BA 3TNUA 4I1LA 5APTA 2K3RA 1NOHA 4D6TE 3L73E 2KZIA 3L75J 1PGPA 2N1TD 3RK2B 1M57D 2GUSA 3A0BH 3CMEP 1NTKK 1HJ0A 2L5GB 2RMZA 2B9BA 2HPCB 3WUVA 1SQVE 3L72D 2YIUC 3NFQA 2ZT9D 2HG5D 3A0BE 2E5YA 1BSHA 1K04A 3CCJP 1ZN5A 1U57A 5KAFH 3BVHA 2QJPC 1J1EC 4WVZA 4D6TG 3PLNA 1ZP0C 3PRJA 1RQVA 2HPCA 2HYNA 5KAFE 1CI6B 4OWFA 3KPEA 1YHQP 4N78D 4XFJA 2IFMA 5AVWB 3L72E 1SQVG 3P7KA 1YJNP 3V4QA 3TSIA 1JY2N 1PP9J 1GU4A 3L36A 3B5ND 3C8VA 1A02F 4GOFA 1IFMA 3SWKA 2R32A 1CI6A 2LXBA 1EDLA 1MFTA 4DT0A 2RH0A 2D2CC 1OW6A 2WPSA 4TLFA 4N78E 1P84D 3CCVP 3AEFC 3L72G 3A2AA 2W83C 3S4RA 1X79B 1PZQA 2WSSH 2WPQA 2QRXA 1KQGB 3U59A 5APSA 3CL3D 1BE3J 1P84E 1VQLP 1HUCA 2Q1KA 1SQVK 1NWQA 3CC7P 3CPWO 3Q5PA 1HH0A 2P10A 4H13B 1FZFA 4TT3H 5KLVD 2WMMA 3CCUP 1ZR4A 1N7SB 1XTGB 3H1IJ 1NH4A 1LTJC 1PFIA 1BGYD 4YXWH 1OW8A 2W6JH 1Q82Q 3I55P 3CCLP 5E79H 1VQ7P 1DIPA 2YXRB 1UIXA 4IFDK 2VRSA 5E79E 1N7SA 1PPJD 5EFWB 4OGQD 2B88A 2ZYAA 1BGYE 3AE1C 4H44C 3UIAA 3KQGA 1SQBE 4WWIA 1AFOA 5CCHA 2Y9YA 2QIWA 3AEGC 2H7HA 5TISH 2KSEA 1T2KD 1GU5A 1LT9C 3VMYA 2XKMA 1NTZD 1RH5B 5KLVG 1L4AD 1PPJE 5TISE 2KIKA 2WSCJ 1VQ5P 2KB7P 1M1JC 2JDIH 3OAKA 1M8OB 1BGYG 1RF1C 4NPFX 4BXLA 2AEFA 1NVOA 4ZKPA 2KOGA 1SLQA 1NTME 2HODB 2OQQA 3HE5B 3VP9A 2FYUK 4H0LB 5KKZC 3L37A 3GLMA 1NTZE 1T3JA 2ITAA 1PPJG 4I2LC 1QVGO 3TGUD 2Q6QA 1NTKJ 3A7OA 1NU1D 3A0HH 1VF5C 2OTJP 2LKMA 4AYCA 1KORA 1QX8A 3V5BA 3V2PA 1SQPD 1K73Q 1YJ9P 1SFCC 2HODA 2YO3A 2A45I 3HE5A 3A0HE 1QL1A 4NPEA 3FWLA 3AE4C 1LTSC 1NJIQ 3EFFK 3FX0A 1URQD 1NTZG 4IFFA 3LW5J 1LT1A 3TGUE 3TDKA 3FWNA 1DEEG 1NU1E 5AW0B 2DW3A 1SQPE 1SQBK 3KXDA 2K9YA 1VQ4P 3G71P 2IX7C 1IO4A 2H8PD 3H1LD 3CC4P 1DH3A 1FZEA 3IAOA 2O01J 2J5UA 2KZJA 4DOJA 4OVNF 5L8RJ 1U7JA 1L2PA 2IBZI 3TGUG 1NU1G 3U1CA 1K8AQ 1SQPG 2YIUB 4K3AA 4HKZH 2I1KA 3H1LE 1NTMK 1RQUA 3L71D 4LLHA 1OFCX 4D6TJ 4EIJA 3Q5RA 2QJPB 1J1EB 3L73J 1KD1Q 4UB6H 2Q9IA 3V6IA 4LC1A 1N2DC 3A5TA 2YMKA 1S3JA 2QM8A 2YKQA 1SQVJ 3H1ID 3Q5SA 1OVVA 3L71E 1X22A 2M5AB 1IFIA 2OYHC 1JCCA 1JMMA 2E75D 3K5BA 1NU1K 1GL2D 3JC22 1H8AA 3VMAA 1FU1A 2D2CB 2A45H 1JUNA 3L72J 2NPSC 2HFED 4H13C 1VQ9P 3L71G 1XTCC 3I5CA 2QA4P 1OZHA 3VTPC 2KS1B 3LIEA 1FE6A 2Z5HA 1X0TA 3H1IG 1L0LK 4ASWA 1VL2A 1FDIA 2IFNA 2HLOA 1J1DC 2A45G 1BSNA 3VYIA 1JEKA 2KS1A 5CCGC 1HBWA 2K37A 2JWAA 5APYA 1DX7A 1LTJB 1M7LA 1HGVA 3QH9A 3RL0C 4Y99C 5CCHD 1IZNB 1Z56A 4WB4A 2Y0EA 2AXTH 3HD7D 3MZWB 3RK3D 4BRYB 2G3AA 1LTJA 1CZQA 4PJ0H 4IOIH 1HGZA 2AXTE 2Y0CA 3MGNA 3OJAB 4PJ0E 2ZFCA 4HJGH 3GF7A 4BRYA 2OGUA 3LW5H 5CJ0A 1LTIC 2A06D 1KTMA 1LWUC 2PFXA 1ZR2A 3N7NA 1BGYJ 1M1JB 4RKUJ 3G3ZA 5GTHH 2ZVOB 1NTKG 1RF1B 5APWA 1VQKP 3II6A 3TF5A 3C9IA 2O01H 1VQNP 1H88A 2P7JA 5KKZB 2A06E 1M1JA 2WITA 1A02J 3AEAC 1FJKA 1RF1A 2O1JA 2OYIC 3L73D 1U7MA 1VF5B 1P84I 1YQ3C 2R44A 4JPZB 3WUTA 1RE3A 2BCCE 3B4SA 1AVOA 1SFCB 2GM4A 5AW9B 3L70D 2E5TA 2HR3A 3AE9C 1NTZJ 2A06G 2YNYA 1KILD 2ZAEB 3CCQP 2K1AA 3OA7A 2N1TC 1SFCA 1KV4A 3Q1MA 2PGDA 3NXSA 1KYOD 4KJMA 4PD4D 5APQA 3L70E 4JYCA 2ZT9C 2ZYDA 5BVZA 4CPGA 2WQYC 3TGUJ 1KILE 2E74D 1NU1J 2N9YB 4PD4H 1KYOH 1CSBA 1SQPJ 2XNDH 3L73G 1QLED 1SQXE 4PD4E 1KYOE 3H1JD 3CMAP 3L70G 5CMZA 2C0WA 1FS0E 3P32A 3B5NC 3N4XA 3H25A 2CPSA 1BCCE 1MV8A 2P58A 1NO4A 3KDPB 1USEA 3M9BA 3V4WA 3A3YB 2M3EA 4Y28J 3CC2P 1UIIA 2JR8A 1GDTA 1PGJA 3H1JE 2YXQB 3H1LJ 2O01N 4I6MC 4L73A 3BRTB 3GG2A 2WVRA 2FYUD 2OYHB 2CPBA 3V2QA 1P84H 2KLUA 2UWJE 4R4LA 3S1KA 1JM0A 1WT6A 1FAVA 1JCDA 3M0AA 3NTNA 3H1JG 1G2CB 2NPSB 3L71J 1QVFO 2E76B 2OYHA 3QWOC 3SWYA 1JY2O 2P67A 2FYUE 1YI2P 4M3LA 1YJWP 5BU5A 5AVRB 1AQ5A 5KJ7D 1G2CA 2JO1A 1SQXK 2NPSA 5AVYB 1SQBD 2FBWC 3MUDA 5AVQB 1J1DB 1JB0J 1EZVD 1S72P 4IL6E 3LIDA
chains in the Genus database with same CATH topology
3KZIH 5B5EH 2AXTH 5TISH 5KAFH 3JCUH 4UB8H 3A0BH 5B66H 3WU2H 5KAIH 5GTIH 4PJ0H 4UB6H 4IL6H 5H2FH 5E79H 1S5LH 3A0HH 5GTHH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI H;  5B5E H;  2AXT H;  5TIS H;  5KAF H;  3JCU H;  4UB8 H;  3A0B H;  5B66 H;  3WU2 H;  5KAI H;  5GTI H;  4PJ0 H;  4UB6 H;  4IL6 H;  5H2F H;  5E79 H;  1S5L H;  3A0H H;  5GTH H; 
#chains in the Genus database with same CATH topology
 2G8Y A;  2YO2 A;  3L74 D;  2FYU G;  2LXC B;  3AE3 C;  1AVY A;  4GT1 A;  4NPD A;  2OAR A;  3Q3D A;  3RL0 B;  2Y0D A;  4Y99 B;  4IL6 X;  2NZ2 A;  1FZG A;  2CK3 H;  5CCG A;  1EZV E;  1SQQ D;  1YTZ I;  1T2K C;  1NTM D;  3CI9 A;  3L74 E;  1S9K D;  1JTH B;  1L4A C;  3D6Z A;  1AQT A;  4H44 D;  4L74 A;  1JY3 P;  1M1K Q;  1IJD B;  1SQB G;  3PTZ A;  1ZXG A;  2C9N Y;  1SQQ E;  3SWF A;  1EZV G;  1RE3 C;  2IZ0 A;  1JTH A;  3AEB C;  1M90 Q;  2N9B A;  3L74 G;  1S9K E;  1LWU B;  3M91 A;  3V2R A;  2KUB A;  4A7P A;  3V2N A;  3B71 A;  2KSJ A;  4RO0 A;  3CCR P;  2C9L Y;  3KHU A;  2XU6 A;  4HH2 A;  2QE7 H;  5AVU B;  1WRG A;  5CBN A;  2H88 C;  3RBZ A;  2IYP A;  1LWU A;  1T8Z A;  1NTM G;  1NKZ B;  4PV1 D;  3IN6 A;  4EYY Q;  3L75 E;  2K88 A;  3GHG C;  2OYI B;  1HJB A;  2P1J A;  4EDF A;  5GTI H;  4WY4 A;  1MUU A;  3HE4 B;  2OYO A;  1L0L D;  2PAJ A;  2QJK C;  1W2B O;  2ZXX A;  5GTI E;  2OYI A;  1G1I A;  1ZRT D;  1L0N K;  3RK2 D;  1LTT C;  4U3F D;  3M06 A;  2YKP A;  3S9O A;  1VDF A;  3D70 A;  3M9Q A;  2W8Z A;  2MJZ A;  3MP7 B;  2N1T B;  3M0D C;  3P8C D;  3HE4 A;  4HB1 A;  2KP8 A;  2H89 C;  3SSU A;  4AUW A;  3WMM 0;  2JJL A;  1HWT C;  1L0L E;  2ZT9 B;  1SQQ K;  3D6Y A;  2QJY C;  1GD2 E;  1PIX A;  1ZRT E;  3RL0 g;  2N1T A;  2FFD C;  4U3F E;  1Y8A A;  3C1L A;  3P8C E;  4JBZ A;  2SPZ A;  3SFE C;  3MD0 A;  3E1R A;  1LNQ A;  2JEE A;  3L70 J;  4C7R A;  1AV1 A;  4WBA A;  1NKN A;  1L0L G;  3CX5 D;  4YTP C;  2O1K A;  3PJS K;  2WSF H;  3H1L G;  2PRR A;  4JF7 A;  1SS1 A;  3B5N B;  2BEQ D;  3CCE P;  1RHZ B;  2C0X A;  3NMD A;  2E75 C;  3CX5 H;  5AW1 B;  1GL2 C;  1SQX J;  2AEJ A;  2M0B A;  1N73 C;  3B5N A;  3CX5 E;  3KYQ A;  3P8M C;  2BEZ F;  1K9M Q;  1VQ8 P;  2B89 A;  2E76 C;  2QSI A;  1BCC J;  2GUV A;  3MUD C;  1FBM A;  1JO5 A;  2XZR A;  1AJY A;  3MTU E;  1KQL A;  1VQM P;  3H1J J;  3H1K D;  4H13 D;  1NGM B;  1FDM A;  1EQ7 A;  4C7N B;  1EDK A;  1K05 A;  3AE7 C;  1N7S D;  1E5W A;  1KQS O;  1HVV A;  4C7N A;  1E79 H;  3R4Y A;  3H1K E;  3I56 P;  3BCC D;  1RE4 C;  2I1J A;  1J2J B;  4QMA A;  3CCM P;  2R5D A;  2FYU J;  4EI2 A;  3HD7 C;  3E7K A;  3AE2 C;  1GK6 A;  3RK3 C;  2FYN B;  2V4H A;  1VQP P;  3VN0 A;  4OGQ B;  1JY3 N;  4PD4 I;  1KYO I;  2E43 A;  3H1K G;  3BCC E;  3EFG A;  5AVT B;  4AQR D;  4GOD A;  4C46 A;  1Q86 Q;  3OW2 O;  3FXE A;  1L4A B;  1IFD A;  1QEX A;  1KFN A;  1SQB J;  5AW2 B;  1IC2 A;  5B5E H;  3IF4 A;  2M3B A;  1S2E A;  1R8E A;  2L91 A;  2BCC D;  2KLV A;  2B87 B;  4H0L D;  1MKM A;  1R5S A;  2R3C A;  3L74 J;  4WY4 C;  1ZLL A;  5B5E E;  1L4A A;  3CXH D;  2Q5U A;  3MIW A;  1LP1 B;  4YXD C;  1W5C E;  3GW6 A;  1Y9B A;  1QGK B;  2POH A;  1GZL A;  1YYC A;  1KMI Z;  1GW3 A;  2B87 A;  1SP4 A;  1W2E A;  3CXH H;  5DJT B;  2Z4E A;  3PH0 A;  1SQQ J;  5CHX A;  1NTM J;  4XA4 A;  1NAF A;  1LP1 A;  2JP3 A;  3CXH E;  1JOC A;  3T97 B;  1URQ B;  5CJ4 A;  1EXI A;  1KIL C;  4RJT A;  3GHG B;  2Q3E A;  5B66 H;  1NAY A;  2W27 A;  3RBX A;  3CWB D;  2NRG A;  1SQX D;  2BCC G;  3AEE C;  2QJK B;  3T97 A;  5B66 E;  1URQ A;  1MZ9 A;  2V7Q H;  3GHG A;  2IYO A;  1EDJ A;  3JCU H;  4W7Z A;  2E74 C;  1BCC D;  1S4X A;  2WSE H;  3JCU E;  1ZW0 A;  3CWB E;  3USS A;  1EZV I;  1FJP A;  1FC2 C;  2J58 A;  3F5H A;  1LTG C;  1KQF B;  2QJY B;  5APU A;  5KAI H;  1KFM A;  3AEC C;  3M0D A;  2FFD B;  1OIP A;  1CW5 A;  2ZXE B;  1YIT P;  5KAI E;  3JSV C;  1L0L J;  3CWB G;  1SQX G;  2QM7 A;  2FFD A;  3G6E P;  4U3F J;  5AVX B;  2D2C D;  1BCC G;  3O8Z A;  4XE5 B;  2E75 B;  1GL2 B;  1FZC C;  5M1B A;  4W80 A;  4MN4 C;  2W90 A;  3CD6 P;  1N73 B;  1KB9 D;  1PGO A;  5AW7 B;  1JMB A;  1YBK A;  2BAS A;  2JKV A;  1ZME C;  2FKW B;  2YKO A;  2H43 A;  1GL2 A;  1N7L A;  2WSF J;  5APX A;  1KB9 H;  4DJG A;  1N73 A;  2KXP B;  5KJ7 C;  3GMA A;  4IL6 H;  3FGA D;  2E42 A;  1KB9 E;  3L35 A;  1S1C X;  1R5L A;  1BDC A;  1N86 A;  2WZ7 A;  2FY8 A;  3VOP A;  4KHX A;  3CCS P;  1L0N D;  2XNX A;  2W6A A;  5AW6 B;  2FYN C;  3ABV C;  1RF0 C;  3TYY A;  4OGQ C;  1OW7 A;  4K35 A;  4O9B A;  1PV3 A;  2XV5 A;  1LGH B;  1Q81 Q;  4ZNC A;  2M8R A;  4ASV A;  5KLI B;  1USD A;  5KLV E;  3H1H D;  3HD7 B;  2R3S A;  1L0N E;  3RK3 B;  1ZV8 A;  5C39 A;  1PGQ A;  4IFM A;  1GW4 A;  1RE4 A;  3H1K J;  1LTB C;  1JNM A;  4JQ0 D;  5AVV B;  3PHL A;  4I7Z C;  2QEX P;  4GIF A;  5AVS B;  1LTA C;  3HD7 A;  3MHV A;  1ZOY C;  2ZYG A;  5K5G B;  1EXJ A;  4HYT B;  2GA1 A;  3H1H E;  2WWW A;  3EQ2 A;  1KZU B;  1S5L H;  4L75 A;  1L0N G;  3L75 D;  4RES B;  2OTK E;  1G1J A;  1OXZ A;  5AW5 B;  3AE5 C;  1KC8 Q;  4ZKU A;  3BCC J;  1QL2 A;  1S5L E;  2FYZ A;  3CX5 I;  3EWK A;  1RY3 A;  4R4M A;  4WY4 B;  1SQQ G;  1DD3 A;  2RKL A;  3H1H G;  3HUS C;  3R2P A;  4PV1 C;  1VF5 D;  1URQ C;  3KZI H;  1OMI A;  1S5L X;  3CLQ A;  2O3J A;  1SFC D;  4GOE A;  3KZI E;  4GDO A;  2OTL P;  1PP9 D;  5KLV K;  3F89 A;  4DCK A;  1VQ6 P;  3M9H A;  1Y47 A;  4L76 A;  1FZB A;  3RK2 C;  1KIL B;  3HRN A;  3L75 G;  1OVU A;  1FDO A;  2AEM A;  1OVR A;  5CBO A;  2BCC J;  3U1A A;  5AW4 B;  4JYB A;  2KYV A;  2W6B A;  5APV A;  3FXD A;  1PP9 E;  4LGD E;  3Q2Y A;  1IFP A;  1AA0 A;  1KIL A;  1Q2N A;  1YQ4 C;  2ZJS E;  3O6Q B;  1X9V A;  2PP6 A;  2E74 B;  3SFD C;  3W68 A;  1BE3 D;  2Q7C A;  3H32 B;  1Q7Y Q;  2KNC B;  2WPV B;  3O6Q A;  1PP9 G;  1NTZ K;  1OX3 A;  2FXM A;  4ZMD A;  5H2F H;  3VMX A;  2K9J B;  4DZO A;  4U3F G;  2V7Q J;  5BU8 B;  3H32 A;  4UB6 E;  3CWB J;  2KNC A;  4GKG A;  1HF9 A;  1BE3 E;  5AW3 B;  5H2F E;  1JY2 P;  5TJH A;  2WSE J;  3IFM A;  3ITK A;  3AE6 C;  1DEB A;  2JWD A;  1VQO P;  2K9J A;  1KN7 A;  3VP8 A;  4B86 A;  1FOS F;  1SQP K;  3H1I E;  3HTK B;  1FZC B;  1DD4 A;  2Y9Z A;  1BE3 G;  2M5A A;  2NPS D;  1IK7 A;  2E76 D;  1T6A A;  4W7Y A;  1OWA A;  1NYH A;  1GK4 A;  1M56 D;  4U7J A;  3CXH I;  2ZVN B;  2IZ1 A;  3BRV B;  3HTK A;  2YMY A;  1FZC A;  1N7S C;  1LJ2 A;  2IBZ D;  3VMZ A;  3L4F A;  1IK9 A;  5DJU B;  1IFJ A;  3IR9 A;  2I8D A;  1GTW A;  1SVF A;  2MKV A;  2P2U A;  5CCH C;  2WSC H;  1IFN A;  3BAS A;  5CCG D;  1Q90 D;  5KLI C;  3RGU A;  1YTZ T;  2IBZ E;  1PL5 A;  5KJ7 A;  2IDB A;  1NTK D;  3AE8 C;  3BAT A;  1HTL C;  4N3Y B;  3RL0 D;  3W67 A;  2RN0 A;  5AVZ B;  3TK1 A;  4BWN A;  4OH8 B;  2IPP A;  2WTY A;  4EOT A;  1X8Y A;  3ZDM A;  1D7M A;  2WPR A;  4N6J A;  2KI7 B;  3WU2 H;  1EC5 A;  1RF0 A;  2IBZ G;  1N8R Q;  2QVA A;  1NTK E;  3G9R A;  4H44 B;  1NHL A;  3WU2 E;  1TU3 F;  2J59 M;  2FXP A;  3AED C;  3WUU A;  4I7Z B;  2AXC A;  3BCC G;  3GF3 A;  4UB8 H;  2XDJ A;  2WT7 B;  1LT9 B;  5KLV J;  4H0L C;  3RK3 E;  2Q3I A;  1VPC A;  1WMK A;  1L0N J;  1GMJ A;  4UB8 E;  3H6P A;  2QG4 A;  1H0T B;  1FOS E;  2WT7 A;  1JY3 O;  1LT9 A;  2KK7 A;  4WY4 D;  4Z1M H;  5GTH E;  1BDD A;  3H1H J;  1YIJ P;  1FZA A;  1EDI A;  3HUS B;  1H89 A;  3TNU B;  4D6T D;  4YPC A;  4PV1 B;  4KT0 J;  5AW8 B;  1MFZ A;  3G4S P;  1H0T A;  3E1I A;  2Z5I A;  3B8E B;  5KTB A;  2FXO A;  3D71 A;  1SQV D;  3PP5 A;  1KB9 I;  2LR2 A;  1T3U A;  3HUS A;  2R5B A;  3TNU A;  4I1L A;  5APT A;  2K3R A;  1NOH A;  4D6T E;  3L73 E;  2KZI A;  3L75 J;  1PGP A;  2N1T D;  3RK2 B;  1M57 D;  2GUS A;  3A0B H;  3CME P;  1NTK K;  1HJ0 A;  2L5G B;  2RMZ A;  2B9B A;  2HPC B;  3WUV A;  1SQV E;  3L72 D;  2YIU C;  3NFQ A;  2ZT9 D;  2HG5 D;  3A0B E;  2E5Y A;  1BSH A;  1K04 A;  3CCJ P;  1ZN5 A;  1U57 A;  5KAF H;  3BVH A;  2QJP C;  1J1E C;  4WVZ A;  4D6T G;  3PLN A;  1ZP0 C;  3PRJ A;  1RQV A;  2HPC A;  2HYN A;  5KAF E;  1CI6 B;  4OWF A;  3KPE A;  1YHQ P;  4N78 D;  4XFJ A;  2IFM A;  5AVW B;  3L72 E;  1SQV G;  3P7K A;  1YJN P;  3V4Q A;  3TSI A;  1JY2 N;  1PP9 J;  1GU4 A;  3L36 A;  3B5N D;  3C8V A;  1A02 F;  4GOF A;  1IFM A;  3SWK A;  2R32 A;  1CI6 A;  2LXB A;  1EDL A;  1MFT A;  4DT0 A;  2RH0 A;  2D2C C;  1OW6 A;  2WPS A;  4TLF A;  4N78 E;  1P84 D;  3CCV P;  3AEF C;  3L72 G;  3A2A A;  2W83 C;  3S4R A;  1X79 B;  1PZQ A;  2WSS H;  2WPQ A;  2QRX A;  1KQG B;  3U59 A;  5APS A;  3CL3 D;  1BE3 J;  1P84 E;  1VQL P;  1HUC A;  2Q1K A;  1SQV K;  1NWQ A;  3CC7 P;  3CPW O;  3Q5P A;  1HH0 A;  2P10 A;  4H13 B;  1FZF A;  4TT3 H;  5KLV D;  2WMM A;  3CCU P;  1ZR4 A;  1N7S B;  1XTG B;  3H1I J;  1NH4 A;  1LTJ C;  1PFI A;  1BGY D;  4YXW H;  1OW8 A;  2W6J H;  1Q82 Q;  3I55 P;  3CCL P;  5E79 H;  1VQ7 P;  1DIP A;  2YXR B;  1UIX A;  4IFD K;  2VRS A;  5E79 E;  1N7S A;  1PPJ D;  5EFW B;  4OGQ D;  2B88 A;  2ZYA A;  1BGY E;  3AE1 C;  4H44 C;  3UIA A;  3KQG A;  1SQB E;  4WWI A;  1AFO A;  5CCH A;  2Y9Y A;  2QIW A;  3AEG C;  2H7H A;  5TIS H;  2KSE A;  1T2K D;  1GU5 A;  1LT9 C;  3VMY A;  2XKM A;  1NTZ D;  1RH5 B;  5KLV G;  1L4A D;  1PPJ E;  5TIS E;  2KIK A;  2WSC J;  1VQ5 P;  2KB7 P;  1M1J C;  2JDI H;  3OAK A;  1M8O B;  1BGY G;  1RF1 C;  4NPF X;  4BXL A;  2AEF A;  1NVO A;  4ZKP A;  2KOG A;  1SLQ A;  1NTM E;  2HOD B;  2OQQ A;  3HE5 B;  3VP9 A;  2FYU K;  4H0L B;  5KKZ C;  3L37 A;  3GLM A;  1NTZ E;  1T3J A;  2ITA A;  1PPJ G;  4I2L C;  1QVG O;  3TGU D;  2Q6Q A;  1NTK J;  3A7O A;  1NU1 D;  3A0H H;  1VF5 C;  2OTJ P;  2LKM A;  4AYC A;  1KOR A;  1QX8 A;  3V5B A;  3V2P A;  1SQP D;  1K73 Q;  1YJ9 P;  1SFC C;  2HOD A;  2YO3 A;  2A45 I;  3HE5 A;  3A0H E;  1QL1 A;  4NPE A;  3FWL A;  3AE4 C;  1LTS C;  1NJI Q;  3EFF K;  3FX0 A;  1URQ D;  1NTZ G;  4IFF A;  3LW5 J;  1LT1 A;  3TGU E;  3TDK A;  3FWN A;  1DEE G;  1NU1 E;  5AW0 B;  2DW3 A;  1SQP E;  1SQB K;  3KXD A;  2K9Y A;  1VQ4 P;  3G71 P;  2IX7 C;  1IO4 A;  2H8P D;  3H1L D;  3CC4 P;  1DH3 A;  1FZE A;  3IAO A;  2O01 J;  2J5U A;  2KZJ A;  4DOJ A;  4OVN F;  5L8R J;  1U7J A;  1L2P A;  2IBZ I;  3TGU G;  1NU1 G;  3U1C A;  1K8A Q;  1SQP G;  2YIU B;  4K3A A;  4HKZ H;  2I1K A;  3H1L E;  1NTM K;  1RQU A;  3L71 D;  4LLH A;  1OFC X;  4D6T J;  4EIJ A;  3Q5R A;  2QJP B;  1J1E B;  3L73 J;  1KD1 Q;  4UB6 H;  2Q9I A;  3V6I A;  4LC1 A;  1N2D C;  3A5T A;  2YMK A;  1S3J A;  2QM8 A;  2YKQ A;  1SQV J;  3H1I D;  3Q5S A;  1OVV A;  3L71 E;  1X22 A;  2M5A B;  1IFI A;  2OYH C;  1JCC A;  1JMM A;  2E75 D;  3K5B A;  1NU1 K;  1GL2 D;  3JC2 2;  1H8A A;  3VMA A;  1FU1 A;  2D2C B;  2A45 H;  1JUN A;  3L72 J;  2NPS C;  2HFE D;  4H13 C;  1VQ9 P;  3L71 G;  1XTC C;  3I5C A;  2QA4 P;  1OZH A;  3VTP C;  2KS1 B;  3LIE A;  1FE6 A;  2Z5H A;  1X0T A;  3H1I G;  1L0L K;  4ASW A;  1VL2 A;  1FDI A;  2IFN A;  2HLO A;  1J1D C;  2A45 G;  1BSN A;  3VYI A;  1JEK A;  2KS1 A;  5CCG C;  1HBW A;  2K37 A;  2JWA A;  5APY A;  1DX7 A;  1LTJ B;  1M7L A;  1HGV A;  3QH9 A;  3RL0 C;  4Y99 C;  5CCH D;  1IZN B;  1Z56 A;  4WB4 A;  2Y0E A;  2AXT H;  3HD7 D;  3MZW B;  3RK3 D;  4BRY B;  2G3A A;  1LTJ A;  1CZQ A;  4PJ0 H;  4IOI H;  1HGZ A;  2AXT E;  2Y0C A;  3MGN A;  3OJA B;  4PJ0 E;  2ZFC A;  4HJG H;  3GF7 A;  4BRY A;  2OGU A;  3LW5 H;  5CJ0 A;  1LTI C;  2A06 D;  1KTM A;  1LWU C;  2PFX A;  1ZR2 A;  3N7N A;  1BGY J;  1M1J B;  4RKU J;  3G3Z A;  5GTH H;  2ZVO B;  1NTK G;  1RF1 B;  5APW A;  1VQK P;  3II6 A;  3TF5 A;  3C9I A;  2O01 H;  1VQN P;  1H88 A;  2P7J A;  5KKZ B;  2A06 E;  1M1J A;  2WIT A;  1A02 J;  3AEA C;  1FJK A;  1RF1 A;  2O1J A;  2OYI C;  3L73 D;  1U7M A;  1VF5 B;  1P84 I;  1YQ3 C;  2R44 A;  4JPZ B;  3WUT A;  1RE3 A;  2BCC E;  3B4S A;  1AVO A;  1SFC B;  2GM4 A;  5AW9 B;  3L70 D;  2E5T A;  2HR3 A;  3AE9 C;  1NTZ J;  2A06 G;  2YNY A;  1KIL D;  2ZAE B;  3CCQ P;  2K1A A;  3OA7 A;  2N1T C;  1SFC A;  1KV4 A;  3Q1M A;  2PGD A;  3NXS A;  1KYO D;  4KJM A;  4PD4 D;  5APQ A;  3L70 E;  4JYC A;  2ZT9 C;  2ZYD A;  5BVZ A;  4CPG A;  2WQY C;  3TGU J;  1KIL E;  2E74 D;  1NU1 J;  2N9Y B;  4PD4 H;  1KYO H;  1CSB A;  1SQP J;  2XND H;  3L73 G;  1QLE D;  1SQX E;  4PD4 E;  1KYO E;  3H1J D;  3CMA P;  3L70 G;  5CMZ A;  2C0W A;  1FS0 E;  3P32 A;  3B5N C;  3N4X A;  3H25 A;  2CPS A;  1BCC E;  1MV8 A;  2P58 A;  1NO4 A;  3KDP B;  1USE A;  3M9B A;  3V4W A;  3A3Y B;  2M3E A;  4Y28 J;  3CC2 P;  1UII A;  2JR8 A;  1GDT A;  1PGJ A;  3H1J E;  2YXQ B;  3H1L J;  2O01 N;  4I6M C;  4L73 A;  3BRT B;  3GG2 A;  2WVR A;  2FYU D;  2OYH B;  2CPB A;  3V2Q A;  1P84 H;  2KLU A;  2UWJ E;  4R4L A;  3S1K A;  1JM0 A;  1WT6 A;  1FAV A;  1JCD A;  3M0A A;  3NTN A;  3H1J G;  1G2C B;  2NPS B;  3L71 J;  1QVF O;  2E76 B;  2OYH A;  3QWO C;  3SWY A;  1JY2 O;  2P67 A;  2FYU E;  1YI2 P;  4M3L A;  1YJW P;  5BU5 A;  5AVR B;  1AQ5 A;  5KJ7 D;  1G2C A;  2JO1 A;  1SQX K;  2NPS A;  5AVY B;  1SQB D;  2FBW C;  3MUD A;  5AVQ B;  1J1D B;  1JB0 J;  1EZV D;  1S72 P;  4IL6 E;  3LID A; 
#chains in the Genus database with same CATH homology
 3KZI H;  5B5E H;  2AXT H;  5TIS H;  5KAF H;  3JCU H;  4UB8 H;  3A0B H;  5B66 H;  3WU2 H;  5KAI H;  5GTI H;  4PJ0 H;  4UB6 H;  4IL6 H;  5H2F H;  5E79 H;  1S5L H;  3A0H H;  5GTH H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...