5E79H

Macromolecular diffractive imaging using imperfect crystals
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
publication title Macromolecular diffractive imaging using imperfect crystals.
pubmed doi rcsb
total genus 13
structure length 65
sequence length 65
chains with identical sequence h
ec nomenclature
pdb deposition date 2015-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5e79H01
4PJ0H 4UB6H 5KAIH 5H2FH 2AXTH 3A0BH 3JCUH 3A0HH 3KZIH 4UB8H 1S5LH 4IL6H 5B5EH 5TISH 5GTIH 5B66H 5E79H 5GTHH 5KAFH 3WU2H
chains in the Genus database with same CATH superfamily
1T8ZA 5AW8B 1Q90D 1W2BO 3CX5I 3M9HA 4JYCA 3PLNA 2WPQA 3U1CA 5AVRB 3CL3D 4K3AA 5KAFH 2IDBA 1DD4A 2JDIH 1GW4A 3B8EB 2E74B 4XA4A 1LTBC 1YJ9P 1R5LA 2WSEH 3L75J 2G8YA 2OARA 1PP9E 3TF5A 1R5SA 1NTMK 2R3CA 3CD6P 1GK4A 4O9BA 4W80A 3A0BE 1ZRTE 3H1IJ 5AW7B 1LTJC 1LT9C 1A02J 4KT0J 1EDLA 3L75G 1RQUA 1SQPD 1EQ7A 2FXPA 4NPFX 2WSCJ 1PL5A 1FU1A 3L70E 1EZVG 1JTHA 2BCCD 3H1IG 3L74D 1LTJA 1LT9A 2R5DA 1T2KC 1T2KD 3TYYA 4N78E 2M0BA 3RBXA 2LXBA 1FZGA 2CK3H 2H7HA 1EC5A 2WSFH 2Q3EA 2GA1A 2C0WA 2KI7B 5KLVD 4HH2A 1L0NE 5AVUB 3H1JE 5TISE 2IBZG 3L72E 2P10A 1SQBE 2QJPB 1IC2A 3GW6A 2R32A 2FYUE 5AVVB 5AW2B 3KDPB 1ZR4A 3RL0B 5AW5B 4H0LB 3EFGA 3WU2E 1OW6A 2W83C 1VQLP 4M3LA 1MZ9A 5AW6B 3H1KG 3SSUA 1ZOYC 2N9YB 1S5LX 1JUNA 2O1KA 1M8OB 4YXDC 4AUWA 3JCUH 2QJYB 1NTKE 4PJ0E 3TGUE 1NOHA 2Y9YA 4OH8B 1JY2O 1NU1E 1L0LD 2RKLA 3BVHA 2FYNC 1PPJD 1HGZA 1BCCJ 1G2CB 1EXIA 2ZT9B 2ZXXA 4Y99C 2ZXEB 5CMZA 1OIPA 2PAJA 1QEXA 1LWUC 2M8RA 1LNQA 1GW3A 5AW1B 3CCJP 3H1HE 4UB6E 5BU5A 3II6A 2HODA 3L4FA 2P1JA 2O01H 1M57D 2YIUC 1IFMA 1FZCC 1PGOA 4A7PA 5AVYB 1SQXJ 2WQYC 1J1DC 1GL2B 1GDTA 2R44A 2HYNA 2AXTH 3AECC 1LWUA 1SQQD 3V6IA 1SQVK 2M5AA 1GTWA 1VQ7P 2PGDA 1BE3D 1U7JA 2A06E 3TNUB 1SQXK 1SQVG 2V7QH 1G1IA 1KB9E 1SQXG 3VMYA 1K04A 3M9QA 3CCVP 4BRYA 3HE4B 2GUVA 3AE2C 2HPCB 2Z5IA 3KZIE 1AQTA 1URQC 2L5GB 1URQD 4HKZH 1NH4A 5APWA 4C46A 3V5BA 2JP3A 4DCKA 2Z4EA 1S9KE 2JR8A 1PP9G 3VP8A 3VMAA 1H0TB 3JSVC 1PGQA 3CC2P 1URQA 1LT1A 2WMMA 3L70J 1NTZD 1SP4A 1GMJA 3M91A 2LR2A 2FXMA 2IX7C 1AQ5A 1H88A 1N7SC 3L73D 1N7SD 4GOFA 1HGVA 1NTME 3H1LE 3P8CD 1OVRA 2A45I 2E5YA 1RF0C 3IR9A 2QJKB 3L70G 1N86A 1L0NJ 3H1JJ 2IZ0A 1RY3A 4H13C 3L72J 4IFMA 4H13D 5APUA 3MTUE 1VQMP 3S4RA 1SQBJ 1EZVE 1N7SA 3HUSB 2FYUJ 3JC22 2XDJA 4WB4A 3EWKA 1ZLLA 1RF0A 5KKZB 1KN7A 2HR3A 1L0NG 4D6TD 3CWBD 3L72G 3Q5RA 2FYUK 4XE5B 4DOJA 1SQBG 4JBZA 1ZXGA 1OVUA 2BEZF 3D6ZA 3HTKA 1YQ4C 2FYUG 4ZKPA 1M1JB 1FS0E 3L74E 2JEEA 1XTCC 5EFWB 1NTKJ 3TGUJ 4I7ZB 3SWFA 1VPCA 3JCUE 5E79H 4GODA 3A0HE 1NVOA 5APTA 2J59M 2H8PD 1X79B 1NU1J 1NTKK 3H1KE 3VMXA 3TK1A 1IK9A 4PV1B 2H43A 3MGNA 2AEMA 1NTKG 1NAFA 3TGUG 2NPSC 1KMIZ 1OW7A 1NU1K 2NPSD 3Q5SA 2FBWC 1JTHB 1QX8A 5APQA 1Y9BA 1CI6A 1NU1G 1SFCC 1SFCD 1KILC 1KILD 2I1KA 3LW5J 3M06A 1JCDA 1X8YA 5AW9B 5APVA 1VQ5P 3H1HJ 1W5CE 3SFDC 3TDKA 2ZYGA 2M3EA 2NPSA 3AEBC 1PIXA 3A5TA 1PV3A 2V4HA 3KXDA 1W2EA 3W68A 1SFCA 2XU6A 1KILA 2E76C 3H1HG 2OYOA 1ZV8A 1K73Q 4JQ0D 2XNDH 3S9OA 1USEA 3GHGC 1JY3P 3FXDA 4I6MC 2FKWB 1OWAA 3AE6C 2KYVA 5CHXA 2YKOA 3D6YA 2A06G 3GF3A 1S1CX 1S5LE 2N1TC 2N1TD 1VQNP 3B5NC 3GHGA 3B5ND 1U7MA 3L71D 3I55P 5BU8B 3MD0A 2CPSA 2KSEA 2YKPA 2OYHC 1SQVE 5B5EH 3BCCE 3WUVA 5GTIH 5KTBA 3A2AA 3CMAP 3IF4A 3MHVA 2JKVA 4YXWH 3AE8C 1BGYD 1MV8A 2G3AA 3HE5A 1NGMB 3O6QB 2N1TA 1YIJP 3B5NA 1SQQE 1N2DC 3HD7D 1QL2A 2OYHA 2ITAA 1P84E 1DD3A 1NTMJ 3H1LJ 4L74A 1QVGO 4EYYQ 2KLVA 3CCQP 4WY4B 2FYNB 1RE4C 3PHLA 2J5UA 3CX5E 3HD7A 4LC1A 3L75D 3OAKA 1LTSC 2B88A 4Y99B 5CBNA 1NTMG 3H1LG 3VYIA 3SWYA 2OGUA 2ZVNB 3QWOC 4U7JA 4W7YA 1LWUB 3WUTA 2WT7A 2M5AB 1VF5C 1VF5D 1RE4A 3H1ID 3L35A 1M1KQ 4ASWA 3G9RA 1OXZA 3L36A 1AJYA 1FZCB 3CMEP 3C1LA 1NTZE 3V4QA 3OW2O 1KFMA 3KHUA 4BRYB 1SQPK 2O01N 4R4LA 1FJKA 4WBAA 1YTZI 3R2PA 1MFTA 2IBZD 5B66H 2Q9IA 1DEBA 3P8CE 2P7JA 2DW3A 4KHXA 5AVXB 3H1KJ 5KAIE 3NTNA 2KOGA 3L74G 2Q5UA 1VDFA 2O1JA 1M56D 2W6BA 2A45H 2WTYA 1URQB 4GKGA 1ZW0A 2ZYDA 1H89A 1QGKB 3G3ZA 4RJTA 2D2CC 2D2CD 2KZIA 1KYOI 1TU3F 4U3FE 2WSCH 2Y0EA 2KSJA 3V2PA 3CLQA 2W90A 1VQ4P 2B87A 3AE1C 1J1EB 1HH0A 3F5HA 1KORA 1JY2P 1OVVA 3LIDA 3RGUA 4WWIA 1T3UA 1FOSF 1OX3A 2H89C 2KS1B 4IFDK 1GK6A 2E74C 2CPBA 2E74D 4HB1A 4C7NA 3H32B 1L0LK 1UIXA 2FFDC 3HTKB 1Z56A 2YXQB 3FXEA 1OMIA 2KUBA 1BCCD 3ITKA 5AVSB 3W67A 1PFIA 4JF7A 3AEFC 1FE6A 1VQOP 4YTPC 1SQVJ 1YITP 1YYCA 3Q1MA 5GTHH 3BCCJ 2PFXA 1RF1B 4ASVA 5B5EE 2BASA 2FFDA 4PD4D 3MP7B 5M1BA 4H44C 4H44D 2OQQA 1J2JB 1IFIA 2Q1KA 4UB8H 3WUUA 1DH3A 4JPZB 3PH0A 2K3RA 3MZWB 3HRNA 3U59A 4GOEA 3BCCG 2WPRA 1LTAC 4OGQC 1CI6B 4OGQD 1SQQK 5KAFE 2Z5HA 3CXHI 1N8RQ 2B9BA 3M0DC 1KQLA 1PP9J 1YHQP 1PGPA 1SQQG 2FYZA 3KYQA 1N73B 2NPSB 1YJNP 5DJTB 2Y0DA 3GMAA 3A7OA 1HTLC 2QJPC 3H6PA 1D7MA 3B71A 2W27A 3PTZA 1JCCA 3M0DA 1GU4A 4KJMA 1ZRTD 1G1JA 3RL0C 3TSIA 3RL0D 4HYTB 4H0LD 3AE3C 3T97B 4BWNA 4PD4H 2HLOA 2KNCA 3S1KA 1FC2C 1YTZT 2LKMA 3B4SA 1BGYE 2QE7H 2QG4A 4TLFA 1RH5B 2IPPA 2K9JB 1LP1B 1USDA 2E76B 1AFOA 1NKNA 1FZFA 1VQ6P 2QRXA 2QIWA 1NTZK 1IK7A 2QJYC 2RH0A 5B66E 1UIIA 1FZEA 4EOTA 4N78D 5AVZB 1NTZG 2JJLA 3MIWA 1E79H 3V4WA 1L4AB 2YKQA 2KK7A 1SVFA 1L0ND 3H1JD 3L73G 3L72D 3AE7C 3I5CA 2XZRA 3A0BH 3B5NB 1SQBD 1BDDA 2IBZI 2ZT9C 2ZT9D 2K9YA 5BVZA 2FYUD 1SQPE 2OYHB 1HF9A 3R4YA 3LIEA 5APYA 2JWDA 3CCRP 2QM7A 1E5WA 2RMZA 2ZAEB 3D70A 2BCCE 4U3FJ 4OVNF 2E5TA 5K5GB 2E43A 1RE3C 1G2CA 1K9MQ 1S4XA 2RN0A 4IL6X 1WT6A 3PJSK 1GL2C 2W6JH 1GL2D 5KLVE 2Q7CA 1RQVA 1NTKD 3TGUD 1YJWP 1KYOD 4U3FG 3CCUP 1RE3A 5TISH 1AVOA 1BSNA 3A3YB 1NU1D 1FBMA 2ZFCA 1GL2A 2XV5A 1GU5A 2W6AA 1ZN5A 2QEXP 4EIJA 5AVWB 1S2EA 1LTJB 4YPCA 1LT9B 1EXJA 5CBOA 1QVFO 2C0XA 2YO3A 3TNUA 3G4SP 2L91A 3V2RA 2K1AA 2OTKE 3WU2H 5CJ0A 1GZLA 3RL0g 4DJGA 2IYOA 1NYHA 3H1HD 3BATA 4N3YB 3HE4A 3BASA 1Y47A 2R3SA 3CPWO 2QM8A 1FDIA 2HPCA 2AXTE 3ABVC 1CSBA 3CCLP 2K88A 4PJ0H 1KYOH 1KTMA 3L37A 1XTGB 1L0LE 3EQ2A 1HJBA 3O8ZA 2ZVOB 2A06D 1X0TA 4GT1A 2P2UA 1PPJE 2E42A 2WSEJ 1H0TA 3QH9A 2JO1A 2QJKC 4PD4I 1LTIC 1KB9D 2C9NY 1JO5A 4IOIH 2P58A 1KC8Q 3PRJA 1BCCE 1R8EA 2J58A 3FWNA 1KD1Q 1FDMA 4IL6H 3CXHD 3LW5H 1VQKP 1BDCA 2B87B 2M3BA 3RK2C 3RK2D 2D2CB 4UB6H 1AVYA 4ZKUA 1GD2E 3Q5PA 3AE5C 4I1LA 2QSIA 4GDOA 2WSSH 3GG2A 1AA0A 3HD7C 1NWQA 1BE3E 1MUUA 4Z1MH 3V2QA 4AYCA 4C7NB 1IFDA 1M1JC 5AW4B 1KQFB 1JM0A 3N4XA 3C8VA 5CCGC 5CCGD 2ZYAA 5AVQB 3CCMP 1IO4A 4I7ZC 2WSFJ 4B86A 1BGYG 2HODB 1NTMD 3H1LD 5AW0B 2Q3IA 1KB9H 2E75C 2KZJA 3G71P 2E75D 3FX0A 2WITA 3C9IA 4NPEA 3E7KA 1M1JA 3MUDC 2FFDB 4PV1C 1IJDB 1T3JA 4PV1D 1OZHA 5CCGA 1S3JA 1LGHB 1NKZB 3KZIH 3CXHH 4QMAA 1EZVD 1JB0J 2MJZA 3RK3C 3RK3D 1SQPJ 2I8DA 1QL1A 2YIUB 1IFPA 1BSHA 1K05A 1KQSO 2JWAA 2BCCJ 3MUDA 1J1DB 1X9VA 3L74J 4H44B 1NAYA 4LGDE 2A45G 1CW5A 3SWKA 3L73E 1NJIQ 3AE9C 3RBZA 2YNYA 1PGJA 1SQPG 1EDKA 3BRTB 5E79E 5APSA 1Q81Q 5KLVJ 2WPSA 3AE4C 4OGQB 1QLED 2BCCG 3G6EP 5KLIC 3NXSA 3FWLA 3GF7A 5CCHC 5CCHD 4EDFA 5KLVK 2YXRB 2KNCB 3H1KD 2WWWA 3VOPA 1YI2P 1Q7YQ 3E1IA 1KV4A 3VN0A 5KLVG 2KP8A 4D6TE 3CWBE 1HJ0A 5APXA 5CCHA 2OYIC 1FJPA 1EDIA 2QA4P 2PRRA 2O01J 3M9BA 3OA7A 2YO2A 4R4MA 3USSA 2YMYA 3SFEC 2AEFA 4JYBA 4GIFA 1JY3N 4RO0A 1X22A 1YQ3C 1N7SB 1JNMA 1WRGA 1PZQA 3CI9A 2OYIA 1ZP0C 2GM4A 1S72P 1L0LJ 3A0HH 4BXLA 1KYOE 5TJHA 3P7KA 2V7QJ 4H13B 4TT3H 3NMDA 1A02F 2OTJP 2MKVA 3O6QA 4WY4C 2AEJA 4WY4D 3ZDMA 1FDOA 2WPVB 2QVAA 2LXCB 4CPGA 2WVRA 1VQ9P 2OTLP 1L0LG 4W7ZA 1KILE 2I1JA 1Y8AA 1PPJG 5H2FH 4IL6E 1DEEG 5GTIE 4WY4A 3NFQA 2KB7P 1SQVD 3BCCD 4LLHA 1BCCG 1SQQJ 4ZMDA 1T6AA 1KB9I 1SQXD 1BE3J 3GLMA 3N7NA 2KLUA 1FZAA 1M7LA 1DX7A 3Q3DA 2B89A 1HWTC 2XKMA 2Y0CA 1P84D 1AV1A 1Q82Q 2SPZA 1BE3G 2GUSA 1Q2NA 1FZCA 2HG5D 3D71A 3M0AA 2C9LY 1HUCA 1PP9D 4DT0A 4AQRD 1ZR2A 3L71E 1VL2A 1SFCB 3CX5D 1KILB 5AVTB 1S5LH 3VP9A 4C7RA 2BEQD 2WZ7A 3K5BA 3CXHE 2KIKA 2UWJE 4Y28J 4H0LC 2P67A 4K35A 1FAVA 2Y9ZA 1NTZJ 1JMBA 1KFNA 2IYPA 1WMKA 1DIPA 3CC7P 1MKMA 2R5BA 3L70D 3L73J 3V2NA 1IZNB 2IFMA 1FZBA 1M90Q 3OJAB 2O3JA 3GHGB 1EZVI 1ZMEC 1P84H 4N6JA 1J1EC 3P32A 4WVZA 2W8ZA 2XNXA 1LJ2A 3L75E 3HE5B 1SLQA 3CX5H 1YBKA 4MN4C 2N1TB 1OW8A 4NPDA 2ZJSE 1IFJA 1FOSE 2POHA 4L73A 4D6TJ 3PP5A 3CWBJ 3H1IE 1L0NK 3RK3E 3KPEA 3RK2B 4XFJA 1NHLA 1SQBK 3H1JG 2KS1A 3AEDC 3VMZA 1U57A 1JY2N 2K37A 1RF1C 1HVVA 3H32A 3HD7B 2IBZE 4U3FD 4D6TG 2PP6A 3CWBG 2IZ1A 1JMMA 3IN6A 4RESB 1VQPP 2WT7B 4HJGH 3KQGA 1RF1A 2H88C 2FY8A 1NO4A 2E75B 5KAIH 4IFFA 1JOCA 5L8RJ 4OWFA 4ZNCA 1KZUB 3AEAC 1RHZB 3CC4P 3I56P 1LTTC 1HBWA 1N73C 5KJ7C 1JEKA 5KJ7D 1VF5B 4RKUJ 5CJ4A 3RK3B 5C39A 1OFCX 2N9BA 3CCEP 3IFMA 5GTHE 5H2FE 1EDJA 1IFNA 1H8AA 3H25A 5AW3B 2AXCA 4L76A 1N73A 3E1RA 5KJ7A 4UB8E 3WMM0 3AEEC 3F89A 3U1AA 3P8MC 1L2PA 2KXPB 2E76D 1VQ8P 2NZ2A 3IAOA 3AEGC 1JY3O 5KLIB 3T97A 3UIAA 2FXOA 3VTPC 2NRGA 2Q6QA 3CCSP 2K9JA 3Q2YA 1LP1A 1L4AC 1N7LA 3L71J 1L4AD 3HUSC 3FGAD 1MFZA 2IFNA 2VRSA 4DZOA 1Q86Q 2HFED 1LTGC 3BRVB 5KKZC 2OYIB 1K8AQ 4L75A 3EFFK 2YMKA 1BGYJ 4PD4E 5DJUB 1P84I 1KQGB 4I2LC 1S9KD 1SS1A 1L4AA 3L71G 4EI2A 3HUSA 1CZQA 1SQXE
chains in the Genus database with same CATH topology
4PJ0H 4UB6H 5KAIH 5H2FH 2AXTH 3A0BH 3JCUH 3A0HH 3KZIH 4UB8H 1S5LH 4IL6H 5B5EH 5TISH 5GTIH 5B66H 5E79H 5GTHH 5KAFH 3WU2H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJ0 H;  4UB6 H;  5KAI H;  5H2F H;  2AXT H;  3A0B H;  3JCU H;  3A0H H;  3KZI H;  4UB8 H;  1S5L H;  4IL6 H;  5B5E H;  5TIS H;  5GTI H;  5B66 H;  5E79 H;  5GTH H;  5KAF H;  3WU2 H; 
#chains in the Genus database with same CATH topology
 1T8Z A;  5AW8 B;  1Q90 D;  1W2B O;  3CX5 I;  3M9H A;  4JYC A;  3PLN A;  2WPQ A;  3U1C A;  5AVR B;  3CL3 D;  4K3A A;  5KAF H;  2IDB A;  1DD4 A;  2JDI H;  1GW4 A;  3B8E B;  2E74 B;  4XA4 A;  1LTB C;  1YJ9 P;  1R5L A;  2WSE H;  3L75 J;  2G8Y A;  2OAR A;  1PP9 E;  3TF5 A;  1R5S A;  1NTM K;  2R3C A;  3CD6 P;  1GK4 A;  4O9B A;  4W80 A;  3A0B E;  1ZRT E;  3H1I J;  5AW7 B;  1LTJ C;  1LT9 C;  1A02 J;  4KT0 J;  1EDL A;  3L75 G;  1RQU A;  1SQP D;  1EQ7 A;  2FXP A;  4NPF X;  2WSC J;  1PL5 A;  1FU1 A;  3L70 E;  1EZV G;  1JTH A;  2BCC D;  3H1I G;  3L74 D;  1LTJ A;  1LT9 A;  2R5D A;  1T2K C;  1T2K D;  3TYY A;  4N78 E;  2M0B A;  3RBX A;  2LXB A;  1FZG A;  2CK3 H;  2H7H A;  1EC5 A;  2WSF H;  2Q3E A;  2GA1 A;  2C0W A;  2KI7 B;  5KLV D;  4HH2 A;  1L0N E;  5AVU B;  3H1J E;  5TIS E;  2IBZ G;  3L72 E;  2P10 A;  1SQB E;  2QJP B;  1IC2 A;  3GW6 A;  2R32 A;  2FYU E;  5AVV B;  5AW2 B;  3KDP B;  1ZR4 A;  3RL0 B;  5AW5 B;  4H0L B;  3EFG A;  3WU2 E;  1OW6 A;  2W83 C;  1VQL P;  4M3L A;  1MZ9 A;  5AW6 B;  3H1K G;  3SSU A;  1ZOY C;  2N9Y B;  1S5L X;  1JUN A;  2O1K A;  1M8O B;  4YXD C;  4AUW A;  3JCU H;  2QJY B;  1NTK E;  4PJ0 E;  3TGU E;  1NOH A;  2Y9Y A;  4OH8 B;  1JY2 O;  1NU1 E;  1L0L D;  2RKL A;  3BVH A;  2FYN C;  1PPJ D;  1HGZ A;  1BCC J;  1G2C B;  1EXI A;  2ZT9 B;  2ZXX A;  4Y99 C;  2ZXE B;  5CMZ A;  1OIP A;  2PAJ A;  1QEX A;  1LWU C;  2M8R A;  1LNQ A;  1GW3 A;  5AW1 B;  3CCJ P;  3H1H E;  4UB6 E;  5BU5 A;  3II6 A;  2HOD A;  3L4F A;  2P1J A;  2O01 H;  1M57 D;  2YIU C;  1IFM A;  1FZC C;  1PGO A;  4A7P A;  5AVY B;  1SQX J;  2WQY C;  1J1D C;  1GL2 B;  1GDT A;  2R44 A;  2HYN A;  2AXT H;  3AEC C;  1LWU A;  1SQQ D;  3V6I A;  1SQV K;  2M5A A;  1GTW A;  1VQ7 P;  2PGD A;  1BE3 D;  1U7J A;  2A06 E;  3TNU B;  1SQX K;  1SQV G;  2V7Q H;  1G1I A;  1KB9 E;  1SQX G;  3VMY A;  1K04 A;  3M9Q A;  3CCV P;  4BRY A;  3HE4 B;  2GUV A;  3AE2 C;  2HPC B;  2Z5I A;  3KZI E;  1AQT A;  1URQ C;  2L5G B;  1URQ D;  4HKZ H;  1NH4 A;  5APW A;  4C46 A;  3V5B A;  2JP3 A;  4DCK A;  2Z4E A;  1S9K E;  2JR8 A;  1PP9 G;  3VP8 A;  3VMA A;  1H0T B;  3JSV C;  1PGQ A;  3CC2 P;  1URQ A;  1LT1 A;  2WMM A;  3L70 J;  1NTZ D;  1SP4 A;  1GMJ A;  3M91 A;  2LR2 A;  2FXM A;  2IX7 C;  1AQ5 A;  1H88 A;  1N7S C;  3L73 D;  1N7S D;  4GOF A;  1HGV A;  1NTM E;  3H1L E;  3P8C D;  1OVR A;  2A45 I;  2E5Y A;  1RF0 C;  3IR9 A;  2QJK B;  3L70 G;  1N86 A;  1L0N J;  3H1J J;  2IZ0 A;  1RY3 A;  4H13 C;  3L72 J;  4IFM A;  4H13 D;  5APU A;  3MTU E;  1VQM P;  3S4R A;  1SQB J;  1EZV E;  1N7S A;  3HUS B;  2FYU J;  3JC2 2;  2XDJ A;  4WB4 A;  3EWK A;  1ZLL A;  1RF0 A;  5KKZ B;  1KN7 A;  2HR3 A;  1L0N G;  4D6T D;  3CWB D;  3L72 G;  3Q5R A;  2FYU K;  4XE5 B;  4DOJ A;  1SQB G;  4JBZ A;  1ZXG A;  1OVU A;  2BEZ F;  3D6Z A;  3HTK A;  1YQ4 C;  2FYU G;  4ZKP A;  1M1J B;  1FS0 E;  3L74 E;  2JEE A;  1XTC C;  5EFW B;  1NTK J;  3TGU J;  4I7Z B;  3SWF A;  1VPC A;  3JCU E;  5E79 H;  4GOD A;  3A0H E;  1NVO A;  5APT A;  2J59 M;  2H8P D;  1X79 B;  1NU1 J;  1NTK K;  3H1K E;  3VMX A;  3TK1 A;  1IK9 A;  4PV1 B;  2H43 A;  3MGN A;  2AEM A;  1NTK G;  1NAF A;  3TGU G;  2NPS C;  1KMI Z;  1OW7 A;  1NU1 K;  2NPS D;  3Q5S A;  2FBW C;  1JTH B;  1QX8 A;  5APQ A;  1Y9B A;  1CI6 A;  1NU1 G;  1SFC C;  1SFC D;  1KIL C;  1KIL D;  2I1K A;  3LW5 J;  3M06 A;  1JCD A;  1X8Y A;  5AW9 B;  5APV A;  1VQ5 P;  3H1H J;  1W5C E;  3SFD C;  3TDK A;  2ZYG A;  2M3E A;  2NPS A;  3AEB C;  1PIX A;  3A5T A;  1PV3 A;  2V4H A;  3KXD A;  1W2E A;  3W68 A;  1SFC A;  2XU6 A;  1KIL A;  2E76 C;  3H1H G;  2OYO A;  1ZV8 A;  1K73 Q;  4JQ0 D;  2XND H;  3S9O A;  1USE A;  3GHG C;  1JY3 P;  3FXD A;  4I6M C;  2FKW B;  1OWA A;  3AE6 C;  2KYV A;  5CHX A;  2YKO A;  3D6Y A;  2A06 G;  3GF3 A;  1S1C X;  1S5L E;  2N1T C;  2N1T D;  1VQN P;  3B5N C;  3GHG A;  3B5N D;  1U7M A;  3L71 D;  3I55 P;  5BU8 B;  3MD0 A;  2CPS A;  2KSE A;  2YKP A;  2OYH C;  1SQV E;  5B5E H;  3BCC E;  3WUV A;  5GTI H;  5KTB A;  3A2A A;  3CMA P;  3IF4 A;  3MHV A;  2JKV A;  4YXW H;  3AE8 C;  1BGY D;  1MV8 A;  2G3A A;  3HE5 A;  1NGM B;  3O6Q B;  2N1T A;  1YIJ P;  3B5N A;  1SQQ E;  1N2D C;  3HD7 D;  1QL2 A;  2OYH A;  2ITA A;  1P84 E;  1DD3 A;  1NTM J;  3H1L J;  4L74 A;  1QVG O;  4EYY Q;  2KLV A;  3CCQ P;  4WY4 B;  2FYN B;  1RE4 C;  3PHL A;  2J5U A;  3CX5 E;  3HD7 A;  4LC1 A;  3L75 D;  3OAK A;  1LTS C;  2B88 A;  4Y99 B;  5CBN A;  1NTM G;  3H1L G;  3VYI A;  3SWY A;  2OGU A;  2ZVN B;  3QWO C;  4U7J A;  4W7Y A;  1LWU B;  3WUT A;  2WT7 A;  2M5A B;  1VF5 C;  1VF5 D;  1RE4 A;  3H1I D;  3L35 A;  1M1K Q;  4ASW A;  3G9R A;  1OXZ A;  3L36 A;  1AJY A;  1FZC B;  3CME P;  3C1L A;  1NTZ E;  3V4Q A;  3OW2 O;  1KFM A;  3KHU A;  4BRY B;  1SQP K;  2O01 N;  4R4L A;  1FJK A;  4WBA A;  1YTZ I;  3R2P A;  1MFT A;  2IBZ D;  5B66 H;  2Q9I A;  1DEB A;  3P8C E;  2P7J A;  2DW3 A;  4KHX A;  5AVX B;  3H1K J;  5KAI E;  3NTN A;  2KOG A;  3L74 G;  2Q5U A;  1VDF A;  2O1J A;  1M56 D;  2W6B A;  2A45 H;  2WTY A;  1URQ B;  4GKG A;  1ZW0 A;  2ZYD A;  1H89 A;  1QGK B;  3G3Z A;  4RJT A;  2D2C C;  2D2C D;  2KZI A;  1KYO I;  1TU3 F;  4U3F E;  2WSC H;  2Y0E A;  2KSJ A;  3V2P A;  3CLQ A;  2W90 A;  1VQ4 P;  2B87 A;  3AE1 C;  1J1E B;  1HH0 A;  3F5H A;  1KOR A;  1JY2 P;  1OVV A;  3LID A;  3RGU A;  4WWI A;  1T3U A;  1FOS F;  1OX3 A;  2H89 C;  2KS1 B;  4IFD K;  1GK6 A;  2E74 C;  2CPB A;  2E74 D;  4HB1 A;  4C7N A;  3H32 B;  1L0L K;  1UIX A;  2FFD C;  3HTK B;  1Z56 A;  2YXQ B;  3FXE A;  1OMI A;  2KUB A;  1BCC D;  3ITK A;  5AVS B;  3W67 A;  1PFI A;  4JF7 A;  3AEF C;  1FE6 A;  1VQO P;  4YTP C;  1SQV J;  1YIT P;  1YYC A;  3Q1M A;  5GTH H;  3BCC J;  2PFX A;  1RF1 B;  4ASV A;  5B5E E;  2BAS A;  2FFD A;  4PD4 D;  3MP7 B;  5M1B A;  4H44 C;  4H44 D;  2OQQ A;  1J2J B;  1IFI A;  2Q1K A;  4UB8 H;  3WUU A;  1DH3 A;  4JPZ B;  3PH0 A;  2K3R A;  3MZW B;  3HRN A;  3U59 A;  4GOE A;  3BCC G;  2WPR A;  1LTA C;  4OGQ C;  1CI6 B;  4OGQ D;  1SQQ K;  5KAF E;  2Z5H A;  3CXH I;  1N8R Q;  2B9B A;  3M0D C;  1KQL A;  1PP9 J;  1YHQ P;  1PGP A;  1SQQ G;  2FYZ A;  3KYQ A;  1N73 B;  2NPS B;  1YJN P;  5DJT B;  2Y0D A;  3GMA A;  3A7O A;  1HTL C;  2QJP C;  3H6P A;  1D7M A;  3B71 A;  2W27 A;  3PTZ A;  1JCC A;  3M0D A;  1GU4 A;  4KJM A;  1ZRT D;  1G1J A;  3RL0 C;  3TSI A;  3RL0 D;  4HYT B;  4H0L D;  3AE3 C;  3T97 B;  4BWN A;  4PD4 H;  2HLO A;  2KNC A;  3S1K A;  1FC2 C;  1YTZ T;  2LKM A;  3B4S A;  1BGY E;  2QE7 H;  2QG4 A;  4TLF A;  1RH5 B;  2IPP A;  2K9J B;  1LP1 B;  1USD A;  2E76 B;  1AFO A;  1NKN A;  1FZF A;  1VQ6 P;  2QRX A;  2QIW A;  1NTZ K;  1IK7 A;  2QJY C;  2RH0 A;  5B66 E;  1UII A;  1FZE A;  4EOT A;  4N78 D;  5AVZ B;  1NTZ G;  2JJL A;  3MIW A;  1E79 H;  3V4W A;  1L4A B;  2YKQ A;  2KK7 A;  1SVF A;  1L0N D;  3H1J D;  3L73 G;  3L72 D;  3AE7 C;  3I5C A;  2XZR A;  3A0B H;  3B5N B;  1SQB D;  1BDD A;  2IBZ I;  2ZT9 C;  2ZT9 D;  2K9Y A;  5BVZ A;  2FYU D;  1SQP E;  2OYH B;  1HF9 A;  3R4Y A;  3LIE A;  5APY A;  2JWD A;  3CCR P;  2QM7 A;  1E5W A;  2RMZ A;  2ZAE B;  3D70 A;  2BCC E;  4U3F J;  4OVN F;  2E5T A;  5K5G B;  2E43 A;  1RE3 C;  1G2C A;  1K9M Q;  1S4X A;  2RN0 A;  4IL6 X;  1WT6 A;  3PJS K;  1GL2 C;  2W6J H;  1GL2 D;  5KLV E;  2Q7C A;  1RQV A;  1NTK D;  3TGU D;  1YJW P;  1KYO D;  4U3F G;  3CCU P;  1RE3 A;  5TIS H;  1AVO A;  1BSN A;  3A3Y B;  1NU1 D;  1FBM A;  2ZFC A;  1GL2 A;  2XV5 A;  1GU5 A;  2W6A A;  1ZN5 A;  2QEX P;  4EIJ A;  5AVW B;  1S2E A;  1LTJ B;  4YPC A;  1LT9 B;  1EXJ A;  5CBO A;  1QVF O;  2C0X A;  2YO3 A;  3TNU A;  3G4S P;  2L91 A;  3V2R A;  2K1A A;  2OTK E;  3WU2 H;  5CJ0 A;  1GZL A;  3RL0 g;  4DJG A;  2IYO A;  1NYH A;  3H1H D;  3BAT A;  4N3Y B;  3HE4 A;  3BAS A;  1Y47 A;  2R3S A;  3CPW O;  2QM8 A;  1FDI A;  2HPC A;  2AXT E;  3ABV C;  1CSB A;  3CCL P;  2K88 A;  4PJ0 H;  1KYO H;  1KTM A;  3L37 A;  1XTG B;  1L0L E;  3EQ2 A;  1HJB A;  3O8Z A;  2ZVO B;  2A06 D;  1X0T A;  4GT1 A;  2P2U A;  1PPJ E;  2E42 A;  2WSE J;  1H0T A;  3QH9 A;  2JO1 A;  2QJK C;  4PD4 I;  1LTI C;  1KB9 D;  2C9N Y;  1JO5 A;  4IOI H;  2P58 A;  1KC8 Q;  3PRJ A;  1BCC E;  1R8E A;  2J58 A;  3FWN A;  1KD1 Q;  1FDM A;  4IL6 H;  3CXH D;  3LW5 H;  1VQK P;  1BDC A;  2B87 B;  2M3B A;  3RK2 C;  3RK2 D;  2D2C B;  4UB6 H;  1AVY A;  4ZKU A;  1GD2 E;  3Q5P A;  3AE5 C;  4I1L A;  2QSI A;  4GDO A;  2WSS H;  3GG2 A;  1AA0 A;  3HD7 C;  1NWQ A;  1BE3 E;  1MUU A;  4Z1M H;  3V2Q A;  4AYC A;  4C7N B;  1IFD A;  1M1J C;  5AW4 B;  1KQF B;  1JM0 A;  3N4X A;  3C8V A;  5CCG C;  5CCG D;  2ZYA A;  5AVQ B;  3CCM P;  1IO4 A;  4I7Z C;  2WSF J;  4B86 A;  1BGY G;  2HOD B;  1NTM D;  3H1L D;  5AW0 B;  2Q3I A;  1KB9 H;  2E75 C;  2KZJ A;  3G71 P;  2E75 D;  3FX0 A;  2WIT A;  3C9I A;  4NPE A;  3E7K A;  1M1J A;  3MUD C;  2FFD B;  4PV1 C;  1IJD B;  1T3J A;  4PV1 D;  1OZH A;  5CCG A;  1S3J A;  1LGH B;  1NKZ B;  3KZI H;  3CXH H;  4QMA A;  1EZV D;  1JB0 J;  2MJZ A;  3RK3 C;  3RK3 D;  1SQP J;  2I8D A;  1QL1 A;  2YIU B;  1IFP A;  1BSH A;  1K05 A;  1KQS O;  2JWA A;  2BCC J;  3MUD A;  1J1D B;  1X9V A;  3L74 J;  4H44 B;  1NAY A;  4LGD E;  2A45 G;  1CW5 A;  3SWK A;  3L73 E;  1NJI Q;  3AE9 C;  3RBZ A;  2YNY A;  1PGJ A;  1SQP G;  1EDK A;  3BRT B;  5E79 E;  5APS A;  1Q81 Q;  5KLV J;  2WPS A;  3AE4 C;  4OGQ B;  1QLE D;  2BCC G;  3G6E P;  5KLI C;  3NXS A;  3FWL A;  3GF7 A;  5CCH C;  5CCH D;  4EDF A;  5KLV K;  2YXR B;  2KNC B;  3H1K D;  2WWW A;  3VOP A;  1YI2 P;  1Q7Y Q;  3E1I A;  1KV4 A;  3VN0 A;  5KLV G;  2KP8 A;  4D6T E;  3CWB E;  1HJ0 A;  5APX A;  5CCH A;  2OYI C;  1FJP A;  1EDI A;  2QA4 P;  2PRR A;  2O01 J;  3M9B A;  3OA7 A;  2YO2 A;  4R4M A;  3USS A;  2YMY A;  3SFE C;  2AEF A;  4JYB A;  4GIF A;  1JY3 N;  4RO0 A;  1X22 A;  1YQ3 C;  1N7S B;  1JNM A;  1WRG A;  1PZQ A;  3CI9 A;  2OYI A;  1ZP0 C;  2GM4 A;  1S72 P;  1L0L J;  3A0H H;  4BXL A;  1KYO E;  5TJH A;  3P7K A;  2V7Q J;  4H13 B;  4TT3 H;  3NMD A;  1A02 F;  2OTJ P;  2MKV A;  3O6Q A;  4WY4 C;  2AEJ A;  4WY4 D;  3ZDM A;  1FDO A;  2WPV B;  2QVA A;  2LXC B;  4CPG A;  2WVR A;  1VQ9 P;  2OTL P;  1L0L G;  4W7Z A;  1KIL E;  2I1J A;  1Y8A A;  1PPJ G;  5H2F H;  4IL6 E;  1DEE G;  5GTI E;  4WY4 A;  3NFQ A;  2KB7 P;  1SQV D;  3BCC D;  4LLH A;  1BCC G;  1SQQ J;  4ZMD A;  1T6A A;  1KB9 I;  1SQX D;  1BE3 J;  3GLM A;  3N7N A;  2KLU A;  1FZA A;  1M7L A;  1DX7 A;  3Q3D A;  2B89 A;  1HWT C;  2XKM A;  2Y0C A;  1P84 D;  1AV1 A;  1Q82 Q;  2SPZ A;  1BE3 G;  2GUS A;  1Q2N A;  1FZC A;  2HG5 D;  3D71 A;  3M0A A;  2C9L Y;  1HUC A;  1PP9 D;  4DT0 A;  4AQR D;  1ZR2 A;  3L71 E;  1VL2 A;  1SFC B;  3CX5 D;  1KIL B;  5AVT B;  1S5L H;  3VP9 A;  4C7R A;  2BEQ D;  2WZ7 A;  3K5B A;  3CXH E;  2KIK A;  2UWJ E;  4Y28 J;  4H0L C;  2P67 A;  4K35 A;  1FAV A;  2Y9Z A;  1NTZ J;  1JMB A;  1KFN A;  2IYP A;  1WMK A;  1DIP A;  3CC7 P;  1MKM A;  2R5B A;  3L70 D;  3L73 J;  3V2N A;  1IZN B;  2IFM A;  1FZB A;  1M90 Q;  3OJA B;  2O3J A;  3GHG B;  1EZV I;  1ZME C;  1P84 H;  4N6J A;  1J1E C;  3P32 A;  4WVZ A;  2W8Z A;  2XNX A;  1LJ2 A;  3L75 E;  3HE5 B;  1SLQ A;  3CX5 H;  1YBK A;  4MN4 C;  2N1T B;  1OW8 A;  4NPD A;  2ZJS E;  1IFJ A;  1FOS E;  2POH A;  4L73 A;  4D6T J;  3PP5 A;  3CWB J;  3H1I E;  1L0N K;  3RK3 E;  3KPE A;  3RK2 B;  4XFJ A;  1NHL A;  1SQB K;  3H1J G;  2KS1 A;  3AED C;  3VMZ A;  1U57 A;  1JY2 N;  2K37 A;  1RF1 C;  1HVV A;  3H32 A;  3HD7 B;  2IBZ E;  4U3F D;  4D6T G;  2PP6 A;  3CWB G;  2IZ1 A;  1JMM A;  3IN6 A;  4RES B;  1VQP P;  2WT7 B;  4HJG H;  3KQG A;  1RF1 A;  2H88 C;  2FY8 A;  1NO4 A;  2E75 B;  5KAI H;  4IFF A;  1JOC A;  5L8R J;  4OWF A;  4ZNC A;  1KZU B;  3AEA C;  1RHZ B;  3CC4 P;  3I56 P;  1LTT C;  1HBW A;  1N73 C;  5KJ7 C;  1JEK A;  5KJ7 D;  1VF5 B;  4RKU J;  5CJ4 A;  3RK3 B;  5C39 A;  1OFC X;  2N9B A;  3CCE P;  3IFM A;  5GTH E;  5H2F E;  1EDJ A;  1IFN A;  1H8A A;  3H25 A;  5AW3 B;  2AXC A;  4L76 A;  1N73 A;  3E1R A;  5KJ7 A;  4UB8 E;  3WMM 0;  3AEE C;  3F89 A;  3U1A A;  3P8M C;  1L2P A;  2KXP B;  2E76 D;  1VQ8 P;  2NZ2 A;  3IAO A;  3AEG C;  1JY3 O;  5KLI B;  3T97 A;  3UIA A;  2FXO A;  3VTP C;  2NRG A;  2Q6Q A;  3CCS P;  2K9J A;  3Q2Y A;  1LP1 A;  1L4A C;  1N7L A;  3L71 J;  1L4A D;  3HUS C;  3FGA D;  1MFZ A;  2IFN A;  2VRS A;  4DZO A;  1Q86 Q;  2HFE D;  1LTG C;  3BRV B;  5KKZ C;  2OYI B;  1K8A Q;  4L75 A;  3EFF K;  2YMK A;  1BGY J;  4PD4 E;  5DJU B;  1P84 I;  1KQG B;  4I2L C;  1S9K D;  1SS1 A;  1L4A A;  3L71 G;  4EI2 A;  3HUS A;  1CZQ A;  1SQX E; 
#chains in the Genus database with same CATH homology
 4PJ0 H;  4UB6 H;  5KAI H;  5H2F H;  2AXT H;  3A0B H;  3JCU H;  3A0H H;  3KZI H;  4UB8 H;  1S5L H;  4IL6 H;  5B5E H;  5TIS H;  5GTI H;  5B66 H;  5E79 H;  5GTH H;  5KAF H;  3WU2 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...