1LTJA

Crystal structure of recombinant human fibrinogen fragment d with the peptide ligands gly-pro-arg-pro-amide and gly-his-arg-pro-amide
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
publication title 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 65
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltjA00
1RE4A 1RF1C 3HUSC 1M1JA 2Q9IA 1LTJC 1JY3O 2XNXA 2A45G 1FZFA 1LWUA 2HODB 3GHGB 2HPCB 3H32B 1T3UA 1JY3N 1FZGA 2FFDB 1N73C 2OYHC 2OYIC 1FZEA 1M1JB 1FZBA 1LT9C 1LWUB 1FZAA 1N86A 3HUSA 1RF1A 1LTJA 1JY2P 1N73A 1FZCC 3E1IA 2OYHA 2OYIA 1RF1B 3HUSB 2A45I 1N73B 1LT9A 1RF0C 1LTJB 1RE3C 2OYHB 1FZCA 2OYIB 3GHGC 2FFDC 1JY3P 1LT9B 1RE4C 2Z4EA 1JY2O 1M1JC 2HLOA 3BVHA 1FZCB 1RF0A 1JY2N 1LWUC 1RE3A 1W2EA 2HPCA 2HODA 3GHGA 2H43A 3H32A 2A45H 2FFDA
chains in the Genus database with same CATH superfamily
3H1LG 4EIJA 4H13B 3AE2C 2WSCJ 1SLQA 3RK3D 1D7MA 1MFTA 3B71A 4A7PA 3BCCG 5AW8B 1NTKK 4K3AA 1RF0A 1YITP 1CI6B 1OW6A 3CCSP 3C8VA 1VQOP 2AEJA 5KLVD 3H1HD 2E76D 1ZV8A 4D6TG 4ZNCA 3A0HH 3M0AA 1LT9C 1IK7A 1BE3E 3L74G 1RQVA 4NPDA 1J2JB 3H1KD 3RL0D 3SFDC 4JYBA 2E76C 1L4AA 2WSFH 3A0BH 1KQFB 2H8PD 3JSVC 2O01N 3PRJA 1S4XA 1VQ9P 1Y47A 1NJIQ 1LTGC 3IR9A 3NTNA 5APVA 1FU1A 2BEZF 1J1DB 5CBNA 4H44B 1DEEG 1P84I 1KYOH 2AXCA 1EC5A 2XKMA 1ZN5A 2R3SA 2IYOA 4H0LB 1VQ4P 3H1LE 4CPGA 1BE3D 2E75D 3L37A 1EXJA 3VMYA 5L8RJ 1DIPA 3EFGA 3H1LJ 2C9LY 2FYZA 3BCCE 5DJUB 2Q9IA 5KKZC 1GL2D 2C0WA 2V7QH 2PGDA 4C46A 3BCCJ 4Y99B 3VMAA 1QL1A 4HJGH 1GL2C 4D6TE 4B86A 1IFIA 3D6YA 2M5AA 5M1BA 1H0TB 3L74E 1LWUA 4D6TJ 4R4MA 1NWQA 3IN6A 1LTAC 2E74D 1N73B 3SWKA 4WY4C 3H1LD 4BWNA 3MD0A 2WTYA 1OIPA 2M3BA 2I1KA 3R4YA 1FZBA 1YTZT 3BCCD 4K35A 2JR8A 5CCGC 3A2AA 2PAJA 3B5NA 3E1RA 5AVRB 3AE4C 1OW7A 2FXMA 3CWBG 1JCDA 4D6TD 3L74D 1FC2C 3U59A 3V2RA 2VRSA 2P67A 3IAOA 3PTZA 4RESB 3TNUA 3M91A 2P7JA 4GOEA 4IL6H 1NAYA 1NKNA 2M0BA 1S1CX 2YIUC 2LKMA 1URQA 3GHGA 1GMJA 1RE4A 1EQ7A 5AVWB 1SFCD 3M9BA 3N7NA 1M56D 1BDCA 2YKOA 1U7MA 1L0NK 1SQBG 3V2QA 1NTKG 1GW3A 2B9BA 2WSFJ 2IFNA 3H1IG 2PP6A 1USDA 1PIXA 2K37A 1Y9BA 4IFDK 2FFDB 2R32A 3MUDC 4IFMA 1HBWA 1GU5A 4BRYB 2KSEA 1CI6A 3LW5H 1KYOE 5CJ4A 2Y0DA 2H89C 1E79H 4KT0J 1M8OB 3VMZA 1SVFA 3TF5A 1Z56A 3TSIA 3VP9A 1LTJB 4Y28J 1OX3A 5KLIB 3CWBJ 2SPZA 3HD7B 1SQPG 2V7QJ 2YMYA 4PV1B 2YXRB 5GTHH 3CCVP 2JEEA 1SQBE 1LTBC 3L70G 3GLMA 1KYOD 1NTKE 2QIWA 2QJPC 2CPSA 3CCUP 1FZCC 1NTKJ 3H1IE 2Q5UA 5CJ0A 2LXBA 3H1IJ 1DX7A 2XDJA 1VQLP 2KIKA 1H89A 1KN7A 3EFFK 1JY2P 1H88A 1DEBA 4EI2A 2OYOA 1NHLA 2IBZI 4PD4H 1K9MQ 5AVUB 1S72P 2MJZA 3W68A 1PGOA 1SQBD 1S3JA 1GK6A 1NTKD 2N1TB 2FKWB 1TU3F 1QL2A 2POHA 3OW2O 1VQKP 1SQPE 3H1ID 1ZMEC 1MUUA 3AECC 3CCJP 3L75G 2WZ7A 2WSEH 1KILB 1GK4A 2ZYGA 2A45G 2JO1A 4I7ZC 3T97B 3L72G 2WMMA 2KUBA 3UIAA 2MKVA 3L70E 2QSIA 1L0LK 1GDTA 1VF5D 3N4XA 2KS1A 3KYQA 1EZVI 3L70J 5KAFH 3F5HA 1L0NG 1SQXK 1S2EA 1VQPP 3RBXA 2P2UA 2NPSD 4I6MC 5TISH 4IFFA 4WBAA 4GT1A 5APXA 1RF0C 1VQMP 4IL6X 4W7ZA 3AE3C 2ZT9C 3LW5J 2OTLP 1YJ9P 1SQPD 2FYNB 3L4FA 1BCCJ 3Q5SA 2ZYAA 3PP5A 1L4AC 3FXEA 3P7KA 3L70D 1N7SD 3Q3DA 3BVHA 2QE7H 4W7YA 3I5CA 1S5LH 2Q7CA 2NRGA 2D2CB 2R5BA 4N6JA 2FFDA 4TT3H 5C39A 3MTUE 3H32B 1JY3N 5GTHE 3BRTB 1X9VA 2KZJA 3GF3A 3L75E 3M0DC 3II6A 4BRYA 3NFQA 3AE9C 3I55P 4IOIH 1PGPA 2ZAEB 1PGQA 3L75J 3L72E 4LLHA 1M1KQ 4C7NB 3KZIH 1RHZB 3L72J 3RK3B 1LTJA 3AEBC 3V4WA 1L0NE 5CMZA 1LT9B 3IF4A 3HD7A 3VP8A 3Q5PA 1L0NJ 3V6IA 1WT6A 2E76B 1EDLA 1BGYJ 3MZWB 1XTGB 4PD4E 3G9RA 2N9BA 1P84H 3L75D 3RL0B 1LWUC 1PGJA 4EYYQ 4WVZA 1DD3A 1Q7YQ 2G8YA 1OFCX 2GUVA 1VQ7P 3K5BA 1VQ6P 4KHXA 3Q5RA 1HJBA 2ZVOB 1L0ND 3L71G 1R5LA 1HF9A 1IFJA 3B5ND 2WSEJ 4YTPC 4I1LA 1JY3O 4RKUJ 3CCRP 2O1JA 4OWFA 3OAKA 3KDPB 5KAFE 1S9KE 3B5NC 2E75B 4PD4D 1RQUA 1JMBA 3CC7P 1WRGA 1LTTC 5APQA 1W2EA 5TISE 1GL2B 2KI7B 1L0LG 3HE4A 2KK7A 2OQQA 2QVAA 4OH8B 1NTZK 1YHQP 2BCCG 5TJHA 2OGUA 3GHGC 2C0XA 2XZRA 1RE4C 3U1CA 1SQXG 3CC2P 1KILA 2KLVA 2PRRA 1HGZA 3T97A 1LTIC 4L75A 2J58A 5KJ7A 3HUSA 1IFMA 2E74B 3P8CE 2M3EA 3AEGC 4H13C 1OZHA 2B87B 1S9KD 5AVYB 1GU4A 1VQNP 4U7JA 1BSNA 1FJKA 2RMZA 3L71E 3CX5H 3Q1MA 3P32A 2KXPB 4XE5B 3V4QA 3RK2D 1PZQA 3KZIE 3L71J 3VTPC 3CLQA 3FGAD 4DCKA 1AVOA 2CPBA 4WY4D 1YBKA 3R2PA 3RK2C 5AW0B 1M1JB 2WPVB 3SSUA 3CMAP 1KC8Q 3AE7C 4R4LA 4N3YB 2BEQD 4OGQD 3P8CD 1L0LE 3BATA 1S5LX 1IJDB 3H32A 1SFCB 3V2PA 1FJPA 2BCCE 5CCGD 1L0LJ 4UB8H 2HODB 1P84E 2OYIC 1J1EB 4OGQC 1SQXE 1X79B 5GTIH 1G1JA 1J1DC 3E1IA 2BCCJ 4H44C 2RH0A 3L71D 1SQXJ 3PH0A 4C7NA 4AQRD 1KZUB 1NOHA 4AYCA 4H0LC 5AW5B 1CSBA 1K73Q 1UIIA 3CD6P 3CCMP 1RF1A 2PFXA 3EWKA 4DZOA 1LT9A 5AW6B 3KQGA 2HG5D 1FBMA 4GOFA 2KNCB 3CX5I 2ZJSE 3A0HE 2YO3A 1ZR4A 1L0LD 3AEFC 3G71P 1KQGB 3JC22 2N9YB 2QEXP 2QRXA 1QLED 1XTCC 2BCCD 3SWFA 2NZ2A 1P84D 2KB7P 5AVVB 1SQXD 5CBOA 3A0BE 1FOSF 2GA1A 2YMKA 3L36A 2WVRA 3MP7B 1NH4A 1KFMA 5CHXA 2I8DA 1G1IA 4W80A 2KYVA 2QJPB 1QGKB 5AW9B 5KLVK 4ZKUA 1FZCB 1JUNA 1OVRA 3H6PA 2QA4P 2HPCB 1ZR2A 5B66H 1NTZG 3TYYA 2E5TA 4XA4A 2L5GB 3B8EB 3CWBE 3CXHI 1FS0E 5KAIH 2OYHB 1BDDA 1W5CE 2AXTH 3CMEP 3CX5E 5DJTB 2RKLA 3HTKB 1KFNA 1KB9H 2IX7C 2JP3A 5B5EH 4BXLA 5BVZA 2KLUA 1L2PA 3HE5B 1MV8A 3AE1C 1FZEA 1G2CB 2AEMA 3FXDA 3KPEA 1KORA 4PJ0H 2B87A 1QEXA 2GM4A 1YI2P 2IPPA 2FFDC 4UB8E 3CWBD 2YNYA 3CPWO 1MKMA 2IDBA 5GTIE 1EDJA 3CI9A 2WPQA 4N78E 1BCCG 4I2LC 1FDOA 2IBZG 4WWIA 1YIJP 1VF5B 1JCCA 3V2NA 1NTZE 1H0TA 1PP9J 1NAFA 1IFDA 1M1JA 1LTJC 1NTZJ 1CZQA 2NPSB 5KLIC 4IL6E 3U1AA 2YO2A 1N73A 2QJKB 5AW7B 2LR2A 3HD7C 2E5YA 1ZLLA 3M06A 1FDMA 3S4RA 1KB9I 1SFCA 1NO4A 1HGVA 2HODA 3IFMA 1PV3A 2E43A 4PV1C 3AEAC 2OTKE 1SQQK 4N78D 1EZVG 2RN0A 3MUDA 3SWYA 1N7SB 3O6QB 1QVFO 2AEFA 1NTZD 1CW5A 1AQ5A 2ZT9D 5APWA 2KSJA 1HVVA 2Q1KA 1BGYG 1T8ZA 3VOPA 1HTLC 3WUVA 1AQTA 2KNCA 2Z4EA 1BCCE 5B66E 3WUTA 1IO4A 4EOTA 2WWWA 3CC4P 3EQ2A 2IBZE 3TGUG 2G3AA 2B88A 1L4AD 1T2KD 2LXCB 5KAIE 1ZRTE 1LNQA 2AXTE 2Z5IA 5AW1B 1FOSE 1T6AA 2Q6QA 3AE8C 1T2KC 2M5AB 1LTSC 1LP1B 4NPFX 2O1KA 1RH5B 3H1JJ 1N86A 3FX0A 3D6ZA 3G6EP 1YJWP 1JTHB 1KILC 2WPRA 1FZCA 4NPEA 1HH0A 2GUSA 1EZVE 5AVXB 2HPCA 2M8RA 4KJMA 3GW6A 1BCCD 1NYHA 5KJ7C 3HUSC 2IBZD 4HH2A 2V4HA 4L74A 2KOGA 5BU8B 3OA7A 2OYHA 1JEKA 1ZRTD 3C9IA 4YXDC 4LGDE 3A5TA 5AVSB 2W27A 3CCLP 3B5NB 3HTKA 1BGYE 2K9YA 3CCQP 4GKGA 2P1JA 2O01H 3GMAA 4JF7A 4DJGA 3TGUE 2FYNC 1EXIA 5APSA 2YXQB 1QX8A 3TGUJ 4GODA 1SQVK 3L72D 1EZVD 5KLVJ 1NTMK 1LGHB 2I1JA 3L73G 4DOJA 2D2CC 2KZIA 3M9HA 3CCEP 1QVGO 3PLNA 3AE6C 1T3JA 3H1KJ 3VN0A 4YXWH 2P58A 4GIFA 2H43A 2W83C 3MIWA 1OVVA 2ZVNB 1BGYD 4ZKPA 1DD4A 1NGMB 2W6JH 5AW2B 1YQ4C 1SQBK 1R8EA 2QJYC 5KKZB 1DH3A 3TGUD 3PJSK 3RK3C 2R3CA 1X8YA 1RE3A 1VPCA 1HUCA 1M90Q 1RF1C 2NPSA 1SQQG 2IZ0A 1URQD 2XNXA 2K88A 2N1TA 5H2FH 3WU2H 1VQ5P 2B89A 2K1AA 1NU1K 2J59M 5K5GB 2Y9ZA 3RK2B 1URQC 1N8RQ 1BE3J 2P10A 1YYCA 4YPCA 5CCHA 1Q2NA 1UIXA 4WY4B 2FYUK 4H13D 3HRNA 1JO5A 1U57A 3RL0C 2JWAA 3Q2YA 3KXDA 3LIEA 3RBZA 1N7SA 2Q3EA 3O6QA 2OTJP 1S5LE 4RJTA 2OYIB 3M0DA 4OGQB 2JDIH 3PHLA 1HJ0A 2WPSA 1OMIA 3L73E 1JOCA 5EFWB 1FZGA 2R44A 5APTA 1E5WA 1SQPK 2FBWC 3L73J 2DW3A 4HYTB 1JY3P 2HLOA 1Y8AA 3USSA 1JM0A 4O9BA 1ZOYC 2E75C 1WMKA 2FXOA 3TDKA 2YIUB 4QMAA 1RY3A 2H7HA 1SQQE 2UWJE 1A02F 1ZXGA 1LP1A 5BU5A 3F89A 1SQQJ 4H44D 2Z5HA 3L74J 3L73D 1HWTC 2O3JA 2O01J 1JTHA 2C9NY 2YKQA 4H0LD 1GZLA 3D71A 1YTZI 1M57D 1KTMA 3BRVB 3BASA 1KQLA 1U7JA 1JY2N 2K3RA 1YJNP 5AW3B 2E74C 4JQ0D 1LJ2A 3CXHH 4MN4C 4EDFA 2JWDA 1IFNA 1Q81Q 2OARA 1KYOI 1PL5A 2Y0EA 3I56P 2KS1B 1SQVG 5KTBA 1SQQD 1FAVA 2XV5A 4Y99C 1NTMG 3C1LA 1OXZA 4XFJA 3E7KA 3MHVA 4JYCA 3LIDA 3QWOC 3GF7A 2FXPA 1M1JC 5H2FE 3WU2E 2W6BA 1YQ3C 2WITA 1N2DC 5E79H 4RO0A 1N73C 1FZFA 3NXSA 3RGUA 3JCUH 1SFCC 1AV1A 2R5DA 1IFPA 3ABVC 4TLFA 2K9JB 1J1EC 4U3FG 1PP9G 1AVYA 4ASWA 1PPJG 1NU1G 2CK3H 2WQYC 3OJAB 5AVQB 3S1KA 4OVNF 2ITAA 4JBZA 1N7LA 2IZ1A 1JY2O 2FYUG 4C7RA 1GL2A 3M9QA 1Q86Q 2WSSH 1SQVE 4Z1MH 4ASVA 1R5SA 2WT7B 1NTME 1SQVJ 4WY4A 4UB6H 5AVZB 3VMXA 1NTMJ 1KQSO 1USEA 2IYPA 1IC2A 2OYIA 1M7LA 2W6AA 4HB1A 4I7ZB 1AFOA 2E42A 5CCGA 1K05A 4LC1A 2A45H 1FE6A 2Q3IA 1JB0J 5AVTB 1SQBJ 3CX5D 4U3FE 1PP9E 2Y0CA 2W8ZA 1PPJE 1SQVD 1NU1E 3CXHE 3O8ZA 4U3FJ 3A3YB 2JJLA 1KMIZ 3FWLA 1NTMD 2A06G 2W90A 1NU1J 3HD7D 5AW4B 2YKPA 3WMM0 2J5UA 2OYHC 1OWAA 2ZT9B 1Q90D 1KV4A 3ITKA 2FYUE 4AUWA 2XU6A 1GW4A 3H1JG 3H25A 4PV1D 1ZW0A 2FYUJ 1Q82Q 1A02J 2ZXXA 3W67A 3V5BA 3VYIA 1L4AB 2JKVA 1GTWA 1X22A 2WSCH 3HE4B 1EDKA 2ZXEB 5E79E 3P8MC 1OW8A 4U3FD 2QM7A 1PP9D 1PPJD 3GG2A 3RL0g 1KILE 1NU1D 1JMMA 1AJYA 3CXHD 1VQ8P 1SQPJ 3SFEC 4L76A 1X0TA 3JCUE 3NMDA 1T3UA 4M3LA 1FZAA 2BASA 4ZMDA 4GDOA 3B4SA 1ZP0C 3HUSB 2A45I 2FYUD 3ZDMA 1VF5C 5APUA 2HYNA 2N1TD 1SS1A 5KLVG 3H1HG 2A06E 1RE3C 2QG4A 2NPSC 1NKZB 3WUUA 1KB9E 4DT0A 2N1TC 3H1KG 2QJKC 3H1JE 2XNDH 1KILD 5CCHD 5B5EE 4PD4I 1LWUB 1K8AQ 1OVUA 4UB6E 5KJ7D 2K9JA 1BSHA 1MFZA 5CCHC 1VDFA 1SP4A 2FY8A 2ZYDA 1AA0A 4PJ0E 3AE5C 1VL2A 1LT1A 1N7SC 1PFIA 3A7OA 3L35A 3FWNA 3AEDC 5APYA 4L73A 1FDIA 1IK9A 2H88C 2A06D 4JPZB 4WB4A 1H8AA 1GD2E 1BE3G 1K04A 2QJYB 1KD1Q 3RK3E 1KB9D 3H1JD 1NVOA 3MGNA 2WT7A 3AEEC 1RF1B 3TNUB 1EDIA 2IFMA 3HE5A 2L91A 5KLVE 3H1HE 3G4SP 2D2CD 1URQB 2QM8A 1JNMA 3GHGB 1G2CA 2HFED 3TK1A 1W2BO 2KP8A 3H1HJ 2Y9YA 2ZFCA 3H1KE 2HR3A 3G3ZA 3S9OA 3D70A 3QH9A 1IZNB 3CL3D 3KHUA 1MZ9A 4HKZH
chains in the Genus database with same CATH topology
1SQXK 4EIJA 3HTKB 1SLQA 2P2UA 1KFNA 2Z5HA 2IX7C 2NPSD 1HWTC 3RK3D 4I6MC 1JTHA 2C9NY 4IFFA 2YKQA 1GZLA 4WBAA 1YTZI 4GT1A 5APXA 1RF0C 5AW8B 4W7ZA 5BVZA 3BRVB 3BASA 1KQLA 1NTKK 1RF0A 1JY2N 1CI6B 5AW3B 3L4FA 3HE5B 1MV8A 1ZV8A 1FZEA 3M0AA 1G2CB 1LT9C 3KPEA 3PP5A 1IFNA 2GM4A 1L4AC 1J2JB 3P7KA 2IPPA 2OARA 1N7SD 2FFDC 3RL0D 4JYBA 3BVHA 4W7YA 5KTBA 2YNYA 1L4AA 3I5CA 2WSFH 1FAVA 2Q7CA 2R5BA 3CI9A 2XV5A 4N6JA 2FFDA 2H8PD 2WPQA 4N78E 4Y99C 3MTUE 3H32B 1JY3N 1OXZA 3BRTB 1X9VA 4I2LC 3M0DC 3II6A 4JYCA 3NFQA 1LTGC 3IR9A 3NTNA 5APVA 1JCCA 1FU1A 3LIDA 3V2NA 1M1JC 2W6BA 1NAFA 1J1DB 2WITA 1N2DC 4LLHA 4C7NB 1IFDA 1M1JA 1LTJC 1N73C 1FZFA 1CZQA 3NXSA 2NPSB 3RK3B 3U1AA 2YO2A 2XKMA 1LTJA 1ZN5A 1N73A 5AW7B 3V4WA 3HD7C 5CMZA 1ZLLA 1SFCC 2R5DA 3M06A 3L37A 1FDMA 1LT9B 3VMYA 3HD7A 1J1EC 3VP8A 1SFCA 1NO4A 3EFGA 1HGVA 2HODA 2C9LY 3IFMA 2FYZA 1WT6A 2Q9IA 2E43A 1GL2D 2C0WA 3OJAB 5AVQB 4C46A 1SQQK 4N78D 1XTGB 2N9BA 1N7LA 4Y99B 3MUDA 3SWYA 1N7SB 1QL1A 3RL0B 1GL2C 1JY2O 4B86A 1IFIA 1LWUC 4C7RA 1GL2A 1CW5A 1AQ5A 1LWUA 3M9QA 5APWA 2KSJA 2GUVA 1HVVA 1NWQA 1LTAC 4KHXA 1N73B 2WT7B 1T8ZA 4WY4C 3VOPA 1HTLC 1HJBA 2Z4EA 1IO4A 3MD0A 4EOTA 2WWWA 4WY4A 3EQ2A 1IFJA 5AVZB 2WTYA 3B5ND 3VMXA 4I1LA 1JY3O 1L4AD 2M3BA 1T2KD 2I1KA 2O1JA 1FZBA 1YTZT 3OAKA 1IC2A 2Z5IA 3KDPB 5AW1B 2OYIA 1S9KE 1M7LA 3B5NC 1FOSE 5CCGC 2W6AA 3A2AA 2PAJA 1T2KC 1AFOA 2E42A 3B5NA 1WRGA 5CCGA 5AVRB 1LTTC 5APQA 1W2EA 2FXMA 4LC1A 2A45H 1JCDA 2Q3IA 1LTSC 5AVTB 2O1KA 1GL2B 3U59A 3V2RA 3HE4A 2VRSA 2P67A 1N86A 4OH8B 4RESB 1NTZK 3TNUA 1JTHB 3M91A 2P7JA 1KILC 2WPRA 1FZCA 3GHGC 1NKNA 2C0XA 2XZRA 1RE4C 3O8ZA 3U1CA 3A3YB 2JJLA 2LKMA 1HH0A 1URQA 1KILA 2GUSA 5AVXB 2KLVA 2HPCA 2M8RA 3GHGA 1RE4A 1EQ7A 3HD7D 1HGZA 5AW4B 5AVWB 1LTIC 1SFCD 2YKPA 3HUSC 3T97A 3WMM0 5KJ7C 3M9BA 3N7NA 4HH2A 2OYHC 1OWAA 2YKOA 2J58A 1L0NK 5KJ7A 2KOGA 5BU8B 3HUSA 3OA7A 1IFMA 4AUWA 2XU6A 3V2QA 2OYHA 1GW4A 3P8CE 3C9IA 4LGDE 1S9KD 3A5TA 1GW3A 1A02J 5AVSB 5AVYB 2W27A 1GU4A 2IFNA 3B5NB 2PP6A 3HTKA 3V5BA 3VYIA 1FJKA 1L4AB 1GTWA 4IFDK 2FFDB 2WSCH 2R32A 4GKGA 2P1JA 3HE4B 2O01H 4IFMA 4JF7A 2ZXEB 3P32A 1HBWA 3P8MC 4XE5B 1GU5A 3V4QA 3RK2D 2QM7A 5APSA 3VTPC 1CI6A 3CLQA 3LW5H 5CJ4A 1JMMA 2CPBA 1SQVK 3NMDA 4WY4D 3R2PA 3RK2C 1T3UA 4M3LA 3VMZA 5AW0B 1M1JB 1SVFA 1FZAA 2BASA 1NTMK 1LGHB 1Z56A 2I1JA 3HUSB 3TSIA 4DOJA 2A45I 3M9HA 3VP9A 1LTJB 4N3YB 1T3JA 3P8CD 3BATA 3VN0A 1IJDB 4GIFA 3HD7B 3H32A 2H43A 1SFCB 3MIWA 3V2PA 1FJPA 5CCGD 2HODB 2OYIC 4ZKPA 1J1EB 5APUA 1X79B 1G1JA 2HYNA 2N1TD 1J1DC 3E1IA 5AW2B 2YMYA 1SQBK 1RE3C 1DH3A 4C7NA 2NPSC 1NKZB 3RK3C 2R3CA 2JEEA 1X8YA 4AQRD 1RE3A 1KZUB 1LTBC 1HUCA 1VPCA 1NOHA 2N1TC 4AYCA 5AW5B 1CSBA 1RF1C 2NPSA 2XNXA 1URQD 1KILD 2CPSA 5CCHD 2N1TA 1LWUB 1RF1A 1NU1K 2J59M 1FZCC 4DZOA 1LT9A 5KJ7D 2Q5UA 3RK2B 5AW6B 3KQGA 2HG5D 1MFZA 1URQC 5CJ0A 5CCHC 1VDFA 1FBMA 1YYCA 1SP4A 1DX7A 2XDJA 2YO3A 5CCHA 1ZR4A 4WY4B 2FYUK 3HRNA 1JO5A 1H89A 1N7SC 3RL0C 1PFIA 3A7OA 3L35A 1XTCC 3SWFA 1JY2P 3LIEA 5APYA 2KB7P 1N7SA 5AVVB 1H88A 1DEBA 2OYIB 1IK9A 3M0DA 1NHLA 1FOSF 4WB4A 1H8AA 3L36A 1GD2E 2WPSA 1NH4A 5AVUB 1JOCA 2MJZA 1KFMA 5CHXA 1FZGA 1GK6A 2N1TB 1G1IA 5APTA 1E5WA 1SQPK 2FKWB 3MGNA 2WT7A 4W80A 2KYVA 1QL2A 1RF1B 2POHA 4HYTB 5AW9B 5KLVK 4ZKUA 3TNUB 1JY3P 1MUUA 2IFMA 2HLOA 1FZCB 1JUNA 3H6PA 3HE5A 4O9BA 2WZ7A 2WSEH 1URQB 1KILB 1GK4A 2HPCB 1ZR2A 2A45G 2QM8A 1JNMA 3GHGB 1G2CA 2HFED 3TK1A 2KP8A 3TYYA 1RY3A 4XA4A 2L5GB 2ZFCA 3B8EB 3UIAA 1L0LK 2H7HA 1GDTA 3G3ZA 2OYHB 3N4XA 1A02F 3KYQA 3CL3D 5BU5A 1MZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RE4 A;  1RF1 C;  3HUS C;  1M1J A;  2Q9I A;  1LTJ C;  1JY3 O;  2XNX A;  2A45 G;  1FZF A;  1LWU A;  2HOD B;  3GHG B;  2HPC B;  3H32 B;  1T3U A;  1JY3 N;  1FZG A;  2FFD B;  1N73 C;  2OYH C;  2OYI C;  1FZE A;  1M1J B;  1FZB A;  1LT9 C;  1LWU B;  1FZA A;  1N86 A;  3HUS A;  1RF1 A;  1LTJ A;  1JY2 P;  1N73 A;  1FZC C;  3E1I A;  2OYH A;  2OYI A;  1RF1 B;  3HUS B;  2A45 I;  1N73 B;  1LT9 A;  1RF0 C;  1LTJ B;  1RE3 C;  2OYH B;  1FZC A;  2OYI B;  3GHG C;  2FFD C;  1JY3 P;  1LT9 B;  1RE4 C;  2Z4E A;  1JY2 O;  1M1J C;  2HLO A;  3BVH A;  1FZC B;  1RF0 A;  1JY2 N;  1LWU C;  1RE3 A;  1W2E A;  2HPC A;  2HOD A;  3GHG A;  2H43 A;  3H32 A;  2A45 H;  2FFD A; 
#chains in the Genus database with same CATH topology
 3H1L G;  4EIJ A;  4H13 B;  3AE2 C;  2WSC J;  1SLQ A;  3RK3 D;  1D7M A;  1MFT A;  3B71 A;  4A7P A;  3BCC G;  5AW8 B;  1NTK K;  4K3A A;  1RF0 A;  1YIT P;  1CI6 B;  1OW6 A;  3CCS P;  3C8V A;  1VQO P;  2AEJ A;  5KLV D;  3H1H D;  2E76 D;  1ZV8 A;  4D6T G;  4ZNC A;  3A0H H;  3M0A A;  1LT9 C;  1IK7 A;  1BE3 E;  3L74 G;  1RQV A;  4NPD A;  1J2J B;  3H1K D;  3RL0 D;  3SFD C;  4JYB A;  2E76 C;  1L4A A;  2WSF H;  3A0B H;  1KQF B;  2H8P D;  3JSV C;  2O01 N;  3PRJ A;  1S4X A;  1VQ9 P;  1Y47 A;  1NJI Q;  1LTG C;  3IR9 A;  3NTN A;  5APV A;  1FU1 A;  2BEZ F;  1J1D B;  5CBN A;  4H44 B;  1DEE G;  1P84 I;  1KYO H;  2AXC A;  1EC5 A;  2XKM A;  1ZN5 A;  2R3S A;  2IYO A;  4H0L B;  1VQ4 P;  3H1L E;  4CPG A;  1BE3 D;  2E75 D;  3L37 A;  1EXJ A;  3VMY A;  5L8R J;  1DIP A;  3EFG A;  3H1L J;  2C9L Y;  2FYZ A;  3BCC E;  5DJU B;  2Q9I A;  5KKZ C;  1GL2 D;  2C0W A;  2V7Q H;  2PGD A;  4C46 A;  3BCC J;  4Y99 B;  3VMA A;  1QL1 A;  4HJG H;  1GL2 C;  4D6T E;  4B86 A;  1IFI A;  3D6Y A;  2M5A A;  5M1B A;  1H0T B;  3L74 E;  1LWU A;  4D6T J;  4R4M A;  1NWQ A;  3IN6 A;  1LTA C;  2E74 D;  1N73 B;  3SWK A;  4WY4 C;  3H1L D;  4BWN A;  3MD0 A;  2WTY A;  1OIP A;  2M3B A;  2I1K A;  3R4Y A;  1FZB A;  1YTZ T;  3BCC D;  4K35 A;  2JR8 A;  5CCG C;  3A2A A;  2PAJ A;  3B5N A;  3E1R A;  5AVR B;  3AE4 C;  1OW7 A;  2FXM A;  3CWB G;  1JCD A;  4D6T D;  3L74 D;  1FC2 C;  3U59 A;  3V2R A;  2VRS A;  2P67 A;  3IAO A;  3PTZ A;  4RES B;  3TNU A;  3M91 A;  2P7J A;  4GOE A;  4IL6 H;  1NAY A;  1NKN A;  2M0B A;  1S1C X;  2YIU C;  2LKM A;  1URQ A;  3GHG A;  1GMJ A;  1RE4 A;  1EQ7 A;  5AVW B;  1SFC D;  3M9B A;  3N7N A;  1M56 D;  1BDC A;  2YKO A;  1U7M A;  1L0N K;  1SQB G;  3V2Q A;  1NTK G;  1GW3 A;  2B9B A;  2WSF J;  2IFN A;  3H1I G;  2PP6 A;  1USD A;  1PIX A;  2K37 A;  1Y9B A;  4IFD K;  2FFD B;  2R32 A;  3MUD C;  4IFM A;  1HBW A;  1GU5 A;  4BRY B;  2KSE A;  1CI6 A;  3LW5 H;  1KYO E;  5CJ4 A;  2Y0D A;  2H89 C;  1E79 H;  4KT0 J;  1M8O B;  3VMZ A;  1SVF A;  3TF5 A;  1Z56 A;  3TSI A;  3VP9 A;  1LTJ B;  4Y28 J;  1OX3 A;  5KLI B;  3CWB J;  2SPZ A;  3HD7 B;  1SQP G;  2V7Q J;  2YMY A;  4PV1 B;  2YXR B;  5GTH H;  3CCV P;  2JEE A;  1SQB E;  1LTB C;  3L70 G;  3GLM A;  1KYO D;  1NTK E;  2QIW A;  2QJP C;  2CPS A;  3CCU P;  1FZC C;  1NTK J;  3H1I E;  2Q5U A;  5CJ0 A;  2LXB A;  3H1I J;  1DX7 A;  2XDJ A;  1VQL P;  2KIK A;  1H89 A;  1KN7 A;  3EFF K;  1JY2 P;  1H88 A;  1DEB A;  4EI2 A;  2OYO A;  1NHL A;  2IBZ I;  4PD4 H;  1K9M Q;  5AVU B;  1S72 P;  2MJZ A;  3W68 A;  1PGO A;  1SQB D;  1S3J A;  1GK6 A;  1NTK D;  2N1T B;  2FKW B;  1TU3 F;  1QL2 A;  2POH A;  3OW2 O;  1VQK P;  1SQP E;  3H1I D;  1ZME C;  1MUU A;  3AEC C;  3CCJ P;  3L75 G;  2WZ7 A;  2WSE H;  1KIL B;  1GK4 A;  2ZYG A;  2A45 G;  2JO1 A;  4I7Z C;  3T97 B;  3L72 G;  2WMM A;  2KUB A;  3UIA A;  2MKV A;  3L70 E;  2QSI A;  1L0L K;  1GDT A;  1VF5 D;  3N4X A;  2KS1 A;  3KYQ A;  1EZV I;  3L70 J;  5KAF H;  3F5H A;  1L0N G;  1SQX K;  1S2E A;  1VQP P;  3RBX A;  2P2U A;  2NPS D;  4I6M C;  5TIS H;  4IFF A;  4WBA A;  4GT1 A;  5APX A;  1RF0 C;  1VQM P;  4IL6 X;  4W7Z A;  3AE3 C;  2ZT9 C;  3LW5 J;  2OTL P;  1YJ9 P;  1SQP D;  2FYN B;  3L4F A;  1BCC J;  3Q5S A;  2ZYA A;  3PP5 A;  1L4A C;  3FXE A;  3P7K A;  3L70 D;  1N7S D;  3Q3D A;  3BVH A;  2QE7 H;  4W7Y A;  3I5C A;  1S5L H;  2Q7C A;  2NRG A;  2D2C B;  2R5B A;  4N6J A;  2FFD A;  4TT3 H;  5C39 A;  3MTU E;  3H32 B;  1JY3 N;  5GTH E;  3BRT B;  1X9V A;  2KZJ A;  3GF3 A;  3L75 E;  3M0D C;  3II6 A;  4BRY A;  3NFQ A;  3AE9 C;  3I55 P;  4IOI H;  1PGP A;  2ZAE B;  1PGQ A;  3L75 J;  3L72 E;  4LLH A;  1M1K Q;  4C7N B;  3KZI H;  1RHZ B;  3L72 J;  3RK3 B;  1LTJ A;  3AEB C;  3V4W A;  1L0N E;  5CMZ A;  1LT9 B;  3IF4 A;  3HD7 A;  3VP8 A;  3Q5P A;  1L0N J;  3V6I A;  1WT6 A;  2E76 B;  1EDL A;  1BGY J;  3MZW B;  1XTG B;  4PD4 E;  3G9R A;  2N9B A;  1P84 H;  3L75 D;  3RL0 B;  1LWU C;  1PGJ A;  4EYY Q;  4WVZ A;  1DD3 A;  1Q7Y Q;  2G8Y A;  1OFC X;  2GUV A;  1VQ7 P;  3K5B A;  1VQ6 P;  4KHX A;  3Q5R A;  1HJB A;  2ZVO B;  1L0N D;  3L71 G;  1R5L A;  1HF9 A;  1IFJ A;  3B5N D;  2WSE J;  4YTP C;  4I1L A;  1JY3 O;  4RKU J;  3CCR P;  2O1J A;  4OWF A;  3OAK A;  3KDP B;  5KAF E;  1S9K E;  3B5N C;  2E75 B;  4PD4 D;  1RQU A;  1JMB A;  3CC7 P;  1WRG A;  1LTT C;  5APQ A;  1W2E A;  5TIS E;  1GL2 B;  2KI7 B;  1L0L G;  3HE4 A;  2KK7 A;  2OQQ A;  2QVA A;  4OH8 B;  1NTZ K;  1YHQ P;  2BCC G;  5TJH A;  2OGU A;  3GHG C;  2C0X A;  2XZR A;  1RE4 C;  3U1C A;  1SQX G;  3CC2 P;  1KIL A;  2KLV A;  2PRR A;  1HGZ A;  3T97 A;  1LTI C;  4L75 A;  2J58 A;  5KJ7 A;  3HUS A;  1IFM A;  2E74 B;  3P8C E;  2M3E A;  3AEG C;  4H13 C;  1OZH A;  2B87 B;  1S9K D;  5AVY B;  1GU4 A;  1VQN P;  4U7J A;  1BSN A;  1FJK A;  2RMZ A;  3L71 E;  3CX5 H;  3Q1M A;  3P32 A;  2KXP B;  4XE5 B;  3V4Q A;  3RK2 D;  1PZQ A;  3KZI E;  3L71 J;  3VTP C;  3CLQ A;  3FGA D;  4DCK A;  1AVO A;  2CPB A;  4WY4 D;  1YBK A;  3R2P A;  3RK2 C;  5AW0 B;  1M1J B;  2WPV B;  3SSU A;  3CMA P;  1KC8 Q;  3AE7 C;  4R4L A;  4N3Y B;  2BEQ D;  4OGQ D;  3P8C D;  1L0L E;  3BAT A;  1S5L X;  1IJD B;  3H32 A;  1SFC B;  3V2P A;  1FJP A;  2BCC E;  5CCG D;  1L0L J;  4UB8 H;  2HOD B;  1P84 E;  2OYI C;  1J1E B;  4OGQ C;  1SQX E;  1X79 B;  5GTI H;  1G1J A;  1J1D C;  3E1I A;  2BCC J;  4H44 C;  2RH0 A;  3L71 D;  1SQX J;  3PH0 A;  4C7N A;  4AQR D;  1KZU B;  1NOH A;  4AYC A;  4H0L C;  5AW5 B;  1CSB A;  1K73 Q;  1UII A;  3CD6 P;  3CCM P;  1RF1 A;  2PFX A;  3EWK A;  4DZO A;  1LT9 A;  5AW6 B;  3KQG A;  2HG5 D;  1FBM A;  4GOF A;  2KNC B;  3CX5 I;  2ZJS E;  3A0H E;  2YO3 A;  1ZR4 A;  1L0L D;  3AEF C;  3G71 P;  1KQG B;  3JC2 2;  2N9Y B;  2QEX P;  2QRX A;  1QLE D;  1XTC C;  2BCC D;  3SWF A;  2NZ2 A;  1P84 D;  2KB7 P;  5AVV B;  1SQX D;  5CBO A;  3A0B E;  1FOS F;  2GA1 A;  2YMK A;  3L36 A;  2WVR A;  3MP7 B;  1NH4 A;  1KFM A;  5CHX A;  2I8D A;  1G1I A;  4W80 A;  2KYV A;  2QJP B;  1QGK B;  5AW9 B;  5KLV K;  4ZKU A;  1FZC B;  1JUN A;  1OVR A;  3H6P A;  2QA4 P;  2HPC B;  1ZR2 A;  5B66 H;  1NTZ G;  3TYY A;  2E5T A;  4XA4 A;  2L5G B;  3B8E B;  3CWB E;  3CXH I;  1FS0 E;  5KAI H;  2OYH B;  1BDD A;  1W5C E;  2AXT H;  3CME P;  3CX5 E;  5DJT B;  2RKL A;  3HTK B;  1KFN A;  1KB9 H;  2IX7 C;  2JP3 A;  5B5E H;  4BXL A;  5BVZ A;  2KLU A;  1L2P A;  3HE5 B;  1MV8 A;  3AE1 C;  1FZE A;  1G2C B;  2AEM A;  3FXD A;  3KPE A;  1KOR A;  4PJ0 H;  2B87 A;  1QEX A;  2GM4 A;  1YI2 P;  2IPP A;  2FFD C;  4UB8 E;  3CWB D;  2YNY A;  3CPW O;  1MKM A;  2IDB A;  5GTI E;  1EDJ A;  3CI9 A;  2WPQ A;  4N78 E;  1BCC G;  4I2L C;  1FDO A;  2IBZ G;  4WWI A;  1YIJ P;  1VF5 B;  1JCC A;  3V2N A;  1NTZ E;  1H0T A;  1PP9 J;  1NAF A;  1IFD A;  1M1J A;  1LTJ C;  1NTZ J;  1CZQ A;  2NPS B;  5KLI C;  4IL6 E;  3U1A A;  2YO2 A;  1N73 A;  2QJK B;  5AW7 B;  2LR2 A;  3HD7 C;  2E5Y A;  1ZLL A;  3M06 A;  1FDM A;  3S4R A;  1KB9 I;  1SFC A;  1NO4 A;  1HGV A;  2HOD A;  3IFM A;  1PV3 A;  2E43 A;  4PV1 C;  3AEA C;  2OTK E;  1SQQ K;  4N78 D;  1EZV G;  2RN0 A;  3MUD A;  3SWY A;  1N7S B;  3O6Q B;  1QVF O;  2AEF A;  1NTZ D;  1CW5 A;  1AQ5 A;  2ZT9 D;  5APW A;  2KSJ A;  1HVV A;  2Q1K A;  1BGY G;  1T8Z A;  3VOP A;  1HTL C;  3WUV A;  1AQT A;  2KNC A;  2Z4E A;  1BCC E;  5B66 E;  3WUT A;  1IO4 A;  4EOT A;  2WWW A;  3CC4 P;  3EQ2 A;  2IBZ E;  3TGU G;  2G3A A;  2B88 A;  1L4A D;  1T2K D;  2LXC B;  5KAI E;  1ZRT E;  1LNQ A;  2AXT E;  2Z5I A;  5AW1 B;  1FOS E;  1T6A A;  2Q6Q A;  3AE8 C;  1T2K C;  2M5A B;  1LTS C;  1LP1 B;  4NPF X;  2O1K A;  1RH5 B;  3H1J J;  1N86 A;  3FX0 A;  3D6Z A;  3G6E P;  1YJW P;  1JTH B;  1KIL C;  2WPR A;  1FZC A;  4NPE A;  1HH0 A;  2GUS A;  1EZV E;  5AVX B;  2HPC A;  2M8R A;  4KJM A;  3GW6 A;  1BCC D;  1NYH A;  5KJ7 C;  3HUS C;  2IBZ D;  4HH2 A;  2V4H A;  4L74 A;  2KOG A;  5BU8 B;  3OA7 A;  2OYH A;  1JEK A;  1ZRT D;  3C9I A;  4YXD C;  4LGD E;  3A5T A;  5AVS B;  2W27 A;  3CCL P;  3B5N B;  3HTK A;  1BGY E;  2K9Y A;  3CCQ P;  4GKG A;  2P1J A;  2O01 H;  3GMA A;  4JF7 A;  4DJG A;  3TGU E;  2FYN C;  1EXI A;  5APS A;  2YXQ B;  1QX8 A;  3TGU J;  4GOD A;  1SQV K;  3L72 D;  1EZV D;  5KLV J;  1NTM K;  1LGH B;  2I1J A;  3L73 G;  4DOJ A;  2D2C C;  2KZI A;  3M9H A;  3CCE P;  1QVG O;  3PLN A;  3AE6 C;  1T3J A;  3H1K J;  3VN0 A;  4YXW H;  2P58 A;  4GIF A;  2H43 A;  2W83 C;  3MIW A;  1OVV A;  2ZVN B;  1BGY D;  4ZKP A;  1DD4 A;  1NGM B;  2W6J H;  5AW2 B;  1YQ4 C;  1SQB K;  1R8E A;  2QJY C;  5KKZ B;  1DH3 A;  3TGU D;  3PJS K;  3RK3 C;  2R3C A;  1X8Y A;  1RE3 A;  1VPC A;  1HUC A;  1M90 Q;  1RF1 C;  2NPS A;  1SQQ G;  2IZ0 A;  1URQ D;  2XNX A;  2K88 A;  2N1T A;  5H2F H;  3WU2 H;  1VQ5 P;  2B89 A;  2K1A A;  1NU1 K;  2J59 M;  5K5G B;  2Y9Z A;  3RK2 B;  1URQ C;  1N8R Q;  1BE3 J;  2P10 A;  1YYC A;  4YPC A;  5CCH A;  1Q2N A;  1UIX A;  4WY4 B;  2FYU K;  4H13 D;  3HRN A;  1JO5 A;  1U57 A;  3RL0 C;  2JWA A;  3Q2Y A;  3KXD A;  3LIE A;  3RBZ A;  1N7S A;  2Q3E A;  3O6Q A;  2OTJ P;  1S5L E;  4RJT A;  2OYI B;  3M0D A;  4OGQ B;  2JDI H;  3PHL A;  1HJ0 A;  2WPS A;  1OMI A;  3L73 E;  1JOC A;  5EFW B;  1FZG A;  2R44 A;  5APT A;  1E5W A;  1SQP K;  2FBW C;  3L73 J;  2DW3 A;  4HYT B;  1JY3 P;  2HLO A;  1Y8A A;  3USS A;  1JM0 A;  4O9B A;  1ZOY C;  2E75 C;  1WMK A;  2FXO A;  3TDK A;  2YIU B;  4QMA A;  1RY3 A;  2H7H A;  1SQQ E;  2UWJ E;  1A02 F;  1ZXG A;  1LP1 A;  5BU5 A;  3F89 A;  1SQQ J;  4H44 D;  2Z5H A;  3L74 J;  3L73 D;  1HWT C;  2O3J A;  2O01 J;  1JTH A;  2C9N Y;  2YKQ A;  4H0L D;  1GZL A;  3D71 A;  1YTZ I;  1M57 D;  1KTM A;  3BRV B;  3BAS A;  1KQL A;  1U7J A;  1JY2 N;  2K3R A;  1YJN P;  5AW3 B;  2E74 C;  4JQ0 D;  1LJ2 A;  3CXH H;  4MN4 C;  4EDF A;  2JWD A;  1IFN A;  1Q81 Q;  2OAR A;  1KYO I;  1PL5 A;  2Y0E A;  3I56 P;  2KS1 B;  1SQV G;  5KTB A;  1SQQ D;  1FAV A;  2XV5 A;  4Y99 C;  1NTM G;  3C1L A;  1OXZ A;  4XFJ A;  3E7K A;  3MHV A;  4JYC A;  3LID A;  3QWO C;  3GF7 A;  2FXP A;  1M1J C;  5H2F E;  3WU2 E;  2W6B A;  1YQ3 C;  2WIT A;  1N2D C;  5E79 H;  4RO0 A;  1N73 C;  1FZF A;  3NXS A;  3RGU A;  3JCU H;  1SFC C;  1AV1 A;  2R5D A;  1IFP A;  3ABV C;  4TLF A;  2K9J B;  1J1E C;  4U3F G;  1PP9 G;  1AVY A;  4ASW A;  1PPJ G;  1NU1 G;  2CK3 H;  2WQY C;  3OJA B;  5AVQ B;  3S1K A;  4OVN F;  2ITA A;  4JBZ A;  1N7L A;  2IZ1 A;  1JY2 O;  2FYU G;  4C7R A;  1GL2 A;  3M9Q A;  1Q86 Q;  2WSS H;  1SQV E;  4Z1M H;  4ASV A;  1R5S A;  2WT7 B;  1NTM E;  1SQV J;  4WY4 A;  4UB6 H;  5AVZ B;  3VMX A;  1NTM J;  1KQS O;  1USE A;  2IYP A;  1IC2 A;  2OYI A;  1M7L A;  2W6A A;  4HB1 A;  4I7Z B;  1AFO A;  2E42 A;  5CCG A;  1K05 A;  4LC1 A;  2A45 H;  1FE6 A;  2Q3I A;  1JB0 J;  5AVT B;  1SQB J;  3CX5 D;  4U3F E;  1PP9 E;  2Y0C A;  2W8Z A;  1PPJ E;  1SQV D;  1NU1 E;  3CXH E;  3O8Z A;  4U3F J;  3A3Y B;  2JJL A;  1KMI Z;  3FWL A;  1NTM D;  2A06 G;  2W90 A;  1NU1 J;  3HD7 D;  5AW4 B;  2YKP A;  3WMM 0;  2J5U A;  2OYH C;  1OWA A;  2ZT9 B;  1Q90 D;  1KV4 A;  3ITK A;  2FYU E;  4AUW A;  2XU6 A;  1GW4 A;  3H1J G;  3H25 A;  4PV1 D;  1ZW0 A;  2FYU J;  1Q82 Q;  1A02 J;  2ZXX A;  3W67 A;  3V5B A;  3VYI A;  1L4A B;  2JKV A;  1GTW A;  1X22 A;  2WSC H;  3HE4 B;  1EDK A;  2ZXE B;  5E79 E;  3P8M C;  1OW8 A;  4U3F D;  2QM7 A;  1PP9 D;  1PPJ D;  3GG2 A;  3RL0 g;  1KIL E;  1NU1 D;  1JMM A;  1AJY A;  3CXH D;  1VQ8 P;  1SQP J;  3SFE C;  4L76 A;  1X0T A;  3JCU E;  3NMD A;  1T3U A;  4M3L A;  1FZA A;  2BAS A;  4ZMD A;  4GDO A;  3B4S A;  1ZP0 C;  3HUS B;  2A45 I;  2FYU D;  3ZDM A;  1VF5 C;  5APU A;  2HYN A;  2N1T D;  1SS1 A;  5KLV G;  3H1H G;  2A06 E;  1RE3 C;  2QG4 A;  2NPS C;  1NKZ B;  3WUU A;  1KB9 E;  4DT0 A;  2N1T C;  3H1K G;  2QJK C;  3H1J E;  2XND H;  1KIL D;  5CCH D;  5B5E E;  4PD4 I;  1LWU B;  1K8A Q;  1OVU A;  4UB6 E;  5KJ7 D;  2K9J A;  1BSH A;  1MFZ A;  5CCH C;  1VDF A;  1SP4 A;  2FY8 A;  2ZYD A;  1AA0 A;  4PJ0 E;  3AE5 C;  1VL2 A;  1LT1 A;  1N7S C;  1PFI A;  3A7O A;  3L35 A;  3FWN A;  3AED C;  5APY A;  4L73 A;  1FDI A;  1IK9 A;  2H88 C;  2A06 D;  4JPZ B;  4WB4 A;  1H8A A;  1GD2 E;  1BE3 G;  1K04 A;  2QJY B;  1KD1 Q;  3RK3 E;  1KB9 D;  3H1J D;  1NVO A;  3MGN A;  2WT7 A;  3AEE C;  1RF1 B;  3TNU B;  1EDI A;  2IFM A;  3HE5 A;  2L91 A;  5KLV E;  3H1H E;  3G4S P;  2D2C D;  1URQ B;  2QM8 A;  1JNM A;  3GHG B;  1G2C A;  2HFE D;  3TK1 A;  1W2B O;  2KP8 A;  3H1H J;  2Y9Y A;  2ZFC A;  3H1K E;  2HR3 A;  3G3Z A;  3S9O A;  3D70 A;  3QH9 A;  1IZN B;  3CL3 D;  3KHU A;  1MZ9 A;  4HKZ H; 
#chains in the Genus database with same CATH homology
 1SQX K;  4EIJ A;  3HTK B;  1SLQ A;  2P2U A;  1KFN A;  2Z5H A;  2IX7 C;  2NPS D;  1HWT C;  3RK3 D;  4I6M C;  1JTH A;  2C9N Y;  4IFF A;  2YKQ A;  1GZL A;  4WBA A;  1YTZ I;  4GT1 A;  5APX A;  1RF0 C;  5AW8 B;  4W7Z A;  5BVZ A;  3BRV B;  3BAS A;  1KQL A;  1NTK K;  1RF0 A;  1JY2 N;  1CI6 B;  5AW3 B;  3L4F A;  3HE5 B;  1MV8 A;  1ZV8 A;  1FZE A;  3M0A A;  1G2C B;  1LT9 C;  3KPE A;  3PP5 A;  1IFN A;  2GM4 A;  1L4A C;  1J2J B;  3P7K A;  2IPP A;  2OAR A;  1N7S D;  2FFD C;  3RL0 D;  4JYB A;  3BVH A;  4W7Y A;  5KTB A;  2YNY A;  1L4A A;  3I5C A;  2WSF H;  1FAV A;  2Q7C A;  2R5B A;  3CI9 A;  2XV5 A;  4N6J A;  2FFD A;  2H8P D;  2WPQ A;  4N78 E;  4Y99 C;  3MTU E;  3H32 B;  1JY3 N;  1OXZ A;  3BRT B;  1X9V A;  4I2L C;  3M0D C;  3II6 A;  4JYC A;  3NFQ A;  1LTG C;  3IR9 A;  3NTN A;  5APV A;  1JCC A;  1FU1 A;  3LID A;  3V2N A;  1M1J C;  2W6B A;  1NAF A;  1J1D B;  2WIT A;  1N2D C;  4LLH A;  4C7N B;  1IFD A;  1M1J A;  1LTJ C;  1N73 C;  1FZF A;  1CZQ A;  3NXS A;  2NPS B;  3RK3 B;  3U1A A;  2YO2 A;  2XKM A;  1LTJ A;  1ZN5 A;  1N73 A;  5AW7 B;  3V4W A;  3HD7 C;  5CMZ A;  1ZLL A;  1SFC C;  2R5D A;  3M06 A;  3L37 A;  1FDM A;  1LT9 B;  3VMY A;  3HD7 A;  1J1E C;  3VP8 A;  1SFC A;  1NO4 A;  3EFG A;  1HGV A;  2HOD A;  2C9L Y;  3IFM A;  2FYZ A;  1WT6 A;  2Q9I A;  2E43 A;  1GL2 D;  2C0W A;  3OJA B;  5AVQ B;  4C46 A;  1SQQ K;  4N78 D;  1XTG B;  2N9B A;  1N7L A;  4Y99 B;  3MUD A;  3SWY A;  1N7S B;  1QL1 A;  3RL0 B;  1GL2 C;  1JY2 O;  4B86 A;  1IFI A;  1LWU C;  4C7R A;  1GL2 A;  1CW5 A;  1AQ5 A;  1LWU A;  3M9Q A;  5APW A;  2KSJ A;  2GUV A;  1HVV A;  1NWQ A;  1LTA C;  4KHX A;  1N73 B;  2WT7 B;  1T8Z A;  4WY4 C;  3VOP A;  1HTL C;  1HJB A;  2Z4E A;  1IO4 A;  3MD0 A;  4EOT A;  2WWW A;  4WY4 A;  3EQ2 A;  1IFJ A;  5AVZ B;  2WTY A;  3B5N D;  3VMX A;  4I1L A;  1JY3 O;  1L4A D;  2M3B A;  1T2K D;  2I1K A;  2O1J A;  1FZB A;  1YTZ T;  3OAK A;  1IC2 A;  2Z5I A;  3KDP B;  5AW1 B;  2OYI A;  1S9K E;  1M7L A;  3B5N C;  1FOS E;  5CCG C;  2W6A A;  3A2A A;  2PAJ A;  1T2K C;  1AFO A;  2E42 A;  3B5N A;  1WRG A;  5CCG A;  5AVR B;  1LTT C;  5APQ A;  1W2E A;  2FXM A;  4LC1 A;  2A45 H;  1JCD A;  2Q3I A;  1LTS C;  5AVT B;  2O1K A;  1GL2 B;  3U59 A;  3V2R A;  3HE4 A;  2VRS A;  2P67 A;  1N86 A;  4OH8 B;  4RES B;  1NTZ K;  3TNU A;  1JTH B;  3M91 A;  2P7J A;  1KIL C;  2WPR A;  1FZC A;  3GHG C;  1NKN A;  2C0X A;  2XZR A;  1RE4 C;  3O8Z A;  3U1C A;  3A3Y B;  2JJL A;  2LKM A;  1HH0 A;  1URQ A;  1KIL A;  2GUS A;  5AVX B;  2KLV A;  2HPC A;  2M8R A;  3GHG A;  1RE4 A;  1EQ7 A;  3HD7 D;  1HGZ A;  5AW4 B;  5AVW B;  1LTI C;  1SFC D;  2YKP A;  3HUS C;  3T97 A;  3WMM 0;  5KJ7 C;  3M9B A;  3N7N A;  4HH2 A;  2OYH C;  1OWA A;  2YKO A;  2J58 A;  1L0N K;  5KJ7 A;  2KOG A;  5BU8 B;  3HUS A;  3OA7 A;  1IFM A;  4AUW A;  2XU6 A;  3V2Q A;  2OYH A;  1GW4 A;  3P8C E;  3C9I A;  4LGD E;  1S9K D;  3A5T A;  1GW3 A;  1A02 J;  5AVS B;  5AVY B;  2W27 A;  1GU4 A;  2IFN A;  3B5N B;  2PP6 A;  3HTK A;  3V5B A;  3VYI A;  1FJK A;  1L4A B;  1GTW A;  4IFD K;  2FFD B;  2WSC H;  2R32 A;  4GKG A;  2P1J A;  3HE4 B;  2O01 H;  4IFM A;  4JF7 A;  2ZXE B;  3P32 A;  1HBW A;  3P8M C;  4XE5 B;  1GU5 A;  3V4Q A;  3RK2 D;  2QM7 A;  5APS A;  3VTP C;  1CI6 A;  3CLQ A;  3LW5 H;  5CJ4 A;  1JMM A;  2CPB A;  1SQV K;  3NMD A;  4WY4 D;  3R2P A;  3RK2 C;  1T3U A;  4M3L A;  3VMZ A;  5AW0 B;  1M1J B;  1SVF A;  1FZA A;  2BAS A;  1NTM K;  1LGH B;  1Z56 A;  2I1J A;  3HUS B;  3TSI A;  4DOJ A;  2A45 I;  3M9H A;  3VP9 A;  1LTJ B;  4N3Y B;  1T3J A;  3P8C D;  3BAT A;  3VN0 A;  1IJD B;  4GIF A;  3HD7 B;  3H32 A;  2H43 A;  1SFC B;  3MIW A;  3V2P A;  1FJP A;  5CCG D;  2HOD B;  2OYI C;  4ZKP A;  1J1E B;  5APU A;  1X79 B;  1G1J A;  2HYN A;  2N1T D;  1J1D C;  3E1I A;  5AW2 B;  2YMY A;  1SQB K;  1RE3 C;  1DH3 A;  4C7N A;  2NPS C;  1NKZ B;  3RK3 C;  2R3C A;  2JEE A;  1X8Y A;  4AQR D;  1RE3 A;  1KZU B;  1LTB C;  1HUC A;  1VPC A;  1NOH A;  2N1T C;  4AYC A;  5AW5 B;  1CSB A;  1RF1 C;  2NPS A;  2XNX A;  1URQ D;  1KIL D;  2CPS A;  5CCH D;  2N1T A;  1LWU B;  1RF1 A;  1NU1 K;  2J59 M;  1FZC C;  4DZO A;  1LT9 A;  5KJ7 D;  2Q5U A;  3RK2 B;  5AW6 B;  3KQG A;  2HG5 D;  1MFZ A;  1URQ C;  5CJ0 A;  5CCH C;  1VDF A;  1FBM A;  1YYC A;  1SP4 A;  1DX7 A;  2XDJ A;  2YO3 A;  5CCH A;  1ZR4 A;  4WY4 B;  2FYU K;  3HRN A;  1JO5 A;  1H89 A;  1N7S C;  3RL0 C;  1PFI A;  3A7O A;  3L35 A;  1XTC C;  3SWF A;  1JY2 P;  3LIE A;  5APY A;  2KB7 P;  1N7S A;  5AVV B;  1H88 A;  1DEB A;  2OYI B;  1IK9 A;  3M0D A;  1NHL A;  1FOS F;  4WB4 A;  1H8A A;  3L36 A;  1GD2 E;  2WPS A;  1NH4 A;  5AVU B;  1JOC A;  2MJZ A;  1KFM A;  5CHX A;  1FZG A;  1GK6 A;  2N1T B;  1G1I A;  5APT A;  1E5W A;  1SQP K;  2FKW B;  3MGN A;  2WT7 A;  4W80 A;  2KYV A;  1QL2 A;  1RF1 B;  2POH A;  4HYT B;  5AW9 B;  5KLV K;  4ZKU A;  3TNU B;  1JY3 P;  1MUU A;  2IFM A;  2HLO A;  1FZC B;  1JUN A;  3H6P A;  3HE5 A;  4O9B A;  2WZ7 A;  2WSE H;  1URQ B;  1KIL B;  1GK4 A;  2HPC B;  1ZR2 A;  2A45 G;  2QM8 A;  1JNM A;  3GHG B;  1G2C A;  2HFE D;  3TK1 A;  2KP8 A;  3TYY A;  1RY3 A;  4XA4 A;  2L5G B;  2ZFC A;  3B8E B;  3UIA A;  1L0L K;  2H7H A;  1GDT A;  3G3Z A;  2OYH B;  3N4X A;  1A02 F;  3KYQ A;  3CL3 D;  5BU5 A;  1MZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...