1RH5B

The structure of a protein conducting channel
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
56
structure length
56
Chain Sequence
LKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Preprotein translocase secY subunit
publication title X-ray structure of a protein-conducting channel
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Protein transport
total genus 22
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.820 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Preprotein translocase SecE subunit 1rh5B00
3JC22 1RH5B 2YXQB 2YXRB 1RHZB 3MP7B
chains in the Genus database with same CATH superfamily
2WPRA 3NXSA 3VN0A 3EQ2A 2YIUB 2KNCA 4IFMA 2WITA 1KYOD 5K5GB 1GMJA 1KQLA 3RK3D 1AVOA 2H7HA 1DD3A 1EDKA 2LXBA 5APXA 3B8EB 3CCVP 4HKZH 5AVVB 1Z56A 3RK3C 3A3YB 1URQD 3N7NA 1SQQK 5AVUB 1SQQE 3H1ID 4D6TE 2FY8A 1IK9A 5AW9B 2QG4A 1R5SA 2OYHA 2P58A 5APTA 4AUWA 2KP8A 4I7ZC 2E43A 2JO1A 1FDOA 1SFCC 2XV5A 3KQGA 2ZFCA 2R3SA 1EZVI 2XNXA 2I1JA 1NU1K 1PGPA 1EC5A 3M0AA 2K37A 1NU1E 1VPCA 1KQFB 1CW5A 4H13D 5B66E 3HE5A 1HTLC 1H0TA 3KZIE 4H13C 4N3YB 5KKZB 2Y0CA 2E76D 2C9NY 2IFMA 4OGQD 4RJTA 5AW0B 4OGQC 2QA4P 1NHLA 1SQXG 2W6JH 3RBZA 3AEBC 1FJKA 1ZR2A 4N6JA 5E79E 3TNUB 2OTLP 3BRTB 5APUA 2ZVNB 2IFNA 1HUCA 1RH5B 1N2DC 3AEDC 1CZQA 3HD7B 4I2LC 3AE1C 3FX0A 1QEXA 3H1HG 5AVTB 5AVZB 3A0BH 1KB9E 3HTKB 1FDMA 1M56D 3L73D 3MGNA 3FGAD 2V7QJ 2FKWB 1RF1A 3ABVC 1L0NJ 3L72D 3CX5H 3EFGA 2JDIH 1GU5A 1BGYD 1N7SD 5TISH 1N7SC 5CJ4A 2C9LY 2IYOA 5AW4B 2WT7B 5H2FH 3TGUD 3C8VA 5KAIH 2KB7P 3CMAP 1E5WA 1R5LA 2FXMA 1KORA 3D6YA 3H1KJ 2QM7A 1KQSO 3PJSK 4M3LA 3Q5PA 5CCHA 2WPSA 3GHGB 1KZUB 1G1IA 2WWWA 1NKNA 3W67A 3AEAC 4PD4H 3VP9A 4NPDA 1GK6A 2RMZA 3U59A 1LTJA 3KPEA 1KILC 1W5CE 1U7MA 1X8YA 1PFIA 2O01H 1S1CX 5KLVJ 1VQLP 5AVSB 3FWNA 2PAJA 3L74E 1OW8A 3G9RA 1M1JC 5AW3B 3WUTA 2FYUJ 1FZBA 3A5TA 5KJ7D 1NTMJ 1PP9G 4W80A 1JTHB 2KS1A 1PGQA 5KJ7C 2B87B 2WSCH 2N1TA 1AQTA 2R5BA 1RHZB 5CCGD 2KSEA 1CSBA 1DIPA 3QH9A 3E1IA 5CCGC 4YXWH 3FXEA 1BCCG 1NOHA 2PGDA 2VRSA 3AE7C 1RQVA 3H32A 4GOFA 1BE3G 1SQPG 2YNYA 1EQ7A 1VQKP 4PJ0H 2P7JA 3A7OA 4MN4C 1SQBK 3NTNA 1RY3A 4KJMA 1SQBE 3L4FA 2FYNB 1GU4A 1KYOI 3L70D 3H1IJ 3Q3DA 2WPVB 2HODA 1FBMA 3ZDMA 2NZ2A 1FU1A 4O9BA 1EZVG 1PGOA 1FE6A 2BASA 1PIXA 3CD6P 3CX5D 2QJPB 1VF5C 2WSSH 1RE4C 1YYCA 3L36A 2RH0A 2N9BA 3WUUA 1MUUA 4IL6E 4DT0A 3O6QA 2QJKC 3MHVA 2LKMA 1ZRTD 3GG2A 1ZN5A 5AW8B 1LNQA 2BCCD 3RK3B 1Q82Q 5AVWB 1XTGB 3PLNA 2LR2A 4BRYA 1URQB 1S9KD 3II6A 1EDIA 1OMIA 1DEBA 5B66H 3BVHA 3KZIH 3EWKA 1OFCX 2LXCB 1Q86Q 2R3CA 4PD4D 1M1JA 2KK7A 1AJYA 3H25A 2R44A 1Q90D 2YO3A 3G3ZA 4XE5B 5AVQB 1NTKD 1K8AQ 3NFQA 3CC4P 1JY2O 1JUNA 5E79H 1JB0J 4U3FE 2O1KA 3G4SP 4HB1A 1NTKG 2KSJA 3OAKA 1VDFA 5BVZA 3L73J 3V4QA 2O1JA 1FDIA 3B5NB 1SQVD 2E75D 2E76B 2WZ7A 1NTZK 1L0ND 2E75C 3L72J 2K9JA 2KUBA 1NTZE 3SWFA 1BGYJ 1PPJE 1JM0A 4ASWA 1NAFA 2KI7B 3E7KA 1KB9H 1L0NG 3BCCE 2D2CD 3L71D 4ASVA 1FAVA 3WUVA 3TGUJ 2HYNA 2KXPB 2E42A 5KAFE 2D2CC 3GF7A 2OYHC 2QJYC 1FZFA 5AVYB 4PV1B 4AQRD 2ZXXA 3V6IA 2PP6A 1J1EC 1K73Q 3CCLP 2N9YB 3H1KG 5CHXA 3AE5C 3TF5A 3TNUA 4K3AA 1LWUB 3CPWO 2Y0EA 4GODA 3AE4C 1NJIQ 4ZMDA 3MTUE 1JY3P 2IBZI 1P84E 2ZT9D 2M5AA 3GLMA 1YQ4C 2L91A 1N7SB 3PH0A 3T97B 2ZT9C 1MV8A 5KLVD 3VMZA 3CWBD 1KFNA 1H88A 3HTKA 2HPCA 5KLVG 3JSVC 3H1JE 3E1RA 2E74D 4WVZA 2QEXP 1SQQD 4UB6E 4D6TD 2YKOA 4C7RA 4DJGA 2E74C 1IFMA 4ZKPA 3JCUE 4GKGA 1FS0E 2FYUG 1VQ5P 1NTMG 3P8MC 4JPZB 2O3JA 3IR9A 1NU1D 3UIAA 2WT7A 1NYHA 2QM8A 3L75D 1FZCB 1YITP 4H0LD 3H1LE 4WB4A 1RF1C 5APSA 4H0LC 4L73A 3G71P 3PRJA 1J2JB 3L75G 1M90Q 1OW7A 1GD2E 1OVVA 3C1LA 2NPSB 4DZOA 3GW6A 5APYA 1JEKA 3R4YA 2H89C 2CPBA 1T6AA 1AA0A 3L70J 1ZP0C 1SFCD 3HUSA 3SWYA 1SVFA 5CCHD 4TLFA 5AVRB 4B86A 5CCHC 4IFDK 3H1IG 2W83C 2Q5UA 2ZJSE 1IFNA 5C39A 1AQ5A 1JO5A 2KIKA 1KB9D 3M91A 2KOGA 1LTJC 1N73B 1JMBA 3CX5I 2YXQB 1JTHA 4NPFX 1HF9A 4N78E 2B87A 1K05A 2QSIA 2WMMA 2BCCJ 1JY3N 4DCKA 1L0LD 5B5EE 4IL6H 3OW2O 1Y9BA 1GW3A 1J1DC 2QE7H 2MJZA 1L0LG 1PZQA 3V2PA 3V2RA 2N1TD 2WPQA 1IK7A 1LT9B 1JY3O 2N1TC 1Q81Q 1IO4A 1NTKJ 2A06D 1FC2C 2IPPA 4XFJA 4PD4I 2O01J 1FJPA 3AECC 4NPEA 1OIPA 2POHA 3KXDA 2KZJA 3NMDA 2A06G 1Y47A 1QGKB 1SQVJ 2P67A 4H44B 2GUVA 1IFJA 3RK2B 3V2NA 3L73G 3TK1A 5AVXB 2KYVA 2WSCJ 3IN6A 1SQXK 4BXLA 2HFED 1DH3A 3L72G 1SQXE 2H88C 3CCUP 3L71J 1BGYG 1D7MA 2GUSA 2G8YA 4WBAA 3RL0D 3VP8A 4LC1A 1X0TA 3RL0C 1LGHB 1S5LE 1L4AB 2P2UA 5GTHE 3TGUG 1N7LA 2V4HA 3V4WA 1URQA 3H1HE 1EXIA 1T8ZA 2YO2A 2IBZD 2OYIB 3VMYA 1DEEG 1EDLA 2AXTE 1KILD 3LW5H 3TSIA 3HE4A 4L75A 2IBZG 2FXPA 1U7JA 2BEZF 4R4MA 5AW5B 1GW4A 3S9OA 3L73E 4U7JA 5AW6B 3CWBJ 3VMXA 1JY2P 4WWIA 2O01N 1SQBD 2PRRA 2YIUC 2R5DA 1BGYE 3B5NA 1SQQJ 4D6TJ 1OWAA 1HBWA 5L8RJ 5AW7B 1P84H 1HJBA 3GF3A 2OTJP 4EDFA 1EXJA 1NH4A 1OVRA 4XA4A 2IDBA 2H43A 1HGVA 1M7LA 1NU1J 1VQ4P 3L75J 3LIEA 1YTZI 2Q7CA 3AEEC 4UB6H 2IZ0A 1VQ9P 2FFDB 3CXHI 1LTTC 3S4RA 2ZT9B 3JCUH 2RN0A 1GL2B 3SSUA 2M0BA 3CCRP 4IFFA 2R32A 3A2AA 2Z5HA 2KZIA 2OQQA 1H89A 1LWUA 4KT0J 2CK3H 5KKZC 2G3AA 5EFWB 1QX8A 3WU2E 1LP1B 1QVGO 4OH8B 1LT1A 5APWA 1NVOA 2AEFA 3AE3C 1PP9E 3AEGC 3L70G 1VF5D 5CJ0A 1FZEA 2A45H 4YXDC 4WY4B 5KLIB 3CL3D 2ZXEB 4CPGA 2JEEA 1QVFO 2HG5D 3CXHE 1RF1B 4U3FD 1BCCE 3AE2C 1RF0A 2E5TA 3HD7C 2SPZA 2OARA 2ITAA 1MFTA 1OX3A 2JKVA 1SQPK 3I5CA 1K04A 1BE3E 1SQPE 1KB9I 1NTZD 5GTIE 1L0LJ 1PPJD 1VQ8P 1FOSE 1BDCA 1W2EA 2YMKA 2I8DA 3CCEP 1JY2N 2BCCG 1YJ9P 2Y9YA 1FZCA 3BCCD 1N86A 4I7ZB 2YMYA 3M9BA 1SFCB 2RKLA 3CLQA 4I1LA 1LTGC 2NPSA 3CI9A 1EZVE 2B88A 1YIJP 1VL2A 5B5EH 4Y99C 2E5YA 1KN7A 1LTJB 3I56P 2CPSA 1KQGB 4GOEA 3FWLA 3RGUA 2XKMA 1QLED 4H13B 1FZAA 3N4XA 1ZXGA 3BATA 3JC22 1Q7YQ 4OGQB 3VTPC 3MP7B 1P84D 3C9IA 2OTKE 1USEA 2FYZA 1SQVG 4HYTB 1RQUA 2K9YA 5CBNA 1J1DB 3AE8C 5DJUB 2PFXA 1KFMA 3HUSC 1N73A 1MKMA 2Q3EA 3H1JD 1JCDA 2AXCA 3F5HA 1S9KE 2ZYAA 3L71G 4LLHA 3Q1MA 1PL5A 2YKQA 3MD0A 2Q3IA 1T2KD 3MZWB 1T2KC 1LTBC 1NTKK 1X9VA 1W2BO 2Z4EA 3CCMP 1NTKE 1S5LH 5AW1B 3H1LD 3P7KA 5GTHH 1G2CB 2KLVA 3HD7A 1L2PA 3P8CE 3Q5SA 1NO4A 1IFDA 3VYIA 3SFDC 2IYPA 1OVUA 1L0NK 2IX7C 2HODB 2J59M 1L0NE 2AXTH 1M8OB 1SQBJ 3M06A 2WSEH 3RL0B 1HH0A 2AEJA 4OWFA 3CWBG 3PHLA 1KV4A 3KHUA 2J5UA 4GT1A 3MUDA 3G6EP 1SQQG 4D6TG 4TT3H 4C7NB 3RL0g 2FYNC 1TU3F 1N8RQ 4RESB 1OW6A 3H1KE 3BASA 2XDJA 1KILB 2JR8A 3CCJP 3R2PA 1SS1A 1L4AA 1NU1G 2NRGA 4ZKUA 2WSFH 2YKPA 4N78D 1ZV8A 1BDDA 2QJPC 1LJ2A 4GDOA 1DD4A 3AE9C 4EI2A 3GHGA 1CI6B 2HR3A 3TYYA 2OYIA 1M1JB 3USSA 5KLVK 2YXRB 5KLVE 1JMMA 3CWBE 3O8ZA 2QIWA 1URQC 3V2QA 2FYUK 1HVVA 2FYUE 1NTMK 2ZYGA 1GTWA 1NTME 1Q2NA 3A0HE 2MKVA 3FXDA 4U3FJ 3V5BA 2K9JB 3WU2H 2M8RA 3PTZA 1WRGA 4HH2A 1NKZB 2W6AA 1RE3A 1KD1Q 1VQMP 1ZLLA 3L75E 1NTZJ 5DJTB 1BSHA 1X22A 3B5ND 3CXHH 2OYOA 1IJDB 1SQXD 4JBZA 1KYOE 2I1KA 3CC2P 3BCCJ 3B5NC 2E76C 3RK3E 2FFDA 1S3JA 2HLOA 1T3JA 2Q1KA 3LW5J 1GL2A 3L37A 4L76A 5GTIH 2JWAA 1VF5B 2P10A 2Q6QA 4UB8E 3H1IE 4YTPC 2K1AA 3H1HD 3D70A 3KDPB 2QJKB 4PV1D 1U57A 1YJWP 2M5AB 1LP1A 4PV1C 2AEMA 1DX7A 1ZW0A 2Z5IA 4Y28J 4WY4A 3KYQA 2HPCB 1S4XA 1LWUC 4IL6X 3I55P 1L0LK 4L74A 1P84I 3L74D 1K9MQ 1AFOA 2IZ1A 1L0LE 5TJHA 1LTSC 3TDKA 3B4SA 3H1JJ 3M9HA 1UIXA 4KHXA 2C0XA 3VMAA 4Y99B 1IZNB 3EFFK 3L74G 4JF7A 1MZ9A 1S72P 2WTYA 1OXZA 3S1KA 2KNCB 5KAFH 4DOJA 3SWKA 1RF0C 1QL2A 1SFCA 3IAOA 2L5GB 3H1LJ 2E75B 2A06E 1YI2P 4BWNA 1UIIA 1YQ3C 4QMAA 3U1CA 1VQ6P 2ZVOB 3IF4A 3LIDA 1PGJA 2M3EA 3M0DC 4Z1MH 1FZCC 2W90A 2D2CB 3HUSB 2OYHB 3L72E 2QJYB 1JOCA 2FBWC 3AEFC 2NPSD 1NWQA 3AE6C 5CBOA 1M1KQ 1J1EB 2A45I 1SQBG 2NPSC 2Y9ZA 2XU6A 1PP9D 3TGUE 3D71A 2V7QH 1VQOP 2B9BA 1JNMA 1Y8AA 3HE5B 3CC7P 1H0TB 3HRNA 2XZRA 3U1AA 2BEQD 3CXHD 5CMZA 4R4LA 1BCCD 2IBZE 1USDA 2Q9IA 1OZHA 1GZLA 3Q5RA 1KILE 1BE3D 1SQPD 1A02F 2XNDH 3Q2YA 2ZAEB 1X79B 3P32A 1JCCA 3GMAA 2B89A 4ZNCA 1NGMB 1N73C 5APVA 1AVYA 3BRVB 2E74B 4GIFA 3VOPA 1G2CA 3MIWA 1VQNP 1N7SA 3T97A 1EZVD 2WVRA 3F89A 1ZMEC 1VQ7P 1SP4A 4W7ZA 2C0WA 4H0LB 3HD7D 1LT9C 4K35A 1IFPA 1XTCC 3ITKA 3H6PA 3SFEC 1GK4A 2ZYDA 2WQYC 5M1BA 3W68A 4U3FG 3RBXA 4C7NA 1PV3A 2W6BA 1QL1A 3CCSP 2KLUA 5BU5A 4HJGH 1A02J 4JYCA 4A7PA 3A0HH 3IFMA 4H44D 4I6MC 3M0DA 1KC8Q 1SLQA 4LGDE 1SQXJ 1KILA 1NTZG 4H44C 1PPJG 3K5BA 3RK2D 3MUDC 3RK2C 2H8PD 3BCCG 1IC2A 2K88A 3A0BE 1S2EA 1ZOYC 3L70E 1YHQP 1CI6A 4JYBA 4YPCA 3H1HJ 2JP3A 3HE4B 1KYOH 1SQPJ 1G1JA 1L4AD 4JQ0D 1FZGA 4EYYQ 1L4AC 1R8EA 3CX5E 5KJ7A 2WSEJ 1NAYA 1H8AA 5TISE 3WMM0 3B71A 2Y0DA 4UB8H 4OVNF 3P8CD 3GHGC 1E79H 1MFZA 2OYIC 5CCGA 4RO0A 5H2FE 1ZRTE 5KAIE 4RKUJ 4IOIH 2BCCE 2W8ZA 2KS1B 3CCQP 3L74J 2QVAA 2N1TB 2OGUA 1EDJA 1WT6A 5APQA 2JJLA 2WSFJ 1VQPP 3CMEP 3H1JG 4PD4E 1GDTA 4W7YA 1HGZA 3H32B 1YJNP 1T3UA 2W27A 2GA1A 3H1KD 1RE3C 1LTAC 2FXOA 1LT9A 5KTBA 1HWTC 1RE4A 3H1LG 2DW3A 1SQVK 1FOSF 3QWOC 1SQVE 2UWJE 5BU8B 1YTZT 2FFDC 2JWDA 2P1JA 2GM4A 1GL2D 1M57D 1BSNA 2A45G 1KMIZ 3OA7A 1GL2C 4EIJA 3L71E 1WMKA 1PP9J 3PP5A 1HJ0A 3O6QB 2FYUD 3M9QA 1AV1A 2M3BA 1NTMD 4EOTA 3OJAB 1BCCJ 2J58A 3D6ZA 3L35A 4PJ0E 1ZR4A 4BRYB 1S5LX 1LTIC 1YBKA 4WY4D 5AW2B 4C46A 1KTMA 4AYCA 2QRXA 4WY4C 1IFIA 5KLIC 2K3RA 1BE3J
chains in the Genus database with same CATH topology
3JC22 1RH5B 2YXQB 2YXRB 1RHZB 3MP7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JC2 2;  1RH5 B;  2YXQ B;  2YXR B;  1RHZ B;  3MP7 B; 
#chains in the Genus database with same CATH topology
 2WPR A;  3NXS A;  3VN0 A;  3EQ2 A;  2YIU B;  2KNC A;  4IFM A;  2WIT A;  1KYO D;  5K5G B;  1GMJ A;  1KQL A;  3RK3 D;  1AVO A;  2H7H A;  1DD3 A;  1EDK A;  2LXB A;  5APX A;  3B8E B;  3CCV P;  4HKZ H;  5AVV B;  1Z56 A;  3RK3 C;  3A3Y B;  1URQ D;  3N7N A;  1SQQ K;  5AVU B;  1SQQ E;  3H1I D;  4D6T E;  2FY8 A;  1IK9 A;  5AW9 B;  2QG4 A;  1R5S A;  2OYH A;  2P58 A;  5APT A;  4AUW A;  2KP8 A;  4I7Z C;  2E43 A;  2JO1 A;  1FDO A;  1SFC C;  2XV5 A;  3KQG A;  2ZFC A;  2R3S A;  1EZV I;  2XNX A;  2I1J A;  1NU1 K;  1PGP A;  1EC5 A;  3M0A A;  2K37 A;  1NU1 E;  1VPC A;  1KQF B;  1CW5 A;  4H13 D;  5B66 E;  3HE5 A;  1HTL C;  1H0T A;  3KZI E;  4H13 C;  4N3Y B;  5KKZ B;  2Y0C A;  2E76 D;  2C9N Y;  2IFM A;  4OGQ D;  4RJT A;  5AW0 B;  4OGQ C;  2QA4 P;  1NHL A;  1SQX G;  2W6J H;  3RBZ A;  3AEB C;  1FJK A;  1ZR2 A;  4N6J A;  5E79 E;  3TNU B;  2OTL P;  3BRT B;  5APU A;  2ZVN B;  2IFN A;  1HUC A;  1RH5 B;  1N2D C;  3AED C;  1CZQ A;  3HD7 B;  4I2L C;  3AE1 C;  3FX0 A;  1QEX A;  3H1H G;  5AVT B;  5AVZ B;  3A0B H;  1KB9 E;  3HTK B;  1FDM A;  1M56 D;  3L73 D;  3MGN A;  3FGA D;  2V7Q J;  2FKW B;  1RF1 A;  3ABV C;  1L0N J;  3L72 D;  3CX5 H;  3EFG A;  2JDI H;  1GU5 A;  1BGY D;  1N7S D;  5TIS H;  1N7S C;  5CJ4 A;  2C9L Y;  2IYO A;  5AW4 B;  2WT7 B;  5H2F H;  3TGU D;  3C8V A;  5KAI H;  2KB7 P;  3CMA P;  1E5W A;  1R5L A;  2FXM A;  1KOR A;  3D6Y A;  3H1K J;  2QM7 A;  1KQS O;  3PJS K;  4M3L A;  3Q5P A;  5CCH A;  2WPS A;  3GHG B;  1KZU B;  1G1I A;  2WWW A;  1NKN A;  3W67 A;  3AEA C;  4PD4 H;  3VP9 A;  4NPD A;  1GK6 A;  2RMZ A;  3U59 A;  1LTJ A;  3KPE A;  1KIL C;  1W5C E;  1U7M A;  1X8Y A;  1PFI A;  2O01 H;  1S1C X;  5KLV J;  1VQL P;  5AVS B;  3FWN A;  2PAJ A;  3L74 E;  1OW8 A;  3G9R A;  1M1J C;  5AW3 B;  3WUT A;  2FYU J;  1FZB A;  3A5T A;  5KJ7 D;  1NTM J;  1PP9 G;  4W80 A;  1JTH B;  2KS1 A;  1PGQ A;  5KJ7 C;  2B87 B;  2WSC H;  2N1T A;  1AQT A;  2R5B A;  1RHZ B;  5CCG D;  2KSE A;  1CSB A;  1DIP A;  3QH9 A;  3E1I A;  5CCG C;  4YXW H;  3FXE A;  1BCC G;  1NOH A;  2PGD A;  2VRS A;  3AE7 C;  1RQV A;  3H32 A;  4GOF A;  1BE3 G;  1SQP G;  2YNY A;  1EQ7 A;  1VQK P;  4PJ0 H;  2P7J A;  3A7O A;  4MN4 C;  1SQB K;  3NTN A;  1RY3 A;  4KJM A;  1SQB E;  3L4F A;  2FYN B;  1GU4 A;  1KYO I;  3L70 D;  3H1I J;  3Q3D A;  2WPV B;  2HOD A;  1FBM A;  3ZDM A;  2NZ2 A;  1FU1 A;  4O9B A;  1EZV G;  1PGO A;  1FE6 A;  2BAS A;  1PIX A;  3CD6 P;  3CX5 D;  2QJP B;  1VF5 C;  2WSS H;  1RE4 C;  1YYC A;  3L36 A;  2RH0 A;  2N9B A;  3WUU A;  1MUU A;  4IL6 E;  4DT0 A;  3O6Q A;  2QJK C;  3MHV A;  2LKM A;  1ZRT D;  3GG2 A;  1ZN5 A;  5AW8 B;  1LNQ A;  2BCC D;  3RK3 B;  1Q82 Q;  5AVW B;  1XTG B;  3PLN A;  2LR2 A;  4BRY A;  1URQ B;  1S9K D;  3II6 A;  1EDI A;  1OMI A;  1DEB A;  5B66 H;  3BVH A;  3KZI H;  3EWK A;  1OFC X;  2LXC B;  1Q86 Q;  2R3C A;  4PD4 D;  1M1J A;  2KK7 A;  1AJY A;  3H25 A;  2R44 A;  1Q90 D;  2YO3 A;  3G3Z A;  4XE5 B;  5AVQ B;  1NTK D;  1K8A Q;  3NFQ A;  3CC4 P;  1JY2 O;  1JUN A;  5E79 H;  1JB0 J;  4U3F E;  2O1K A;  3G4S P;  4HB1 A;  1NTK G;  2KSJ A;  3OAK A;  1VDF A;  5BVZ A;  3L73 J;  3V4Q A;  2O1J A;  1FDI A;  3B5N B;  1SQV D;  2E75 D;  2E76 B;  2WZ7 A;  1NTZ K;  1L0N D;  2E75 C;  3L72 J;  2K9J A;  2KUB A;  1NTZ E;  3SWF A;  1BGY J;  1PPJ E;  1JM0 A;  4ASW A;  1NAF A;  2KI7 B;  3E7K A;  1KB9 H;  1L0N G;  3BCC E;  2D2C D;  3L71 D;  4ASV A;  1FAV A;  3WUV A;  3TGU J;  2HYN A;  2KXP B;  2E42 A;  5KAF E;  2D2C C;  3GF7 A;  2OYH C;  2QJY C;  1FZF A;  5AVY B;  4PV1 B;  4AQR D;  2ZXX A;  3V6I A;  2PP6 A;  1J1E C;  1K73 Q;  3CCL P;  2N9Y B;  3H1K G;  5CHX A;  3AE5 C;  3TF5 A;  3TNU A;  4K3A A;  1LWU B;  3CPW O;  2Y0E A;  4GOD A;  3AE4 C;  1NJI Q;  4ZMD A;  3MTU E;  1JY3 P;  2IBZ I;  1P84 E;  2ZT9 D;  2M5A A;  3GLM A;  1YQ4 C;  2L91 A;  1N7S B;  3PH0 A;  3T97 B;  2ZT9 C;  1MV8 A;  5KLV D;  3VMZ A;  3CWB D;  1KFN A;  1H88 A;  3HTK A;  2HPC A;  5KLV G;  3JSV C;  3H1J E;  3E1R A;  2E74 D;  4WVZ A;  2QEX P;  1SQQ D;  4UB6 E;  4D6T D;  2YKO A;  4C7R A;  4DJG A;  2E74 C;  1IFM A;  4ZKP A;  3JCU E;  4GKG A;  1FS0 E;  2FYU G;  1VQ5 P;  1NTM G;  3P8M C;  4JPZ B;  2O3J A;  3IR9 A;  1NU1 D;  3UIA A;  2WT7 A;  1NYH A;  2QM8 A;  3L75 D;  1FZC B;  1YIT P;  4H0L D;  3H1L E;  4WB4 A;  1RF1 C;  5APS A;  4H0L C;  4L73 A;  3G71 P;  3PRJ A;  1J2J B;  3L75 G;  1M90 Q;  1OW7 A;  1GD2 E;  1OVV A;  3C1L A;  2NPS B;  4DZO A;  3GW6 A;  5APY A;  1JEK A;  3R4Y A;  2H89 C;  2CPB A;  1T6A A;  1AA0 A;  3L70 J;  1ZP0 C;  1SFC D;  3HUS A;  3SWY A;  1SVF A;  5CCH D;  4TLF A;  5AVR B;  4B86 A;  5CCH C;  4IFD K;  3H1I G;  2W83 C;  2Q5U A;  2ZJS E;  1IFN A;  5C39 A;  1AQ5 A;  1JO5 A;  2KIK A;  1KB9 D;  3M91 A;  2KOG A;  1LTJ C;  1N73 B;  1JMB A;  3CX5 I;  2YXQ B;  1JTH A;  4NPF X;  1HF9 A;  4N78 E;  2B87 A;  1K05 A;  2QSI A;  2WMM A;  2BCC J;  1JY3 N;  4DCK A;  1L0L D;  5B5E E;  4IL6 H;  3OW2 O;  1Y9B A;  1GW3 A;  1J1D C;  2QE7 H;  2MJZ A;  1L0L G;  1PZQ A;  3V2P A;  3V2R A;  2N1T D;  2WPQ A;  1IK7 A;  1LT9 B;  1JY3 O;  2N1T C;  1Q81 Q;  1IO4 A;  1NTK J;  2A06 D;  1FC2 C;  2IPP A;  4XFJ A;  4PD4 I;  2O01 J;  1FJP A;  3AEC C;  4NPE A;  1OIP A;  2POH A;  3KXD A;  2KZJ A;  3NMD A;  2A06 G;  1Y47 A;  1QGK B;  1SQV J;  2P67 A;  4H44 B;  2GUV A;  1IFJ A;  3RK2 B;  3V2N A;  3L73 G;  3TK1 A;  5AVX B;  2KYV A;  2WSC J;  3IN6 A;  1SQX K;  4BXL A;  2HFE D;  1DH3 A;  3L72 G;  1SQX E;  2H88 C;  3CCU P;  3L71 J;  1BGY G;  1D7M A;  2GUS A;  2G8Y A;  4WBA A;  3RL0 D;  3VP8 A;  4LC1 A;  1X0T A;  3RL0 C;  1LGH B;  1S5L E;  1L4A B;  2P2U A;  5GTH E;  3TGU G;  1N7L A;  2V4H A;  3V4W A;  1URQ A;  3H1H E;  1EXI A;  1T8Z A;  2YO2 A;  2IBZ D;  2OYI B;  3VMY A;  1DEE G;  1EDL A;  2AXT E;  1KIL D;  3LW5 H;  3TSI A;  3HE4 A;  4L75 A;  2IBZ G;  2FXP A;  1U7J A;  2BEZ F;  4R4M A;  5AW5 B;  1GW4 A;  3S9O A;  3L73 E;  4U7J A;  5AW6 B;  3CWB J;  3VMX A;  1JY2 P;  4WWI A;  2O01 N;  1SQB D;  2PRR A;  2YIU C;  2R5D A;  1BGY E;  3B5N A;  1SQQ J;  4D6T J;  1OWA A;  1HBW A;  5L8R J;  5AW7 B;  1P84 H;  1HJB A;  3GF3 A;  2OTJ P;  4EDF A;  1EXJ A;  1NH4 A;  1OVR A;  4XA4 A;  2IDB A;  2H43 A;  1HGV A;  1M7L A;  1NU1 J;  1VQ4 P;  3L75 J;  3LIE A;  1YTZ I;  2Q7C A;  3AEE C;  4UB6 H;  2IZ0 A;  1VQ9 P;  2FFD B;  3CXH I;  1LTT C;  3S4R A;  2ZT9 B;  3JCU H;  2RN0 A;  1GL2 B;  3SSU A;  2M0B A;  3CCR P;  4IFF A;  2R32 A;  3A2A A;  2Z5H A;  2KZI A;  2OQQ A;  1H89 A;  1LWU A;  4KT0 J;  2CK3 H;  5KKZ C;  2G3A A;  5EFW B;  1QX8 A;  3WU2 E;  1LP1 B;  1QVG O;  4OH8 B;  1LT1 A;  5APW A;  1NVO A;  2AEF A;  3AE3 C;  1PP9 E;  3AEG C;  3L70 G;  1VF5 D;  5CJ0 A;  1FZE A;  2A45 H;  4YXD C;  4WY4 B;  5KLI B;  3CL3 D;  2ZXE B;  4CPG A;  2JEE A;  1QVF O;  2HG5 D;  3CXH E;  1RF1 B;  4U3F D;  1BCC E;  3AE2 C;  1RF0 A;  2E5T A;  3HD7 C;  2SPZ A;  2OAR A;  2ITA A;  1MFT A;  1OX3 A;  2JKV A;  1SQP K;  3I5C A;  1K04 A;  1BE3 E;  1SQP E;  1KB9 I;  1NTZ D;  5GTI E;  1L0L J;  1PPJ D;  1VQ8 P;  1FOS E;  1BDC A;  1W2E A;  2YMK A;  2I8D A;  3CCE P;  1JY2 N;  2BCC G;  1YJ9 P;  2Y9Y A;  1FZC A;  3BCC D;  1N86 A;  4I7Z B;  2YMY A;  3M9B A;  1SFC B;  2RKL A;  3CLQ A;  4I1L A;  1LTG C;  2NPS A;  3CI9 A;  1EZV E;  2B88 A;  1YIJ P;  1VL2 A;  5B5E H;  4Y99 C;  2E5Y A;  1KN7 A;  1LTJ B;  3I56 P;  2CPS A;  1KQG B;  4GOE A;  3FWL A;  3RGU A;  2XKM A;  1QLE D;  4H13 B;  1FZA A;  3N4X A;  1ZXG A;  3BAT A;  3JC2 2;  1Q7Y Q;  4OGQ B;  3VTP C;  3MP7 B;  1P84 D;  3C9I A;  2OTK E;  1USE A;  2FYZ A;  1SQV G;  4HYT B;  1RQU A;  2K9Y A;  5CBN A;  1J1D B;  3AE8 C;  5DJU B;  2PFX A;  1KFM A;  3HUS C;  1N73 A;  1MKM A;  2Q3E A;  3H1J D;  1JCD A;  2AXC A;  3F5H A;  1S9K E;  2ZYA A;  3L71 G;  4LLH A;  3Q1M A;  1PL5 A;  2YKQ A;  3MD0 A;  2Q3I A;  1T2K D;  3MZW B;  1T2K C;  1LTB C;  1NTK K;  1X9V A;  1W2B O;  2Z4E A;  3CCM P;  1NTK E;  1S5L H;  5AW1 B;  3H1L D;  3P7K A;  5GTH H;  1G2C B;  2KLV A;  3HD7 A;  1L2P A;  3P8C E;  3Q5S A;  1NO4 A;  1IFD A;  3VYI A;  3SFD C;  2IYP A;  1OVU A;  1L0N K;  2IX7 C;  2HOD B;  2J59 M;  1L0N E;  2AXT H;  1M8O B;  1SQB J;  3M06 A;  2WSE H;  3RL0 B;  1HH0 A;  2AEJ A;  4OWF A;  3CWB G;  3PHL A;  1KV4 A;  3KHU A;  2J5U A;  4GT1 A;  3MUD A;  3G6E P;  1SQQ G;  4D6T G;  4TT3 H;  4C7N B;  3RL0 g;  2FYN C;  1TU3 F;  1N8R Q;  4RES B;  1OW6 A;  3H1K E;  3BAS A;  2XDJ A;  1KIL B;  2JR8 A;  3CCJ P;  3R2P A;  1SS1 A;  1L4A A;  1NU1 G;  2NRG A;  4ZKU A;  2WSF H;  2YKP A;  4N78 D;  1ZV8 A;  1BDD A;  2QJP C;  1LJ2 A;  4GDO A;  1DD4 A;  3AE9 C;  4EI2 A;  3GHG A;  1CI6 B;  2HR3 A;  3TYY A;  2OYI A;  1M1J B;  3USS A;  5KLV K;  2YXR B;  5KLV E;  1JMM A;  3CWB E;  3O8Z A;  2QIW A;  1URQ C;  3V2Q A;  2FYU K;  1HVV A;  2FYU E;  1NTM K;  2ZYG A;  1GTW A;  1NTM E;  1Q2N A;  3A0H E;  2MKV A;  3FXD A;  4U3F J;  3V5B A;  2K9J B;  3WU2 H;  2M8R A;  3PTZ A;  1WRG A;  4HH2 A;  1NKZ B;  2W6A A;  1RE3 A;  1KD1 Q;  1VQM P;  1ZLL A;  3L75 E;  1NTZ J;  5DJT B;  1BSH A;  1X22 A;  3B5N D;  3CXH H;  2OYO A;  1IJD B;  1SQX D;  4JBZ A;  1KYO E;  2I1K A;  3CC2 P;  3BCC J;  3B5N C;  2E76 C;  3RK3 E;  2FFD A;  1S3J A;  2HLO A;  1T3J A;  2Q1K A;  3LW5 J;  1GL2 A;  3L37 A;  4L76 A;  5GTI H;  2JWA A;  1VF5 B;  2P10 A;  2Q6Q A;  4UB8 E;  3H1I E;  4YTP C;  2K1A A;  3H1H D;  3D70 A;  3KDP B;  2QJK B;  4PV1 D;  1U57 A;  1YJW P;  2M5A B;  1LP1 A;  4PV1 C;  2AEM A;  1DX7 A;  1ZW0 A;  2Z5I A;  4Y28 J;  4WY4 A;  3KYQ A;  2HPC B;  1S4X A;  1LWU C;  4IL6 X;  3I55 P;  1L0L K;  4L74 A;  1P84 I;  3L74 D;  1K9M Q;  1AFO A;  2IZ1 A;  1L0L E;  5TJH A;  1LTS C;  3TDK A;  3B4S A;  3H1J J;  3M9H A;  1UIX A;  4KHX A;  2C0X A;  3VMA A;  4Y99 B;  1IZN B;  3EFF K;  3L74 G;  4JF7 A;  1MZ9 A;  1S72 P;  2WTY A;  1OXZ A;  3S1K A;  2KNC B;  5KAF H;  4DOJ A;  3SWK A;  1RF0 C;  1QL2 A;  1SFC A;  3IAO A;  2L5G B;  3H1L J;  2E75 B;  2A06 E;  1YI2 P;  4BWN A;  1UII A;  1YQ3 C;  4QMA A;  3U1C A;  1VQ6 P;  2ZVO B;  3IF4 A;  3LID A;  1PGJ A;  2M3E A;  3M0D C;  4Z1M H;  1FZC C;  2W90 A;  2D2C B;  3HUS B;  2OYH B;  3L72 E;  2QJY B;  1JOC A;  2FBW C;  3AEF C;  2NPS D;  1NWQ A;  3AE6 C;  5CBO A;  1M1K Q;  1J1E B;  2A45 I;  1SQB G;  2NPS C;  2Y9Z A;  2XU6 A;  1PP9 D;  3TGU E;  3D71 A;  2V7Q H;  1VQO P;  2B9B A;  1JNM A;  1Y8A A;  3HE5 B;  3CC7 P;  1H0T B;  3HRN A;  2XZR A;  3U1A A;  2BEQ D;  3CXH D;  5CMZ A;  4R4L A;  1BCC D;  2IBZ E;  1USD A;  2Q9I A;  1OZH A;  1GZL A;  3Q5R A;  1KIL E;  1BE3 D;  1SQP D;  1A02 F;  2XND H;  3Q2Y A;  2ZAE B;  1X79 B;  3P32 A;  1JCC A;  3GMA A;  2B89 A;  4ZNC A;  1NGM B;  1N73 C;  5APV A;  1AVY A;  3BRV B;  2E74 B;  4GIF A;  3VOP A;  1G2C A;  3MIW A;  1VQN P;  1N7S A;  3T97 A;  1EZV D;  2WVR A;  3F89 A;  1ZME C;  1VQ7 P;  1SP4 A;  4W7Z A;  2C0W A;  4H0L B;  3HD7 D;  1LT9 C;  4K35 A;  1IFP A;  1XTC C;  3ITK A;  3H6P A;  3SFE C;  1GK4 A;  2ZYD A;  2WQY C;  5M1B A;  3W68 A;  4U3F G;  3RBX A;  4C7N A;  1PV3 A;  2W6B A;  1QL1 A;  3CCS P;  2KLU A;  5BU5 A;  4HJG H;  1A02 J;  4JYC A;  4A7P A;  3A0H H;  3IFM A;  4H44 D;  4I6M C;  3M0D A;  1KC8 Q;  1SLQ A;  4LGD E;  1SQX J;  1KIL A;  1NTZ G;  4H44 C;  1PPJ G;  3K5B A;  3RK2 D;  3MUD C;  3RK2 C;  2H8P D;  3BCC G;  1IC2 A;  2K88 A;  3A0B E;  1S2E A;  1ZOY C;  3L70 E;  1YHQ P;  1CI6 A;  4JYB A;  4YPC A;  3H1H J;  2JP3 A;  3HE4 B;  1KYO H;  1SQP J;  1G1J A;  1L4A D;  4JQ0 D;  1FZG A;  4EYY Q;  1L4A C;  1R8E A;  3CX5 E;  5KJ7 A;  2WSE J;  1NAY A;  1H8A A;  5TIS E;  3WMM 0;  3B71 A;  2Y0D A;  4UB8 H;  4OVN F;  3P8C D;  3GHG C;  1E79 H;  1MFZ A;  2OYI C;  5CCG A;  4RO0 A;  5H2F E;  1ZRT E;  5KAI E;  4RKU J;  4IOI H;  2BCC E;  2W8Z A;  2KS1 B;  3CCQ P;  3L74 J;  2QVA A;  2N1T B;  2OGU A;  1EDJ A;  1WT6 A;  5APQ A;  2JJL A;  2WSF J;  1VQP P;  3CME P;  3H1J G;  4PD4 E;  1GDT A;  4W7Y A;  1HGZ A;  3H32 B;  1YJN P;  1T3U A;  2W27 A;  2GA1 A;  3H1K D;  1RE3 C;  1LTA C;  2FXO A;  1LT9 A;  5KTB A;  1HWT C;  1RE4 A;  3H1L G;  2DW3 A;  1SQV K;  1FOS F;  3QWO C;  1SQV E;  2UWJ E;  5BU8 B;  1YTZ T;  2FFD C;  2JWD A;  2P1J A;  2GM4 A;  1GL2 D;  1M57 D;  1BSN A;  2A45 G;  1KMI Z;  3OA7 A;  1GL2 C;  4EIJ A;  3L71 E;  1WMK A;  1PP9 J;  3PP5 A;  1HJ0 A;  3O6Q B;  2FYU D;  3M9Q A;  1AV1 A;  2M3B A;  1NTM D;  4EOT A;  3OJA B;  1BCC J;  2J58 A;  3D6Z A;  3L35 A;  4PJ0 E;  1ZR4 A;  4BRY B;  1S5L X;  1LTI C;  1YBK A;  4WY4 D;  5AW2 B;  4C46 A;  1KTM A;  4AYC A;  2QRX A;  4WY4 C;  1IFI A;  5KLI C;  2K3R A;  1BE3 J; 
#chains in the Genus database with same CATH homology
 3JC2 2;  1RH5 B;  2YXQ B;  2YXR B;  1RHZ B;  3MP7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...