1RH5B

The structure of a protein conducting channel
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
56
structure length
56
Chain Sequence
LKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Preprotein translocase secY subunit
publication title X-ray structure of a protein-conducting channel
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
total genus 22
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.820 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Preprotein translocase SecE subunit 1rh5B00
3MP7B 1RHZB 3JC22 2YXRB 2YXQB 1RH5B
chains in the Genus database with same CATH superfamily
4K3AA 2IBZD 1FZCB 4O9BA 3L37A 1LJ2A 2OYOA 1KV4A 3CMAP 3P8CD 1HJBA 4LC1A 2FFDA 2J58A 3B5NA 1BSNA 1P84I 3NXSA 1A02J 1SFCC 1OVUA 4RESB 1VQNP 3TGUG 3MZWB 3F89A 3V4WA 1JMBA 2FXOA 1GK6A 3S9OA 1WRGA 5AW5B 3L70D 1W2BO 4H13B 3KDPB 1S72P 3H1JD 3HTKB 1L2PA 4WVZA 5KAIH 3GF7A 1DH3A 1VQOP 3HD7D 3KQGA 1AVOA 2KYVA 3L4FA 4B86A 2H89C 4ZKPA 1YIJP 1M1KQ 5AVWB 4ASWA 1RF1C 3V2QA 2HPCA 3H1LJ 2E75B 1AQ5A 3RK3B 2RN0A 2Q6QA 3W67A 1LT9C 2Y9YA 1P84D 1LTBC 1M1JA 1T6AA 3GLMA 3Q3DA 1S5LE 1EDLA 1NTZK 1JY2N 2YKOA 2O01H 4Y99C 1SQBJ 1T3JA 1IFDA 5CCHD 1LWUA 1WMKA 1OVRA 1BE3E 3JCUH 5KLIB 3TGUD 1N7SC 2E76C 2YMYA 3TYYA 5AVZB 4L76A 2HLOA 2V7QH 1KORA 1KILA 2K3RA 1SLQA 1NJIQ 2HODA 2QM8A 1P84H 1Y47A 4NPEA 1R8EA 5GTIH 2NPSC 3L72J 3D6YA 1N2DC 1JMMA 3UIAA 3GHGB 2O01N 3KZIE 1TU3F 3K5BA 2KB7P 1EDJA 2OYHC 1GL2A 2AEFA 1JNMA 4D6TJ 2N1TD 2P1JA 3T97A 2I1KA 3H1HG 3PHLA 4DZOA 2FYNB 2M3EA 1PL5A 1HUCA 1NTKG 1QGKB 5GTIE 2J5UA 3RK2C 1RE4C 1GMJA 3NMDA 2BEZF 4BRYB 2Q3EA 5KJ7D 1N73B 2E5YA 1AV1A 4IL6E 3M91A 1NU1G 3QH9A 5AVXB 4N78E 3V5BA 1USDA 3PJSK 4ASVA 1GDTA 4JPZB 2PFXA 3JSVC 2WWWA 4W80A 4AUWA 1L0NJ 1BCCE 3BCCJ 2BEQD 2MKVA 3TSIA 2RMZA 1CI6B 2QRXA 1QVGO 1G1IA 3H1KG 3MHVA 3CCLP 3G71P 5B5EH 1YTZI 3AEBC 5APWA 1NTMJ 1FS0E 2P10A 2Q3IA 1KB9H 4GOFA 1T8ZA 5KTBA 2E43A 1SQVG 1BGYE 3H1HD 3SWKA 2NRGA 1HJ0A 4UB6H 1NTKD 1KD1Q 5DJTB 3PLNA 5TJHA 3RL0g 2K88A 4RJTA 2WPQA 5AW8B 3CWBE 2H8PD 2Q7CA 1VQMP 3E7KA 1ZP0C 4Y28J 3TK1A 1PGPA 2WZ7A 3L71J 1NU1D 4WY4D 1IJDB 1ZN5A 3A0HH 2FYUG 2XKMA 1VQPP 1KB9E 1SQXG 1J1EB 4PD4E 1AJYA 4UB6E 4PJ0H 2LXBA 4GDOA 1GU4A 2WSFJ 3H32B 3Q1MA 1G2CB 1FZFA 3H1KD 4PV1D 1N86A 5AVUB 2QEXP 1JUNA 4HJGH 3TNUA 5AW7B 2WSCJ 2QJYC 3G4SP 1KILD 3B5NC 1KYOI 1LTSC 1SQVD 4H44B 3H1HE 3I56P 3V2NA 1LT9B 1E5WA 3MP7B 1IFIA 1A02F 1KQLA 3G3ZA 1PZQA 5APYA 3USSA 3LIDA 4CPGA 3W68A 2W27A 1SQPE 2M5AB 4TT3H 4Y99B 4U3FG 1X0TA 3HD7A 1KMIZ 3N7NA 2FYUD 2XNXA 3L74J 4EOTA 2WT7A 1GL2D 1SQXD 1SQBK 2R3SA 2KNCA 3CD6P 4C7NA 3AEAC 1N7SB 2E76B 1X9VA 3TF5A 2M0BA 1NTKK 3CXHI 2IYPA 4HB1A 5AVVB 1YJWP 1L0LJ 2YIUC 1VQ4P 1VL2A 3CCUP 2OYIA 1KN7A 1LNQA 1NU1K 1KYOD 3GHGC 1BE3J 2NPSB 3SSUA 5CJ4A 5CCHA 2HFED 4R4MA 2K9YA 1SQQG 3LW5H 1K8AQ 2H7HA 1KILE 1M56D 4ZKUA 1LWUC 2BCCG 1JOCA 5KLVE 2UWJE 2OYHB 5AW6B 3IR9A 3U1CA 2N9YB 2O01J 5E79E 2LKMA 1QL1A 2D2CC 1VQ6P 3L74G 4H0LD 2L5GB 3CMEP 3B4SA 2YXQB 3RK2B 2R3CA 3SWYA 5AW9B 2ZVNB 2E74D 4U3FD 3AEDC 1DD4A 4YPCA 1YITP 3CXHD 5CCGA 3B8EB 2B88A 5CMZA 1H89A 2AEMA 3CCEP 3WUUA 2ZVOB 2ZT9C 2I8DA 5BU5A 2YKPA 3HE5B 1PP9E 1VF5C 4GT1A 1LGHB 1M8OB 1L0NK 5BVZA 4C7RA 3AE9C 2QA4P 4DOJA 4UB8E 2JJLA 4KHXA 3VP9A 3BATA 3CXHH 1SQQD 3A7OA 2FXPA 1BDCA 5TISH 2BCCD 1BCCJ 4W7YA 1FAVA 2JWDA 1Y8AA 2CPBA 4L74A 2POHA 1NTMK 1RQVA 1VDFA 5CHXA 3HTKA 2WSEH 3I55P 3HE4A 4EDFA 3L75E 2M3BA 4LLHA 2Q9IA 4OGQC 2B89A 1ZOYC 1HTLC 1YTZT 3NTNA 2N1TB 1EZVE 1IO4A 2IZ0A 1J1EC 5H2FH 1OWAA 1PV3A 3VMXA 1BGYJ 1GU5A 3VOPA 1K73Q 2IYOA 3H1IE 1EXIA 2DW3A 1ZV8A 2KK7A 3CWBJ 1NTZE 2Y0EA 2JR8A 2ZFCA 3C9IA 2IZ1A 2B87B 1IFPA 3L73G 1RF0A 3FX0A 1H8AA 1AVYA 3H6PA 4WY4A 2KUBA 1OW7A 3CCQP 5H2FE 3MTUE 1PPJG 2A06E 4N3YB 1SS1A 1N8RQ 4H44C 3CCSP 1KTMA 3AE5C 2QJYB 1NHLA 1X22A 3AE3C 3B5NB 2IBZE 3FGAD 1T2KC 1M7LA 1KC8Q 1IFNA 2Q5UA 1YQ3C 5KAIE 3CX5I 3P8CE 3VN0A 3KHUA 1VQLP 2JEEA 4N6JA 1FOSF 3D71A 1SQQK 2QJPC 1IC2A 4HH2A 1YBKA 3PTZA 3C1LA 2R44A 1GW3A 4YTPC 4AQRD 1EXJA 5APTA 1MKMA 5APQA 2OTLP 3HUSA 1QVFO 3L70E 3AE4C 5B66H 3H1JE 2JKVA 2YIUB 1URQD 1SQPJ 4RKUJ 2HPCB 3H1LG 2OTKE 2YKQA 3L73D 1M90Q 1EDIA 5CCGD 2FKWB 1FDMA 2Z5IA 3A2AA 1NAYA 1OFCX 1ZRTD 3JCUE 1L0LK 3MUDC 1M1JB 4JF7A 2K9JA 1PPJD 2OQQA 1RY3A 3VMZA 3CX5D 4I2LC 1SQBG 1RE3A 2P2UA 2ZYDA 1LWUB 3HD7C 2ZXXA 1P84E 5CBOA 5CBNA 5B66E 2WQYC 3EFFK 2FXMA 3M9BA 1SVFA 3R2PA 1JTHA 2IPPA 1LTJC 1H88A 2C9NY 1BDDA 2D2CB 3VP8A 2WVRA 1KILB 4I6MC 3NFQA 2HODB 3MIWA 3VMYA 2KSEA 3TGUE 1ZXGA 2OYIC 3AE8C 3CX5H 4R4LA 4H13D 4OWFA 3L72G 3SFDC 1S1CX 5CCHC 1HBWA 1JB0J 1W5CE 2HG5D 2ZT9B 2Y9ZA 3H1LD 3VTPC 2YO2A 1GL2B 1VF5B 4JYCA 2JO1A 3T97B 4D6TG 2E75D 3Q2YA 3RK3D 2QIWA 1SFCA 1JY3N 2RH0A 4YXWH 2IFMA 3CCMP 3PRJA 5AVQB 1JCCA 5AW1B 1YJNP 1SQBD 3H25A 5CCGC 1CSBA 3BASA 1OMIA 1Q82Q 1PP9J 5AW4B 4EI2A 2KXPB 1FZGA 1Q2NA 5K5GB 2KLVA 2W83C 3D70A 1IK7A 2PRRA 4IFMA 2N1TC 2GM4A 5B5EE 1L0NG 3ZDMA 3V2PA 4OGQB 3BCCG 1AFOA 1H0TA 2ZJSE 3L35A 4YXDC 5L8RJ 1RF1A 3IAOA 4GOEA 2KS1A 2W8ZA 1D7MA 2GUSA 1KFNA 3L72D 1JY3P 4GODA 3GW6A 1ZMEC 5KJ7C 4IOIH 3WU2H 1KZUB 4GIFA 4H0LB 2SPZA 1VQKP 1ZLLA 2ZXEB 2W6AA 3F5HA 2Y0DA 1NTMG 2A45G 3L75J 3CC4P 1FBMA 3O6QA 2M5AA 4L75A 4D6TD 2WSSH 4Z1MH 1DIPA 3A0HE 2A45I 2K37A 5CJ0A 3LIEA 2FFDC 1N7SA 3M9QA 1HF9A 1CW5A 1OW8A 3WU2E 2QVAA 2C0XA 3H1IJ 3U1AA 4PJ0E 1NTKE 3L71G 2R5BA 1IFJA 3KYQA 3Q5RA 4EIJA 1JY2O 1FC2C 2R5DA 1W2EA 3FWNA 2NPSA 5KKZC 1AA0A 4ZNCA 5AW2B 3QWOC 1L0ND 1NU1E 2ZYAA 3BCCD 1XTCC 5AVTB 2QJPB 2IFNA 3BRTB 3KPEA 2OARA 2XNDH 3M0DA 1NGMB 3V4QA 4C46A 2E42A 2IDBA 3FXDA 4WY4C 1NTMD 3TNUB 4WB4A 2AXTH 3MD0A 1YYCA 2XU6A 1ZR4A 4DT0A 3H1KE 1M1JC 1U57A 2JWAA 1SP4A 1X79B 3FXEA 2QM7A 1YHQP 1L4AA 2WPVB 1SQPK 2PGDA 2WITA 3GMAA 2FY8A 3CI9A 5KAFH 1SQVE 3RL0D 1LP1B 3L70J 4PV1C 3RBZA 3L71D 4WWIA 3H1JJ 3E1IA 3HD7B 1PGQA 4I7ZC 2WT7B 5DJUB 1KILC 1UIXA 4C7NB 5GTHH 3HUSC 4HKZH 1URQA 3GF3A 1KYOH 1SFCD 1LTJB 2PP6A 1IK9A 2KSJA 3CC7P 2FYUE 2YO3A 1SQXE 1L0LG 2GUVA 2V7QJ 1MFZA 2Z4EA 3KXDA 4WBAA 5KAFE 1OZHA 2OYIB 1FZCA 2BASA 1IZNB 2I1JA 1BE3G 3O8ZA 2OTJP 2CPSA 2XZRA 4EYYQ 2L91A 3PP5A 1J2JB 1GL2C 1K9MQ 1RE3C 3CL3D 3EWKA 5AVYB 1KYOE 1J1DC 1R5SA 1MFTA 1UIIA 3TGUJ 4IFFA 1Q7YQ 3V2RA 3HRNA 1S9KD 2LR2A 1VQ9P 5BU8B 5AW3B 1PIXA 2YNYA 2WSFH 1MV8A 1R5LA 2ITAA 1YQ4C 3AEEC 3L71E 2MJZA 3L74D 5AVSB 2WSCH 2N9BA 4U3FE 1KQSO 3TDKA 4JBZA 1BSHA 4BWNA 1N7SD 3CXHE 2E76D 1L0LD 1LTTC 4BXLA 3AE7C 5TISE 1HVVA 3EQ2A 4H0LC 2KZIA 1MUUA 2B9BA 4LGDE 2HYNA 2E74C 1GD2E 1BE3D 1LT1A 3G9RA 3A0BH 2QJKC 1VQ8P 2NPSD 1LTIC 4K35A 2FBWC 1BCCG 1VQ5P 3WMM0 2H88C 1XTGB 1SQQE 1S5LH 1S9KE 4U7JA 4W7ZA 1N7LA 3HE4B 2BCCE 2FFDB 4I1LA 3S4RA 4IFDK 3A0BE 1M57D 2QE7H 3II6A 3RK2D 3L74E 3CCRP 1NWQA 1JM0A 4M3LA 3PH0A 3OA7A 3OAKA 1U7MA 1ZR2A 1BGYG 3GHGA 5KKZB 1L4AD 1FJPA 2HR3A 3BVHA 2P67A 1L0LE 3CWBG 3H1HJ 2R32A 5APUA 1NTKJ 3OW2O 1FE6A 1K05A 4N78D 4HYTB 4BRYA 4OH8B 3KZIH 4WY4B 2G3AA 1N73A 1USEA 2JP3A 3U59A 1BCCD 1NU1J 2C9LY 3I5CA 1Q86Q 2KIKA 1KB9I 1OXZA 1QX8A 3V6IA 3SWFA 3CC2P 3N4XA 3M0AA 3P8MC 4PD4I 1RQUA 5APSA 2YXRB 1JY2P 1FJKA 2NZ2A 4IL6H 1GK4A 1HGZA 1CI6A 1RHZB 1AQTA 3M0DC 4PV1B 3AE6C 2Z5HA 3H1KJ 1EDKA 1ZW0A 4I7ZB 4TLFA 1BGYD 1DEBA 3HUSB 5EFWB 1S5LX 1QEXA 2M8RA 2LXCB 3CWBD 1SQVJ 1KFMA 2WPSA 4XFJA 5KLVJ 2XV5A 1SQPG 1KQFB 4DJGA 1DD3A 3AEGC 1L4AC 4A7PA 1KB9D 4RO0A 2K9JB 3FWLA 4PD4D 3Q5SA 3L73E 1FDOA 2W6JH 4MN4C 1E79H 3LW5J 2FYUJ 1OX3A 1ZRTE 5AVRB 1J1DB 1SQXJ 1FZBA 1U7JA 2O3JA 1DX7A 1PPJE 3B5ND 3RBXA 1FU1A 2QSIA 3CX5E 1URQC 1JTHB 2WTYA 1Q81Q 2FYZA 1JCDA 3H32A 1G2CA 1OIPA 5APXA 1VPCA 4PD4H 4ZMDA 1FZCC 1HGVA 5KLVG 1GTWA 3RL0B 3M9HA 1Q90D 3VYIA 1RH5B 4OVNF 2IX7C 3ITKA 1SQPD 2AXCA 2KLUA 4IL6X 1LT9A 2C0WA 3IFMA 1EQ7A 2E74B 2ZYGA 2PAJA 1SFCB 2QJKB 3H1LE 4U3FJ 1S3JA 1QL2A 2XDJA 3Q5PA 4H13C 1KQGB 3CLQA 3OJAB 3RK3E 1JEKA 1PGJA 1PP9G 1YI2P 4NPFX 1SQBE 1FDIA 1NYHA 1VQ7P 2WSEJ 1WT6A 3P7KA 1NAFA 3M06A 2E75C 3RK3C 3L36A 3WUVA 2D2CD 3IF4A 1H0TB 3D6ZA 3RGUA 1NTZJ 3VMAA 1HWTC 2QG4A 1RF1B 1GZLA 2KS1B 5KLVD 1LTAC 1NO4A 2VRSA 2W90A 1Z56A 1SQQJ 1NKZB 3AECC 3ABVC 3A5TA 3MUDA 2H43A 2BCCJ 3SFEC 2E5TA 3P32A 1LP1A 2O1JA 2OYHA 2P58A 3L75G 3O6QB 1OVVA 3L72E 4JYBA 2AEJA 1PGOA 3AEFC 5KLIC 2ZT9D 1RF0C 2JDIH 4KJMA 2Y0CA 3AE1C 1EZVG 2KI7B 2KOGA 5M1BA 1VF5D 1NVOA 1RE4A 2W6BA 1IFMA 1EC5A 1LTJA 4D6TE 3IN6A 1EZVI 1G1JA 5AW0B 4L73A 3H1IG 4QMAA 1PP9D 5E79H 3GG2A 2P7JA 2Q1KA 3E1RA 3BRVB 1NTZG 4XE5B 2RKLA 2KZJA 2CK3H 2J59M 3G6EP 3HE5A 1DEEG 3C8VA 1JO5A 2AXTE 1QLED 2KP8A 3S1KA 2A45H 1FZEA 2A06G 3CCJP 4OGQD 1X8YA 2KNCB 2FYNC 1L0NE 4NPDA 1YJ9P 2IBZG 3BCCE 2K1AA 1N73C 1HH0A 1LTGC 5APVA 3L75D 5C39A 4KT0J 4UB8H 2IBZI 1MZ9A 3R4YA 1T3UA 1EZVD 1GW4A 4XA4A 1Y9BA 1NTME 2WPRA 1SQVK 3EFGA 3CPWO 1L4AB 1NOHA 5KLVK 5GTHE 1K04A 1S2EA 2O1KA 2G8YA 2N1TA 2WMMA 3CCVP 3L70G 3H1ID 1PFIA 1NH4A 4H44D 1JY3O 2OGUA 3H1JG 4JQ0D 2YMKA 1NTZD 1NKNA 1CZQA 3A3YB 1T2KD 4GKGA 5KJ7A 2FYUK 1URQB 2ZAEB 2V4HA 3WUTA 1SQXK 2A06D 4AYCA 1S4XA 3AE2C 1FZAA 3L73J 1OW6A 2B87A 3JC22 3B71A 4DCKA 1FOSE 3MGNA 2GA1A 3RL0C
chains in the Genus database with same CATH topology
3MP7B 1RHZB 3JC22 2YXRB 2YXQB 1RH5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MP7 B;  1RHZ B;  3JC2 2;  2YXR B;  2YXQ B;  1RH5 B; 
#chains in the Genus database with same CATH topology
 4K3A A;  2IBZ D;  1FZC B;  4O9B A;  3L37 A;  1LJ2 A;  2OYO A;  1KV4 A;  3CMA P;  3P8C D;  1HJB A;  4LC1 A;  2FFD A;  2J58 A;  3B5N A;  1BSN A;  1P84 I;  3NXS A;  1A02 J;  1SFC C;  1OVU A;  4RES B;  1VQN P;  3TGU G;  3MZW B;  3F89 A;  3V4W A;  1JMB A;  2FXO A;  1GK6 A;  3S9O A;  1WRG A;  5AW5 B;  3L70 D;  1W2B O;  4H13 B;  3KDP B;  1S72 P;  3H1J D;  3HTK B;  1L2P A;  4WVZ A;  5KAI H;  3GF7 A;  1DH3 A;  1VQO P;  3HD7 D;  3KQG A;  1AVO A;  2KYV A;  3L4F A;  4B86 A;  2H89 C;  4ZKP A;  1YIJ P;  1M1K Q;  5AVW B;  4ASW A;  1RF1 C;  3V2Q A;  2HPC A;  3H1L J;  2E75 B;  1AQ5 A;  3RK3 B;  2RN0 A;  2Q6Q A;  3W67 A;  1LT9 C;  2Y9Y A;  1P84 D;  1LTB C;  1M1J A;  1T6A A;  3GLM A;  3Q3D A;  1S5L E;  1EDL A;  1NTZ K;  1JY2 N;  2YKO A;  2O01 H;  4Y99 C;  1SQB J;  1T3J A;  1IFD A;  5CCH D;  1LWU A;  1WMK A;  1OVR A;  1BE3 E;  3JCU H;  5KLI B;  3TGU D;  1N7S C;  2E76 C;  2YMY A;  3TYY A;  5AVZ B;  4L76 A;  2HLO A;  2V7Q H;  1KOR A;  1KIL A;  2K3R A;  1SLQ A;  1NJI Q;  2HOD A;  2QM8 A;  1P84 H;  1Y47 A;  4NPE A;  1R8E A;  5GTI H;  2NPS C;  3L72 J;  3D6Y A;  1N2D C;  1JMM A;  3UIA A;  3GHG B;  2O01 N;  3KZI E;  1TU3 F;  3K5B A;  2KB7 P;  1EDJ A;  2OYH C;  1GL2 A;  2AEF A;  1JNM A;  4D6T J;  2N1T D;  2P1J A;  3T97 A;  2I1K A;  3H1H G;  3PHL A;  4DZO A;  2FYN B;  2M3E A;  1PL5 A;  1HUC A;  1NTK G;  1QGK B;  5GTI E;  2J5U A;  3RK2 C;  1RE4 C;  1GMJ A;  3NMD A;  2BEZ F;  4BRY B;  2Q3E A;  5KJ7 D;  1N73 B;  2E5Y A;  1AV1 A;  4IL6 E;  3M91 A;  1NU1 G;  3QH9 A;  5AVX B;  4N78 E;  3V5B A;  1USD A;  3PJS K;  4ASV A;  1GDT A;  4JPZ B;  2PFX A;  3JSV C;  2WWW A;  4W80 A;  4AUW A;  1L0N J;  1BCC E;  3BCC J;  2BEQ D;  2MKV A;  3TSI A;  2RMZ A;  1CI6 B;  2QRX A;  1QVG O;  1G1I A;  3H1K G;  3MHV A;  3CCL P;  3G71 P;  5B5E H;  1YTZ I;  3AEB C;  5APW A;  1NTM J;  1FS0 E;  2P10 A;  2Q3I A;  1KB9 H;  4GOF A;  1T8Z A;  5KTB A;  2E43 A;  1SQV G;  1BGY E;  3H1H D;  3SWK A;  2NRG A;  1HJ0 A;  4UB6 H;  1NTK D;  1KD1 Q;  5DJT B;  3PLN A;  5TJH A;  3RL0 g;  2K88 A;  4RJT A;  2WPQ A;  5AW8 B;  3CWB E;  2H8P D;  2Q7C A;  1VQM P;  3E7K A;  1ZP0 C;  4Y28 J;  3TK1 A;  1PGP A;  2WZ7 A;  3L71 J;  1NU1 D;  4WY4 D;  1IJD B;  1ZN5 A;  3A0H H;  2FYU G;  2XKM A;  1VQP P;  1KB9 E;  1SQX G;  1J1E B;  4PD4 E;  1AJY A;  4UB6 E;  4PJ0 H;  2LXB A;  4GDO A;  1GU4 A;  2WSF J;  3H32 B;  3Q1M A;  1G2C B;  1FZF A;  3H1K D;  4PV1 D;  1N86 A;  5AVU B;  2QEX P;  1JUN A;  4HJG H;  3TNU A;  5AW7 B;  2WSC J;  2QJY C;  3G4S P;  1KIL D;  3B5N C;  1KYO I;  1LTS C;  1SQV D;  4H44 B;  3H1H E;  3I56 P;  3V2N A;  1LT9 B;  1E5W A;  3MP7 B;  1IFI A;  1A02 F;  1KQL A;  3G3Z A;  1PZQ A;  5APY A;  3USS A;  3LID A;  4CPG A;  3W68 A;  2W27 A;  1SQP E;  2M5A B;  4TT3 H;  4Y99 B;  4U3F G;  1X0T A;  3HD7 A;  1KMI Z;  3N7N A;  2FYU D;  2XNX A;  3L74 J;  4EOT A;  2WT7 A;  1GL2 D;  1SQX D;  1SQB K;  2R3S A;  2KNC A;  3CD6 P;  4C7N A;  3AEA C;  1N7S B;  2E76 B;  1X9V A;  3TF5 A;  2M0B A;  1NTK K;  3CXH I;  2IYP A;  4HB1 A;  5AVV B;  1YJW P;  1L0L J;  2YIU C;  1VQ4 P;  1VL2 A;  3CCU P;  2OYI A;  1KN7 A;  1LNQ A;  1NU1 K;  1KYO D;  3GHG C;  1BE3 J;  2NPS B;  3SSU A;  5CJ4 A;  5CCH A;  2HFE D;  4R4M A;  2K9Y A;  1SQQ G;  3LW5 H;  1K8A Q;  2H7H A;  1KIL E;  1M56 D;  4ZKU A;  1LWU C;  2BCC G;  1JOC A;  5KLV E;  2UWJ E;  2OYH B;  5AW6 B;  3IR9 A;  3U1C A;  2N9Y B;  2O01 J;  5E79 E;  2LKM A;  1QL1 A;  2D2C C;  1VQ6 P;  3L74 G;  4H0L D;  2L5G B;  3CME P;  3B4S A;  2YXQ B;  3RK2 B;  2R3C A;  3SWY A;  5AW9 B;  2ZVN B;  2E74 D;  4U3F D;  3AED C;  1DD4 A;  4YPC A;  1YIT P;  3CXH D;  5CCG A;  3B8E B;  2B88 A;  5CMZ A;  1H89 A;  2AEM A;  3CCE P;  3WUU A;  2ZVO B;  2ZT9 C;  2I8D A;  5BU5 A;  2YKP A;  3HE5 B;  1PP9 E;  1VF5 C;  4GT1 A;  1LGH B;  1M8O B;  1L0N K;  5BVZ A;  4C7R A;  3AE9 C;  2QA4 P;  4DOJ A;  4UB8 E;  2JJL A;  4KHX A;  3VP9 A;  3BAT A;  3CXH H;  1SQQ D;  3A7O A;  2FXP A;  1BDC A;  5TIS H;  2BCC D;  1BCC J;  4W7Y A;  1FAV A;  2JWD A;  1Y8A A;  2CPB A;  4L74 A;  2POH A;  1NTM K;  1RQV A;  1VDF A;  5CHX A;  3HTK A;  2WSE H;  3I55 P;  3HE4 A;  4EDF A;  3L75 E;  2M3B A;  4LLH A;  2Q9I A;  4OGQ C;  2B89 A;  1ZOY C;  1HTL C;  1YTZ T;  3NTN A;  2N1T B;  1EZV E;  1IO4 A;  2IZ0 A;  1J1E C;  5H2F H;  1OWA A;  1PV3 A;  3VMX A;  1BGY J;  1GU5 A;  3VOP A;  1K73 Q;  2IYO A;  3H1I E;  1EXI A;  2DW3 A;  1ZV8 A;  2KK7 A;  3CWB J;  1NTZ E;  2Y0E A;  2JR8 A;  2ZFC A;  3C9I A;  2IZ1 A;  2B87 B;  1IFP A;  3L73 G;  1RF0 A;  3FX0 A;  1H8A A;  1AVY A;  3H6P A;  4WY4 A;  2KUB A;  1OW7 A;  3CCQ P;  5H2F E;  3MTU E;  1PPJ G;  2A06 E;  4N3Y B;  1SS1 A;  1N8R Q;  4H44 C;  3CCS P;  1KTM A;  3AE5 C;  2QJY B;  1NHL A;  1X22 A;  3AE3 C;  3B5N B;  2IBZ E;  3FGA D;  1T2K C;  1M7L A;  1KC8 Q;  1IFN A;  2Q5U A;  1YQ3 C;  5KAI E;  3CX5 I;  3P8C E;  3VN0 A;  3KHU A;  1VQL P;  2JEE A;  4N6J A;  1FOS F;  3D71 A;  1SQQ K;  2QJP C;  1IC2 A;  4HH2 A;  1YBK A;  3PTZ A;  3C1L A;  2R44 A;  1GW3 A;  4YTP C;  4AQR D;  1EXJ A;  5APT A;  1MKM A;  5APQ A;  2OTL P;  3HUS A;  1QVF O;  3L70 E;  3AE4 C;  5B66 H;  3H1J E;  2JKV A;  2YIU B;  1URQ D;  1SQP J;  4RKU J;  2HPC B;  3H1L G;  2OTK E;  2YKQ A;  3L73 D;  1M90 Q;  1EDI A;  5CCG D;  2FKW B;  1FDM A;  2Z5I A;  3A2A A;  1NAY A;  1OFC X;  1ZRT D;  3JCU E;  1L0L K;  3MUD C;  1M1J B;  4JF7 A;  2K9J A;  1PPJ D;  2OQQ A;  1RY3 A;  3VMZ A;  3CX5 D;  4I2L C;  1SQB G;  1RE3 A;  2P2U A;  2ZYD A;  1LWU B;  3HD7 C;  2ZXX A;  1P84 E;  5CBO A;  5CBN A;  5B66 E;  2WQY C;  3EFF K;  2FXM A;  3M9B A;  1SVF A;  3R2P A;  1JTH A;  2IPP A;  1LTJ C;  1H88 A;  2C9N Y;  1BDD A;  2D2C B;  3VP8 A;  2WVR A;  1KIL B;  4I6M C;  3NFQ A;  2HOD B;  3MIW A;  3VMY A;  2KSE A;  3TGU E;  1ZXG A;  2OYI C;  3AE8 C;  3CX5 H;  4R4L A;  4H13 D;  4OWF A;  3L72 G;  3SFD C;  1S1C X;  5CCH C;  1HBW A;  1JB0 J;  1W5C E;  2HG5 D;  2ZT9 B;  2Y9Z A;  3H1L D;  3VTP C;  2YO2 A;  1GL2 B;  1VF5 B;  4JYC A;  2JO1 A;  3T97 B;  4D6T G;  2E75 D;  3Q2Y A;  3RK3 D;  2QIW A;  1SFC A;  1JY3 N;  2RH0 A;  4YXW H;  2IFM A;  3CCM P;  3PRJ A;  5AVQ B;  1JCC A;  5AW1 B;  1YJN P;  1SQB D;  3H25 A;  5CCG C;  1CSB A;  3BAS A;  1OMI A;  1Q82 Q;  1PP9 J;  5AW4 B;  4EI2 A;  2KXP B;  1FZG A;  1Q2N A;  5K5G B;  2KLV A;  2W83 C;  3D70 A;  1IK7 A;  2PRR A;  4IFM A;  2N1T C;  2GM4 A;  5B5E E;  1L0N G;  3ZDM A;  3V2P A;  4OGQ B;  3BCC G;  1AFO A;  1H0T A;  2ZJS E;  3L35 A;  4YXD C;  5L8R J;  1RF1 A;  3IAO A;  4GOE A;  2KS1 A;  2W8Z A;  1D7M A;  2GUS A;  1KFN A;  3L72 D;  1JY3 P;  4GOD A;  3GW6 A;  1ZME C;  5KJ7 C;  4IOI H;  3WU2 H;  1KZU B;  4GIF A;  4H0L B;  2SPZ A;  1VQK P;  1ZLL A;  2ZXE B;  2W6A A;  3F5H A;  2Y0D A;  1NTM G;  2A45 G;  3L75 J;  3CC4 P;  1FBM A;  3O6Q A;  2M5A A;  4L75 A;  4D6T D;  2WSS H;  4Z1M H;  1DIP A;  3A0H E;  2A45 I;  2K37 A;  5CJ0 A;  3LIE A;  2FFD C;  1N7S A;  3M9Q A;  1HF9 A;  1CW5 A;  1OW8 A;  3WU2 E;  2QVA A;  2C0X A;  3H1I J;  3U1A A;  4PJ0 E;  1NTK E;  3L71 G;  2R5B A;  1IFJ A;  3KYQ A;  3Q5R A;  4EIJ A;  1JY2 O;  1FC2 C;  2R5D A;  1W2E A;  3FWN A;  2NPS A;  5KKZ C;  1AA0 A;  4ZNC A;  5AW2 B;  3QWO C;  1L0N D;  1NU1 E;  2ZYA A;  3BCC D;  1XTC C;  5AVT B;  2QJP B;  2IFN A;  3BRT B;  3KPE A;  2OAR A;  2XND H;  3M0D A;  1NGM B;  3V4Q A;  4C46 A;  2E42 A;  2IDB A;  3FXD A;  4WY4 C;  1NTM D;  3TNU B;  4WB4 A;  2AXT H;  3MD0 A;  1YYC A;  2XU6 A;  1ZR4 A;  4DT0 A;  3H1K E;  1M1J C;  1U57 A;  2JWA A;  1SP4 A;  1X79 B;  3FXE A;  2QM7 A;  1YHQ P;  1L4A A;  2WPV B;  1SQP K;  2PGD A;  2WIT A;  3GMA A;  2FY8 A;  3CI9 A;  5KAF H;  1SQV E;  3RL0 D;  1LP1 B;  3L70 J;  4PV1 C;  3RBZ A;  3L71 D;  4WWI A;  3H1J J;  3E1I A;  3HD7 B;  1PGQ A;  4I7Z C;  2WT7 B;  5DJU B;  1KIL C;  1UIX A;  4C7N B;  5GTH H;  3HUS C;  4HKZ H;  1URQ A;  3GF3 A;  1KYO H;  1SFC D;  1LTJ B;  2PP6 A;  1IK9 A;  2KSJ A;  3CC7 P;  2FYU E;  2YO3 A;  1SQX E;  1L0L G;  2GUV A;  2V7Q J;  1MFZ A;  2Z4E A;  3KXD A;  4WBA A;  5KAF E;  1OZH A;  2OYI B;  1FZC A;  2BAS A;  1IZN B;  2I1J A;  1BE3 G;  3O8Z A;  2OTJ P;  2CPS A;  2XZR A;  4EYY Q;  2L91 A;  3PP5 A;  1J2J B;  1GL2 C;  1K9M Q;  1RE3 C;  3CL3 D;  3EWK A;  5AVY B;  1KYO E;  1J1D C;  1R5S A;  1MFT A;  1UII A;  3TGU J;  4IFF A;  1Q7Y Q;  3V2R A;  3HRN A;  1S9K D;  2LR2 A;  1VQ9 P;  5BU8 B;  5AW3 B;  1PIX A;  2YNY A;  2WSF H;  1MV8 A;  1R5L A;  2ITA A;  1YQ4 C;  3AEE C;  3L71 E;  2MJZ A;  3L74 D;  5AVS B;  2WSC H;  2N9B A;  4U3F E;  1KQS O;  3TDK A;  4JBZ A;  1BSH A;  4BWN A;  1N7S D;  3CXH E;  2E76 D;  1L0L D;  1LTT C;  4BXL A;  3AE7 C;  5TIS E;  1HVV A;  3EQ2 A;  4H0L C;  2KZI A;  1MUU A;  2B9B A;  4LGD E;  2HYN A;  2E74 C;  1GD2 E;  1BE3 D;  1LT1 A;  3G9R A;  3A0B H;  2QJK C;  1VQ8 P;  2NPS D;  1LTI C;  4K35 A;  2FBW C;  1BCC G;  1VQ5 P;  3WMM 0;  2H88 C;  1XTG B;  1SQQ E;  1S5L H;  1S9K E;  4U7J A;  4W7Z A;  1N7L A;  3HE4 B;  2BCC E;  2FFD B;  4I1L A;  3S4R A;  4IFD K;  3A0B E;  1M57 D;  2QE7 H;  3II6 A;  3RK2 D;  3L74 E;  3CCR P;  1NWQ A;  1JM0 A;  4M3L A;  3PH0 A;  3OA7 A;  3OAK A;  1U7M A;  1ZR2 A;  1BGY G;  3GHG A;  5KKZ B;  1L4A D;  1FJP A;  2HR3 A;  3BVH A;  2P67 A;  1L0L E;  3CWB G;  3H1H J;  2R32 A;  5APU A;  1NTK J;  3OW2 O;  1FE6 A;  1K05 A;  4N78 D;  4HYT B;  4BRY A;  4OH8 B;  3KZI H;  4WY4 B;  2G3A A;  1N73 A;  1USE A;  2JP3 A;  3U59 A;  1BCC D;  1NU1 J;  2C9L Y;  3I5C A;  1Q86 Q;  2KIK A;  1KB9 I;  1OXZ A;  1QX8 A;  3V6I A;  3SWF A;  3CC2 P;  3N4X A;  3M0A A;  3P8M C;  4PD4 I;  1RQU A;  5APS A;  2YXR B;  1JY2 P;  1FJK A;  2NZ2 A;  4IL6 H;  1GK4 A;  1HGZ A;  1CI6 A;  1RHZ B;  1AQT A;  3M0D C;  4PV1 B;  3AE6 C;  2Z5H A;  3H1K J;  1EDK A;  1ZW0 A;  4I7Z B;  4TLF A;  1BGY D;  1DEB A;  3HUS B;  5EFW B;  1S5L X;  1QEX A;  2M8R A;  2LXC B;  3CWB D;  1SQV J;  1KFM A;  2WPS A;  4XFJ A;  5KLV J;  2XV5 A;  1SQP G;  1KQF B;  4DJG A;  1DD3 A;  3AEG C;  1L4A C;  4A7P A;  1KB9 D;  4RO0 A;  2K9J B;  3FWL A;  4PD4 D;  3Q5S A;  3L73 E;  1FDO A;  2W6J H;  4MN4 C;  1E79 H;  3LW5 J;  2FYU J;  1OX3 A;  1ZRT E;  5AVR B;  1J1D B;  1SQX J;  1FZB A;  1U7J A;  2O3J A;  1DX7 A;  1PPJ E;  3B5N D;  3RBX A;  1FU1 A;  2QSI A;  3CX5 E;  1URQ C;  1JTH B;  2WTY A;  1Q81 Q;  2FYZ A;  1JCD A;  3H32 A;  1G2C A;  1OIP A;  5APX A;  1VPC A;  4PD4 H;  4ZMD A;  1FZC C;  1HGV A;  5KLV G;  1GTW A;  3RL0 B;  3M9H A;  1Q90 D;  3VYI A;  1RH5 B;  4OVN F;  2IX7 C;  3ITK A;  1SQP D;  2AXC A;  2KLU A;  4IL6 X;  1LT9 A;  2C0W A;  3IFM A;  1EQ7 A;  2E74 B;  2ZYG A;  2PAJ A;  1SFC B;  2QJK B;  3H1L E;  4U3F J;  1S3J A;  1QL2 A;  2XDJ A;  3Q5P A;  4H13 C;  1KQG B;  3CLQ A;  3OJA B;  3RK3 E;  1JEK A;  1PGJ A;  1PP9 G;  1YI2 P;  4NPF X;  1SQB E;  1FDI A;  1NYH A;  1VQ7 P;  2WSE J;  1WT6 A;  3P7K A;  1NAF A;  3M06 A;  2E75 C;  3RK3 C;  3L36 A;  3WUV A;  2D2C D;  3IF4 A;  1H0T B;  3D6Z A;  3RGU A;  1NTZ J;  3VMA A;  1HWT C;  2QG4 A;  1RF1 B;  1GZL A;  2KS1 B;  5KLV D;  1LTA C;  1NO4 A;  2VRS A;  2W90 A;  1Z56 A;  1SQQ J;  1NKZ B;  3AEC C;  3ABV C;  3A5T A;  3MUD A;  2H43 A;  2BCC J;  3SFE C;  2E5T A;  3P32 A;  1LP1 A;  2O1J A;  2OYH A;  2P58 A;  3L75 G;  3O6Q B;  1OVV A;  3L72 E;  4JYB A;  2AEJ A;  1PGO A;  3AEF C;  5KLI C;  2ZT9 D;  1RF0 C;  2JDI H;  4KJM A;  2Y0C A;  3AE1 C;  1EZV G;  2KI7 B;  2KOG A;  5M1B A;  1VF5 D;  1NVO A;  1RE4 A;  2W6B A;  1IFM A;  1EC5 A;  1LTJ A;  4D6T E;  3IN6 A;  1EZV I;  1G1J A;  5AW0 B;  4L73 A;  3H1I G;  4QMA A;  1PP9 D;  5E79 H;  3GG2 A;  2P7J A;  2Q1K A;  3E1R A;  3BRV B;  1NTZ G;  4XE5 B;  2RKL A;  2KZJ A;  2CK3 H;  2J59 M;  3G6E P;  3HE5 A;  1DEE G;  3C8V A;  1JO5 A;  2AXT E;  1QLE D;  2KP8 A;  3S1K A;  2A45 H;  1FZE A;  2A06 G;  3CCJ P;  4OGQ D;  1X8Y A;  2KNC B;  2FYN C;  1L0N E;  4NPD A;  1YJ9 P;  2IBZ G;  3BCC E;  2K1A A;  1N73 C;  1HH0 A;  1LTG C;  5APV A;  3L75 D;  5C39 A;  4KT0 J;  4UB8 H;  2IBZ I;  1MZ9 A;  3R4Y A;  1T3U A;  1EZV D;  1GW4 A;  4XA4 A;  1Y9B A;  1NTM E;  2WPR A;  1SQV K;  3EFG A;  3CPW O;  1L4A B;  1NOH A;  5KLV K;  5GTH E;  1K04 A;  1S2E A;  2O1K A;  2G8Y A;  2N1T A;  2WMM A;  3CCV P;  3L70 G;  3H1I D;  1PFI A;  1NH4 A;  4H44 D;  1JY3 O;  2OGU A;  3H1J G;  4JQ0 D;  2YMK A;  1NTZ D;  1NKN A;  1CZQ A;  3A3Y B;  1T2K D;  4GKG A;  5KJ7 A;  2FYU K;  1URQ B;  2ZAE B;  2V4H A;  3WUT A;  1SQX K;  2A06 D;  4AYC A;  1S4X A;  3AE2 C;  1FZA A;  3L73 J;  1OW6 A;  2B87 A;  3JC2 2;  3B71 A;  4DCK A;  1FOS E;  3MGN A;  2GA1 A;  3RL0 C; 
#chains in the Genus database with same CATH homology
 3MP7 B;  1RHZ B;  3JC2 2;  2YXR B;  2YXQ B;  1RH5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...