3BRVB

Nemo/ikkb association domain structure
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
61
structure length
61
Chain Sequence
b'ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inhibitor of nuclear factor kappa-B kinase subunit beta
molecule tags Transferase/transcription
source organism Homo sapiens
publication title Structure of a NEMO/IKK-Associating Domain Reveals Architecture of the Interaction Site.
pubmed doi rcsb
total genus 29
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11577 NEMO NF-kappa-B essential modulator NEMO
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3brvB00
3BRVB 1JOCA 3CL3D 3EQ2A 2YKPA 3BRTB 2YKQA 3L4FA 2W6BA 2YKOA
chains in the Genus database with same CATH superfamily
1FAVA 3CL3D 4WWIA 2K1AA 3BCCD 2O01N 2NPSD 3O8ZA 1OW7A 1XTGB 3MZWB 1SQVJ 2HR3A 3BATA 1YBKA 3H1HE 1MZ9A 3HUSC 2O3JA 4GDOA 1USEA 2QM7A 1BE3D 3QWOC 4U3FG 1QX8A 2IBZI 3H1KJ 2YXRB 1KB9I 3S1KA 1RH5B 2Q9IA 5B5EH 2E42A 1NTKE 1OFCX 1N2DC 1Q7YQ 4N78E 2WZ7A 2Q1KA 1FC2C 1KB9H 2BEQD 4D6TE 1IK9A 1G1JA 1GMJA 1WT6A 1NH4A 4YXWH 1EXJA 2RKLA 1MKMA 3L70D 1PZQA 2FKWB 2KOGA 1M8OB 1ZOYC 2R3CA 5AVXB 4WB4A 1YQ4C 3T97A 2ZVOB 3GF7A 4OGQC 2OYIB 1T2KD 1NTME 1OX3A 1S5LE 4UB8E 3GHGB 2CPSA 5AVUB 5TISE 3VN0A 5AW5B 3CC7P 2FYNC 4W80A 2IFNA 2CPBA 2IPPA 3FX0A 4JQ0D 3M06A 2P7JA 1ZR4A 3AE9C 1DEEG 3IR9A 2GM4A 4RJTA 4PV1B 1PL5A 4ZNCA 1URQD 1R8EA 1OXZA 4IFDK 5AVVB 1WRGA 1FDOA 1HUCA 1W5CE 1GL2C 1VQNP 4BWNA 2JP3A 3TK1A 3L73E 4Z1MH 2KZIA 2JJLA 3VP8A 2HG5D 3V4QA 1R5SA 2I1KA 3Q1MA 5AW0B 3HUSA 4ASVA 1PGQA 2HODA 2KSEA 1QL1A 1S5LX 5APVA 2Q5UA 4N6JA 4Y99C 2HFED 1OVRA 4H44D 2YIUB 2KLVA 4ZKUA 3ITKA 3RL0B 3L35A 1IFNA 1L4AA 1VQKP 1SQQK 1LJ2A 1SQPD 2E76B 4D6TJ 1H88A 5E79E 2KB7P 3NMDA 3H1JE 4U3FJ 2NPSB 2RN0A 2BCCG 2WITA 4HH2A 4KT0J 2QA4P 2KNCB 3KXDA 3KPEA 2KLUA 5AW1B 2BASA 1L4AD 1VL2A 3L75J 4DZOA 1AV1A 2N1TD 1N7SC 5KLIC 1NHLA 4DCKA 3L71J 2AEMA 1RY3A 2AXTE 2GUVA 2XV5A 1RE4A 1LT9C 1SQBK 1VF5B 2HLOA 2M3EA 4H0LB 2IZ0A 5B5EE 1NTMD 1FZFA 4HJGH 2QEXP 1BCCJ 5CBNA 1HWTC 2ZAEB 2FXPA 3ABVC 3RL0C 3Q5RA 2M3BA 4C7NA 2YKOA 5KAIE 1SQBE 3E1IA 2FYUJ 2WSCJ 3L74D 3RL0g 3S9OA 1IO4A 3LW5J 3B4SA 3CXHE 3WUUA 1H8AA 1EDLA 2OARA 4JF7A 1SQPJ 1JM0A 4D6TD 5CBOA 2M0BA 3PP5A 3V5BA 2ZJSE 3C8VA 3LIEA 1EDJA 3JCUE 1FZAA 3FWNA 4U3FE 3RK2D 3CCUP 1LTIC 3VOPA 2KZJA 3KZIE 2Y9ZA 1SQQJ 2WSCH 1SQQE 4HYTB 1CI6B 3CXHI 3IN6A 2MJZA 2YMKA 3L74G 5APSA 1Q86Q 2KXPB 2FXMA 2E75C 2FYUG 3JC22 1NU1J 2K3RA 2JWDA 1Y47A 2A06E 3W68A 1ZR2A 1ZRTE 1KTMA 3MTUE 1S9KD 1KV4A 1SQXE 1N7LA 1IJDB 2OYHC 1VF5D 2FYUD 3L74J 1SFCA 1SQBJ 1GZLA 3H1LE 2VRSA 4OGQB 3B8EB 3HD7B 1NJIQ 2HODB 3HE5A 2CK3H 1AQ5A 5AVQB 3LIDA 1KYOE 4IFFA 3L71E 5CCGA 3U59A 3TYYA 1IFMA 3FGAD 3CWBD 3OW2O 3L70J 2KK7A 1ZMEC 3R4YA 1PPJD 4O9BA 2E5YA 4DT0A 1BE3J 3HE5B 3L75G 1VQ8P 1LP1B 1GL2B 1LTSC 1XTCC 5CCGD 1BGYJ 3H1IJ 4WY4D 3M9BA 1BGYD 2OYIA 1VQLP 2K37A 1VQ5P 4OVNF 1FZEA 1Q82Q 1NTKG 2V7QJ 4PV1C 1N73A 3CCEP 3H1JD 1BCCG 1KFNA 1OIPA 1LWUC 3B5NC 4C7RA 3D6YA 1AA0A 1M90Q 1JMBA 3SWKA 5KJ7A 3F89A 1KILD 3SSUA 3W67A 5APYA 5KLIB 1IFDA 1QL2A 3L75D 1JY2O 1NTZD 4I7ZC 3C1LA 1PGOA 3TGUD 2WTYA 5APWA 2OYIC 1NTMG 3CWBG 1PGJA 1OZHA 1NTKK 2WQYC 2NPSA 1TU3F 5GTHE 3L73J 3H32A 2KNCA 4GOEA 4EYYQ 1HBWA 3EFFK 4EOTA 1ZRTD 1RHZB 2YIUC 3FWLA 5CCGC 3H6PA 3NXSA 1SQBD 4QMAA 3L74E 2E74C 2QJYB 4GODA 4U7JA 1P84E 4Y99B 1S9KE 1PP9D 1Y9BA 5BU5A 1BDDA 2XZRA 5KAFE 4PV1D 5KKZC 3CC2P 3H1LJ 4RO0A 1T3JA 3SFEC 5GTIH 3CPWO 5KLVJ 3H1LD 1H0TA 1HGZA 3G9RA 3CX5E 2KIKA 1CI6A 2A45I 2N9BA 3KYQA 4BRYA 3GMAA 2WSSH 2I1JA 3P8CE 2Q7CA 1SQQD 3HTKA 3LW5H 1RF0C 2JO1A 3H1LG 3II6A 4PD4E 5CCHD 1QGKB 2R5DA 4OGQD 3TNUA 3H1IE 1FOSE 5B66E 4H13B 1NU1K 2LKMA 3GG2A 2IBZE 3JCUH 3L4FA 5AVYB 5KLVG 1YYCA 2FYNB 3H1KG 4IL6X 1ZP0C 3RL0D 3Q2YA 2HPCA 1W2EA 2OYHB 1T3UA 1HJBA 1NTKD 1YITP 1JY3N 2N1TA 3EFGA 5CJ4A 2ZXEB 3CXHH 4H13C 4JBZA 2J59M 1LTTC 1IFJA 5AW9B 4TT3H 3I56P 4EI2A 1OVVA 2OYHA 2JDIH 3O6QA 1DEBA 2C9NY 1EDKA 2BCCE 3HE4A 3RK3B 4C46A 1K04A 2WPSA 4ZMDA 3L71D 1NTZE 3TGUE 1RQUA 1L0LG 5TISH 1JNMA 3MHVA 2K9JA 2O1KA 2R44A 2W6JH 3A0BH 4H0LD 1JOCA 1NWQA 3H1HD 1D7MA 3CCMP 5BU8B 3HE4B 3MUDC 1YJNP 1Q90D 1K73Q 1RF0A 1J2JB 1G2CA 2KS1A 1EZVD 2R3SA 3TF5A 1L0LJ 1YTZI 2OTLP 3V4WA 1HF9A 1NO4A 1CSBA 2IZ1A 3A7OA 3OJAB 5APQA 1L0LK 2Y0CA 4H13D 3V2RA 4DOJA 1N73B 5K5GB 2R32A 3CX5D 1KILE 3AE6C 1LWUA 3B5NA 4Y28J 3V2PA 1VQ6P 2J5UA 1L4AC 1SFCB 5GTHH 1SS1A 4WBAA 2QRXA 3A0HE 2ZT9C 3SWYA 2Z4EA 3CCSP 1GTWA 1DIPA 5AVZB 1AVYA 1FDMA 1K8AQ 1LWUB 1MV8A 1VPCA 3B5NB 3VYIA 1RE3A 4ASWA 2NPSC 3SWFA 3CMEP 2H7HA 2A06G 2YNYA 2IBZD 1NU1G 2WT7A 1HGVA 1YIJP 1U7JA 1PP9E 2B89A 1PP9J 1FZGA 4JYBA 5AVRB 4BRYB 1GL2A 2SPZA 1YJWP 1SQXK 4PJ0E 1GL2D 2QJPC 1SQPK 3EWKA 1JCDA 1RQVA 4L75A 1SQBG 2XNDH 5DJTB 2WT7B 1NKNA 3BASA 4EDFA 3G71P 3L73D 4UB6E 1EZVI 3L72E 1JEKA 2BEZF 2W6BA 2WWWA 3K5BA 3P8CD 1S5LH 2PGDA 4WY4A 2C9LY 1BCCD 5EFWB 1JO5A 1LT1A 4PD4D 2OQQA 1H0TB 2WMMA 3HD7C 2PFXA 4UB6H 3H1KD 3RK3C 2E75D 1JTHA 5KAFH 3AE7C 1YQ3C 1EZVG 3SFDC 2MKVA 1U57A 1EZVE 1IC2A 1NYHA 1PV3A 1X9VA 3PLNA 3O6QB 2Q3EA 1N86A 1SQPE 5KJ7D 1YHQP 1KD1Q 3CXHD 1A02F 4YPCA 2IX7C 2E75B 3MIWA 4HB1A 2JWAA 1USDA 4RESB 2YO2A 2AEJA 1N7SD 2V4HA 2WSFJ 3CX5H 3IAOA 3M0DC 5KAIH 3V2QA 3C9IA 2QVAA 2BCCJ 5B66H 3M91A 2M5AA 2W6AA 1SP4A 3TDKA 2P58A 5APTA 4AUWA 1FS0E 3HD7A 4MN4C 3L71G 2A06D 1NU1D 2JR8A 2ZYDA 1E79H 3ZDMA 3CC4P 3V2NA 5AW4B 2XU6A 2M5AB 3TNUB 1EDIA 1FJPA 3M0DA 1L0LE 1NAFA 3NFQA 3EQ2A 1NTZG 3PH0A 3TGUG 1KZUB 1NKZB 2C0XA 1VF5C 3A0HH 1ZXGA 3B5ND 3HUSB 2WPQA 3MGNA 5C39A 3TSIA 1YJ9P 1G2CB 2KS1B 1Y8AA 2FYZA 3CI9A 1KB9E 1N7SB 3A3YB 2NRGA 2QM8A 2KP8A 1FU1A 3L72D 1KYOD 1LTJC 3AE5C 1SFCD 3AEBC 1L0ND 1OMIA 2OTKE 3CWBE 3GLMA 5CMZA 1SVFA 2B87A 5AW3B 3KZIH 1PGPA 3A2AA 3P7KA 3AE2C 3H1KE 1BE3G 3N4XA 4RKUJ 1LT9A 1NTZK 3Q5SA 1S72P 2W90A 1J1DB 1CZQA 4JYCA 1X22A 3H1IG 4GOFA 4IL6E 5AW2B 3WUTA 2H89C 2R5BA 3VMXA 5APXA 1R5LA 2QE7H 1L0NK 1URQC 3BRVB 1M57D 3QH9A 3Q5PA 2Y0DA 2YMYA 3KDPB 3OAKA 3WU2H 2G8YA 2OGUA 1S1CX 2G3AA 1IFIA 1ZW0A 1NTMK 1X79B 3L75E 1UIXA 2WSFH 2HPCB 1RF1A 4XFJA 1PIXA 1NTMJ 5AVSB 5AW7B 5CCHC 3D71A 2E5TA 5KKZB 1G1IA 1KQSO 3L73G 1NAYA 4JPZB 1SQXG 3CCVP 1W2BO 3AE8C 4R4MA 2PP6A 2E43A 4ZKPA 1ZLLA 3G3ZA 4XA4A 1BGYE 5GTIE 1KILA 4K3AA 2ZYGA 1KYOI 3AE3C 1X0TA 2FXOA 2HYNA 2POHA 1FZCA 4OH8B 3PHLA 1DX7A 3CCRP 2QJKC 2QSIA 1KYOH 1UIIA 2QIWA 2IFMA 2XNXA 3T97B 3S4RA 4UB8H 3RGUA 2JKVA 3FXEA 2Q3IA 5CHXA 3AEAC 1SLQA 3L70E 4L73A 4OWFA 1QVGO 3GHGA 1U7MA 1AJYA 2D2CB 1L0NJ 2DW3A 4KHXA 4LGDE 2OTJP 1L0NE 1SQQG 1IK7A 5H2FH 1KC8Q 2LR2A 4LLHA 2YKPA 1J1EB 3N7NA 5AVWB 1GU4A 3HD7D 1KN7A 4WY4B 5KLVK 1S4XA 2M8RA 4WVZA 1YTZT 1K9MQ 2PAJA 1GU5A 3AECC 3KHUA 1P84D 4HKZH 4IOIH 4WY4C 1L0LD 5L8RJ 1URQB 1JB0J 2KYVA 1PP9G 3NTNA 1P84H 1KFMA 2OYOA 1AVOA 2A45H 2Z5IA 3AEFC 4BXLA 5AVTB 1M1KQ 1GDTA 1T8ZA 3P32A 1VDFA 4NPDA 1H89A 1HVVA 3M0AA 5DJUB 4AYCA 2IYPA 2IDBA 2ZT9D 3L37A 2P2UA 1X8YA 1LTAC 4GKGA 4LC1A 2UWJE 1ZN5A 2L91A 2QJKB 1MUUA 1M1JB 2B9BA 3H1JG 4I7ZB 4IL6H 3H1ID 3L70G 3USSA 1MFZA 4H44C 3RK2B 1Q2NA 4IFMA 1KMIZ 1S2EA 1SQVE 3H1HJ 2A45G 1A02J 3M9HA 1NGMB 1PFIA 1DD3A 3WU2E 1PPJG 1SQPG 1FDIA 1FJKA 2E76C 3U1AA 3UIAA 1M1JA 4D6TG 1LTGC 2FFDB 3G4SP 1FOSF 1SQXJ 2P1JA 1LGHB 1E5WA 3E1RA 5AW8B 1LP1A 4KJMA 2ZVNB 2KSJA 2H43A 1VQOP 1MFTA 4XE5B 4U3FD 5AW6B 3CWBJ 1IZNB 3AEGC 1M56D 1M7LA 2XDJA 3BCCG 3CLQA 1AFOA 4PJ0H 1BDCA 3L72G 3CMAP 2QJPB 2AXCA 1RE3C 2E74D 2GUSA 3RK3E 1IFPA 1BSHA 4A7PA 3P8MC 1J1DC 1WMKA 2FFDC 1OVUA 3F5HA 1K05A 4I2LC 3AE1C 3VMZA 1T2KC 1CW5A 2Y0EA 1QLED 4GT1A 4DJGA 1LT9B 2LXCB 1AQTA 3IFMA 3CCJP 3V6IA 1ZV8A 1KQGB 2FYUE 3KQGA 3B71A 3HRNA 2WSEH 2AEFA 2QG4A 1LTJB 3PRJA 4H44B 1JY3P 3FXDA 3RK2C 5BVZA 1M1JC 3L72J 3D70A 5KLVD 3PTZA 2JEEA 2KI7B 1KILB 1GW3A 2N1TC 2O01J 2D2CD 4R4LA 3VTPC 3BVHA 3VMAA 1FZCB 2B88A 1BCCE 1FBMA 1LNQA 5APUA 2ZFCA 3MUDA 1JY2N 1N73C 2NZ2A 3BCCE 3IF4A 3CCQP 4I1LA 3BRTB 3WUVA 2YKQA 3HTKB 1SQXD 2FBWC 3RBXA 2FYUK 1GK4A 2K9YA 1HTLC 1JY3O 2H88C 2V7QH 2P67A 3GW6A 5M1BA 4N78D 2Q6QA 1YI2P 3CD6P 5H2FE 3H1JJ 2Z5HA 2K9JB 3U1CA 1J1EC 5TJHA 3G6EP 2L5GB 2ZXXA 1VQ9P 3VMYA 1KQLA 1SQVG 5KTBA 4H0LC 3H1HG 3JSVC 4K35A 2I8DA 3D6ZA 1KILC 1P84I 2D2CC 2N1TB 4AQRD 3A5TA 1FZCC 3AE4C 3L36A 3MD0A 4TLFA 1Q81Q 2O1JA 2RH0A 4L76A 1PPJE 2ZT9B 1GK6A 4B86A 2W8ZA 1BSNA 3AEEC 1L2PA 2K88A 2Y9YA 1RE4C 2YO3A 1SQVD 2C0WA 1BE3E 3AEDC 1JCCA 1BGYG 1Z56A 3BCCJ 2W27A 1OWAA 2WPVB 1FE6A 1N7SA 2GA1A 2WPRA 3GHGC 4YTPC 3H25A 1NTKJ 4NPEA 5E79H 1VQMP 2KUBA 2W83C 3Q3DA 4PD4I 2WVRA 2B87B 4W7ZA 4NPFX 1GD2E 4GIFA 3M9QA 3I55P 1SQVK 2ZYAA 4YXDC 1EXIA 3E7KA 1VQ7P 2J58A 1HH0A 1URQA 3H32B 4I6MC 1KB9D 1JUNA 2FFDA 4M3LA 1VQPP 2YXQB 4PD4H 1OW8A 2PRRA 4N3YB 1LTBC 4EIJA 1L0NG 1KQFB 4C7NB 1HJ0A 2LXBA 1NOHA 1DH3A 4W7YA 2FY8A 2N9YB 4CPGA 5CCHA 3RK3D 1NU1E 1S3JA 5CJ0A 2O01H 1RF1C 1KORA 1JMMA 2E74B 2QJYC 1LTJA 1JY2P 1NVOA 2AXTH 3A0BE 3OA7A 2XKMA 1OW6A 1QEXA 4L74A 1N8RQ 2WSEJ 3GF3A 1QVFO 3R2PA 2E76D 2IYOA 5KJ7C 1EC5A 1T6AA 1DD4A 2RMZA 2ITAA 3MP7B 3WMM0 1RF1B 1EQ7A 3CX5I 1VQ4P 3RBZA 1FZBA 1JTHB 2H8PD 3I5CA 5KLVE 1L4AB 1NTZJ 1SFCC 1GW4A 2BCCD 2IBZG 2P10A 3PJSK 3TGUJ 3CCLP 3VP9A
chains in the Genus database with same CATH topology
1FAVA 3CL3D 3VP8A 2NPSD 3O8ZA 1XTGB 5AVVB 3BATA 3HUSC 1MZ9A 2QM7A 1RF1B 2Q9IA 2E42A 1N2DC 4N78E 2WZ7A 1IK9A 1G1JA 1WT6A 1NH4A 2FKWB 2KOGA 5AVXB 2R3CA 4WB4A 3T97A 2OYIB 1T2KD 3GHGB 2CPSA 5AVUB 3VN0A 5AW5B 4W80A 2IFNA 2CPBA 2IPPA 3M06A 2P7JA 1ZR4A 3IR9A 2GM4A 1URQD 1OXZA 4IFDK 1WRGA 1HUCA 1GL2C 3TK1A 2JJLA 2HG5D 3V4QA 2I1KA 5AW0B 3HUSA 2HODA 1QL1A 5APVA 2Q5UA 4N6JA 4Y99C 2HFED 2KLVA 4ZKUA 3RL0B 3L35A 1IFNA 1L4AA 1SQQK 1H88A 2KB7P 3NMDA 2NPSB 2WITA 4HH2A 3KPEA 5AW1B 2BASA 1L4AD 4DZOA 2N1TD 1N7SC 1NHLA 1RY3A 2GUVA 2XV5A 1RE4A 1LT9C 1SQBK 2HLOA 1FZFA 1HWTC 3RL0C 2M3BA 4C7NA 2YKOA 1IO4A 3E1IA 1H8AA 2OARA 4JF7A 3PP5A 3V5BA 3LIEA 1FZAA 3RK2D 1LTIC 3VOPA 2WSCH 4HYTB 1CI6B 2MJZA 5APSA 2FXMA 1ZR2A 3MTUE 1S9KD 1N7LA 1IJDB 2OYHC 1SFCA 1GZLA 2VRSA 3B8EB 3HD7B 2HODB 3HE5A 1AQ5A 5AVQB 3LIDA 4IFFA 5CCGA 3U59A 3TYYA 1IFMA 4O9BA 3HE5B 1GL2B 1LTSC 1XTCC 5CCGD 4WY4D 3M9BA 2OYIA 1FZEA 1KFNA 1LWUC 3B5NC 4C7RA 5KJ7A 1KILD 5APYA 1IFDA 1QL2A 1JY2O 2WTYA 2OYIC 5APWA 1NTKK 2NPSA 3H32A 1HBWA 4EOTA 5CCGC 3H6PA 3NXSA 1S9KE 4Y99B 5BU5A 2XZRA 1T3JA 1HGZA 1CI6A 2A45I 2N9BA 3KYQA 2I1JA 3P8CE 2Q7CA 3HTKA 3LW5H 1RF0C 3II6A 5CCHD 2R5DA 3TNUA 1FOSE 1NU1K 2LKMA 5AVYB 3L4FA 1YYCA 2OYHB 3RL0D 1W2EA 1T3UA 1HJBA 1JY3N 2N1TA 3EFGA 5CJ4A 2ZXEB 2J59M 1LTTC 1IFJA 5AW9B 2OYHA 2C9NY 1DEBA 3HE4A 4C46A 3RK3B 2WPSA 1JNMA 2O1KA 1NWQA 1JOCA 5BU8B 3HE4B 1RF0A 1J2JB 1G2CA 1YTZI 3V4WA 1NO4A 1CSBA 3A7OA 3OJAB 5APQA 1L0LK 3V2RA 4DOJA 1N73B 2R32A 1LWUA 3B5NA 3V2PA 1L4AC 1SFCB 4WBAA 3SWYA 2Z4EA 1GTWA 5AVZB 1FDMA 1LWUB 1MV8A 1VPCA 3B5NB 3VYIA 1RE3A 3SWFA 2NPSC 2H7HA 2YNYA 2WT7A 1HGVA 1FZGA 4JYBA 5AVRB 1GL2A 1SQXK 1GL2D 1SQPK 1JCDA 2WT7B 1NKNA 3BASA 2WWWA 2W6BA 3P8CD 1JO5A 4WY4A 2C9LY 3HD7C 3RK3C 1JTHA 1IC2A 1X9VA 1N86A 5KJ7D 1A02F 2IX7C 3MIWA 4RESB 2YO2A 3M0DC 1N7SD 3V2QA 3C9IA 3M91A 2W6AA 1SP4A 5APTA 4AUWA 3HD7A 3V2NA 5AW4B 2XU6A 3TNUB 3M0DA 1NAFA 3NFQA 3EQ2A 1KZUB 1NKZB 3HUSB 2C0XA 3B5ND 3MGNA 2WPQA 3TSIA 1G2CB 3CI9A 2FYZA 1N7SB 3A3YB 2QM8A 2KP8A 1FU1A 1LTJC 1SFCD 5CMZA 1SVFA 2HPCB 5AW3B 3A2AA 3P7KA 3N4XA 1LT9A 1NTZK 1J1DB 1CZQA 4JYCA 1AFOA 5AW2B 3VMXA 2R5BA 5APXA 1L0NK 1URQC 3BRVB 2YMYA 3KDPB 3OAKA 1IFIA 1NTMK 1X79B 2WSFH 1RF1A 5AVSB 5AW7B 5CCHC 1G1IA 2E43A 2PP6A 4ZKPA 1ZLLA 3G3ZA 4XA4A 1KILA 1FZCA 2HYNA 2POHA 4OH8B 1DX7A 2IFMA 2XNXA 2Q3IA 5CHXA 1SLQA 3GHGA 4KHXA 4LGDE 4LLHA 2YKPA 3N7NA 1J1EB 5AVWB 1GU4A 3HD7D 4WY4B 5KLVK 2M8RA 1YTZT 2PAJA 1GU5A 4WY4C 1URQB 2KYVA 3NTNA 1KFMA 2Z5IA 2A45H 5AVTB 1GDTA 1T8ZA 3P32A 1VDFA 1H89A 1HVVA 3M0AA 4AYCA 3L37A 2P2UA 1X8YA 1LTAC 4GKGA 4LC1A 1ZN5A 1MUUA 1M1JB 1MFZA 3RK2B 4IFMA 2A45G 1A02J 3M9HA 1PFIA 3UIAA 1FJKA 3U1AA 1M1JA 1FOSF 1LTGC 2FFDB 2P1JA 1LGHB 1E5WA 5AW8B 2KSJA 2H43A 4XE5B 5AW6B 2XDJA 1M7LA 3CLQA 1RE3C 2GUSA 3P8MC 1J1DC 2FFDC 1T2KC 4I2LC 3VMZA 1CW5A 4GT1A 1LT9B 3IFMA 1ZV8A 3KQGA 3HRNA 2WSEH 3RK2C 1LTJB 1JY3P 5BVZA 1M1JC 2JEEA 1KILB 1GW3A 2N1TC 3VTPC 1FZCB 3BVHA 1FBMA 5APUA 2ZFCA 3MUDA 1JY2N 1N73C 4I1LA 3BRTB 2YKQA 3HTKB 2FYUK 1GK4A 1HTLC 1JY3O 2P67A 4N78D 2Z5HA 3U1CA 1J1EC 2L5GB 3VMYA 1KQLA 5KTBA 2HPCA 1KILC 2N1TB 3A5TA 4AQRD 1FZCC 3L36A 3MD0A 2O1JA 1GK6A 4B86A 2YO3A 1N73A 1RE4C 2C0WA 1JCCA 1Z56A 2W27A 1OWAA 3GHGC 1FJPA 1N7SA 2WPRA 4W7ZA 1GD2E 4GIFA 3M9QA 1SQVK 2J58A 1HH0A 1URQA 3H32B 4I6MC 1JUNA 2FFDA 4M3LA 4N3YB 1LTBC 4EIJA 4C7NB 1NOHA 1DH3A 4W7YA 5CCHA 3RK3D 5CJ0A 2O01H 1RF1C 1JMMA 1LTJA 1JY2P 3OA7A 2XKMA 3R2PA 5KJ7C 3WMM0 1EQ7A 3I5CA 1FZBA 1JTHB 2H8PD 1L4AB 1SFCC 1GW4A 3VP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BRV B;  1JOC A;  3CL3 D;  3EQ2 A;  2YKP A;  3BRT B;  2YKQ A;  3L4F A;  2W6B A;  2YKO A; 
#chains in the Genus database with same CATH topology
 1FAV A;  3CL3 D;  4WWI A;  2K1A A;  3BCC D;  2O01 N;  2NPS D;  3O8Z A;  1OW7 A;  1XTG B;  3MZW B;  1SQV J;  2HR3 A;  3BAT A;  1YBK A;  3H1H E;  1MZ9 A;  3HUS C;  2O3J A;  4GDO A;  1USE A;  2QM7 A;  1BE3 D;  3QWO C;  4U3F G;  1QX8 A;  2IBZ I;  3H1K J;  2YXR B;  1KB9 I;  3S1K A;  1RH5 B;  2Q9I A;  5B5E H;  2E42 A;  1NTK E;  1OFC X;  1N2D C;  1Q7Y Q;  4N78 E;  2WZ7 A;  2Q1K A;  1FC2 C;  1KB9 H;  2BEQ D;  4D6T E;  1IK9 A;  1G1J A;  1GMJ A;  1WT6 A;  1NH4 A;  4YXW H;  1EXJ A;  2RKL A;  1MKM A;  3L70 D;  1PZQ A;  2FKW B;  2KOG A;  1M8O B;  1ZOY C;  2R3C A;  5AVX B;  4WB4 A;  1YQ4 C;  3T97 A;  2ZVO B;  3GF7 A;  4OGQ C;  2OYI B;  1T2K D;  1NTM E;  1OX3 A;  1S5L E;  4UB8 E;  3GHG B;  2CPS A;  5AVU B;  5TIS E;  3VN0 A;  5AW5 B;  3CC7 P;  2FYN C;  4W80 A;  2IFN A;  2CPB A;  2IPP A;  3FX0 A;  4JQ0 D;  3M06 A;  2P7J A;  1ZR4 A;  3AE9 C;  1DEE G;  3IR9 A;  2GM4 A;  4RJT A;  4PV1 B;  1PL5 A;  4ZNC A;  1URQ D;  1R8E A;  1OXZ A;  4IFD K;  5AVV B;  1WRG A;  1FDO A;  1HUC A;  1W5C E;  1GL2 C;  1VQN P;  4BWN A;  2JP3 A;  3TK1 A;  3L73 E;  4Z1M H;  2KZI A;  2JJL A;  3VP8 A;  2HG5 D;  3V4Q A;  1R5S A;  2I1K A;  3Q1M A;  5AW0 B;  3HUS A;  4ASV A;  1PGQ A;  2HOD A;  2KSE A;  1QL1 A;  1S5L X;  5APV A;  2Q5U A;  4N6J A;  4Y99 C;  2HFE D;  1OVR A;  4H44 D;  2YIU B;  2KLV A;  4ZKU A;  3ITK A;  3RL0 B;  3L35 A;  1IFN A;  1L4A A;  1VQK P;  1SQQ K;  1LJ2 A;  1SQP D;  2E76 B;  4D6T J;  1H88 A;  5E79 E;  2KB7 P;  3NMD A;  3H1J E;  4U3F J;  2NPS B;  2RN0 A;  2BCC G;  2WIT A;  4HH2 A;  4KT0 J;  2QA4 P;  2KNC B;  3KXD A;  3KPE A;  2KLU A;  5AW1 B;  2BAS A;  1L4A D;  1VL2 A;  3L75 J;  4DZO A;  1AV1 A;  2N1T D;  1N7S C;  5KLI C;  1NHL A;  4DCK A;  3L71 J;  2AEM A;  1RY3 A;  2AXT E;  2GUV A;  2XV5 A;  1RE4 A;  1LT9 C;  1SQB K;  1VF5 B;  2HLO A;  2M3E A;  4H0L B;  2IZ0 A;  5B5E E;  1NTM D;  1FZF A;  4HJG H;  2QEX P;  1BCC J;  5CBN A;  1HWT C;  2ZAE B;  2FXP A;  3ABV C;  3RL0 C;  3Q5R A;  2M3B A;  4C7N A;  2YKO A;  5KAI E;  1SQB E;  3E1I A;  2FYU J;  2WSC J;  3L74 D;  3RL0 g;  3S9O A;  1IO4 A;  3LW5 J;  3B4S A;  3CXH E;  3WUU A;  1H8A A;  1EDL A;  2OAR A;  4JF7 A;  1SQP J;  1JM0 A;  4D6T D;  5CBO A;  2M0B A;  3PP5 A;  3V5B A;  2ZJS E;  3C8V A;  3LIE A;  1EDJ A;  3JCU E;  1FZA A;  3FWN A;  4U3F E;  3RK2 D;  3CCU P;  1LTI C;  3VOP A;  2KZJ A;  3KZI E;  2Y9Z A;  1SQQ J;  2WSC H;  1SQQ E;  4HYT B;  1CI6 B;  3CXH I;  3IN6 A;  2MJZ A;  2YMK A;  3L74 G;  5APS A;  1Q86 Q;  2KXP B;  2FXM A;  2E75 C;  2FYU G;  3JC2 2;  1NU1 J;  2K3R A;  2JWD A;  1Y47 A;  2A06 E;  3W68 A;  1ZR2 A;  1ZRT E;  1KTM A;  3MTU E;  1S9K D;  1KV4 A;  1SQX E;  1N7L A;  1IJD B;  2OYH C;  1VF5 D;  2FYU D;  3L74 J;  1SFC A;  1SQB J;  1GZL A;  3H1L E;  2VRS A;  4OGQ B;  3B8E B;  3HD7 B;  1NJI Q;  2HOD B;  3HE5 A;  2CK3 H;  1AQ5 A;  5AVQ B;  3LID A;  1KYO E;  4IFF A;  3L71 E;  5CCG A;  3U59 A;  3TYY A;  1IFM A;  3FGA D;  3CWB D;  3OW2 O;  3L70 J;  2KK7 A;  1ZME C;  3R4Y A;  1PPJ D;  4O9B A;  2E5Y A;  4DT0 A;  1BE3 J;  3HE5 B;  3L75 G;  1VQ8 P;  1LP1 B;  1GL2 B;  1LTS C;  1XTC C;  5CCG D;  1BGY J;  3H1I J;  4WY4 D;  3M9B A;  1BGY D;  2OYI A;  1VQL P;  2K37 A;  1VQ5 P;  4OVN F;  1FZE A;  1Q82 Q;  1NTK G;  2V7Q J;  4PV1 C;  1N73 A;  3CCE P;  3H1J D;  1BCC G;  1KFN A;  1OIP A;  1LWU C;  3B5N C;  4C7R A;  3D6Y A;  1AA0 A;  1M90 Q;  1JMB A;  3SWK A;  5KJ7 A;  3F89 A;  1KIL D;  3SSU A;  3W67 A;  5APY A;  5KLI B;  1IFD A;  1QL2 A;  3L75 D;  1JY2 O;  1NTZ D;  4I7Z C;  3C1L A;  1PGO A;  3TGU D;  2WTY A;  5APW A;  2OYI C;  1NTM G;  3CWB G;  1PGJ A;  1OZH A;  1NTK K;  2WQY C;  2NPS A;  1TU3 F;  5GTH E;  3L73 J;  3H32 A;  2KNC A;  4GOE A;  4EYY Q;  1HBW A;  3EFF K;  4EOT A;  1ZRT D;  1RHZ B;  2YIU C;  3FWL A;  5CCG C;  3H6P A;  3NXS A;  1SQB D;  4QMA A;  3L74 E;  2E74 C;  2QJY B;  4GOD A;  4U7J A;  1P84 E;  4Y99 B;  1S9K E;  1PP9 D;  1Y9B A;  5BU5 A;  1BDD A;  2XZR A;  5KAF E;  4PV1 D;  5KKZ C;  3CC2 P;  3H1L J;  4RO0 A;  1T3J A;  3SFE C;  5GTI H;  3CPW O;  5KLV J;  3H1L D;  1H0T A;  1HGZ A;  3G9R A;  3CX5 E;  2KIK A;  1CI6 A;  2A45 I;  2N9B A;  3KYQ A;  4BRY A;  3GMA A;  2WSS H;  2I1J A;  3P8C E;  2Q7C A;  1SQQ D;  3HTK A;  3LW5 H;  1RF0 C;  2JO1 A;  3H1L G;  3II6 A;  4PD4 E;  5CCH D;  1QGK B;  2R5D A;  4OGQ D;  3TNU A;  3H1I E;  1FOS E;  5B66 E;  4H13 B;  1NU1 K;  2LKM A;  3GG2 A;  2IBZ E;  3JCU H;  3L4F A;  5AVY B;  5KLV G;  1YYC A;  2FYN B;  3H1K G;  4IL6 X;  1ZP0 C;  3RL0 D;  3Q2Y A;  2HPC A;  1W2E A;  2OYH B;  1T3U A;  1HJB A;  1NTK D;  1YIT P;  1JY3 N;  2N1T A;  3EFG A;  5CJ4 A;  2ZXE B;  3CXH H;  4H13 C;  4JBZ A;  2J59 M;  1LTT C;  1IFJ A;  5AW9 B;  4TT3 H;  3I56 P;  4EI2 A;  1OVV A;  2OYH A;  2JDI H;  3O6Q A;  1DEB A;  2C9N Y;  1EDK A;  2BCC E;  3HE4 A;  3RK3 B;  4C46 A;  1K04 A;  2WPS A;  4ZMD A;  3L71 D;  1NTZ E;  3TGU E;  1RQU A;  1L0L G;  5TIS H;  1JNM A;  3MHV A;  2K9J A;  2O1K A;  2R44 A;  2W6J H;  3A0B H;  4H0L D;  1JOC A;  1NWQ A;  3H1H D;  1D7M A;  3CCM P;  5BU8 B;  3HE4 B;  3MUD C;  1YJN P;  1Q90 D;  1K73 Q;  1RF0 A;  1J2J B;  1G2C A;  2KS1 A;  1EZV D;  2R3S A;  3TF5 A;  1L0L J;  1YTZ I;  2OTL P;  3V4W A;  1HF9 A;  1NO4 A;  1CSB A;  2IZ1 A;  3A7O A;  3OJA B;  5APQ A;  1L0L K;  2Y0C A;  4H13 D;  3V2R A;  4DOJ A;  1N73 B;  5K5G B;  2R32 A;  3CX5 D;  1KIL E;  3AE6 C;  1LWU A;  3B5N A;  4Y28 J;  3V2P A;  1VQ6 P;  2J5U A;  1L4A C;  1SFC B;  5GTH H;  1SS1 A;  4WBA A;  2QRX A;  3A0H E;  2ZT9 C;  3SWY A;  2Z4E A;  3CCS P;  1GTW A;  1DIP A;  5AVZ B;  1AVY A;  1FDM A;  1K8A Q;  1LWU B;  1MV8 A;  1VPC A;  3B5N B;  3VYI A;  1RE3 A;  4ASW A;  2NPS C;  3SWF A;  3CME P;  2H7H A;  2A06 G;  2YNY A;  2IBZ D;  1NU1 G;  2WT7 A;  1HGV A;  1YIJ P;  1U7J A;  1PP9 E;  2B89 A;  1PP9 J;  1FZG A;  4JYB A;  5AVR B;  4BRY B;  1GL2 A;  2SPZ A;  1YJW P;  1SQX K;  4PJ0 E;  1GL2 D;  2QJP C;  1SQP K;  3EWK A;  1JCD A;  1RQV A;  4L75 A;  1SQB G;  2XND H;  5DJT B;  2WT7 B;  1NKN A;  3BAS A;  4EDF A;  3G71 P;  3L73 D;  4UB6 E;  1EZV I;  3L72 E;  1JEK A;  2BEZ F;  2W6B A;  2WWW A;  3K5B A;  3P8C D;  1S5L H;  2PGD A;  4WY4 A;  2C9L Y;  1BCC D;  5EFW B;  1JO5 A;  1LT1 A;  4PD4 D;  2OQQ A;  1H0T B;  2WMM A;  3HD7 C;  2PFX A;  4UB6 H;  3H1K D;  3RK3 C;  2E75 D;  1JTH A;  5KAF H;  3AE7 C;  1YQ3 C;  1EZV G;  3SFD C;  2MKV A;  1U57 A;  1EZV E;  1IC2 A;  1NYH A;  1PV3 A;  1X9V A;  3PLN A;  3O6Q B;  2Q3E A;  1N86 A;  1SQP E;  5KJ7 D;  1YHQ P;  1KD1 Q;  3CXH D;  1A02 F;  4YPC A;  2IX7 C;  2E75 B;  3MIW A;  4HB1 A;  2JWA A;  1USD A;  4RES B;  2YO2 A;  2AEJ A;  1N7S D;  2V4H A;  2WSF J;  3CX5 H;  3IAO A;  3M0D C;  5KAI H;  3V2Q A;  3C9I A;  2QVA A;  2BCC J;  5B66 H;  3M91 A;  2M5A A;  2W6A A;  1SP4 A;  3TDK A;  2P58 A;  5APT A;  4AUW A;  1FS0 E;  3HD7 A;  4MN4 C;  3L71 G;  2A06 D;  1NU1 D;  2JR8 A;  2ZYD A;  1E79 H;  3ZDM A;  3CC4 P;  3V2N A;  5AW4 B;  2XU6 A;  2M5A B;  3TNU B;  1EDI A;  1FJP A;  3M0D A;  1L0L E;  1NAF A;  3NFQ A;  3EQ2 A;  1NTZ G;  3PH0 A;  3TGU G;  1KZU B;  1NKZ B;  2C0X A;  1VF5 C;  3A0H H;  1ZXG A;  3B5N D;  3HUS B;  2WPQ A;  3MGN A;  5C39 A;  3TSI A;  1YJ9 P;  1G2C B;  2KS1 B;  1Y8A A;  2FYZ A;  3CI9 A;  1KB9 E;  1N7S B;  3A3Y B;  2NRG A;  2QM8 A;  2KP8 A;  1FU1 A;  3L72 D;  1KYO D;  1LTJ C;  3AE5 C;  1SFC D;  3AEB C;  1L0N D;  1OMI A;  2OTK E;  3CWB E;  3GLM A;  5CMZ A;  1SVF A;  2B87 A;  5AW3 B;  3KZI H;  1PGP A;  3A2A A;  3P7K A;  3AE2 C;  3H1K E;  1BE3 G;  3N4X A;  4RKU J;  1LT9 A;  1NTZ K;  3Q5S A;  1S72 P;  2W90 A;  1J1D B;  1CZQ A;  4JYC A;  1X22 A;  3H1I G;  4GOF A;  4IL6 E;  5AW2 B;  3WUT A;  2H89 C;  2R5B A;  3VMX A;  5APX A;  1R5L A;  2QE7 H;  1L0N K;  1URQ C;  3BRV B;  1M57 D;  3QH9 A;  3Q5P A;  2Y0D A;  2YMY A;  3KDP B;  3OAK A;  3WU2 H;  2G8Y A;  2OGU A;  1S1C X;  2G3A A;  1IFI A;  1ZW0 A;  1NTM K;  1X79 B;  3L75 E;  1UIX A;  2WSF H;  2HPC B;  1RF1 A;  4XFJ A;  1PIX A;  1NTM J;  5AVS B;  5AW7 B;  5CCH C;  3D71 A;  2E5T A;  5KKZ B;  1G1I A;  1KQS O;  3L73 G;  1NAY A;  4JPZ B;  1SQX G;  3CCV P;  1W2B O;  3AE8 C;  4R4M A;  2PP6 A;  2E43 A;  4ZKP A;  1ZLL A;  3G3Z A;  4XA4 A;  1BGY E;  5GTI E;  1KIL A;  4K3A A;  2ZYG A;  1KYO I;  3AE3 C;  1X0T A;  2FXO A;  2HYN A;  2POH A;  1FZC A;  4OH8 B;  3PHL A;  1DX7 A;  3CCR P;  2QJK C;  2QSI A;  1KYO H;  1UII A;  2QIW A;  2IFM A;  2XNX A;  3T97 B;  3S4R A;  4UB8 H;  3RGU A;  2JKV A;  3FXE A;  2Q3I A;  5CHX A;  3AEA C;  1SLQ A;  3L70 E;  4L73 A;  4OWF A;  1QVG O;  3GHG A;  1U7M A;  1AJY A;  2D2C B;  1L0N J;  2DW3 A;  4KHX A;  4LGD E;  2OTJ P;  1L0N E;  1SQQ G;  1IK7 A;  5H2F H;  1KC8 Q;  2LR2 A;  4LLH A;  2YKP A;  1J1E B;  3N7N A;  5AVW B;  1GU4 A;  3HD7 D;  1KN7 A;  4WY4 B;  5KLV K;  1S4X A;  2M8R A;  4WVZ A;  1YTZ T;  1K9M Q;  2PAJ A;  1GU5 A;  3AEC C;  3KHU A;  1P84 D;  4HKZ H;  4IOI H;  4WY4 C;  1L0L D;  5L8R J;  1URQ B;  1JB0 J;  2KYV A;  1PP9 G;  3NTN A;  1P84 H;  1KFM A;  2OYO A;  1AVO A;  2A45 H;  2Z5I A;  3AEF C;  4BXL A;  5AVT B;  1M1K Q;  1GDT A;  1T8Z A;  3P32 A;  1VDF A;  4NPD A;  1H89 A;  1HVV A;  3M0A A;  5DJU B;  4AYC A;  2IYP A;  2IDB A;  2ZT9 D;  3L37 A;  2P2U A;  1X8Y A;  1LTA C;  4GKG A;  4LC1 A;  2UWJ E;  1ZN5 A;  2L91 A;  2QJK B;  1MUU A;  1M1J B;  2B9B A;  3H1J G;  4I7Z B;  4IL6 H;  3H1I D;  3L70 G;  3USS A;  1MFZ A;  4H44 C;  3RK2 B;  1Q2N A;  4IFM A;  1KMI Z;  1S2E A;  1SQV E;  3H1H J;  2A45 G;  1A02 J;  3M9H A;  1NGM B;  1PFI A;  1DD3 A;  3WU2 E;  1PPJ G;  1SQP G;  1FDI A;  1FJK A;  2E76 C;  3U1A A;  3UIA A;  1M1J A;  4D6T G;  1LTG C;  2FFD B;  3G4S P;  1FOS F;  1SQX J;  2P1J A;  1LGH B;  1E5W A;  3E1R A;  5AW8 B;  1LP1 A;  4KJM A;  2ZVN B;  2KSJ A;  2H43 A;  1VQO P;  1MFT A;  4XE5 B;  4U3F D;  5AW6 B;  3CWB J;  1IZN B;  3AEG C;  1M56 D;  1M7L A;  2XDJ A;  3BCC G;  3CLQ A;  1AFO A;  4PJ0 H;  1BDC A;  3L72 G;  3CMA P;  2QJP B;  2AXC A;  1RE3 C;  2E74 D;  2GUS A;  3RK3 E;  1IFP A;  1BSH A;  4A7P A;  3P8M C;  1J1D C;  1WMK A;  2FFD C;  1OVU A;  3F5H A;  1K05 A;  4I2L C;  3AE1 C;  3VMZ A;  1T2K C;  1CW5 A;  2Y0E A;  1QLE D;  4GT1 A;  4DJG A;  1LT9 B;  2LXC B;  1AQT A;  3IFM A;  3CCJ P;  3V6I A;  1ZV8 A;  1KQG B;  2FYU E;  3KQG A;  3B71 A;  3HRN A;  2WSE H;  2AEF A;  2QG4 A;  1LTJ B;  3PRJ A;  4H44 B;  1JY3 P;  3FXD A;  3RK2 C;  5BVZ A;  1M1J C;  3L72 J;  3D70 A;  5KLV D;  3PTZ A;  2JEE A;  2KI7 B;  1KIL B;  1GW3 A;  2N1T C;  2O01 J;  2D2C D;  4R4L A;  3VTP C;  3BVH A;  3VMA A;  1FZC B;  2B88 A;  1BCC E;  1FBM A;  1LNQ A;  5APU A;  2ZFC A;  3MUD A;  1JY2 N;  1N73 C;  2NZ2 A;  3BCC E;  3IF4 A;  3CCQ P;  4I1L A;  3BRT B;  3WUV A;  2YKQ A;  3HTK B;  1SQX D;  2FBW C;  3RBX A;  2FYU K;  1GK4 A;  2K9Y A;  1HTL C;  1JY3 O;  2H88 C;  2V7Q H;  2P67 A;  3GW6 A;  5M1B A;  4N78 D;  2Q6Q A;  1YI2 P;  3CD6 P;  5H2F E;  3H1J J;  2Z5H A;  2K9J B;  3U1C A;  1J1E C;  5TJH A;  3G6E P;  2L5G B;  2ZXX A;  1VQ9 P;  3VMY A;  1KQL A;  1SQV G;  5KTB A;  4H0L C;  3H1H G;  3JSV C;  4K35 A;  2I8D A;  3D6Z A;  1KIL C;  1P84 I;  2D2C C;  2N1T B;  4AQR D;  3A5T A;  1FZC C;  3AE4 C;  3L36 A;  3MD0 A;  4TLF A;  1Q81 Q;  2O1J A;  2RH0 A;  4L76 A;  1PPJ E;  2ZT9 B;  1GK6 A;  4B86 A;  2W8Z A;  1BSN A;  3AEE C;  1L2P A;  2K88 A;  2Y9Y A;  1RE4 C;  2YO3 A;  1SQV D;  2C0W A;  1BE3 E;  3AED C;  1JCC A;  1BGY G;  1Z56 A;  3BCC J;  2W27 A;  1OWA A;  2WPV B;  1FE6 A;  1N7S A;  2GA1 A;  2WPR A;  3GHG C;  4YTP C;  3H25 A;  1NTK J;  4NPE A;  5E79 H;  1VQM P;  2KUB A;  2W83 C;  3Q3D A;  4PD4 I;  2WVR A;  2B87 B;  4W7Z A;  4NPF X;  1GD2 E;  4GIF A;  3M9Q A;  3I55 P;  1SQV K;  2ZYA A;  4YXD C;  1EXI A;  3E7K A;  1VQ7 P;  2J58 A;  1HH0 A;  1URQ A;  3H32 B;  4I6M C;  1KB9 D;  1JUN A;  2FFD A;  4M3L A;  1VQP P;  2YXQ B;  4PD4 H;  1OW8 A;  2PRR A;  4N3Y B;  1LTB C;  4EIJ A;  1L0N G;  1KQF B;  4C7N B;  1HJ0 A;  2LXB A;  1NOH A;  1DH3 A;  4W7Y A;  2FY8 A;  2N9Y B;  4CPG A;  5CCH A;  3RK3 D;  1NU1 E;  1S3J A;  5CJ0 A;  2O01 H;  1RF1 C;  1KOR A;  1JMM A;  2E74 B;  2QJY C;  1LTJ A;  1JY2 P;  1NVO A;  2AXT H;  3A0B E;  3OA7 A;  2XKM A;  1OW6 A;  1QEX A;  4L74 A;  1N8R Q;  2WSE J;  3GF3 A;  1QVF O;  3R2P A;  2E76 D;  2IYO A;  5KJ7 C;  1EC5 A;  1T6A A;  1DD4 A;  2RMZ A;  2ITA A;  3MP7 B;  3WMM 0;  1RF1 B;  1EQ7 A;  3CX5 I;  1VQ4 P;  3RBZ A;  1FZB A;  1JTH B;  2H8P D;  3I5C A;  5KLV E;  1L4A B;  1NTZ J;  1SFC C;  1GW4 A;  2BCC D;  2IBZ G;  2P10 A;  3PJS K;  3TGU J;  3CCL P;  3VP9 A; 
#chains in the Genus database with same CATH homology
 1FAV A;  3CL3 D;  3VP8 A;  2NPS D;  3O8Z A;  1XTG B;  5AVV B;  3BAT A;  3HUS C;  1MZ9 A;  2QM7 A;  1RF1 B;  2Q9I A;  2E42 A;  1N2D C;  4N78 E;  2WZ7 A;  1IK9 A;  1G1J A;  1WT6 A;  1NH4 A;  2FKW B;  2KOG A;  5AVX B;  2R3C A;  4WB4 A;  3T97 A;  2OYI B;  1T2K D;  3GHG B;  2CPS A;  5AVU B;  3VN0 A;  5AW5 B;  4W80 A;  2IFN A;  2CPB A;  2IPP A;  3M06 A;  2P7J A;  1ZR4 A;  3IR9 A;  2GM4 A;  1URQ D;  1OXZ A;  4IFD K;  1WRG A;  1HUC A;  1GL2 C;  3TK1 A;  2JJL A;  2HG5 D;  3V4Q A;  2I1K A;  5AW0 B;  3HUS A;  2HOD A;  1QL1 A;  5APV A;  2Q5U A;  4N6J A;  4Y99 C;  2HFE D;  2KLV A;  4ZKU A;  3RL0 B;  3L35 A;  1IFN A;  1L4A A;  1SQQ K;  1H88 A;  2KB7 P;  3NMD A;  2NPS B;  2WIT A;  4HH2 A;  3KPE A;  5AW1 B;  2BAS A;  1L4A D;  4DZO A;  2N1T D;  1N7S C;  1NHL A;  1RY3 A;  2GUV A;  2XV5 A;  1RE4 A;  1LT9 C;  1SQB K;  2HLO A;  1FZF A;  1HWT C;  3RL0 C;  2M3B A;  4C7N A;  2YKO A;  1IO4 A;  3E1I A;  1H8A A;  2OAR A;  4JF7 A;  3PP5 A;  3V5B A;  3LIE A;  1FZA A;  3RK2 D;  1LTI C;  3VOP A;  2WSC H;  4HYT B;  1CI6 B;  2MJZ A;  5APS A;  2FXM A;  1ZR2 A;  3MTU E;  1S9K D;  1N7L A;  1IJD B;  2OYH C;  1SFC A;  1GZL A;  2VRS A;  3B8E B;  3HD7 B;  2HOD B;  3HE5 A;  1AQ5 A;  5AVQ B;  3LID A;  4IFF A;  5CCG A;  3U59 A;  3TYY A;  1IFM A;  4O9B A;  3HE5 B;  1GL2 B;  1LTS C;  1XTC C;  5CCG D;  4WY4 D;  3M9B A;  2OYI A;  1FZE A;  1KFN A;  1LWU C;  3B5N C;  4C7R A;  5KJ7 A;  1KIL D;  5APY A;  1IFD A;  1QL2 A;  1JY2 O;  2WTY A;  2OYI C;  5APW A;  1NTK K;  2NPS A;  3H32 A;  1HBW A;  4EOT A;  5CCG C;  3H6P A;  3NXS A;  1S9K E;  4Y99 B;  5BU5 A;  2XZR A;  1T3J A;  1HGZ A;  1CI6 A;  2A45 I;  2N9B A;  3KYQ A;  2I1J A;  3P8C E;  2Q7C A;  3HTK A;  3LW5 H;  1RF0 C;  3II6 A;  5CCH D;  2R5D A;  3TNU A;  1FOS E;  1NU1 K;  2LKM A;  5AVY B;  3L4F A;  1YYC A;  2OYH B;  3RL0 D;  1W2E A;  1T3U A;  1HJB A;  1JY3 N;  2N1T A;  3EFG A;  5CJ4 A;  2ZXE B;  2J59 M;  1LTT C;  1IFJ A;  5AW9 B;  2OYH A;  2C9N Y;  1DEB A;  3HE4 A;  4C46 A;  3RK3 B;  2WPS A;  1JNM A;  2O1K A;  1NWQ A;  1JOC A;  5BU8 B;  3HE4 B;  1RF0 A;  1J2J B;  1G2C A;  1YTZ I;  3V4W A;  1NO4 A;  1CSB A;  3A7O A;  3OJA B;  5APQ A;  1L0L K;  3V2R A;  4DOJ A;  1N73 B;  2R32 A;  1LWU A;  3B5N A;  3V2P A;  1L4A C;  1SFC B;  4WBA A;  3SWY A;  2Z4E A;  1GTW A;  5AVZ B;  1FDM A;  1LWU B;  1MV8 A;  1VPC A;  3B5N B;  3VYI A;  1RE3 A;  3SWF A;  2NPS C;  2H7H A;  2YNY A;  2WT7 A;  1HGV A;  1FZG A;  4JYB A;  5AVR B;  1GL2 A;  1SQX K;  1GL2 D;  1SQP K;  1JCD A;  2WT7 B;  1NKN A;  3BAS A;  2WWW A;  2W6B A;  3P8C D;  1JO5 A;  4WY4 A;  2C9L Y;  3HD7 C;  3RK3 C;  1JTH A;  1IC2 A;  1X9V A;  1N86 A;  5KJ7 D;  1A02 F;  2IX7 C;  3MIW A;  4RES B;  2YO2 A;  3M0D C;  1N7S D;  3V2Q A;  3C9I A;  3M91 A;  2W6A A;  1SP4 A;  5APT A;  4AUW A;  3HD7 A;  3V2N A;  5AW4 B;  2XU6 A;  3TNU B;  3M0D A;  1NAF A;  3NFQ A;  3EQ2 A;  1KZU B;  1NKZ B;  3HUS B;  2C0X A;  3B5N D;  3MGN A;  2WPQ A;  3TSI A;  1G2C B;  3CI9 A;  2FYZ A;  1N7S B;  3A3Y B;  2QM8 A;  2KP8 A;  1FU1 A;  1LTJ C;  1SFC D;  5CMZ A;  1SVF A;  2HPC B;  5AW3 B;  3A2A A;  3P7K A;  3N4X A;  1LT9 A;  1NTZ K;  1J1D B;  1CZQ A;  4JYC A;  1AFO A;  5AW2 B;  3VMX A;  2R5B A;  5APX A;  1L0N K;  1URQ C;  3BRV B;  2YMY A;  3KDP B;  3OAK A;  1IFI A;  1NTM K;  1X79 B;  2WSF H;  1RF1 A;  5AVS B;  5AW7 B;  5CCH C;  1G1I A;  2E43 A;  2PP6 A;  4ZKP A;  1ZLL A;  3G3Z A;  4XA4 A;  1KIL A;  1FZC A;  2HYN A;  2POH A;  4OH8 B;  1DX7 A;  2IFM A;  2XNX A;  2Q3I A;  5CHX A;  1SLQ A;  3GHG A;  4KHX A;  4LGD E;  4LLH A;  2YKP A;  3N7N A;  1J1E B;  5AVW B;  1GU4 A;  3HD7 D;  4WY4 B;  5KLV K;  2M8R A;  1YTZ T;  2PAJ A;  1GU5 A;  4WY4 C;  1URQ B;  2KYV A;  3NTN A;  1KFM A;  2Z5I A;  2A45 H;  5AVT B;  1GDT A;  1T8Z A;  3P32 A;  1VDF A;  1H89 A;  1HVV A;  3M0A A;  4AYC A;  3L37 A;  2P2U A;  1X8Y A;  1LTA C;  4GKG A;  4LC1 A;  1ZN5 A;  1MUU A;  1M1J B;  1MFZ A;  3RK2 B;  4IFM A;  2A45 G;  1A02 J;  3M9H A;  1PFI A;  3UIA A;  1FJK A;  3U1A A;  1M1J A;  1FOS F;  1LTG C;  2FFD B;  2P1J A;  1LGH B;  1E5W A;  5AW8 B;  2KSJ A;  2H43 A;  4XE5 B;  5AW6 B;  2XDJ A;  1M7L A;  3CLQ A;  1RE3 C;  2GUS A;  3P8M C;  1J1D C;  2FFD C;  1T2K C;  4I2L C;  3VMZ A;  1CW5 A;  4GT1 A;  1LT9 B;  3IFM A;  1ZV8 A;  3KQG A;  3HRN A;  2WSE H;  3RK2 C;  1LTJ B;  1JY3 P;  5BVZ A;  1M1J C;  2JEE A;  1KIL B;  1GW3 A;  2N1T C;  3VTP C;  1FZC B;  3BVH A;  1FBM A;  5APU A;  2ZFC A;  3MUD A;  1JY2 N;  1N73 C;  4I1L A;  3BRT B;  2YKQ A;  3HTK B;  2FYU K;  1GK4 A;  1HTL C;  1JY3 O;  2P67 A;  4N78 D;  2Z5H A;  3U1C A;  1J1E C;  2L5G B;  3VMY A;  1KQL A;  5KTB A;  2HPC A;  1KIL C;  2N1T B;  3A5T A;  4AQR D;  1FZC C;  3L36 A;  3MD0 A;  2O1J A;  1GK6 A;  4B86 A;  2YO3 A;  1N73 A;  1RE4 C;  2C0W A;  1JCC A;  1Z56 A;  2W27 A;  1OWA A;  3GHG C;  1FJP A;  1N7S A;  2WPR A;  4W7Z A;  1GD2 E;  4GIF A;  3M9Q A;  1SQV K;  2J58 A;  1HH0 A;  1URQ A;  3H32 B;  4I6M C;  1JUN A;  2FFD A;  4M3L A;  4N3Y B;  1LTB C;  4EIJ A;  4C7N B;  1NOH A;  1DH3 A;  4W7Y A;  5CCH A;  3RK3 D;  5CJ0 A;  2O01 H;  1RF1 C;  1JMM A;  1LTJ A;  1JY2 P;  3OA7 A;  2XKM A;  3R2P A;  5KJ7 C;  3WMM 0;  1EQ7 A;  3I5C A;  1FZB A;  1JTH B;  2H8P D;  1L4A B;  1SFC C;  1GW4 A;  3VP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...