3BRVB

Nemo/ikkb association domain structure
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
61
structure length
61
Chain Sequence
ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transcription
molecule keywords Inhibitor of nuclear factor kappa-B kinase subunit beta
publication title Structure of a NEMO/IKK-Associating Domain Reveals Architecture of the Interaction Site.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11577 NEMO NF-kappa-B essential modulator NEMO
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3brvB00
3CL3D 2YKQA 3BRVB 3BRTB 2YKPA 2YKOA 1JOCA 3EQ2A 3L4FA 2W6BA
chains in the Genus database with same CATH superfamily
1JY3N 2H89C 1L4AD 1LP1A 1NO4A 1R5SA 1AQ5A 3LW5H 2V4HA 3A5TA 2CK3H 1IFDA 1NTKE 2FKWB 3IN6A 2OYIA 1H0TA 3SSUA 2GA1A 1OZHA 4U3FD 1MUUA 5GTHE 3P32A 2XU6A 1GDTA 2NPSD 3M9BA 1YTZT 1RQUA 3CCLP 5GTIE 2E75B 2C9LY 2K9YA 1L0LG 1L4AC 3RK3D 4IFFA 4PV1B 3MD0A 2P58A 3I5CA 3I55P 4JQ0D 1NTMJ 3VMZA 2JO1A 3EQ2A 5AVZB 2K37A 2M3BA 4L75A 4I7ZB 5AW8B 2NPSC 1OFCX 1MKMA 3CCEP 3VP9A 5AW7B 1FDIA 1BGYE 4R4MA 2L5GB 3K5BA 2R32A 3CCUP 1YIJP 4WB4A 1E79H 1ZXGA 5DJTB 3F5HA 1SQXG 2D2CB 3P8CE 1BCCJ 1YITP 3TGUJ 1FJKA 5BU5A 1HTLC 3GG2A 1KYOE 1U7MA 2H88C 1OVUA 5B66H 4RKUJ 1Q7YQ 2ZT9D 4Z1MH 1LWUC 2YNYA 3G3ZA 1FZCA 1VQ5P 2NZ2A 3L73G 3R4YA 3H1IG 2WMMA 2FYUK 3Q5PA 1RF1C 2O01N 1J2JB 5KLIB 4C46A 4ASWA 3CCRP 2JWDA 1WRGA 2FBWC 1NU1D 3AE3C 5AW1B 1SQBD 4QMAA 1HVVA 5KLVE 2KS1B 1IFIA 5B5EH 5CCGA 2QIWA 5DJUB 2BCCJ 1X0TA 3E7KA 3VTPC 4H13C 3CX5I 1GL2A 2ZVOB 2FXOA 1U57A 1DD4A 1JUNA 3SFDC 3NTNA 1QGKB 3V2RA 3H1HD 3H32A 3MUDC 3M91A 1KYOD 3PTZA 2FYUJ 2LXCB 2HYNA 1W2BO 2GUSA 3L75E 4WWIA 3VYIA 2ZYAA 3KZIH 1KFMA 1P84I 1A02F 5H2FH 2UWJE 3RK2D 4GT1A 1KQFB 1BGYG 3RL0B 1CZQA 2KZJA 5L8RJ 3UIAA 4GODA 3S4RA 4O9BA 3H1LE 3Q5RA 1X22A 1ZP0C 2AEMA 1JY2P 2IFNA 1J1EC 2R3CA 2OYHB 5AVYB 5APSA 4JPZB 4L76A 3CX5H 3OA7A 2GM4A 1W5CE 1HJBA 1NGMB 3S1KA 1VQOP 2OYIB 3MIWA 1KN7A 3RK2C 5E79H 3G6EP 3KXDA 3V6IA 1PGPA 1EZVD 4IL6H 3H1JJ 3CI9A 1VQ4P 5KJ7A 3Q1MA 5KKZB 3PJSK 1EDIA 3IF4A 1DX7A 1P84H 4GIFA 5AW4B 3G4SP 1PPJE 2HPCA 4JYBA 5KLVG 2XZRA 2FY8A 3B5ND 1N7SB 2E74D 3AE1C 1NJIQ 3RGUA 2KI7B 1IK9A 4BXLA 4PJ0E 2BEZF 1NHLA 1LTAC 1JTHA 1NAFA 1ZV8A 1FOSE 2RKLA 3H1LD 3SWKA 3TNUB 4PD4E 3JCUH 3FX0A 1VQ8P 5M1BA 3T97A 3D6YA 2V7QJ 1K04A 3P8MC 1BCCG 3GF7A 2E76D 3LW5J 2C9NY 3L75G 1L4AA 3FXEA 1AV1A 4I1LA 1T3JA 2J58A 1W2EA 2WT7B 1BSNA 3AECC 1BE3E 1KQSO 1SQPE 4N78E 1KTMA 2A45H 2Q3IA 1FZCC 4RESB 4JBZA 3C8VA 1M8OB 1JB0J 1FZAA 1PP9E 3E1IA 3CPWO 3BRTB 4YXWH 3SWYA 3IFMA 3M9HA 5APYA 3BCCD 5BVZA 2IBZE 1JY2O 2OQQA 1YYCA 1N8RQ 4PD4D 1JY3P 1VQLP 4DT0A 1NKZB 3AEEC 3B8EB 1LT9A 2YO3A 3VN0A 3CXHE 2P67A 1GL2C 4M3LA 2IZ0A 1KMIZ 1M1JA 2Y9YA 1HF9A 2FYUG 3HRNA 1PGJA 4GKGA 3PHLA 3B4SA 1BE3D 2AEFA 2JEEA 1DEEG 1SQPD 3M9QA 1LTIC 3CWBJ 1K73Q 1FDMA 2WTYA 1N86A 1PGQA 2M5AB 3EFGA 2W83C 2B9BA 2WWWA 1Q90D 2N9BA 1Y8AA 5CBOA 3SFEC 1M1KQ 1SFCB 4K35A 3D71A 1M90Q 2C0WA 4H44B 2KUBA 3B71A 3AEFC 3L72J 3MUDA 1OW6A 3HTKB 3MTUE 1HH0A 3BVHA 4Y28J 1Q86Q 1L0NK 1S4XA 1SQXE 5KTBA 1KILB 1LTTC 1K8AQ 3H1JG 1PIXA 3CXHD 5KAFH 1AVOA 2YMYA 1URQD 1FZGA 2I8DA 3M0AA 1EQ7A 3O6QB 4BRYA 3HD7B 4UB6H 3HE4A 1OIPA 5KJ7C 1VQMP 3CCJP 1IZNB 3N4XA 4LGDE 4OGQB 1AJYA 3L73E 1L0LD 3H1IE 5B66E 4EI2A 2IBZG 1N2DC 1NU1J 1NWQA 3MGNA 1SQBJ 2CPBA 2OARA 1URQC 3HUSB 5KAIH 3VMYA 2M0BA 1NTMK 1LTJB 1SQQK 1OVRA 1Q82Q 1L0NJ 4TLFA 4IOIH 4ZNCA 4YTPC 2YO2A 1GW3A 1JY3O 3L70E 2KXPB 3F89A 1FC2C 2PFXA 1FU1A 1M56D 4OVNF 1HWTC 2XV5A 3R2PA 4ZKUA 3H1HJ 1M57D 2KLVA 1GTWA 1L4AB 3L72E 1SQXD 2KOGA 2Q3EA 1JOCA 1ZRTD 2KNCA 2E75D 4N6JA 1FOSF 4D6TJ 1NKNA 2HG5D 4OH8B 1S2EA 4PV1D 4NPFX 3ABVC 3L4FA 4IFMA 4C7NB 1JCCA 2Q6QA 2NPSB 2GUVA 3M0DA 5AVWB 2HODA 3JSVC 2N9YB 1YHQP 3NXSA 1SQQJ 3L71D 4KHXA 3H1ID 2E43A 2YIUC 3USSA 1RE4A 2N1TA 1GD2E 3RK3C 4L73A 4PV1C 4AQRD 1MZ9A 2R44A 3B5NA 2D2CD 1KC8Q 1NTKD 3HE5B 2K9JB 1KD1Q 1S9KE 1LWUB 1CI6B 1LT9C 3CD6P 1QX8A 3NFQA 1RF1B 2WVRA 1JO5A 1MV8A 3FGAD 1M1JC 1S1CX 1R8EA 1LJ2A 5TJHA 5AVXB 2KSJA 3AE9C 1KB9E 3GW6A 1T6AA 3AEGC 4IL6E 1DEBA 3CWBG 3VP8A 1T2KD 5CJ4A 1QL1A 4KT0J 3H1KJ 2POHA 2KZIA 2Y0EA 3V4WA 2QM8A 1IJDB 2G3AA 1NTME 2ZT9C 4LC1A 3L70G 4H13B 3C9IA 1BGYD 4H0LB 3A0HE 2DW3A 4CPGA 3L72G 3P8CD 2Q9IA 1SS1A 3AE7C 5GTHH 2WPVB 4U7JA 1KYOI 4A7PA 3CCVP 1S9KD 2ZAEB 1G2CB 1IFNA 1GMJA 1BCCE 3JCUE 1U7JA 3TGUE 2B89A 3GHGC 4BRYB 1GK6A 3CL3D 3MZWB 3CC7P 1YJ9P 5EFWB 3KDPB 1H89A 2VRSA 1KB9D 1H88A 3RL0D 2JWAA 3CCSP 2ZFCA 1J1EB 1ZR2A 4UB8E 3I56P 1UIXA 1L2PA 1SVFA 4YPCA 1OMIA 3V5BA 2KP8A 5KLVD 4N3YB 1EXJA 3CMEP 5CCHD 1LP1B 1L0NG 3RK2B 3SWFA 1EC5A 2ZYDA 2BCCE 1KYOH 1EZVI 1OW7A 1H0TB 3RL0C 1DH3A 1NYHA 1OWAA 2W27A 2QG4A 2H43A 3GLMA 4RO0A 3H1HG 2PP6A 3Q2YA 1RQVA 3QWOC 1SQVK 5CMZA 1BCCD 2QM7A 4HYTB 1SP4A 5CCHC 1LTSC 1NTZK 2HR3A 4D6TG 1N73A 3L75D 1Q2NA 2O1JA 2P7JA 2FYUE 2Z5HA 1ZOYC 3AE8C 2N1TD 1IFPA 2HLOA 1URQA 2C0XA 2FFDA 1USEA 1NTMG 2AEJA 1SQQG 2QSIA 1ZW0A 1MFTA 2Y0DA 5AVRB 4RJTA 1LTBC 3M0DC 2B87A 3L37A 2Z5IA 3W68A 2QEXP 1CSBA 2SPZA 2FXMA 4NPEA 1JMBA 1RE4C 2N1TC 3GF3A 1SQVJ 1VPCA 2KK7A 1X79B 3B5NC 3TGUG 2E74C 1QL2A 1NTZJ 3L74J 3WUVA 5AW3B 5AVTB 2A06G 2IFMA 3N7NA 1GU5A 2J5UA 2WITA 3WU2E 3ZDMA 3H1JE 1FZCB 1CW5A 5AVVB 2LKMA 1QLED 3D6ZA 1IC2A 2AXTE 2KYVA 1HJ0A 2FYUD 3A0BH 3MHVA 1PPJD 2E76C 2BEQD 4DCKA 1UIIA 1L0LJ 2IPPA 2WPQA 2YMKA 4W80A 2P10A 2A45G 3H1KG 2WPSA 5AVUB 4UB6E 2WSSH 4PD4I 2BCCG 3EFFK 1S5LX 1KV4A 1HBWA 5AW6B 1TU3F 2FYNC 2FYZA 3JC22 1GL2B 3BATA 4EIJA 1A02J 1KILE 4NPDA 3M06A 1VDFA 5KAIE 4U3FJ 3H32B 3QH9A 2OGUA 1USDA 2QJPC 5BU8B 1NTKK 1OVVA 4JYCA 1FZBA 1FZFA 4LLHA 3KYQA 1QVFO 4N78D 1R5LA 4EOTA 4PJ0H 1VQ7P 3L71J 1VQNP 4WY4D 3II6A 4PD4H 1PP9D 1ZR4A 1SFCD 2QJYB 2QVAA 2JR8A 2QJKC 3W67A 2HFED 3A2AA 4HH2A 2K3RA 4I6MC 1VF5D 1IK7A 2IBZD 1NU1K 1JNMA 4H44D 1SQBK 2RN0A 1FAVA 4EDFA 1NTKJ 1YQ3C 5APQA 4WY4C 3CXHI 3GHGA 1RE3C 3Q5SA 1SFCC 2BASA 4L74A 1VF5C 5CBNA 3HD7D 4U3FE 2E5TA 2R5DA 2JP3A 2L91A 1Z56A 2PAJA 2HPCB 4Y99C 1N73C 3FWLA 4K3AA 5AW9B 1FDOA 3CLQA 1J1DC 2W8ZA 1S72P 1ZLLA 3IR9A 5TISH 3FWNA 3CWBE 2FFDC 1VQKP 1WMKA 2B87B 5CHXA 1JTHB 1BSHA 3CC4P 1GK4A 2I1JA 2OTKE 2P1JA 4W7YA 3TSIA 3U1CA 3T97B 3CXHH 4GOFA 3VMXA 3WUUA 1SQVG 3AE2C 2OYHA 2W6JH 3HUSC 5B5EE 1NTZG 5CCHA 1OXZA 1M7LA 2MKVA 3L74G 1LTJC 3AEAC 2Q5UA 3OJAB 1JEKA 2YKOA 4TT3H 1KZUB 4KJMA 2WQYC 1DD3A 2RH0A 2KSEA 3AEBC 2IDBA 2W6BA 4ZMDA 3CC2P 2YIUB 3RBXA 2QA4P 2O01H 3L73D 3RK3B 2E75C 3TK1A 2O3JA 3AE6C 3KZIE 3CWBD 1RH5B 5KLVJ 3PRJA 1AA0A 1NU1E 1N7SA 3S9OA 1SQBE 1EDKA 1RF0C 5H2FE 2YKPA 3IAOA 3KQGA 3L70D 2I1KA 1LT9B 3TNUA 1L0NE 4I7ZC 3V2QA 3LIEA 4U3FG 2FXPA 4AYCA 1M1JB 4W7ZA 3L72D 1AFOA 3CX5E 2ZXXA 1G1IA 2M3EA 4I2LC 3H1HE 3L75J 2D2CC 3RBZA 2NRGA 3MP7B 2WPRA 1JCDA 1YJWP 4WVZA 5E79E 3TDKA 1S5LH 1PZQA 4D6TE 2QRXA 2WT7A 1WT6A 1BDCA 1FBMA 1GW4A 2RMZA 2ZT9B 2Q7CA 3L71G 1YTZI 3CCMP 2G8YA 2CPSA 1K05A 1FJPA 5APVA 1P84E 3ITKA 1RY3A 1DIPA 1SQQE 3H1LJ 4H13D 5AVSB 3C1LA 1X9VA 4H0LD 5KLIC 1HGVA 4B86A 1KORA 1GZLA 2K1AA 2W90A 1T2KC 1NTKG 2JKVA 1GU4A 1XTGB 3GHGB 1L0ND 1S3JA 5GTIH 2OYOA 3AE5C 2QE7H 3CCQP 1QVGO 4H0LC 1EZVE 3AE4C 3CX5D 2A06E 3HE4B 1OX3A 1KB9I 2PRRA 4WBAA 2KB7P 4D6TD 1ZN5A 1Q81Q 1SQPK 4YXDC 1NU1G 4BWNA 1SQBG 3H6PA 1HGZA 3BCCJ 2PGDA 1P84D 3A7OA 1NTMD 4DOJA 1SQQD 2XKMA 3G9RA 3A0BE 3H1KE 2M5AA 4WY4A 1RE3A 1NVOA 1SFCA 2XNXA 1AQTA 1E5WA 1KQLA 1KQGB 3Q3DA 2KNCB 5AW5B 2OYHC 3TGUD 3HTKA 4IFDK 1T3UA 2Q1KA 1BE3J 1KB9H 1KILA 3BRVB 1SQPJ 3WUTA 2A06D 2OYIC 2YKQA 2WSCJ 3O6QA 1VL2A 2HODB 1N7SD 5APUA 5AW0B 1IFJA 3HD7A 5KKZC 4AUWA 1PP9J 2H7HA 3LIDA 2M8RA 2N1TB 1L0LK 3P7KA 3A0HH 3KPEA 2A45I 3B5NB 1ZMEC 2WSEJ 2E74B 3H1KD 3HUSA 3U59A 3BCCE 2WSFJ 2LXBA 1N7SC 2OTJP 1LTJA 2BCCD 1EXIA 4HJGH 2ITAA 1NAYA 1EZVG 2E42A 4XFJA 2H8PD 3H25A 2E5YA 5APTA 1YJNP 1VQ6P 4EYYQ 3OAKA 1BDDA 3GMAA 2JDIH 2E76B 1FZEA 1IFMA 1SQXK 1PV3A 1JMMA 2P2UA 4UB8H 3CMAP 3BASA 5KAFE 2KLUA 1K9MQ 3E1RA 1YI2P 3U1AA 3WMM0 3RL0g 2ZVNB 1VQ9P 3EWKA 4C7NA 5CCGD 1LNQA 1RF0A 2O01J 2NPSA 3V2PA 1X8YA 2FYNB 2IX7C 3H1LG 2K88A 1PGOA 4R4LA 5CJ0A 1GL2D 2IZ1A 3V2NA 4XE5B 1JY2N 5TISE 1N7LA 2B88A 2QJPB 3PP5A 1H8AA 2J59M 1LT1A 1SQXJ 5CCGC 1SLQA 1SQVE 1LGHB 1NOHA 5APXA 1NTZE 3HE5A 3TF5A 2K9JA 3L74E 2JJLA 3AEDC 3H1JD 1LWUA 3PH0A 1CI6A 2ZJSE 1JM0A 1MFZA 2XNDH 3FXDA 1RF1A 1PPJG 5AW2B 5K5GB 3L73J 2QJKB 3H1IJ 1NH4A 2OTLP 1IO4A 4GOEA 2MJZA 2YXQB 3NMDA 3PLNA 4HB1A 1YBKA 1L0LE 1G1JA 2IBZI 3BCCG 1FS0E 4XA4A 1KFNA 1HUCA 4MN4C 1RHZB 1QEXA 4DZOA 2R3SA 4WY4B 4C7RA 2KS1A 3V4QA 1FE6A 3L70J 1YQ4C 1Y9BA 1PL5A 1KILD 4GDOA 1OW8A 1VF5B 2QJYC 5KJ7D 3WU2H 2Y0CA 1SQVD 4JF7A 5APWA 2ZYGA 3L36A 3KHUA 2AXTH 2WSCH 4Y99B 2ZXEB 1N73B 4H44C 1NTZD 1J1DB 1PFIA 2AXCA 1BE3G 3L35A 1G2CA 1ZRTE 3L74D 2Y9ZA 1EDJA 1SQPG 4OGQD 1URQB 2YXRB 3RK3E 2Z4EA 1KILC 2FFDB 1T8ZA 4HKZH 3O8ZA 5AVQB 5C39A 2O1KA 3D70A 2WSEH 3VOPA 2XDJA 1PP9G 3TYYA 2WZ7A 4IL6X 3HD7C 1Y47A 3L71E 2KIKA 2WSFH 2LR2A 2R5BA 2IYOA 1S5LE 1BGYJ 1LTGC 3OW2O 4ASVA 1EDLA 1XTCC 4OGQC 2IYPA 1D7MA 2W6AA 5KLVK 3G71P 1VQPP 3VMAA 1AVYA 3A3YB 2V7QH 4OWFA 4ZKPA 4DJGA
chains in the Genus database with same CATH topology
1JY3N 1L4AD 2HLOA 1URQA 1M1JA 1NO4A 1X9VA 2C0XA 1AQ5A 3LW5H 3A5TA 2FFDA 1IFDA 3HRNA 2FKWB 4GKGA 1HGVA 4B86A 5AVRB 2OYIA 1LTBC 3M0DC 1GZLA 2JEEA 1T2KC 3L37A 2Z5IA 3M9QA 1MUUA 1CSBA 1GU4A 1LTIC 1XTGB 3GHGB 2XU6A 3P32A 1GDTA 2NPSD 3M9BA 2FXMA 1YTZT 1FDMA 1RE4C 2WTYA 1N86A 2N1TC 2C9LY 3EFGA 1L4AC 3RK3D 4IFFA 1VPCA 2WWWA 2N9BA 1X79B 3B5NC 3MD0A 3HE4B 1QL2A 1SFCB 3I5CA 4WBAA 5AW3B 3VMZA 5AVTB 3EQ2A 2IFMA 2C0WA 5AVZB 2KB7P 3N7NA 2M3BA 1GU5A 1ZN5A 5AW8B 2NPSC 3MUDA 2WITA 1SQPK 3HTKB 1FZCB 3VP9A 1CW5A 3MTUE 1HH0A 3BVHA 5AVVB 2LKMA 5AW7B 1L0NK 3H6PA 1HGZA 1IC2A 2KYVA 5KTBA 1KILB 1LTTC 3A7OA 2L5GB 2R32A 4DOJA 2XKMA 2YMYA 4WB4A 1URQD 1FZGA 3M0AA 2IPPA 2WPQA 1EQ7A 4WY4A 3P8CE 4W80A 1RE3A 3HD7B 2A45G 1FJKA 3HE4A 5BU5A 5KJ7C 2WPSA 1HTLC 1SFCA 5AVUB 2XNXA 3N4XA 4LGDE 1E5WA 1KQLA 1HBWA 5AW6B 5AW5B 2OYHC 1LWUC 1N2DC 2YNYA 3G3ZA 3HTKA 1FZCA 2FYZA 1NWQA 4IFDK 3MGNA 1GL2B 3BATA 2CPBA 3HUSB 2OARA 1T3UA 1URQC 4EIJA 1A02J 3VMYA 2FYUK 1RF1C 1KILA 1NTMK 1LTJB 3BRVB 3M06A 1SQQK 1VDFA 1J2JB 2OYIC 4C46A 3H32B 2YKQA 2HODB 5BU8B 2YO2A 1NTKK 1GW3A 1N7SD 1JY3O 1WRGA 5APUA 5AW0B 4JYCA 5AW1B 1IFJA 3HD7A 1FZBA 4AUWA 1HVVA 1IFIA 1FZFA 4LLHA 1FU1A 5CCGA 2H7HA 3KYQA 3LIDA 2M8RA 1HWTC 2XV5A 2N1TB 1L0LK 3R2PA 2KLVA 3P7KA 4N78D 4ZKUA 3KPEA 1GTWA 4EOTA 1L4AB 2A45I 2KOGA 1JOCA 4N6JA 3B5NB 3VTPC 1FOSF 1NKNA 2HG5D 4OH8B 4WY4D 1GL2A 3U59A 3HUSA 3II6A 1JUNA 1N7SC 3L4FA 1LTJA 4IFMA 3NTNA 1ZR4A 1SFCD 3V2RA 3H32A 4C7NB 3M91A 2HFED 1JCCA 3A2AA 2NPSB 2GUVA 3M0DA 4HH2A 4I6MC 5AVWB 2E42A 2HODA 2H8PD 3NXSA 1NU1K 2HYNA 1JNMA 5APTA 2GUSA 1SQBK 4KHXA 3VYIA 1FAVA 3OAKA 1KFMA 2E43A 1RE4A 5APQA 4WY4C 1FZEA 2N1TA 1IFMA 1SQXK 1GD2E 3GHGA 3RK3C 1A02F 1RE3C 4AQRD 1MZ9A 3B5NA 1JMMA 1SFCC 2BASA 2P2UA 3RK2D 3BASA 4GT1A 3RL0B 1CZQA 3UIAA 3HD7D 3U1AA 4O9BA 3WMM0 3HE5B 1JY2P 1S9KE 4C7NA 5CCGD 1RF0A 2R5DA 2NPSA 2IFNA 3V2PA 1J1EC 1Z56A 2R3CA 2OYHB 2PAJA 1X8YA 5APSA 5AVYB 1LWUB 2HPCB 2IX7C 4Y99C 1N73C 5AW9B 1CI6B 1LT9C 3CLQA 3OA7A 1J1DC 2GM4A 1HJBA 3NFQA 5CJ0A 1ZLLA 1RF1B 3IR9A 1JO5A 1MV8A 1GL2D 3V2NA 2OYIB 3MIWA 4XE5B 1JY2N 3RK2C 1M1JC 2FFDC 1N7LA 5CHXA 1JTHB 5AVXB 2KSJA 1GK4A 3CI9A 3PP5A 2I1JA 1DEBA 1H8AA 2J59M 3VP8A 5KJ7A 1GL2C 5CCGC 2P1JA 1SLQA 4W7YA 1T2KD 1LGHB 1NOHA 3TSIA 3U1CA 5CJ4A 1DX7A 1QL1A 5APXA 3HE5A 4GIFA 3VMXA 2POHA 3V4WA 2QM8A 1IJDB 5AW4B 2JJLA 4LC1A 2OYHA 1LWUA 2HPCA 3HUSC 4JYBA 3C9IA 1CI6A 5CCHA 1OXZA 1M7LA 1LTJC 1MFZA 2XZRA 1RF1A 3B5ND 1N7SB 2Q5UA 3OJAB 5AW2B 2YKOA 1IK9A 1NH4A 1IO4A 3P8CD 2Q9IA 1NHLA 1LTAC 1JTHA 1NAFA 1ZV8A 2MJZA 1FOSE 1KZUB 3NMDA 3TNUB 1G1JA 1S9KD 4XA4A 1G2CB 1IFNA 1KFNA 1HUCA 2W6BA 4DZOA 2O01H 3T97A 3GHGC 4WY4B 3RK3B 1GK6A 4C7RA 3P8MC 3V4QA 3CL3D 3TK1A 2C9NY 1KILD 1L4AA 3KDPB 4I1LA 1T3JA 1N7SA 1H89A 2VRSA 2J58A 1W2EA 2WT7B 5KJ7D 1H88A 3RL0D 1RF0C 2YKPA 4JF7A 2ZFCA 1J1EB 5APWA 1ZR2A 3L36A 3KQGA 2WSCH 4Y99B 1SVFA 2ZXEB 1N73B 4N78E 2I1KA 1LT9B 3TNUA 1J1DB 2KP8A 3V5BA 1PFIA 2A45H 2Q3IA 3L35A 1G2CA 3V2QA 4N3YB 1FZCC 3LIEA 4RESB 5CCHD 4AYCA 1URQB 1M1JB 3RK2B 4W7ZA 1FZAA 2Z4EA 1KILC 3SWFA 2FFDB 1AFOA 3E1IA 1T8ZA 1G1IA 3O8ZA 4I2LC 3BRTB 3SWYA 3IFMA 5AVQB 3RL0C 3M9HA 5APYA 1DH3A 2O1KA 2WSEH 3VOPA 1OWAA 5BVZA 2XDJA 2W27A 2WPRA 1JCDA 1JY2O 3TYYA 2H43A 2WZ7A 3HD7C 2WSFH 1YYCA 2PP6A 2WT7A 2R5BA 1JY3P 1SQVK 1WT6A 1LTGC 1FBMA 5CMZA 1NKZB 2QM7A 1GW4A 4HYTB 1SP4A 1XTCC 2Q7CA 3B8EB 5CCHC 1YTZI 1LTSC 1NTZK 1N73A 1LT9A 2W6AA 5KLVK 2YO3A 2O1JA 2CPSA 1FJPA 5APVA 3VN0A 2P7JA 2Z5HA 3A3YB 1RY3A 2P67A 4ZKPA 2N1TD 4M3LA 5AVSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CL3 D;  2YKQ A;  3BRV B;  3BRT B;  2YKP A;  2YKO A;  1JOC A;  3EQ2 A;  3L4F A;  2W6B A; 
#chains in the Genus database with same CATH topology
 1JY3 N;  2H89 C;  1L4A D;  1LP1 A;  1NO4 A;  1R5S A;  1AQ5 A;  3LW5 H;  2V4H A;  3A5T A;  2CK3 H;  1IFD A;  1NTK E;  2FKW B;  3IN6 A;  2OYI A;  1H0T A;  3SSU A;  2GA1 A;  1OZH A;  4U3F D;  1MUU A;  5GTH E;  3P32 A;  2XU6 A;  1GDT A;  2NPS D;  3M9B A;  1YTZ T;  1RQU A;  3CCL P;  5GTI E;  2E75 B;  2C9L Y;  2K9Y A;  1L0L G;  1L4A C;  3RK3 D;  4IFF A;  4PV1 B;  3MD0 A;  2P58 A;  3I5C A;  3I55 P;  4JQ0 D;  1NTM J;  3VMZ A;  2JO1 A;  3EQ2 A;  5AVZ B;  2K37 A;  2M3B A;  4L75 A;  4I7Z B;  5AW8 B;  2NPS C;  1OFC X;  1MKM A;  3CCE P;  3VP9 A;  5AW7 B;  1FDI A;  1BGY E;  4R4M A;  2L5G B;  3K5B A;  2R32 A;  3CCU P;  1YIJ P;  4WB4 A;  1E79 H;  1ZXG A;  5DJT B;  3F5H A;  1SQX G;  2D2C B;  3P8C E;  1BCC J;  1YIT P;  3TGU J;  1FJK A;  5BU5 A;  1HTL C;  3GG2 A;  1KYO E;  1U7M A;  2H88 C;  1OVU A;  5B66 H;  4RKU J;  1Q7Y Q;  2ZT9 D;  4Z1M H;  1LWU C;  2YNY A;  3G3Z A;  1FZC A;  1VQ5 P;  2NZ2 A;  3L73 G;  3R4Y A;  3H1I G;  2WMM A;  2FYU K;  3Q5P A;  1RF1 C;  2O01 N;  1J2J B;  5KLI B;  4C46 A;  4ASW A;  3CCR P;  2JWD A;  1WRG A;  2FBW C;  1NU1 D;  3AE3 C;  5AW1 B;  1SQB D;  4QMA A;  1HVV A;  5KLV E;  2KS1 B;  1IFI A;  5B5E H;  5CCG A;  2QIW A;  5DJU B;  2BCC J;  1X0T A;  3E7K A;  3VTP C;  4H13 C;  3CX5 I;  1GL2 A;  2ZVO B;  2FXO A;  1U57 A;  1DD4 A;  1JUN A;  3SFD C;  3NTN A;  1QGK B;  3V2R A;  3H1H D;  3H32 A;  3MUD C;  3M91 A;  1KYO D;  3PTZ A;  2FYU J;  2LXC B;  2HYN A;  1W2B O;  2GUS A;  3L75 E;  4WWI A;  3VYI A;  2ZYA A;  3KZI H;  1KFM A;  1P84 I;  1A02 F;  5H2F H;  2UWJ E;  3RK2 D;  4GT1 A;  1KQF B;  1BGY G;  3RL0 B;  1CZQ A;  2KZJ A;  5L8R J;  3UIA A;  4GOD A;  3S4R A;  4O9B A;  3H1L E;  3Q5R A;  1X22 A;  1ZP0 C;  2AEM A;  1JY2 P;  2IFN A;  1J1E C;  2R3C A;  2OYH B;  5AVY B;  5APS A;  4JPZ B;  4L76 A;  3CX5 H;  3OA7 A;  2GM4 A;  1W5C E;  1HJB A;  1NGM B;  3S1K A;  1VQO P;  2OYI B;  3MIW A;  1KN7 A;  3RK2 C;  5E79 H;  3G6E P;  3KXD A;  3V6I A;  1PGP A;  1EZV D;  4IL6 H;  3H1J J;  3CI9 A;  1VQ4 P;  5KJ7 A;  3Q1M A;  5KKZ B;  3PJS K;  1EDI A;  3IF4 A;  1DX7 A;  1P84 H;  4GIF A;  5AW4 B;  3G4S P;  1PPJ E;  2HPC A;  4JYB A;  5KLV G;  2XZR A;  2FY8 A;  3B5N D;  1N7S B;  2E74 D;  3AE1 C;  1NJI Q;  3RGU A;  2KI7 B;  1IK9 A;  4BXL A;  4PJ0 E;  2BEZ F;  1NHL A;  1LTA C;  1JTH A;  1NAF A;  1ZV8 A;  1FOS E;  2RKL A;  3H1L D;  3SWK A;  3TNU B;  4PD4 E;  3JCU H;  3FX0 A;  1VQ8 P;  5M1B A;  3T97 A;  3D6Y A;  2V7Q J;  1K04 A;  3P8M C;  1BCC G;  3GF7 A;  2E76 D;  3LW5 J;  2C9N Y;  3L75 G;  1L4A A;  3FXE A;  1AV1 A;  4I1L A;  1T3J A;  2J58 A;  1W2E A;  2WT7 B;  1BSN A;  3AEC C;  1BE3 E;  1KQS O;  1SQP E;  4N78 E;  1KTM A;  2A45 H;  2Q3I A;  1FZC C;  4RES B;  4JBZ A;  3C8V A;  1M8O B;  1JB0 J;  1FZA A;  1PP9 E;  3E1I A;  3CPW O;  3BRT B;  4YXW H;  3SWY A;  3IFM A;  3M9H A;  5APY A;  3BCC D;  5BVZ A;  2IBZ E;  1JY2 O;  2OQQ A;  1YYC A;  1N8R Q;  4PD4 D;  1JY3 P;  1VQL P;  4DT0 A;  1NKZ B;  3AEE C;  3B8E B;  1LT9 A;  2YO3 A;  3VN0 A;  3CXH E;  2P67 A;  1GL2 C;  4M3L A;  2IZ0 A;  1KMI Z;  1M1J A;  2Y9Y A;  1HF9 A;  2FYU G;  3HRN A;  1PGJ A;  4GKG A;  3PHL A;  3B4S A;  1BE3 D;  2AEF A;  2JEE A;  1DEE G;  1SQP D;  3M9Q A;  1LTI C;  3CWB J;  1K73 Q;  1FDM A;  2WTY A;  1N86 A;  1PGQ A;  2M5A B;  3EFG A;  2W83 C;  2B9B A;  2WWW A;  1Q90 D;  2N9B A;  1Y8A A;  5CBO A;  3SFE C;  1M1K Q;  1SFC B;  4K35 A;  3D71 A;  1M90 Q;  2C0W A;  4H44 B;  2KUB A;  3B71 A;  3AEF C;  3L72 J;  3MUD A;  1OW6 A;  3HTK B;  3MTU E;  1HH0 A;  3BVH A;  4Y28 J;  1Q86 Q;  1L0N K;  1S4X A;  1SQX E;  5KTB A;  1KIL B;  1LTT C;  1K8A Q;  3H1J G;  1PIX A;  3CXH D;  5KAF H;  1AVO A;  2YMY A;  1URQ D;  1FZG A;  2I8D A;  3M0A A;  1EQ7 A;  3O6Q B;  4BRY A;  3HD7 B;  4UB6 H;  3HE4 A;  1OIP A;  5KJ7 C;  1VQM P;  3CCJ P;  1IZN B;  3N4X A;  4LGD E;  4OGQ B;  1AJY A;  3L73 E;  1L0L D;  3H1I E;  5B66 E;  4EI2 A;  2IBZ G;  1N2D C;  1NU1 J;  1NWQ A;  3MGN A;  1SQB J;  2CPB A;  2OAR A;  1URQ C;  3HUS B;  5KAI H;  3VMY A;  2M0B A;  1NTM K;  1LTJ B;  1SQQ K;  1OVR A;  1Q82 Q;  1L0N J;  4TLF A;  4IOI H;  4ZNC A;  4YTP C;  2YO2 A;  1GW3 A;  1JY3 O;  3L70 E;  2KXP B;  3F89 A;  1FC2 C;  2PFX A;  1FU1 A;  1M56 D;  4OVN F;  1HWT C;  2XV5 A;  3R2P A;  4ZKU A;  3H1H J;  1M57 D;  2KLV A;  1GTW A;  1L4A B;  3L72 E;  1SQX D;  2KOG A;  2Q3E A;  1JOC A;  1ZRT D;  2KNC A;  2E75 D;  4N6J A;  1FOS F;  4D6T J;  1NKN A;  2HG5 D;  4OH8 B;  1S2E A;  4PV1 D;  4NPF X;  3ABV C;  3L4F A;  4IFM A;  4C7N B;  1JCC A;  2Q6Q A;  2NPS B;  2GUV A;  3M0D A;  5AVW B;  2HOD A;  3JSV C;  2N9Y B;  1YHQ P;  3NXS A;  1SQQ J;  3L71 D;  4KHX A;  3H1I D;  2E43 A;  2YIU C;  3USS A;  1RE4 A;  2N1T A;  1GD2 E;  3RK3 C;  4L73 A;  4PV1 C;  4AQR D;  1MZ9 A;  2R44 A;  3B5N A;  2D2C D;  1KC8 Q;  1NTK D;  3HE5 B;  2K9J B;  1KD1 Q;  1S9K E;  1LWU B;  1CI6 B;  1LT9 C;  3CD6 P;  1QX8 A;  3NFQ A;  1RF1 B;  2WVR A;  1JO5 A;  1MV8 A;  3FGA D;  1M1J C;  1S1C X;  1R8E A;  1LJ2 A;  5TJH A;  5AVX B;  2KSJ A;  3AE9 C;  1KB9 E;  3GW6 A;  1T6A A;  3AEG C;  4IL6 E;  1DEB A;  3CWB G;  3VP8 A;  1T2K D;  5CJ4 A;  1QL1 A;  4KT0 J;  3H1K J;  2POH A;  2KZI A;  2Y0E A;  3V4W A;  2QM8 A;  1IJD B;  2G3A A;  1NTM E;  2ZT9 C;  4LC1 A;  3L70 G;  4H13 B;  3C9I A;  1BGY D;  4H0L B;  3A0H E;  2DW3 A;  4CPG A;  3L72 G;  3P8C D;  2Q9I A;  1SS1 A;  3AE7 C;  5GTH H;  2WPV B;  4U7J A;  1KYO I;  4A7P A;  3CCV P;  1S9K D;  2ZAE B;  1G2C B;  1IFN A;  1GMJ A;  1BCC E;  3JCU E;  1U7J A;  3TGU E;  2B89 A;  3GHG C;  4BRY B;  1GK6 A;  3CL3 D;  3MZW B;  3CC7 P;  1YJ9 P;  5EFW B;  3KDP B;  1H89 A;  2VRS A;  1KB9 D;  1H88 A;  3RL0 D;  2JWA A;  3CCS P;  2ZFC A;  1J1E B;  1ZR2 A;  4UB8 E;  3I56 P;  1UIX A;  1L2P A;  1SVF A;  4YPC A;  1OMI A;  3V5B A;  2KP8 A;  5KLV D;  4N3Y B;  1EXJ A;  3CME P;  5CCH D;  1LP1 B;  1L0N G;  3RK2 B;  3SWF A;  1EC5 A;  2ZYD A;  2BCC E;  1KYO H;  1EZV I;  1OW7 A;  1H0T B;  3RL0 C;  1DH3 A;  1NYH A;  1OWA A;  2W27 A;  2QG4 A;  2H43 A;  3GLM A;  4RO0 A;  3H1H G;  2PP6 A;  3Q2Y A;  1RQV A;  3QWO C;  1SQV K;  5CMZ A;  1BCC D;  2QM7 A;  4HYT B;  1SP4 A;  5CCH C;  1LTS C;  1NTZ K;  2HR3 A;  4D6T G;  1N73 A;  3L75 D;  1Q2N A;  2O1J A;  2P7J A;  2FYU E;  2Z5H A;  1ZOY C;  3AE8 C;  2N1T D;  1IFP A;  2HLO A;  1URQ A;  2C0X A;  2FFD A;  1USE A;  1NTM G;  2AEJ A;  1SQQ G;  2QSI A;  1ZW0 A;  1MFT A;  2Y0D A;  5AVR B;  4RJT A;  1LTB C;  3M0D C;  2B87 A;  3L37 A;  2Z5I A;  3W68 A;  2QEX P;  1CSB A;  2SPZ A;  2FXM A;  4NPE A;  1JMB A;  1RE4 C;  2N1T C;  3GF3 A;  1SQV J;  1VPC A;  2KK7 A;  1X79 B;  3B5N C;  3TGU G;  2E74 C;  1QL2 A;  1NTZ J;  3L74 J;  3WUV A;  5AW3 B;  5AVT B;  2A06 G;  2IFM A;  3N7N A;  1GU5 A;  2J5U A;  2WIT A;  3WU2 E;  3ZDM A;  3H1J E;  1FZC B;  1CW5 A;  5AVV B;  2LKM A;  1QLE D;  3D6Z A;  1IC2 A;  2AXT E;  2KYV A;  1HJ0 A;  2FYU D;  3A0B H;  3MHV A;  1PPJ D;  2E76 C;  2BEQ D;  4DCK A;  1UII A;  1L0L J;  2IPP A;  2WPQ A;  2YMK A;  4W80 A;  2P10 A;  2A45 G;  3H1K G;  2WPS A;  5AVU B;  4UB6 E;  2WSS H;  4PD4 I;  2BCC G;  3EFF K;  1S5L X;  1KV4 A;  1HBW A;  5AW6 B;  1TU3 F;  2FYN C;  2FYZ A;  3JC2 2;  1GL2 B;  3BAT A;  4EIJ A;  1A02 J;  1KIL E;  4NPD A;  3M06 A;  1VDF A;  5KAI E;  4U3F J;  3H32 B;  3QH9 A;  2OGU A;  1USD A;  2QJP C;  5BU8 B;  1NTK K;  1OVV A;  4JYC A;  1FZB A;  1FZF A;  4LLH A;  3KYQ A;  1QVF O;  4N78 D;  1R5L A;  4EOT A;  4PJ0 H;  1VQ7 P;  3L71 J;  1VQN P;  4WY4 D;  3II6 A;  4PD4 H;  1PP9 D;  1ZR4 A;  1SFC D;  2QJY B;  2QVA A;  2JR8 A;  2QJK C;  3W67 A;  2HFE D;  3A2A A;  4HH2 A;  2K3R A;  4I6M C;  1VF5 D;  1IK7 A;  2IBZ D;  1NU1 K;  1JNM A;  4H44 D;  1SQB K;  2RN0 A;  1FAV A;  4EDF A;  1NTK J;  1YQ3 C;  5APQ A;  4WY4 C;  3CXH I;  3GHG A;  1RE3 C;  3Q5S A;  1SFC C;  2BAS A;  4L74 A;  1VF5 C;  5CBN A;  3HD7 D;  4U3F E;  2E5T A;  2R5D A;  2JP3 A;  2L91 A;  1Z56 A;  2PAJ A;  2HPC B;  4Y99 C;  1N73 C;  3FWL A;  4K3A A;  5AW9 B;  1FDO A;  3CLQ A;  1J1D C;  2W8Z A;  1S72 P;  1ZLL A;  3IR9 A;  5TIS H;  3FWN A;  3CWB E;  2FFD C;  1VQK P;  1WMK A;  2B87 B;  5CHX A;  1JTH B;  1BSH A;  3CC4 P;  1GK4 A;  2I1J A;  2OTK E;  2P1J A;  4W7Y A;  3TSI A;  3U1C A;  3T97 B;  3CXH H;  4GOF A;  3VMX A;  3WUU A;  1SQV G;  3AE2 C;  2OYH A;  2W6J H;  3HUS C;  5B5E E;  1NTZ G;  5CCH A;  1OXZ A;  1M7L A;  2MKV A;  3L74 G;  1LTJ C;  3AEA C;  2Q5U A;  3OJA B;  1JEK A;  2YKO A;  4TT3 H;  1KZU B;  4KJM A;  2WQY C;  1DD3 A;  2RH0 A;  2KSE A;  3AEB C;  2IDB A;  2W6B A;  4ZMD A;  3CC2 P;  2YIU B;  3RBX A;  2QA4 P;  2O01 H;  3L73 D;  3RK3 B;  2E75 C;  3TK1 A;  2O3J A;  3AE6 C;  3KZI E;  3CWB D;  1RH5 B;  5KLV J;  3PRJ A;  1AA0 A;  1NU1 E;  1N7S A;  3S9O A;  1SQB E;  1EDK A;  1RF0 C;  5H2F E;  2YKP A;  3IAO A;  3KQG A;  3L70 D;  2I1K A;  1LT9 B;  3TNU A;  1L0N E;  4I7Z C;  3V2Q A;  3LIE A;  4U3F G;  2FXP A;  4AYC A;  1M1J B;  4W7Z A;  3L72 D;  1AFO A;  3CX5 E;  2ZXX A;  1G1I A;  2M3E A;  4I2L C;  3H1H E;  3L75 J;  2D2C C;  3RBZ A;  2NRG A;  3MP7 B;  2WPR A;  1JCD A;  1YJW P;  4WVZ A;  5E79 E;  3TDK A;  1S5L H;  1PZQ A;  4D6T E;  2QRX A;  2WT7 A;  1WT6 A;  1BDC A;  1FBM A;  1GW4 A;  2RMZ A;  2ZT9 B;  2Q7C A;  3L71 G;  1YTZ I;  3CCM P;  2G8Y A;  2CPS A;  1K05 A;  1FJP A;  5APV A;  1P84 E;  3ITK A;  1RY3 A;  1DIP A;  1SQQ E;  3H1L J;  4H13 D;  5AVS B;  3C1L A;  1X9V A;  4H0L D;  5KLI C;  1HGV A;  4B86 A;  1KOR A;  1GZL A;  2K1A A;  2W90 A;  1T2K C;  1NTK G;  2JKV A;  1GU4 A;  1XTG B;  3GHG B;  1L0N D;  1S3J A;  5GTI H;  2OYO A;  3AE5 C;  2QE7 H;  3CCQ P;  1QVG O;  4H0L C;  1EZV E;  3AE4 C;  3CX5 D;  2A06 E;  3HE4 B;  1OX3 A;  1KB9 I;  2PRR A;  4WBA A;  2KB7 P;  4D6T D;  1ZN5 A;  1Q81 Q;  1SQP K;  4YXD C;  1NU1 G;  4BWN A;  1SQB G;  3H6P A;  1HGZ A;  3BCC J;  2PGD A;  1P84 D;  3A7O A;  1NTM D;  4DOJ A;  1SQQ D;  2XKM A;  3G9R A;  3A0B E;  3H1K E;  2M5A A;  4WY4 A;  1RE3 A;  1NVO A;  1SFC A;  2XNX A;  1AQT A;  1E5W A;  1KQL A;  1KQG B;  3Q3D A;  2KNC B;  5AW5 B;  2OYH C;  3TGU D;  3HTK A;  4IFD K;  1T3U A;  2Q1K A;  1BE3 J;  1KB9 H;  1KIL A;  3BRV B;  1SQP J;  3WUT A;  2A06 D;  2OYI C;  2YKQ A;  2WSC J;  3O6Q A;  1VL2 A;  2HOD B;  1N7S D;  5APU A;  5AW0 B;  1IFJ A;  3HD7 A;  5KKZ C;  4AUW A;  1PP9 J;  2H7H A;  3LID A;  2M8R A;  2N1T B;  1L0L K;  3P7K A;  3A0H H;  3KPE A;  2A45 I;  3B5N B;  1ZME C;  2WSE J;  2E74 B;  3H1K D;  3HUS A;  3U59 A;  3BCC E;  2WSF J;  2LXB A;  1N7S C;  2OTJ P;  1LTJ A;  2BCC D;  1EXI A;  4HJG H;  2ITA A;  1NAY A;  1EZV G;  2E42 A;  4XFJ A;  2H8P D;  3H25 A;  2E5Y A;  5APT A;  1YJN P;  1VQ6 P;  4EYY Q;  3OAK A;  1BDD A;  3GMA A;  2JDI H;  2E76 B;  1FZE A;  1IFM A;  1SQX K;  1PV3 A;  1JMM A;  2P2U A;  4UB8 H;  3CMA P;  3BAS A;  5KAF E;  2KLU A;  1K9M Q;  3E1R A;  1YI2 P;  3U1A A;  3WMM 0;  3RL0 g;  2ZVN B;  1VQ9 P;  3EWK A;  4C7N A;  5CCG D;  1LNQ A;  1RF0 A;  2O01 J;  2NPS A;  3V2P A;  1X8Y A;  2FYN B;  2IX7 C;  3H1L G;  2K88 A;  1PGO A;  4R4L A;  5CJ0 A;  1GL2 D;  2IZ1 A;  3V2N A;  4XE5 B;  1JY2 N;  5TIS E;  1N7L A;  2B88 A;  2QJP B;  3PP5 A;  1H8A A;  2J59 M;  1LT1 A;  1SQX J;  5CCG C;  1SLQ A;  1SQV E;  1LGH B;  1NOH A;  5APX A;  1NTZ E;  3HE5 A;  3TF5 A;  2K9J A;  3L74 E;  2JJL A;  3AED C;  3H1J D;  1LWU A;  3PH0 A;  1CI6 A;  2ZJS E;  1JM0 A;  1MFZ A;  2XND H;  3FXD A;  1RF1 A;  1PPJ G;  5AW2 B;  5K5G B;  3L73 J;  2QJK B;  3H1I J;  1NH4 A;  2OTL P;  1IO4 A;  4GOE A;  2MJZ A;  2YXQ B;  3NMD A;  3PLN A;  4HB1 A;  1YBK A;  1L0L E;  1G1J A;  2IBZ I;  3BCC G;  1FS0 E;  4XA4 A;  1KFN A;  1HUC A;  4MN4 C;  1RHZ B;  1QEX A;  4DZO A;  2R3S A;  4WY4 B;  4C7R A;  2KS1 A;  3V4Q A;  1FE6 A;  3L70 J;  1YQ4 C;  1Y9B A;  1PL5 A;  1KIL D;  4GDO A;  1OW8 A;  1VF5 B;  2QJY C;  5KJ7 D;  3WU2 H;  2Y0C A;  1SQV D;  4JF7 A;  5APW A;  2ZYG A;  3L36 A;  3KHU A;  2AXT H;  2WSC H;  4Y99 B;  2ZXE B;  1N73 B;  4H44 C;  1NTZ D;  1J1D B;  1PFI A;  2AXC A;  1BE3 G;  3L35 A;  1G2C A;  1ZRT E;  3L74 D;  2Y9Z A;  1EDJ A;  1SQP G;  4OGQ D;  1URQ B;  2YXR B;  3RK3 E;  2Z4E A;  1KIL C;  2FFD B;  1T8Z A;  4HKZ H;  3O8Z A;  5AVQ B;  5C39 A;  2O1K A;  3D70 A;  2WSE H;  3VOP A;  2XDJ A;  1PP9 G;  3TYY A;  2WZ7 A;  4IL6 X;  3HD7 C;  1Y47 A;  3L71 E;  2KIK A;  2WSF H;  2LR2 A;  2R5B A;  2IYO A;  1S5L E;  1BGY J;  1LTG C;  3OW2 O;  4ASV A;  1EDL A;  1XTC C;  4OGQ C;  2IYP A;  1D7M A;  2W6A A;  5KLV K;  3G71 P;  1VQP P;  3VMA A;  1AVY A;  3A3Y B;  2V7Q H;  4OWF A;  4ZKP A;  4DJG A; 
#chains in the Genus database with same CATH homology
 1JY3 N;  1L4A D;  2HLO A;  1URQ A;  1M1J A;  1NO4 A;  1X9V A;  2C0X A;  1AQ5 A;  3LW5 H;  3A5T A;  2FFD A;  1IFD A;  3HRN A;  2FKW B;  4GKG A;  1HGV A;  4B86 A;  5AVR B;  2OYI A;  1LTB C;  3M0D C;  1GZL A;  2JEE A;  1T2K C;  3L37 A;  2Z5I A;  3M9Q A;  1MUU A;  1CSB A;  1GU4 A;  1LTI C;  1XTG B;  3GHG B;  2XU6 A;  3P32 A;  1GDT A;  2NPS D;  3M9B A;  2FXM A;  1YTZ T;  1FDM A;  1RE4 C;  2WTY A;  1N86 A;  2N1T C;  2C9L Y;  3EFG A;  1L4A C;  3RK3 D;  4IFF A;  1VPC A;  2WWW A;  2N9B A;  1X79 B;  3B5N C;  3MD0 A;  3HE4 B;  1QL2 A;  1SFC B;  3I5C A;  4WBA A;  5AW3 B;  3VMZ A;  5AVT B;  3EQ2 A;  2IFM A;  2C0W A;  5AVZ B;  2KB7 P;  3N7N A;  2M3B A;  1GU5 A;  1ZN5 A;  5AW8 B;  2NPS C;  3MUD A;  2WIT A;  1SQP K;  3HTK B;  1FZC B;  3VP9 A;  1CW5 A;  3MTU E;  1HH0 A;  3BVH A;  5AVV B;  2LKM A;  5AW7 B;  1L0N K;  3H6P A;  1HGZ A;  1IC2 A;  2KYV A;  5KTB A;  1KIL B;  1LTT C;  3A7O A;  2L5G B;  2R32 A;  4DOJ A;  2XKM A;  2YMY A;  4WB4 A;  1URQ D;  1FZG A;  3M0A A;  2IPP A;  2WPQ A;  1EQ7 A;  4WY4 A;  3P8C E;  4W80 A;  1RE3 A;  3HD7 B;  2A45 G;  1FJK A;  3HE4 A;  5BU5 A;  5KJ7 C;  2WPS A;  1HTL C;  1SFC A;  5AVU B;  2XNX A;  3N4X A;  4LGD E;  1E5W A;  1KQL A;  1HBW A;  5AW6 B;  5AW5 B;  2OYH C;  1LWU C;  1N2D C;  2YNY A;  3G3Z A;  3HTK A;  1FZC A;  2FYZ A;  1NWQ A;  4IFD K;  3MGN A;  1GL2 B;  3BAT A;  2CPB A;  3HUS B;  2OAR A;  1T3U A;  1URQ C;  4EIJ A;  1A02 J;  3VMY A;  2FYU K;  1RF1 C;  1KIL A;  1NTM K;  1LTJ B;  3BRV B;  3M06 A;  1SQQ K;  1VDF A;  1J2J B;  2OYI C;  4C46 A;  3H32 B;  2YKQ A;  2HOD B;  5BU8 B;  2YO2 A;  1NTK K;  1GW3 A;  1N7S D;  1JY3 O;  1WRG A;  5APU A;  5AW0 B;  4JYC A;  5AW1 B;  1IFJ A;  3HD7 A;  1FZB A;  4AUW A;  1HVV A;  1IFI A;  1FZF A;  4LLH A;  1FU1 A;  5CCG A;  2H7H A;  3KYQ A;  3LID A;  2M8R A;  1HWT C;  2XV5 A;  2N1T B;  1L0L K;  3R2P A;  2KLV A;  3P7K A;  4N78 D;  4ZKU A;  3KPE A;  1GTW A;  4EOT A;  1L4A B;  2A45 I;  2KOG A;  1JOC A;  4N6J A;  3B5N B;  3VTP C;  1FOS F;  1NKN A;  2HG5 D;  4OH8 B;  4WY4 D;  1GL2 A;  3U59 A;  3HUS A;  3II6 A;  1JUN A;  1N7S C;  3L4F A;  1LTJ A;  4IFM A;  3NTN A;  1ZR4 A;  1SFC D;  3V2R A;  3H32 A;  4C7N B;  3M91 A;  2HFE D;  1JCC A;  3A2A A;  2NPS B;  2GUV A;  3M0D A;  4HH2 A;  4I6M C;  5AVW B;  2E42 A;  2HOD A;  2H8P D;  3NXS A;  1NU1 K;  2HYN A;  1JNM A;  5APT A;  2GUS A;  1SQB K;  4KHX A;  3VYI A;  1FAV A;  3OAK A;  1KFM A;  2E43 A;  1RE4 A;  5APQ A;  4WY4 C;  1FZE A;  2N1T A;  1IFM A;  1SQX K;  1GD2 E;  3GHG A;  3RK3 C;  1A02 F;  1RE3 C;  4AQR D;  1MZ9 A;  3B5N A;  1JMM A;  1SFC C;  2BAS A;  2P2U A;  3RK2 D;  3BAS A;  4GT1 A;  3RL0 B;  1CZQ A;  3UIA A;  3HD7 D;  3U1A A;  4O9B A;  3WMM 0;  3HE5 B;  1JY2 P;  1S9K E;  4C7N A;  5CCG D;  1RF0 A;  2R5D A;  2NPS A;  2IFN A;  3V2P A;  1J1E C;  1Z56 A;  2R3C A;  2OYH B;  2PAJ A;  1X8Y A;  5APS A;  5AVY B;  1LWU B;  2HPC B;  2IX7 C;  4Y99 C;  1N73 C;  5AW9 B;  1CI6 B;  1LT9 C;  3CLQ A;  3OA7 A;  1J1D C;  2GM4 A;  1HJB A;  3NFQ A;  5CJ0 A;  1ZLL A;  1RF1 B;  3IR9 A;  1JO5 A;  1MV8 A;  1GL2 D;  3V2N A;  2OYI B;  3MIW A;  4XE5 B;  1JY2 N;  3RK2 C;  1M1J C;  2FFD C;  1N7L A;  5CHX A;  1JTH B;  5AVX B;  2KSJ A;  1GK4 A;  3CI9 A;  3PP5 A;  2I1J A;  1DEB A;  1H8A A;  2J59 M;  3VP8 A;  5KJ7 A;  1GL2 C;  5CCG C;  2P1J A;  1SLQ A;  4W7Y A;  1T2K D;  1LGH B;  1NOH A;  3TSI A;  3U1C A;  5CJ4 A;  1DX7 A;  1QL1 A;  5APX A;  3HE5 A;  4GIF A;  3VMX A;  2POH A;  3V4W A;  2QM8 A;  1IJD B;  5AW4 B;  2JJL A;  4LC1 A;  2OYH A;  1LWU A;  2HPC A;  3HUS C;  4JYB A;  3C9I A;  1CI6 A;  5CCH A;  1OXZ A;  1M7L A;  1LTJ C;  1MFZ A;  2XZR A;  1RF1 A;  3B5N D;  1N7S B;  2Q5U A;  3OJA B;  5AW2 B;  2YKO A;  1IK9 A;  1NH4 A;  1IO4 A;  3P8C D;  2Q9I A;  1NHL A;  1LTA C;  1JTH A;  1NAF A;  1ZV8 A;  2MJZ A;  1FOS E;  1KZU B;  3NMD A;  3TNU B;  1G1J A;  1S9K D;  4XA4 A;  1G2C B;  1IFN A;  1KFN A;  1HUC A;  2W6B A;  4DZO A;  2O01 H;  3T97 A;  3GHG C;  4WY4 B;  3RK3 B;  1GK6 A;  4C7R A;  3P8M C;  3V4Q A;  3CL3 D;  3TK1 A;  2C9N Y;  1KIL D;  1L4A A;  3KDP B;  4I1L A;  1T3J A;  1N7S A;  1H89 A;  2VRS A;  2J58 A;  1W2E A;  2WT7 B;  5KJ7 D;  1H88 A;  3RL0 D;  1RF0 C;  2YKP A;  4JF7 A;  2ZFC A;  1J1E B;  5APW A;  1ZR2 A;  3L36 A;  3KQG A;  2WSC H;  4Y99 B;  1SVF A;  2ZXE B;  1N73 B;  4N78 E;  2I1K A;  1LT9 B;  3TNU A;  1J1D B;  2KP8 A;  3V5B A;  1PFI A;  2A45 H;  2Q3I A;  3L35 A;  1G2C A;  3V2Q A;  4N3Y B;  1FZC C;  3LIE A;  4RES B;  5CCH D;  4AYC A;  1URQ B;  1M1J B;  3RK2 B;  4W7Z A;  1FZA A;  2Z4E A;  1KIL C;  3SWF A;  2FFD B;  1AFO A;  3E1I A;  1T8Z A;  1G1I A;  3O8Z A;  4I2L C;  3BRT B;  3SWY A;  3IFM A;  5AVQ B;  3RL0 C;  3M9H A;  5APY A;  1DH3 A;  2O1K A;  2WSE H;  3VOP A;  1OWA A;  5BVZ A;  2XDJ A;  2W27 A;  2WPR A;  1JCD A;  1JY2 O;  3TYY A;  2H43 A;  2WZ7 A;  3HD7 C;  2WSF H;  1YYC A;  2PP6 A;  2WT7 A;  2R5B A;  1JY3 P;  1SQV K;  1WT6 A;  1LTG C;  1FBM A;  5CMZ A;  1NKZ B;  2QM7 A;  1GW4 A;  4HYT B;  1SP4 A;  1XTC C;  2Q7C A;  3B8E B;  5CCH C;  1YTZ I;  1LTS C;  1NTZ K;  1N73 A;  1LT9 A;  2W6A A;  5KLV K;  2YO3 A;  2O1J A;  2CPS A;  1FJP A;  5APV A;  3VN0 A;  2P7J A;  2Z5H A;  3A3Y B;  1RY3 A;  2P67 A;  4ZKP A;  2N1T D;  4M3L A;  5AVS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...