3BRVB

Nemo/ikkb association domain structure
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
61
structure length
61
Chain Sequence
b'ETLQRCLEENQELRDAIRQSNQILRERCEELLHFQASQREEKEFLMCKFQEARKLVERLGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inhibitor of nuclear factor kappa-B kinase subunit beta
publication title Structure of a NEMO/IKK-Associating Domain Reveals Architecture of the Interaction Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transcription
total genus 29
structure length 61
sequence length 61
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11577 NEMO NF-kappa-B essential modulator NEMO
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.390 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3brvB00
2YKOA 3CL3D 2YKQA 3BRTB 2W6BA 2YKPA 3EQ2A 3BRVB 1JOCA 3L4FA
chains in the Genus database with same CATH superfamily
1L4AD 1AVYA 3PLNA 3HD7D 2ZVOB 3CX5H 3HE4A 3V4QA 3TNUA 3E1RA 2KZIA 1OFCX 2E76C 2LXBA 2HPCB 1QGKB 4ZKUA 3LIDA 1EZVI 4GOEA 2HG5D 5KJ7A 1KILD 2ITAA 2WSSH 5AW2B 3CCQP 4XE5B 3WMM0 2JJLA 3NTNA 3L75D 1LT9C 2O3JA 5CBOA 5AVZB 1GTWA 4IFDK 5CCGA 5APUA 1KYOE 4AQRD 4GIFA 2WTYA 1L4AC 3N7NA 2CPBA 2C0XA 4AUWA 3BRTB 4RESB 5KLIB 3GF3A 4UB6E 2QM7A 2QSIA 1IFMA 4ZKPA 1FZBA 5B66E 1NO4A 3WUVA 1TU3F 1URQC 3HE4B 2W6AA 3KHUA 1IFNA 1KQGB 2WSCH 4I2LC 5DJUB 2OYHC 3V2NA 2WITA 3VMYA 3WU2E 2I8DA 2YKOA 1RF0A 3M9HA 3LW5H 2RKLA 1VDFA 3GMAA 2LR2A 1JEKA 1H8AA 2FYUE 1KYOD 4PD4E 3HUSA 3S9OA 1OVUA 3MIWA 1LP1B 4EOTA 1Q86Q 2YIUC 3KQGA 4W7ZA 5CJ0A 1GD2E 3BCCJ 1AQ5A 2Z5IA 3H1JE 1FZCC 4HKZH 1JB0J 1N73C 1JTHA 3Q1MA 3CCVP 2WSCJ 5APVA 1WMKA 1ZR2A 3LW5J 2NPSA 1JNMA 2FYUD 3L75G 3RBZA 2R5BA 5KJ7D 4PD4D 3P7KA 5TISH 2Y0EA 3NMDA 3H1LJ 2FFDC 1L2PA 1ZMEC 2NRGA 3M9QA 3HUSB 4EDFA 2HR3A 1M90Q 5CCGD 1RE3C 3L72J 3H1JD 3KZIE 1NGMB 4I7ZC 1JY3N 5AW5B 2ZYAA 3MHVA 4H13C 1NH4A 1LTTC 1EDKA 2R44A 4IFFA 1RE4C 1JTHB 1K05A 4YPCA 5CCHC 2FBWC 4H0LB 1QLED 1OMIA 1GU4A 5AVXB 4I6MC 2L91A 2NPSB 1LTAC 1EXJA 3T97A 2R5DA 1AV1A 1FDMA 3M91A 2E5TA 2QJYC 3K5BA 3AEFC 1GK6A 1GZLA 1FDOA 5KLVK 3RL0B 2MJZA 3FGAD 5APWA 5C39A 3VTPC 3L37A 3M9BA 3G6EP 4DT0A 4M3LA 1N86A 2N1TC 1FC2C 2WVRA 4LC1A 1Q7YQ 3WU2H 2YMYA 5DJTB 4C46A 1PP9E 3AE4C 3D6ZA 2WSEH 1BSNA 3TGUE 2FYUG 2Q3EA 4IOIH 3V2RA 2NPSD 3C1LA 4PD4H 3KPEA 2XKMA 3PRJA 1FDIA 1VQPP 3T97B 2O1JA 2N9YB 4N78E 3OJAB 3WUUA 1OXZA 3TF5A 2Z4EA 3QWOC 3H1JG 1SQXE 1GL2A 2J5UA 4GT1A 3D70A 3RL0D 1KD1Q 3NXSA 2WT7B 1G1JA 2WWWA 3KXDA 4CPGA 2CK3H 4LLHA 2M0BA 2FXPA 3A0BH 1PP9D 1L0ND 2K37A 3TGUD 4NPFX 3SSUA 3Q5RA 4R4MA 1NVOA 1VQ6P 1K04A 2FYUJ 4IL6H 3L74E 2WPVB 4LGDE 1KFNA 2KNCB 3WUTA 2BCCE 3CC7P 3RK2B 1J1EB 3MD0A 1ZXGA 2QA4P 3ZDMA 3HE5A 1JCDA 1NKZB 1AVOA 1VQMP 1OVVA 2IBZE 2KLVA 2XNDH 1Q90D 2SPZA 3KZIH 3L70J 3H32A 3EQ2A 2JO1A 1IZNB 1GL2B 1FJKA 1QL1A 3U1AA 1NKNA 1NU1D 1RHZB 3FWLA 2J58A 3E7KA 2JP3A 1HF9A 5AVRB 3SWKA 1MUUA 4U3FE 2WMMA 2Q6QA 1PGQA 2E75C 1USDA 3D71A 2FYNB 1DX7A 2KOGA 1AA0A 1P84H 2KS1A 3BRVB 3AE1C 1USEA 2BCCD 3AE3C 1NWQA 1NTMD 1OVRA 2P2UA 2XZRA 1FAVA 2JWAA 4DCKA 2YO3A 2Y9ZA 1VQKP 2IBZD 1HGVA 3HE5B 5KKZC 2OYIC 3H32B 2AXTH 2P67A 4U3FD 1GL2D 2XV5A 3KYQA 3SWYA 1URQA 1PP9G 3B4SA 1L0NG 1HJ0A 4OWFA 3TGUG 4YTPC 1JY3P 2IZ0A 2JKVA 2OYHA 1CSBA 1H89A 2E76B 4ASVA 3SFEC 1VQ4P 4ASWA 3F5HA 2YXQB 2H8PD 1L0LE 1JY2O 1OW7A 3AE7C 3MUDC 3A2AA 2KP8A 2KS1B 1T2KC 3CXHE 3CMEP 1LT9B 1Q2NA 1HTLC 1S3JA 1L0NK 2ZT9B 1M1JB 4TLFA 1Y9BA 2ZFCA 2POHA 2XDJA 1NU1G 5BVZA 1L4AB 2ZJSE 4WVZA 3FXEA 1FZCA 3U59A 1FBMA 1N73A 1URQB 3BATA 4OH8B 2OYHB 1X0TA 2E76D 1L0LD 1JM0A 1T8ZA 1S4XA 1KILB 1NU1K 3B5NC 2P58A 1S5LX 2BCCG 1Q82Q 1NTMG 1KILE 3CXHD 3PH0A 1OW8A 5AVTB 2FFDA 2IBZG 2Y9YA 4ZNCA 3R2PA 1SQXJ 5AW3B 2KI7B 2J59M 3P32A 1FS0E 3AE2C 5B5EH 3FWNA 4B86A 4U3FG 2YIUB 1RE3A 2QJKC 3USSA 1FZEA 1K9MQ 1U57A 1NTMK 3VP9A 1FZCB 2B87A 1N7SC 2HLOA 3IAOA 2D2CC 2IYPA 5AW8B 1N73B 1RE4A 3ITKA 1URQD 5CCHA 5EFWB 3PTZA 3L74J 1YI2P 1SQVK 5KLVE 1SQBE 3W67A 1BCCD 1NAFA 2BCCJ 1KQSO 2ZXXA 3H25A 4Y99C 1SQPE 4XFJA 1PIXA 2FFDB 1JUNA 1JO5A 1OX3A 1A02J 2AXCA 1NTZK 1RQVA 5K5GB 2K9JA 3AEBC 4U3FJ 1KB9H 1PZQA 4I7ZB 2WPRA 2N1TA 1A02F 5KAFE 3V5BA 2B87B 4H13B 1ZN5A 3TNUB 1EZVE 1X8YA 4A7PA 3RBXA 3VOPA 1L0LG 3VMZA 1NAYA 5KLVD 2Y0DA 1SQBD 2H43A 2XNXA 3L73D 2V4HA 2M3BA 1SQPD 1CZQA 1UIIA 1BSHA 2OQQA 2FXOA 1WT6A 2QJYB 1L0LK 2IYOA 4YXDC 1KN7A 5L8RJ 2K9JB 1JMBA 3IF4A 3V6IA 4H44C 1EZVD 4H13D 5AVVB 1LTJC 1QEXA 4C7RA 5CCHD 1NHLA 5APYA 2MKVA 1BCCG 1HVVA 4W7YA 1E79H 4AYCA 4D6TD 3PP5A 4YXWH 1GU5A 1NJIQ 3CCUP 2OTKE 1JCCA 5M1BA 5CBNA 2ZAEB 4JYBA 1HUCA 3RGUA 5BU8B 1RY3A 3Q2YA 1P84I 2I1JA 3M0DC 3BVHA 1ZLLA 4XA4A 1YJ9P 2BEZF 2O01H 2CPSA 1SLQA 2N1TD 2IZ1A 5H2FE 5KLVG 1EXIA 1SQBG 3L73G 3CCEP 2DW3A 2KK7A 1T3UA 1OZHA 4PJ0E 3SWFA 1SQPG 1M56D 1PL5A 3L75J 3L71E 2WPSA 2A45G 1KYOH 1T6AA 2O01N 4TT3H 3O6QA 3IR9A 3MP7B 4R4LA 5APSA 1JY3O 1SQBK 2OYIA 1N2DC 3UIAA 1XTCC 3G4SP 3CI9A 1NTKD 4UB6H 1EDIA 2VRSA 1R8EA 3Q5SA 5B66H 2H7HA 2KLUA 3TDKA 3CPWO 1EZVG 1SQPK 2O01J 2PGDA 5KAIE 1X79B 2FYZA 1KZUB 2H88C 2E75B 2JDIH 3CC2P 1L0NE 5KLVJ 2Z5HA 4KJMA 3CMAP 5E79E 2I1KA 3M06A 3L71D 4D6TG 1SS1A 1BE3D 2HFED 3MUDA 4GDOA 3H1KE 2OARA 1YTZT 3II6A 1LWUC 2FXMA 1E5WA 5AW1B 3PJSK 4OGQC 3RL0g 1R5LA 1S5LE 3O6QB 3I55P 4WBAA 4N3YB 1S2EA 2WSFH 1DD3A 5KKZB 4WB4A 2OYIB 1NU1E 5AW7B 3OW2O 1VL2A 1PFIA 2A06D 4N6JA 2B89A 2ZYDA 1SQQD 2FY8A 3CCSP 1KORA 1GMJA 3L4FA 1CI6A 2UWJE 3HRNA 3A0HE 2E75D 5KTBA 4L75A 1FJPA 2QJPC 1WRGA 1M57D 3B5NA 3P8CE 1SFCC 4KHXA 1VQ5P 1Y8AA 3A5TA 3CCMP 1VQLP 3H1KD 3CX5I 1IK9A 1IFDA 4H0LC 1MFZA 5CHXA 1NTME 5GTHE 1D7MA 2XU6A 3GF7A 2WSFJ 4MN4C 1NTKG 3JCUE 3H1JJ 3V2QA 2W27A 3MTUE 1AFOA 1LTBC 4WWIA 1S1CX 1PPJE 3A7OA 1SVFA 4JYCA 1SQVE 1UIXA 1LJ2A 5TJHA 1N7SA 2M8RA 4WY4A 3H1HE 2JWDA 3C9IA 3CCLP 3CLQA 4PJ0H 3P8CD 1JOCA 3L71G 1NTKK 1BE3G 2QVAA 3MGNA 1KB9I 1NTZE 2O1KA 1U7JA 4NPEA 3B5NB 1IO4A 4IL6X 1N7LA 5AW0B 1IK7A 3TSIA 1QVGO 1T2KD 5AVWB 2IX7C 1Y47A 1BGYE 3JC22 1PPJD 1SQVD 1JY2N 2BASA 1KC8Q 1KQLA 3E1IA 1KFMA 5KAIH 2A06G 3U1CA 1SQQG 2Q7CA 3H1HD 5GTIE 5BU5A 3VYIA 1N7SB 3G9RA 3HD7A 2D2CB 2Q5UA 2RH0A 1DIPA 1NTZD 3H1KG 1H0TA 3F89A 3FXDA 3RK3C 3B5ND 3Q5PA 1SQQK 3GHGC 2P7JA 3AE5C 1BDCA 2AEFA 3H1IE 4Y99B 1EDJA 1PGOA 1BGYD 2IPPA 3D6YA 4K3AA 1G1IA 3SFDC 2IFNA 3RK2C 1YBKA 1ZW0A 3GG2A 2QM8A 1CW5A 2PP6A 3A0HH 2YNYA 1W5CE 2QIWA 1IFPA 1PP9J 1L0NJ 1N7SD 1VF5C 1LTJA 4WY4D 2D2CD 3A3YB 3TGUJ 1AJYA 3L72E 1RQUA 3BCCD 3B8EB 2QE7H 2WZ7A 4HB1A 1J1DC 1S72P 3H1KJ 5AW6B 1K73Q 1BCCE 1LGHB 4DOJA 2FYNC 3V2PA 3H1ID 3VP8A 1AQTA 3EFGA 1U7MA 3H6PA 3JCUH 1DH3A 4U7JA 3G71P 1PPJG 2K3RA 1SQVG 1YITP 1HH0A 3CC4P 1NU1J 2QRXA 3H1LD 1OW6A 3H1HG 3M0DA 3O8ZA 1YYCA 3JSVC 1ZR4A 2JR8A 1KYOI 1RH5B 1FZFA 4H44B 4WY4C 1SP4A 3L72D 5AVYB 1K8AQ 3LIEA 1NTZG 4L73A 1LTJB 3TK1A 1J2JB 2L5GB 1EQ7A 3CL3D 3L73E 1IJDB 1NTMJ 4HYTB 5AW4B 1YTZI 1FZGA 1BGYG 4PV1C 2H89C 3GLMA 3VN0A 2QEXP 1SQVJ 1YQ3C 2BEQD 3AECC 2E74D 1LP1A 2KB7P 3AEGC 2ZT9C 1M1JC 5GTIH 4PD4I 3H1HJ 1VQ8P 2W90A 2YKQA 4H44D 3HD7C 4I1LA 1X9VA 4KT0J 3BCCG 2GM4A 3KDPB 3FX0A 2K9YA 1NTZJ 3CWBE 2G8YA 4UB8E 1RF1C 4L76A 2IDBA 1VQ7P 1NYHA 3H1IG 5APXA 3CXHH 1PGJA 3AE8C 5AVQB 1KV4A 2E43A 2K1AA 4D6TE 1KILC 1LWUA 1BGYJ 1M1KQ 2Q3IA 2E74C 3H1LG 2WQYC 3AEAC 3G3ZA 3GW6A 3PHLA 1GDTA 2B9BA 2Q9IA 4K35A 1ZV8A 2N1TB 3L72G 1LNQA 4QMAA 1JY2P 2AEJA 3L70E 3CWBD 1L0LJ 2ZVNB 3V4WA 1QX8A 1FOSE 2V7QH 2GUVA 1SFCA 1S9KE 2RN0A 4BXLA 2PRRA 1R5SA 1X22A 3H1IJ 1FZAA 3CCRP 3A0BE 2M5AA 2OTJP 1LWUB 4OGQB 3I56P 5AVUB 2QG4A 3ABVC 4IL6E 2ZXEB 2JEEA 2N9BA 1NTKE 1GK4A 3AEEC 3IN6A 1BDDA 3NFQA 3L70D 2KSEA 5KLIC 1S9KD 2V7QJ 2QJPB 3IFMA 1DD4A 1VQOP 4HJGH 1YJNP 1BCCJ 1SFCB 4DJGA 4BRYA 5CJ4A 1BE3E 3HTKA 2A45H 1FE6A 5KJ7C 2M5AB 4OGQD 1LT1A 1P84E 2C0WA 4C7NA 3AEDC 1HWTC 2M3EA 5KAFH 1ZP0C 5CCGC 4EYYQ 2W6BA 3VMAA 2C9LY 2A06E 1SQQE 2R3CA 3CWBG 2WT7A 4ZMDA 2R32A 4Z1MH 4UB8H 2AXTE 1SQBJ 3L73J 2B88A 4JPZB 4JBZA 3AE6C 1SFCD 1SQPJ 1ZRTE 2AEMA 4BRYB 2YKPA 3GHGA 2KXPB 3HTKB 1RF0C 3L35A 4H0LD 1P84D 3S1KA 2E42A 2KNCA 4JF7A 1HGZA 2OGUA 2YMKA 3CD6P 5APQA 5APTA 4C7NB 3HUSC 1YHQP 4RJTA 3BASA 1MV8A 1H88A 4OVNF 3L70G 1G2CA 2IBZI 2GUSA 2G3AA 2R3SA 2FYUK 3CWBJ 4GKGA 2LXCB 4EIJA 2OYOA 4RO0A 4EI2A 2ZYGA 3N4XA 1ZRTD 4D6TJ 3RK3B 2K88A 1PV3A 1M7LA 3TYYA 2HYNA 2WSEJ 3GHGB 1GW3A 1MZ9A 3RK3E 2NPSC 1IFJA 3CCJP 2P10A 4JQ0D 1ZOYC 4HH2A 1MFTA 4N78D 5AW9B 1XTGB 4IFMA 1Z56A 3W68A 2YXRB 1OIPA 1SQXD 5H2FH 3RL0C 3QH9A 4BWNA 1JMMA 1G2CB 3EWKA 5B5EE 1CI6B 1N8RQ 3R4YA 3VMXA 1VF5B 1HJBA 1QL2A 2W8ZA 3CX5E 1Q81Q 1EC5A 4NPDA 1FOSF 1J1DB 3RK3D 2W83C 1VQNP 2IFMA 2KZJA 3L74D 1VPCA 4O9BA 2C9NY 4L74A 1IFIA 3OAKA 2WPQA 2HODA 1NTKJ 2KYVA 2QJKB 2GA1A 1LT9A 2NZ2A 1QVFO 1M1JA 4GODA 3CXHI 3RK2D 3L36A 1LTGC 4Y28J 1L4AA 1W2BO 4WY4B 1YJWP 1YIJP 5E79H 1HBWA 3S4RA 1VF5D 1KB9E 1KMIZ 2OTLP 3CX5D 1MKMA 3EFFK 3BCCE 1RF1A 3L71J 1IC2A 1BE3J 1OWAA 2P1JA 3P8MC 1DEBA 1PGPA 3C8VA 1S5LH 1KILA 5CMZA 2E5YA 1KTMA 2KUBA 1T3JA 4PV1B 3M0AA 1J1EC 2HODB 1SQXG 2Y0CA 3H1LE 1W2EA 2KIKA 2YO2A 1YQ4C 1SQQJ 1GL2C 2RMZA 3HD7B 1KB9D 1DEEG 4RKUJ 4W80A 3Q3DA 1EDLA 1LTSC 1VQ9P 1H0TB 1FU1A 1RF1B 2HPCA 1SQXK 5GTHH 1LTIC 2KSJA 3L74G 4GOFA 1M8OB 3AE9C 2PFXA 2W6JH 3I5CA 1GW4A 2Q1KA 2PAJA 4PV1D 1NOHA 3MZWB 3OA7A 2LKMA 2E74B 3L75E 5TISE 4DZOA 2FKWB 1KQFB 2ZT9D 3B71A 2A45I 5AVSB
chains in the Genus database with same CATH topology
1L4AD 1SFCA 2OARA 1S9KE 1YTZT 3HE5B 3HD7D 3II6A 2OYIC 1LWUC 2FXMA 1E5WA 5AW1B 3H32B 2P67A 3HE4A 1GL2D 3V4QA 2XV5A 1FZAA 4WBAA 4N3YB 3KYQA 3TNUA 2WSFH 3SWYA 4WB4A 2HPCB 2OYIB 4ZKUA 3LIDA 1LWUB 1URQA 2HG5D 5AVUB 1JY3P 5AW7B 2OYHA 1CSBA 1PFIA 4N6JA 2ZXEB 5KJ7A 1KILD 2JEEA 1H89A 2N9BA 5AW2B 4XE5B 3WMM0 2JJLA 1GK4A 3L4FA 1CI6A 3NTNA 3HRNA 1LT9C 2H8PD 5KTBA 5AVZB 1JY2O 1GTWA 1FJPA 4IFDK 3NFQA 1WRGA 3A2AA 5APUA 2KP8A 5CCGA 4AQRD 4GIFA 3B5NA 3P8CE 2WTYA 1SFCC 4KHXA 1T2KC 3A5TA 1L4AC 3N7NA 1LT9B 1HTLC 2CPBA 1S9KD 1IK9A 2C0XA 1L0NK 4AUWA 1IFDA 1M1JB 3IFMA 3BRTB 1MFZA 2ZFCA 5CHXA 2POHA 4RESB 1SFCB 2XDJA 5BVZA 1L4AB 2QM7A 5CJ4A 1IFMA 2XU6A 3HTKA 4ZKPA 1FZBA 1NO4A 1URQC 2A45H 3HE4B 2W6AA 1IFNA 2WSCH 4I2LC 1FZCA 3U59A 2OYHC 3V2QA 1FBMA 2W27A 3MTUE 3V2NA 5KJ7C 1AFOA 2WITA 3VMYA 1LTBC 1N73A 3A7OA 2YKOA 1SVFA 4JYCA 1RF0A 1URQB 3M9HA 2C0WA 3LW5H 4C7NA 3BATA 1VDFA 4OH8B 1HWTC 2OYHB 1N7SA 2M8RA 4WY4A 5CCGC 1T8ZA 1H8AA 1KILB 1NU1K 3B5NC 2W6BA 3C9IA 3CLQA 2C9LY 3HUSA 3P8CD 3MIWA 2R3CA 4EOTA 1JOCA 2WT7A 2R32A 1NTKK 3MGNA 5AVTB 2O1KA 3KQGA 4W7ZA 5CJ0A 2FFDA 3B5NB 1GD2E 1IO4A 3R2PA 1N7LA 5AW3B 2J59M 3P32A 5AW0B 1AQ5A 2Z5IA 4B86A 3TSIA 1RE3A 1FZCC 1SFCD 1FZEA 1T2KD 5AVWB 2IX7C 2YKPA 1N73C 3GHGA 1JTHA 3HTKB 1RF0C 3L35A 1NTMK 3VP9A 1FZCB 1JY2N 2BASA 1N7SC 1KQLA 2HLOA 3E1IA 5APVA 1KFMA 5AW8B 2E42A 3U1CA 1N73B 1RE4A 4JF7A 1ZR2A 1HGZA 2Q7CA 1URQD 2NPSA 5APQA 5CCHA 1JNMA 5APTA 4C7NB 3HUSC 5BU5A 3VYIA 3BASA 1MV8A 1N7SB 2R5BA 5KJ7D 3HD7A 1H88A 3P7KA 1SQVK 3NMDA 2FFDC 2Q5UA 1G2CA 1NAFA 3M9QA 3HUSB 2GUSA 2FYUK 4GKGA 5CCGD 4Y99C 3RK3C 1RE3C 3B5ND 2FFDB 1JUNA 4EIJA 1JO5A 1SQQK 3GHGC 2P7JA 3N4XA 1A02J 1JY3N 1NTZK 4Y99B 5AW5B 3RK3B 2IPPA 1NH4A 1LTTC 1M7LA 4IFFA 3TYYA 1G1IA 2HYNA 3GHGB 1GW3A 1MZ9A 2WPRA 1RE4C 1JTHB 2N1TA 1A02F 2IFNA 2NPSC 1IFJA 3RK2C 5CCHC 3V5BA 4HH2A 1ZN5A 2QM8A 3TNUB 2PP6A 1X8YA 1CW5A 4N78D 3VOPA 5AW9B 1GU4A 1XTGB 4IFMA 5AVXB 3VMZA 4I6MC 2NPSB 2YNYA 1LTAC 1Z56A 3T97A 2H43A 1N7SD 2R5DA 1LTJA 2XNXA 4WY4D 3A3YB 3RL0C 1FDMA 2M3BA 1JMMA 1G2CB 3M91A 3B8EB 1CZQA 1CI6B 2WZ7A 1GK6A 1GZLA 3VMXA 1J1DC 5KLVK 1HJBA 3RL0B 2MJZA 5AW6B 1QL2A 5APWA 1LGHB 4DOJA 3V2PA 1WT6A 3VP8A 3VTPC 3L37A 1L0LK 3M9BA 3EFGA 1FOSF 4M3LA 1N86A 2N1TC 1J1DB 3H6PA 3RK3D 1DH3A 4LC1A 2IFMA 1HH0A 1VPCA 2YMYA 4C46A 4O9BA 2WSEH 3M0DA 2C9NY 1IFIA 3O8ZA 3OAKA 5AVVB 1YYCA 2WPQA 1ZR4A 2HODA 1LTJC 2KYVA 1LT9A 1FZFA 4WY4C 3V2RA 4C7RA 1SP4A 1M1JA 2NPSD 3RK2D 3KPEA 1NHLA 5APYA 5CCHD 2XKMA 3L36A 1LTGC 5AVYB 3LIEA 2O1JA 4N78E 1LTJB 1HVVA 3OJAB 1OXZA 1L4AA 3TK1A 4W7YA 2Z4EA 1J2JB 4WY4B 2L5GB 4AYCA 1EQ7A 1HBWA 3PP5A 1GU5A 1GL2A 4GT1A 3CL3D 1IJDB 3RL0D 3NXSA 4HYTB 2WT7B 5AW4B 1JCCA 1RF1A 1G1JA 1IC2A 1YTZI 2WWWA 1FZGA 1OWAA 2P1JA 3P8MC 4JYBA 1HUCA 5BU8B 1RY3A 1DEBA 4LLHA 2I1JA 3VN0A 3M0DC 3BVHA 1ZLLA 1KILA 4XA4A 2O01H 5CMZA 2CPSA 1SLQA 1T3JA 2KB7P 2N1TD 1M1JC 3M0AA 1J1EC 2HODB 2YKQA 4LGDE 3HD7C 4I1LA 1KFNA 1W2EA 1X9VA 1T3UA 2YO2A 3SWFA 2GM4A 1GL2C 3RK2B 3KDPB 1J1EB 3MD0A 2WPSA 3HE5A 1JCDA 2A45G 3HD7B 1NKZB 1RF1C 2KLVA 4W80A 3H32A 3EQ2A 5APXA 1QL1A 1GL2B 1FJKA 3IR9A 5AVQB 3U1AA 1NKNA 2E43A 1LTSC 2J58A 5AVRB 5APSA 1KILC 1MUUA 1FU1A 1RF1B 1JY3O 2HPCA 1SQBK 2OYIA 1N2DC 3UIAA 1LWUA 1SQXK 1XTCC 1LTIC 3CI9A 2KSJA 2VRSA 2Q3IA 2H7HA 1SQPK 3G3ZA 1X79B 2FYZA 1GDTA 3I5CA 1GW4A 1KZUB 2Q9IA 2PAJA 1DX7A 1NOHA 3OA7A 2LKMA 2KOGA 1ZV8A 2N1TB 1JY2P 3BRVB 2Z5HA 4DZOA 2I1KA 1NWQA 3M06A 2FKWB 2XZRA 2P2UA 1FAVA 2A45I 2YO3A 5AVSB 2HFED 3V4WA 3MUDA 1FOSE 2GUVA 1HGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKO A;  3CL3 D;  2YKQ A;  3BRT B;  2W6B A;  2YKP A;  3EQ2 A;  3BRV B;  1JOC A;  3L4F A; 
#chains in the Genus database with same CATH topology
 1L4A D;  1AVY A;  3PLN A;  3HD7 D;  2ZVO B;  3CX5 H;  3HE4 A;  3V4Q A;  3TNU A;  3E1R A;  2KZI A;  1OFC X;  2E76 C;  2LXB A;  2HPC B;  1QGK B;  4ZKU A;  3LID A;  1EZV I;  4GOE A;  2HG5 D;  5KJ7 A;  1KIL D;  2ITA A;  2WSS H;  5AW2 B;  3CCQ P;  4XE5 B;  3WMM 0;  2JJL A;  3NTN A;  3L75 D;  1LT9 C;  2O3J A;  5CBO A;  5AVZ B;  1GTW A;  4IFD K;  5CCG A;  5APU A;  1KYO E;  4AQR D;  4GIF A;  2WTY A;  1L4A C;  3N7N A;  2CPB A;  2C0X A;  4AUW A;  3BRT B;  4RES B;  5KLI B;  3GF3 A;  4UB6 E;  2QM7 A;  2QSI A;  1IFM A;  4ZKP A;  1FZB A;  5B66 E;  1NO4 A;  3WUV A;  1TU3 F;  1URQ C;  3HE4 B;  2W6A A;  3KHU A;  1IFN A;  1KQG B;  2WSC H;  4I2L C;  5DJU B;  2OYH C;  3V2N A;  2WIT A;  3VMY A;  3WU2 E;  2I8D A;  2YKO A;  1RF0 A;  3M9H A;  3LW5 H;  2RKL A;  1VDF A;  3GMA A;  2LR2 A;  1JEK A;  1H8A A;  2FYU E;  1KYO D;  4PD4 E;  3HUS A;  3S9O A;  1OVU A;  3MIW A;  1LP1 B;  4EOT A;  1Q86 Q;  2YIU C;  3KQG A;  4W7Z A;  5CJ0 A;  1GD2 E;  3BCC J;  1AQ5 A;  2Z5I A;  3H1J E;  1FZC C;  4HKZ H;  1JB0 J;  1N73 C;  1JTH A;  3Q1M A;  3CCV P;  2WSC J;  5APV A;  1WMK A;  1ZR2 A;  3LW5 J;  2NPS A;  1JNM A;  2FYU D;  3L75 G;  3RBZ A;  2R5B A;  5KJ7 D;  4PD4 D;  3P7K A;  5TIS H;  2Y0E A;  3NMD A;  3H1L J;  2FFD C;  1L2P A;  1ZME C;  2NRG A;  3M9Q A;  3HUS B;  4EDF A;  2HR3 A;  1M90 Q;  5CCG D;  1RE3 C;  3L72 J;  3H1J D;  3KZI E;  1NGM B;  4I7Z C;  1JY3 N;  5AW5 B;  2ZYA A;  3MHV A;  4H13 C;  1NH4 A;  1LTT C;  1EDK A;  2R44 A;  4IFF A;  1RE4 C;  1JTH B;  1K05 A;  4YPC A;  5CCH C;  2FBW C;  4H0L B;  1QLE D;  1OMI A;  1GU4 A;  5AVX B;  4I6M C;  2L91 A;  2NPS B;  1LTA C;  1EXJ A;  3T97 A;  2R5D A;  1AV1 A;  1FDM A;  3M91 A;  2E5T A;  2QJY C;  3K5B A;  3AEF C;  1GK6 A;  1GZL A;  1FDO A;  5KLV K;  3RL0 B;  2MJZ A;  3FGA D;  5APW A;  5C39 A;  3VTP C;  3L37 A;  3M9B A;  3G6E P;  4DT0 A;  4M3L A;  1N86 A;  2N1T C;  1FC2 C;  2WVR A;  4LC1 A;  1Q7Y Q;  3WU2 H;  2YMY A;  5DJT B;  4C46 A;  1PP9 E;  3AE4 C;  3D6Z A;  2WSE H;  1BSN A;  3TGU E;  2FYU G;  2Q3E A;  4IOI H;  3V2R A;  2NPS D;  3C1L A;  4PD4 H;  3KPE A;  2XKM A;  3PRJ A;  1FDI A;  1VQP P;  3T97 B;  2O1J A;  2N9Y B;  4N78 E;  3OJA B;  3WUU A;  1OXZ A;  3TF5 A;  2Z4E A;  3QWO C;  3H1J G;  1SQX E;  1GL2 A;  2J5U A;  4GT1 A;  3D70 A;  3RL0 D;  1KD1 Q;  3NXS A;  2WT7 B;  1G1J A;  2WWW A;  3KXD A;  4CPG A;  2CK3 H;  4LLH A;  2M0B A;  2FXP A;  3A0B H;  1PP9 D;  1L0N D;  2K37 A;  3TGU D;  4NPF X;  3SSU A;  3Q5R A;  4R4M A;  1NVO A;  1VQ6 P;  1K04 A;  2FYU J;  4IL6 H;  3L74 E;  2WPV B;  4LGD E;  1KFN A;  2KNC B;  3WUT A;  2BCC E;  3CC7 P;  3RK2 B;  1J1E B;  3MD0 A;  1ZXG A;  2QA4 P;  3ZDM A;  3HE5 A;  1JCD A;  1NKZ B;  1AVO A;  1VQM P;  1OVV A;  2IBZ E;  2KLV A;  2XND H;  1Q90 D;  2SPZ A;  3KZI H;  3L70 J;  3H32 A;  3EQ2 A;  2JO1 A;  1IZN B;  1GL2 B;  1FJK A;  1QL1 A;  3U1A A;  1NKN A;  1NU1 D;  1RHZ B;  3FWL A;  2J58 A;  3E7K A;  2JP3 A;  1HF9 A;  5AVR B;  3SWK A;  1MUU A;  4U3F E;  2WMM A;  2Q6Q A;  1PGQ A;  2E75 C;  1USD A;  3D71 A;  2FYN B;  1DX7 A;  2KOG A;  1AA0 A;  1P84 H;  2KS1 A;  3BRV B;  3AE1 C;  1USE A;  2BCC D;  3AE3 C;  1NWQ A;  1NTM D;  1OVR A;  2P2U A;  2XZR A;  1FAV A;  2JWA A;  4DCK A;  2YO3 A;  2Y9Z A;  1VQK P;  2IBZ D;  1HGV A;  3HE5 B;  5KKZ C;  2OYI C;  3H32 B;  2AXT H;  2P67 A;  4U3F D;  1GL2 D;  2XV5 A;  3KYQ A;  3SWY A;  1URQ A;  1PP9 G;  3B4S A;  1L0N G;  1HJ0 A;  4OWF A;  3TGU G;  4YTP C;  1JY3 P;  2IZ0 A;  2JKV A;  2OYH A;  1CSB A;  1H89 A;  2E76 B;  4ASV A;  3SFE C;  1VQ4 P;  4ASW A;  3F5H A;  2YXQ B;  2H8P D;  1L0L E;  1JY2 O;  1OW7 A;  3AE7 C;  3MUD C;  3A2A A;  2KP8 A;  2KS1 B;  1T2K C;  3CXH E;  3CME P;  1LT9 B;  1Q2N A;  1HTL C;  1S3J A;  1L0N K;  2ZT9 B;  1M1J B;  4TLF A;  1Y9B A;  2ZFC A;  2POH A;  2XDJ A;  1NU1 G;  5BVZ A;  1L4A B;  2ZJS E;  4WVZ A;  3FXE A;  1FZC A;  3U59 A;  1FBM A;  1N73 A;  1URQ B;  3BAT A;  4OH8 B;  2OYH B;  1X0T A;  2E76 D;  1L0L D;  1JM0 A;  1T8Z A;  1S4X A;  1KIL B;  1NU1 K;  3B5N C;  2P58 A;  1S5L X;  2BCC G;  1Q82 Q;  1NTM G;  1KIL E;  3CXH D;  3PH0 A;  1OW8 A;  5AVT B;  2FFD A;  2IBZ G;  2Y9Y A;  4ZNC A;  3R2P A;  1SQX J;  5AW3 B;  2KI7 B;  2J59 M;  3P32 A;  1FS0 E;  3AE2 C;  5B5E H;  3FWN A;  4B86 A;  4U3F G;  2YIU B;  1RE3 A;  2QJK C;  3USS A;  1FZE A;  1K9M Q;  1U57 A;  1NTM K;  3VP9 A;  1FZC B;  2B87 A;  1N7S C;  2HLO A;  3IAO A;  2D2C C;  2IYP A;  5AW8 B;  1N73 B;  1RE4 A;  3ITK A;  1URQ D;  5CCH A;  5EFW B;  3PTZ A;  3L74 J;  1YI2 P;  1SQV K;  5KLV E;  1SQB E;  3W67 A;  1BCC D;  1NAF A;  2BCC J;  1KQS O;  2ZXX A;  3H25 A;  4Y99 C;  1SQP E;  4XFJ A;  1PIX A;  2FFD B;  1JUN A;  1JO5 A;  1OX3 A;  1A02 J;  2AXC A;  1NTZ K;  1RQV A;  5K5G B;  2K9J A;  3AEB C;  4U3F J;  1KB9 H;  1PZQ A;  4I7Z B;  2WPR A;  2N1T A;  1A02 F;  5KAF E;  3V5B A;  2B87 B;  4H13 B;  1ZN5 A;  3TNU B;  1EZV E;  1X8Y A;  4A7P A;  3RBX A;  3VOP A;  1L0L G;  3VMZ A;  1NAY A;  5KLV D;  2Y0D A;  1SQB D;  2H43 A;  2XNX A;  3L73 D;  2V4H A;  2M3B A;  1SQP D;  1CZQ A;  1UII A;  1BSH A;  2OQQ A;  2FXO A;  1WT6 A;  2QJY B;  1L0L K;  2IYO A;  4YXD C;  1KN7 A;  5L8R J;  2K9J B;  1JMB A;  3IF4 A;  3V6I A;  4H44 C;  1EZV D;  4H13 D;  5AVV B;  1LTJ C;  1QEX A;  4C7R A;  5CCH D;  1NHL A;  5APY A;  2MKV A;  1BCC G;  1HVV A;  4W7Y A;  1E79 H;  4AYC A;  4D6T D;  3PP5 A;  4YXW H;  1GU5 A;  1NJI Q;  3CCU P;  2OTK E;  1JCC A;  5M1B A;  5CBN A;  2ZAE B;  4JYB A;  1HUC A;  3RGU A;  5BU8 B;  1RY3 A;  3Q2Y A;  1P84 I;  2I1J A;  3M0D C;  3BVH A;  1ZLL A;  4XA4 A;  1YJ9 P;  2BEZ F;  2O01 H;  2CPS A;  1SLQ A;  2N1T D;  2IZ1 A;  5H2F E;  5KLV G;  1EXI A;  1SQB G;  3L73 G;  3CCE P;  2DW3 A;  2KK7 A;  1T3U A;  1OZH A;  4PJ0 E;  3SWF A;  1SQP G;  1M56 D;  1PL5 A;  3L75 J;  3L71 E;  2WPS A;  2A45 G;  1KYO H;  1T6A A;  2O01 N;  4TT3 H;  3O6Q A;  3IR9 A;  3MP7 B;  4R4L A;  5APS A;  1JY3 O;  1SQB K;  2OYI A;  1N2D C;  3UIA A;  1XTC C;  3G4S P;  3CI9 A;  1NTK D;  4UB6 H;  1EDI A;  2VRS A;  1R8E A;  3Q5S A;  5B66 H;  2H7H A;  2KLU A;  3TDK A;  3CPW O;  1EZV G;  1SQP K;  2O01 J;  2PGD A;  5KAI E;  1X79 B;  2FYZ A;  1KZU B;  2H88 C;  2E75 B;  2JDI H;  3CC2 P;  1L0N E;  5KLV J;  2Z5H A;  4KJM A;  3CMA P;  5E79 E;  2I1K A;  3M06 A;  3L71 D;  4D6T G;  1SS1 A;  1BE3 D;  2HFE D;  3MUD A;  4GDO A;  3H1K E;  2OAR A;  1YTZ T;  3II6 A;  1LWU C;  2FXM A;  1E5W A;  5AW1 B;  3PJS K;  4OGQ C;  3RL0 g;  1R5L A;  1S5L E;  3O6Q B;  3I55 P;  4WBA A;  4N3Y B;  1S2E A;  2WSF H;  1DD3 A;  5KKZ B;  4WB4 A;  2OYI B;  1NU1 E;  5AW7 B;  3OW2 O;  1VL2 A;  1PFI A;  2A06 D;  4N6J A;  2B89 A;  2ZYD A;  1SQQ D;  2FY8 A;  3CCS P;  1KOR A;  1GMJ A;  3L4F A;  1CI6 A;  2UWJ E;  3HRN A;  3A0H E;  2E75 D;  5KTB A;  4L75 A;  1FJP A;  2QJP C;  1WRG A;  1M57 D;  3B5N A;  3P8C E;  1SFC C;  4KHX A;  1VQ5 P;  1Y8A A;  3A5T A;  3CCM P;  1VQL P;  3H1K D;  3CX5 I;  1IK9 A;  1IFD A;  4H0L C;  1MFZ A;  5CHX A;  1NTM E;  5GTH E;  1D7M A;  2XU6 A;  3GF7 A;  2WSF J;  4MN4 C;  1NTK G;  3JCU E;  3H1J J;  3V2Q A;  2W27 A;  3MTU E;  1AFO A;  1LTB C;  4WWI A;  1S1C X;  1PPJ E;  3A7O A;  1SVF A;  4JYC A;  1SQV E;  1UIX A;  1LJ2 A;  5TJH A;  1N7S A;  2M8R A;  4WY4 A;  3H1H E;  2JWD A;  3C9I A;  3CCL P;  3CLQ A;  4PJ0 H;  3P8C D;  1JOC A;  3L71 G;  1NTK K;  1BE3 G;  2QVA A;  3MGN A;  1KB9 I;  1NTZ E;  2O1K A;  1U7J A;  4NPE A;  3B5N B;  1IO4 A;  4IL6 X;  1N7L A;  5AW0 B;  1IK7 A;  3TSI A;  1QVG O;  1T2K D;  5AVW B;  2IX7 C;  1Y47 A;  1BGY E;  3JC2 2;  1PPJ D;  1SQV D;  1JY2 N;  2BAS A;  1KC8 Q;  1KQL A;  3E1I A;  1KFM A;  5KAI H;  2A06 G;  3U1C A;  1SQQ G;  2Q7C A;  3H1H D;  5GTI E;  5BU5 A;  3VYI A;  1N7S B;  3G9R A;  3HD7 A;  2D2C B;  2Q5U A;  2RH0 A;  1DIP A;  1NTZ D;  3H1K G;  1H0T A;  3F89 A;  3FXD A;  3RK3 C;  3B5N D;  3Q5P A;  1SQQ K;  3GHG C;  2P7J A;  3AE5 C;  1BDC A;  2AEF A;  3H1I E;  4Y99 B;  1EDJ A;  1PGO A;  1BGY D;  2IPP A;  3D6Y A;  4K3A A;  1G1I A;  3SFD C;  2IFN A;  3RK2 C;  1YBK A;  1ZW0 A;  3GG2 A;  2QM8 A;  1CW5 A;  2PP6 A;  3A0H H;  2YNY A;  1W5C E;  2QIW A;  1IFP A;  1PP9 J;  1L0N J;  1N7S D;  1VF5 C;  1LTJ A;  4WY4 D;  2D2C D;  3A3Y B;  3TGU J;  1AJY A;  3L72 E;  1RQU A;  3BCC D;  3B8E B;  2QE7 H;  2WZ7 A;  4HB1 A;  1J1D C;  1S72 P;  3H1K J;  5AW6 B;  1K73 Q;  1BCC E;  1LGH B;  4DOJ A;  2FYN C;  3V2P A;  3H1I D;  3VP8 A;  1AQT A;  3EFG A;  1U7M A;  3H6P A;  3JCU H;  1DH3 A;  4U7J A;  3G71 P;  1PPJ G;  2K3R A;  1SQV G;  1YIT P;  1HH0 A;  3CC4 P;  1NU1 J;  2QRX A;  3H1L D;  1OW6 A;  3H1H G;  3M0D A;  3O8Z A;  1YYC A;  3JSV C;  1ZR4 A;  2JR8 A;  1KYO I;  1RH5 B;  1FZF A;  4H44 B;  4WY4 C;  1SP4 A;  3L72 D;  5AVY B;  1K8A Q;  3LIE A;  1NTZ G;  4L73 A;  1LTJ B;  3TK1 A;  1J2J B;  2L5G B;  1EQ7 A;  3CL3 D;  3L73 E;  1IJD B;  1NTM J;  4HYT B;  5AW4 B;  1YTZ I;  1FZG A;  1BGY G;  4PV1 C;  2H89 C;  3GLM A;  3VN0 A;  2QEX P;  1SQV J;  1YQ3 C;  2BEQ D;  3AEC C;  2E74 D;  1LP1 A;  2KB7 P;  3AEG C;  2ZT9 C;  1M1J C;  5GTI H;  4PD4 I;  3H1H J;  1VQ8 P;  2W90 A;  2YKQ A;  4H44 D;  3HD7 C;  4I1L A;  1X9V A;  4KT0 J;  3BCC G;  2GM4 A;  3KDP B;  3FX0 A;  2K9Y A;  1NTZ J;  3CWB E;  2G8Y A;  4UB8 E;  1RF1 C;  4L76 A;  2IDB A;  1VQ7 P;  1NYH A;  3H1I G;  5APX A;  3CXH H;  1PGJ A;  3AE8 C;  5AVQ B;  1KV4 A;  2E43 A;  2K1A A;  4D6T E;  1KIL C;  1LWU A;  1BGY J;  1M1K Q;  2Q3I A;  2E74 C;  3H1L G;  2WQY C;  3AEA C;  3G3Z A;  3GW6 A;  3PHL A;  1GDT A;  2B9B A;  2Q9I A;  4K35 A;  1ZV8 A;  2N1T B;  3L72 G;  1LNQ A;  4QMA A;  1JY2 P;  2AEJ A;  3L70 E;  3CWB D;  1L0L J;  2ZVN B;  3V4W A;  1QX8 A;  1FOS E;  2V7Q H;  2GUV A;  1SFC A;  1S9K E;  2RN0 A;  4BXL A;  2PRR A;  1R5S A;  1X22 A;  3H1I J;  1FZA A;  3CCR P;  3A0B E;  2M5A A;  2OTJ P;  1LWU B;  4OGQ B;  3I56 P;  5AVU B;  2QG4 A;  3ABV C;  4IL6 E;  2ZXE B;  2JEE A;  2N9B A;  1NTK E;  1GK4 A;  3AEE C;  3IN6 A;  1BDD A;  3NFQ A;  3L70 D;  2KSE A;  5KLI C;  1S9K D;  2V7Q J;  2QJP B;  3IFM A;  1DD4 A;  1VQO P;  4HJG H;  1YJN P;  1BCC J;  1SFC B;  4DJG A;  4BRY A;  5CJ4 A;  1BE3 E;  3HTK A;  2A45 H;  1FE6 A;  5KJ7 C;  2M5A B;  4OGQ D;  1LT1 A;  1P84 E;  2C0W A;  4C7N A;  3AED C;  1HWT C;  2M3E A;  5KAF H;  1ZP0 C;  5CCG C;  4EYY Q;  2W6B A;  3VMA A;  2C9L Y;  2A06 E;  1SQQ E;  2R3C A;  3CWB G;  2WT7 A;  4ZMD A;  2R32 A;  4Z1M H;  4UB8 H;  2AXT E;  1SQB J;  3L73 J;  2B88 A;  4JPZ B;  4JBZ A;  3AE6 C;  1SFC D;  1SQP J;  1ZRT E;  2AEM A;  4BRY B;  2YKP A;  3GHG A;  2KXP B;  3HTK B;  1RF0 C;  3L35 A;  4H0L D;  1P84 D;  3S1K A;  2E42 A;  2KNC A;  4JF7 A;  1HGZ A;  2OGU A;  2YMK A;  3CD6 P;  5APQ A;  5APT A;  4C7N B;  3HUS C;  1YHQ P;  4RJT A;  3BAS A;  1MV8 A;  1H88 A;  4OVN F;  3L70 G;  1G2C A;  2IBZ I;  2GUS A;  2G3A A;  2R3S A;  2FYU K;  3CWB J;  4GKG A;  2LXC B;  4EIJ A;  2OYO A;  4RO0 A;  4EI2 A;  2ZYG A;  3N4X A;  1ZRT D;  4D6T J;  3RK3 B;  2K88 A;  1PV3 A;  1M7L A;  3TYY A;  2HYN A;  2WSE J;  3GHG B;  1GW3 A;  1MZ9 A;  3RK3 E;  2NPS C;  1IFJ A;  3CCJ P;  2P10 A;  4JQ0 D;  1ZOY C;  4HH2 A;  1MFT A;  4N78 D;  5AW9 B;  1XTG B;  4IFM A;  1Z56 A;  3W68 A;  2YXR B;  1OIP A;  1SQX D;  5H2F H;  3RL0 C;  3QH9 A;  4BWN A;  1JMM A;  1G2C B;  3EWK A;  5B5E E;  1CI6 B;  1N8R Q;  3R4Y A;  3VMX A;  1VF5 B;  1HJB A;  1QL2 A;  2W8Z A;  3CX5 E;  1Q81 Q;  1EC5 A;  4NPD A;  1FOS F;  1J1D B;  3RK3 D;  2W83 C;  1VQN P;  2IFM A;  2KZJ A;  3L74 D;  1VPC A;  4O9B A;  2C9N Y;  4L74 A;  1IFI A;  3OAK A;  2WPQ A;  2HOD A;  1NTK J;  2KYV A;  2QJK B;  2GA1 A;  1LT9 A;  2NZ2 A;  1QVF O;  1M1J A;  4GOD A;  3CXH I;  3RK2 D;  3L36 A;  1LTG C;  4Y28 J;  1L4A A;  1W2B O;  4WY4 B;  1YJW P;  1YIJ P;  5E79 H;  1HBW A;  3S4R A;  1VF5 D;  1KB9 E;  1KMI Z;  2OTL P;  3CX5 D;  1MKM A;  3EFF K;  3BCC E;  1RF1 A;  3L71 J;  1IC2 A;  1BE3 J;  1OWA A;  2P1J A;  3P8M C;  1DEB A;  1PGP A;  3C8V A;  1S5L H;  1KIL A;  5CMZ A;  2E5Y A;  1KTM A;  2KUB A;  1T3J A;  4PV1 B;  3M0A A;  1J1E C;  2HOD B;  1SQX G;  2Y0C A;  3H1L E;  1W2E A;  2KIK A;  2YO2 A;  1YQ4 C;  1SQQ J;  1GL2 C;  2RMZ A;  3HD7 B;  1KB9 D;  1DEE G;  4RKU J;  4W80 A;  3Q3D A;  1EDL A;  1LTS C;  1VQ9 P;  1H0T B;  1FU1 A;  1RF1 B;  2HPC A;  1SQX K;  5GTH H;  1LTI C;  2KSJ A;  3L74 G;  4GOF A;  1M8O B;  3AE9 C;  2PFX A;  2W6J H;  3I5C A;  1GW4 A;  2Q1K A;  2PAJ A;  4PV1 D;  1NOH A;  3MZW B;  3OA7 A;  2LKM A;  2E74 B;  3L75 E;  5TIS E;  4DZO A;  2FKW B;  1KQF B;  2ZT9 D;  3B71 A;  2A45 I;  5AVS B; 
#chains in the Genus database with same CATH homology
 1L4A D;  1SFC A;  2OAR A;  1S9K E;  1YTZ T;  3HE5 B;  3HD7 D;  3II6 A;  2OYI C;  1LWU C;  2FXM A;  1E5W A;  5AW1 B;  3H32 B;  2P67 A;  3HE4 A;  1GL2 D;  3V4Q A;  2XV5 A;  1FZA A;  4WBA A;  4N3Y B;  3KYQ A;  3TNU A;  2WSF H;  3SWY A;  4WB4 A;  2HPC B;  2OYI B;  4ZKU A;  3LID A;  1LWU B;  1URQ A;  2HG5 D;  5AVU B;  1JY3 P;  5AW7 B;  2OYH A;  1CSB A;  1PFI A;  4N6J A;  2ZXE B;  5KJ7 A;  1KIL D;  2JEE A;  1H89 A;  2N9B A;  5AW2 B;  4XE5 B;  3WMM 0;  2JJL A;  1GK4 A;  3L4F A;  1CI6 A;  3NTN A;  3HRN A;  1LT9 C;  2H8P D;  5KTB A;  5AVZ B;  1JY2 O;  1GTW A;  1FJP A;  4IFD K;  3NFQ A;  1WRG A;  3A2A A;  5APU A;  2KP8 A;  5CCG A;  4AQR D;  4GIF A;  3B5N A;  3P8C E;  2WTY A;  1SFC C;  4KHX A;  1T2K C;  3A5T A;  1L4A C;  3N7N A;  1LT9 B;  1HTL C;  2CPB A;  1S9K D;  1IK9 A;  2C0X A;  1L0N K;  4AUW A;  1IFD A;  1M1J B;  3IFM A;  3BRT B;  1MFZ A;  2ZFC A;  5CHX A;  2POH A;  4RES B;  1SFC B;  2XDJ A;  5BVZ A;  1L4A B;  2QM7 A;  5CJ4 A;  1IFM A;  2XU6 A;  3HTK A;  4ZKP A;  1FZB A;  1NO4 A;  1URQ C;  2A45 H;  3HE4 B;  2W6A A;  1IFN A;  2WSC H;  4I2L C;  1FZC A;  3U59 A;  2OYH C;  3V2Q A;  1FBM A;  2W27 A;  3MTU E;  3V2N A;  5KJ7 C;  1AFO A;  2WIT A;  3VMY A;  1LTB C;  1N73 A;  3A7O A;  2YKO A;  1SVF A;  4JYC A;  1RF0 A;  1URQ B;  3M9H A;  2C0W A;  3LW5 H;  4C7N A;  3BAT A;  1VDF A;  4OH8 B;  1HWT C;  2OYH B;  1N7S A;  2M8R A;  4WY4 A;  5CCG C;  1T8Z A;  1H8A A;  1KIL B;  1NU1 K;  3B5N C;  2W6B A;  3C9I A;  3CLQ A;  2C9L Y;  3HUS A;  3P8C D;  3MIW A;  2R3C A;  4EOT A;  1JOC A;  2WT7 A;  2R32 A;  1NTK K;  3MGN A;  5AVT B;  2O1K A;  3KQG A;  4W7Z A;  5CJ0 A;  2FFD A;  3B5N B;  1GD2 E;  1IO4 A;  3R2P A;  1N7L A;  5AW3 B;  2J59 M;  3P32 A;  5AW0 B;  1AQ5 A;  2Z5I A;  4B86 A;  3TSI A;  1RE3 A;  1FZC C;  1SFC D;  1FZE A;  1T2K D;  5AVW B;  2IX7 C;  2YKP A;  1N73 C;  3GHG A;  1JTH A;  3HTK B;  1RF0 C;  3L35 A;  1NTM K;  3VP9 A;  1FZC B;  1JY2 N;  2BAS A;  1N7S C;  1KQL A;  2HLO A;  3E1I A;  5APV A;  1KFM A;  5AW8 B;  2E42 A;  3U1C A;  1N73 B;  1RE4 A;  4JF7 A;  1ZR2 A;  1HGZ A;  2Q7C A;  1URQ D;  2NPS A;  5APQ A;  5CCH A;  1JNM A;  5APT A;  4C7N B;  3HUS C;  5BU5 A;  3VYI A;  3BAS A;  1MV8 A;  1N7S B;  2R5B A;  5KJ7 D;  3HD7 A;  1H88 A;  3P7K A;  1SQV K;  3NMD A;  2FFD C;  2Q5U A;  1G2C A;  1NAF A;  3M9Q A;  3HUS B;  2GUS A;  2FYU K;  4GKG A;  5CCG D;  4Y99 C;  3RK3 C;  1RE3 C;  3B5N D;  2FFD B;  1JUN A;  4EIJ A;  1JO5 A;  1SQQ K;  3GHG C;  2P7J A;  3N4X A;  1A02 J;  1JY3 N;  1NTZ K;  4Y99 B;  5AW5 B;  3RK3 B;  2IPP A;  1NH4 A;  1LTT C;  1M7L A;  4IFF A;  3TYY A;  1G1I A;  2HYN A;  3GHG B;  1GW3 A;  1MZ9 A;  2WPR A;  1RE4 C;  1JTH B;  2N1T A;  1A02 F;  2IFN A;  2NPS C;  1IFJ A;  3RK2 C;  5CCH C;  3V5B A;  4HH2 A;  1ZN5 A;  2QM8 A;  3TNU B;  2PP6 A;  1X8Y A;  1CW5 A;  4N78 D;  3VOP A;  5AW9 B;  1GU4 A;  1XTG B;  4IFM A;  5AVX B;  3VMZ A;  4I6M C;  2NPS B;  2YNY A;  1LTA C;  1Z56 A;  3T97 A;  2H43 A;  1N7S D;  2R5D A;  1LTJ A;  2XNX A;  4WY4 D;  3A3Y B;  3RL0 C;  1FDM A;  2M3B A;  1JMM A;  1G2C B;  3M91 A;  3B8E B;  1CZQ A;  1CI6 B;  2WZ7 A;  1GK6 A;  1GZL A;  3VMX A;  1J1D C;  5KLV K;  1HJB A;  3RL0 B;  2MJZ A;  5AW6 B;  1QL2 A;  5APW A;  1LGH B;  4DOJ A;  3V2P A;  1WT6 A;  3VP8 A;  3VTP C;  3L37 A;  1L0L K;  3M9B A;  3EFG A;  1FOS F;  4M3L A;  1N86 A;  2N1T C;  1J1D B;  3H6P A;  3RK3 D;  1DH3 A;  4LC1 A;  2IFM A;  1HH0 A;  1VPC A;  2YMY A;  4C46 A;  4O9B A;  2WSE H;  3M0D A;  2C9N Y;  1IFI A;  3O8Z A;  3OAK A;  5AVV B;  1YYC A;  2WPQ A;  1ZR4 A;  2HOD A;  1LTJ C;  2KYV A;  1LT9 A;  1FZF A;  4WY4 C;  3V2R A;  4C7R A;  1SP4 A;  1M1J A;  2NPS D;  3RK2 D;  3KPE A;  1NHL A;  5APY A;  5CCH D;  2XKM A;  3L36 A;  1LTG C;  5AVY B;  3LIE A;  2O1J A;  4N78 E;  1LTJ B;  1HVV A;  3OJA B;  1OXZ A;  1L4A A;  3TK1 A;  4W7Y A;  2Z4E A;  1J2J B;  4WY4 B;  2L5G B;  4AYC A;  1EQ7 A;  1HBW A;  3PP5 A;  1GU5 A;  1GL2 A;  4GT1 A;  3CL3 D;  1IJD B;  3RL0 D;  3NXS A;  4HYT B;  2WT7 B;  5AW4 B;  1JCC A;  1RF1 A;  1G1J A;  1IC2 A;  1YTZ I;  2WWW A;  1FZG A;  1OWA A;  2P1J A;  3P8M C;  4JYB A;  1HUC A;  5BU8 B;  1RY3 A;  1DEB A;  4LLH A;  2I1J A;  3VN0 A;  3M0D C;  3BVH A;  1ZLL A;  1KIL A;  4XA4 A;  2O01 H;  5CMZ A;  2CPS A;  1SLQ A;  1T3J A;  2KB7 P;  2N1T D;  1M1J C;  3M0A A;  1J1E C;  2HOD B;  2YKQ A;  4LGD E;  3HD7 C;  4I1L A;  1KFN A;  1W2E A;  1X9V A;  1T3U A;  2YO2 A;  3SWF A;  2GM4 A;  1GL2 C;  3RK2 B;  3KDP B;  1J1E B;  3MD0 A;  2WPS A;  3HE5 A;  1JCD A;  2A45 G;  3HD7 B;  1NKZ B;  1RF1 C;  2KLV A;  4W80 A;  3H32 A;  3EQ2 A;  5APX A;  1QL1 A;  1GL2 B;  1FJK A;  3IR9 A;  5AVQ B;  3U1A A;  1NKN A;  2E43 A;  1LTS C;  2J58 A;  5AVR B;  5APS A;  1KIL C;  1MUU A;  1FU1 A;  1RF1 B;  1JY3 O;  2HPC A;  1SQB K;  2OYI A;  1N2D C;  3UIA A;  1LWU A;  1SQX K;  1XTC C;  1LTI C;  3CI9 A;  2KSJ A;  2VRS A;  2Q3I A;  2H7H A;  1SQP K;  3G3Z A;  1X79 B;  2FYZ A;  1GDT A;  3I5C A;  1GW4 A;  1KZU B;  2Q9I A;  2PAJ A;  1DX7 A;  1NOH A;  3OA7 A;  2LKM A;  2KOG A;  1ZV8 A;  2N1T B;  1JY2 P;  3BRV B;  2Z5H A;  4DZO A;  2I1K A;  1NWQ A;  3M06 A;  2FKW B;  2XZR A;  2P2U A;  1FAV A;  2A45 I;  2YO3 A;  5AVS B;  2HFE D;  3V4W A;  3MUD A;  1FOS E;  2GUV A;  1HGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...