2B87A

Structural basis for molecular recognition in an affibody:affibody complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
58
structure length
58
Chain Sequence
VDNKFNKELGWATWEIFNLPNLNGVQVKAFIDSLRDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ZTaq affibody
publication title Structural basis for molecular recognition in an affibody:affibody complex.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 20
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2005-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2b87A00
4HB1A 1EDLA 2UWJE 2KUBA 2LXCB 2KIKA 2QVAA 2OTKE 1EDJA 1Q2NA 1OVUA 2KS1B 1U7JA 4HJGH 2SPZA 1BDDA 1DEEG 3FXEA 2Q1KA 2K3RA 2KZJA 4WWIA 1LT1A 3RGUA 5EFWB 3ZDMA 2R44A 5CBOA 5C39A 1JM0A 2B87B 4GOFA 3PH0A 3MHVA 1OVRA 4GOEA 5DJUB 4CPGA 1Y47A 2HR3A 4EYYQ 1ZW0A 1U7MA 1ZXGA 1LP1A 1OVVA 1X0TA 4BXLA 2I8DA 4NPEA 1JMBA 4NPFX 2JWDA 1H0TA 2B88A 2KZIA 1SS1A 1S3JA 1NVOA 4MN4C 2QRXA 2WMMA 5CBNA 4ASWA 4K3AA 2M5AA 2LXBA 1EC5A 4JBZA 1EDKA 4K35A 4KJMA 4ZNCA 2KI7B 4GODA 2P58A 3QWOC 1EDIA 4ZMDA 5K5GB 4IOIH 4HKZH 1LP1B 2RKLA 4ASVA 1H0TB 2M0BA 2ZAEB 5DJTB 2B87A 3S1KA 1BDCA 1FC2C 3FXDA 2LR2A 2M5AB 2B89A 4NPDA 1MFTA 3MZWB
chains in the Genus database with same CATH superfamily
1VQLP 2JP3A 3VP8A 1EDJA 2YIUB 3AEGC 2Y0CA 4HJGH 3LW5J 1USDA 2B9BA 2Q5UA 1SQBK 3L75E 4U3FD 5KLVK 1IFJA 3MIWA 2K37A 1GU5A 3L37A 1M56D 1L0NJ 4DZOA 3SWKA 4D6TG 4HYTB 2M3EA 1CI6B 3KZIH 1EZVI 1VQ7P 3KYQA 3GLMA 4CPGA 2KLUA 1BCCE 1URQB 3TGUE 5BU8B 1NTZJ 4NPEA 2KS1A 2E75D 1AVYA 2Z4EA 2QJKB 2KZIA 2XZRA 4OH8B 1AJYA 2Y9ZA 2Q7CA 2QRXA 3L72G 3HE4B 3L71J 2RN0A 1M8OB 4JBZA 1AV1A 4KJMA 1IO4A 2FXOA 3V4WA 1J1EC 1LTSC 3RBXA 2E74B 2CK3H 3A2AA 3MP7B 3AE1C 4L74A 1DH3A 2K9JB 2OARA 3TNUB 5GTIH 1OZHA 3P8MC 2KYVA 1JCCA 3M9BA 5AW7B 5GTIE 1SQXD 2WT7A 4H44B 1YITP 3RBZA 3NMDA 4Z1MH 2A06E 4W7ZA 1PGQA 1N7SD 2BASA 2HODB 3S9OA 4RO0A 1EZVE 1DEEG 3AE8C 3RGUA 1LTJB 5CJ4A 1KN7A 4BRYB 2IPPA 2KOGA 3A5TA 3A0HH 4GOEA 5DJUB 1IFIA 3A0HE 1SQQD 1RF0C 3H1LE 1Q82Q 1NU1J 2E75C 3HD7B 2I1KA 3IAOA 4UB6H 2BEQD 2QJPB 1FZCB 4PV1B 1SQBJ 5AVYB 3A0BE 5KLVJ 1M90Q 1BE3E 1T2KD 1SQVG 2NPSD 1N8RQ 1LTIC 3WU2H 1R8EA 1YTZI 3G9RA 2IX7C 1E79H 1RE3C 3CPWO 1M1KQ 3EFFK 3WU2E 3L70J 2QIWA 4JPZB 1GK6A 1GK4A 3BCCD 3HUSA 5CCGD 4WY4B 1Q7YQ 1N7SC 1PL5A 1GMJA 1OVUA 2KS1B 1XTGB 1LNQA 1HGVA 3CX5D 1JY3O 4WB4A 2K3RA 3L74G 1JEKA 3VMYA 1DEBA 2R5DA 1SQPE 4LC1A 4GOFA 3V2RA 2D2CB 4DT0A 1P84I 2YKPA 4AYCA 3Q1MA 1G1IA 3CC2P 1WMKA 3M0AA 3L4FA 2K1AA 3M9QA 1QVFO 2E76B 2H8PD 5AVSB 3CD6P 4MN4C 2WT7B 1KILE 1SVFA 3T97A 2NPSC 1L4AD 1HWTC 4EI2A 3L75J 1L0ND 2JR8A 1EDIA 4ZMDA 1NTKG 1CW5A 3O6QA 1VQNP 1HJ0A 1OW7A 2YO3A 1BCCJ 2HYNA 3FX0A 3TGUJ 1NTZD 1IFPA 4PJ0H 5B66H 2FYNC 2K88A 1N73A 1NTME 4KT0J 2GA1A 5B66E 1P84H 2R32A 3L71D 2GUSA 2ZVOB 2WSFH 1P84E 3CCRP 4H13C 2XU6A 2N9YB 4DJGA 3CCSP 3AE9C 1KILC 1PGOA 1FOSF 1AFOA 2FYUG 1LWUC 1GU4A 1PP9E 1SQPK 2FFDC 2W6AA 4RJTA 1KZUB 2KNCA 1KD1Q 3TK1A 1LP1A 1DD3A 1WT6A 3CCQP 3AEFC 2Q6QA 3MUDA 1L2PA 1OX3A 3CL3D 3Q5PA 1L4AC 3G4SP 3H25A 1IK7A 5AW0B 1N7LA 3BVHA 3H1IE 1W2EA 1YJWP 3QWOC 1J1EB 2PFXA 5APTA 2CPSA 2J5UA 1OWAA 1NO4A 4TT3H 2O01H 1NU1D 1YJNP 2KB7P 4YPCA 1T3UA 2MKVA 1S5LH 2P7JA 3H1LJ 1RE4C 5AVWB 1CI6A 1NJIQ 3Q2YA 1S1CX 1KV4A 1L0LE 3BRVB 1HUCA 2IFMA 1SQBD 2LXCB 1IFDA 5KLVD 1NTMK 4I7ZB 3OW2O 3L71G 1GW4A 3IFMA 1BE3J 3L70D 3IN6A 2WPVB 5CCGA 1GW3A 2YXQB 3AEBC 2IFNA 3LIEA 1G2CB 3RK3D 3H1HG 1NOHA 1PFIA 1LJ2A 1PV3A 2A45I 1IFNA 3MTUE 3O6QB 1VQKP 3II6A 1EQ7A 2E75B 1JY2N 3RK2D 2ITAA 1K73Q 2WQYC 3L73G 1FJPA 2OYHC 1RQVA 2MJZA 1EXJA 1N73B 2LXBA 1QVGO 3H1JE 2HODA 5KAIH 2W6JH 2O3JA 5BU5A 1SQPJ 5KAIE 4OGQD 1PPJG 2OYIC 1LTJA 3P32A 3F89A 2N1TD 4BRYA 3HE5A 2W6BA 3CXHI 1NKNA 2E42A 4D6TE 3CWBE 3C9IA 2GM4A 2LR2A 1RF1C 1QX8A 1R5SA 1USEA 2IBZD 3TDKA 2JJLA 3RL0C 3NXSA 3FWNA 4JF7A 1N7SB 1N2DC 1EXIA 1DIPA 1HVVA 3HD7A 3IF4A 1M57D 3Q5SA 3L75D 2HFED 1Z56A 1FZAA 1FZCA 3N4XA 3ZDMA 3L72E 3PH0A 3VP9A 2JDIH 4I2LC 3V5BA 3E1RA 3RK3C 1BCCD 2WZ7A 3WMM0 3TGUD 3RK2C 1QGKB 1NHLA 1LTGC 2ZYDA 1SS1A 1NTMJ 1M1JC 1YYCA 4L76A 1JNMA 2FYZA 4WY4A 3Q5RA 1PIXA 1VQ8P 3KZIE 4GT1A 5AVUB 3CXHH 2NPSB 2WSFJ 2QEXP 1Y9BA 4GODA 3CXHE 3M0DC 4OGQC 1IZNB 2WSEH 5M1BA 3AEDC 1BGYG 1RH5B 2N1TC 2P2UA 4DCKA 1PP9J 5CCHD 1NAYA 3TF5A 5AW3B 2KSEA 4W80A 4N6JA 3PRJA 4N78E 4Y99C 3HTKB 2M5AB 2B89A 2QE7H 1MFTA 1SFCD 2A06D 2KUBA 3G71P 3NFQA 2Q3IA 1YBKA 1EZVD 1BDDA 5AVQB 1K9MQ 3Q3DA 4H13B 2XV5A 3KXDA 3I5CA 3F5HA 4IL6H 3H1IJ 4WVZA 2NRGA 1KILB 1ZP0C 3CCEP 1VQ6P 1SQVE 4GDOA 3VN0A 3H1LD 3UIAA 1NKZB 2FFDB 4IFFA 2O01J 1BCCG 4IFMA 2N9BA 3HE5B 4U3FG 3ABVC 1L0LJ 1JY3P 5AW1B 5APWA 1X9VA 1BE3D 5CHXA 2Y0EA 1L4AB 3W68A 1ZRTE 3CC4P 3AE2C 3PTZA 4ZKPA 2AEJA 5CCHC 3USSA 1JOCA 4UB6E 2IZ1A 3L74E 3S1KA 1JMMA 1Q90D 1FDIA 1SFCC 2Y9YA 1OW6A 4NPDA 1G1JA 1FJKA 1HGZA 2ZYGA 2QM7A 3I56P 3GHGC 2XKMA 1HF9A 2JKVA 3H1JJ 3OA7A 3FXEA 4AQRD 3AECC 2R3SA 1VQ4P 1AVOA 1SQPD 2WSCH 3JCUH 2R3CA 2WPQA 2WWWA 1SQXG 3JCUE 5KJ7D 1LTAC 1W5CE 3NTNA 1X8YA 1LT9C 1NTKE 5KKZC 1SQVK 4H13D 2PP6A 4D6TJ 3FWLA 5L8RJ 3CWBJ 2WTYA 2J58A 2BCCE 2IYOA 1KILD 4ZKUA 5CBNA 3SWYA 2OYHB 4DOJA 1KYOI 1SQQG 2J59M 1GL2D 3L72J 5BVZA 1FBMA 3U59A 1J2JB 1A02F 3CI9A 3CLQA 1FC2C 1KFMA 2FYUE 1NTMD 1Y8AA 1G2CA 1RF1B 3AE6C 1RF0A 1JCDA 1BSNA 1FDOA 1URQC 3B5ND 2QVAA 4A7PA 1VQ9P 5AW5B 1P84D 1VF5D 2C9NY 4BWNA 3C1LA 5KLIC 3BCCG 2KZJA 2QJKC 1SQQK 4HH2A 1YIJP 3FGAD 2YMKA 3M91A 4PJ0E 5KJ7C 2YNYA 4YXDC 1PP9D 3HRNA 1NYHA 1ZOYC 4YXWH 3RK3B 2QM8A 1ZXGA 2E74C 1RE3A 3VMZA 1KYOH 2H7HA 1RQUA 1W2BO 2ZT9D 1KYOE 3RK2B 1PGPA 2R5BA 1RHZB 1NTKK 1M1JB 4ASWA 3MGNA 2IYPA 1JY2O 5AVRB 1XTCC 1GL2C 1N7SA 3I55P 3H1ID 2QG4A 5K5GB 4OGQB 1T3JA 2HPCB 1JTHB 4I6MC 2N1TB 5AW2B 4R4MA 1SQVJ 2V7QH 4PD4I 4H0LD 4L75A 2JO1A 3KQGA 4Y28J 3B5NC 3MZWB 1L0LD 4HB1A 2Z5IA 1EDLA 3H1HE 1L0NG 1VF5C 2FYUK 5E79H 2OTKE 1KB9I 3JSVC 5E79E 5TJHA 5APVA 1VPCA 1S5LE 3L73E 1YHQP 1NTZG 2HG5D 3KHUA 1Q86Q 2OTLP 2NPSA 3RL0D 3SFEC 3E7KA 2PGDA 3L74J 2KSJA 4EOTA 5APQA 2ZT9C 1H88A 3VTPC 2JWDA 1S9KE 3G3ZA 1PPJE 2M3BA 1KFNA 4W7YA 1LTTC 1L0NK 2ZXXA 2E5YA 3PHLA 4GIFA 3AEEC 3HTKA 2M5AA 1AA0A 3H1JD 1IJDB 1UIXA 4U7JA 4ZNCA 4PD4H 3H6PA 3P8CE 4N3YB 1OW8A 4PD4E 1KMIZ 1JUNA 2VRSA 5KAFH 1NTZK 1A02J 3V2QA 2WSCJ 1MUUA 5KAFE 1YQ4C 2WITA 3AE7C 3H1KE 1H0TB 1KB9H 2ZAEB 2OGUA 1KB9E 4H0LC 3CCJP 4C7RA 4D6TD 1KILA 3CWBD 2ZVNB 5AVVB 1QEXA 1NTKJ 1K8AQ 1LWUA 2AXTH 1SFCB 5CMZA 2FFDA 1OIPA 4KHXA 2AXTE 2BCCJ 2G8YA 2E76C 1L0LG 3K5BA 5AW6B 3EFGA 1U7JA 2SPZA 3GHGB 3V2NA 2H89C 2Q1KA 1IFMA 2H43A 4RESB 1KQLA 1NU1G 3L72D 2FXPA 1N86A 1L4AA 1OVRA 2IZ0A 1ZMEC 1T6AA 2XDJA 1HJBA 3L35A 1SQBG 1H89A 5KLVG 1LT9B 2I8DA 1BGYE 4M3LA 2FYUJ 4LLHA 4RKUJ 3VMAA 3L70G 4K3AA 1RE4A 1EDKA 5KTBA 5AVZB 4B86A 1NH4A 3CXHD 5CJ0A 3GMAA 1NU1K 3U1CA 2O01N 1GD2E 3WUVA 1LGHB 3D71A 3L36A 1BDCA 4N78D 2YO2A 3CWBG 1GZLA 1SLQA 2UWJE 4L73A 1KQSO 5AVTB 2DW3A 3HUSC 4U3FE 1LT1A 2M8RA 5KLIB 2ZFCA 4OWFA 5CBOA 2OQQA 2OYHA 2FYNB 2A45G 2FXMA 1SQVD 2AEFA 2IBZG 5APUA 1QLED 1FZEA 4EDFA 1GDTA 3AEAC 1FS0E 3M9HA 1BSHA 4JYBA 4C7NB 4GKGA 2V7QJ 4EIJA 2B88A 3L75G 2OYIA 3KDPB 3VOPA 4IL6E 3H1HJ 5AW8B 2QJYC 1LWUB 3LIDA 2KP8A 3VMXA 3WUTA 1RF1A 1ZRTD 3SSUA 1KTMA 3TGUG 2V4HA 1GL2B 3L73J 1J1DC 4IOIH 1KORA 1FZGA 2JEEA 4I7ZC 2W27A 1H8AA 5APYA 3A3YB 2Q9IA 2JWAA 3L74D 4AUWA 3H32B 3N7NA 5AVXB 5APXA 1SQXE 3BASA 1ZN5A 4ASVA 1D7MA 5AW9B 3AE3C 4QMAA 3B5NB 2KIKA 2XNXA 1VF5B 1PZQA 2WVRA 2POHA 2Q3EA 3CC7P 1M1JA 3A7OA 2PRRA 3CCLP 5EFWB 1VQ5P 1JM0A 2B87B 4JQ0D 2W83C 3A0BH 3TYYA 1N73C 4XE5B 3R4YA 2K9YA 1M7LA 3D6YA 3CX5I 3H1KJ 1R5LA 1Y47A 2A06G 3SFDC 4EYYQ 1SQQE 1URQD 2E5TA 1NTKD 3M0DA 1FE6A 2HPCA 1JB0J 1JTHA 1EZVG 2YMYA 3U1AA 3EWKA 2ZT9B 2KLVA 2N1TA 2C0XA 1QL2A 2BCCD 3C8VA 4TLFA 3EQ2A 2ZJSE 2ZYAA 5APSA 3V6IA 1OMIA 3H1LG 2FBWC 2E74D 3R2PA 2L91A 2OYOA 4I1LA 3MUDC 2RH0A 3KPEA 3BCCE 3GF3A 1HBWA 1JO5A 1VQPP 2FYUD 1K05A 1BE3G 4H0LB 4H44D 1BGYJ 3GW6A 2ZXEB 1MKMA 1SQXK 2YIUC 1FDMA 1JY2P 2XNDH 3VYIA 3CX5H 5TISH 2G3AA 1S5LX 2Y0DA 2OYIB 4R4LA 3CX5E 5B5EH 5TISE 1S72P 5B5EE 2R44A 1MV8A 3CCVP 1YQ3C 2QSIA 3RL0B 1T2KC 2BEZF 2HR3A 5GTHH 3AE4C 1FOSE 4JYCA 3RL0g 1ZLLA 5GTHE 1T8ZA 2FKWB 3HD7D 1OXZA 1H0TA 5CCHA 1KYOD 1IK9A 4O9BA 1TU3F 3AE5C 1ZV8A 3LW5H 1SQPG 2WMMA 2I1JA 4PV1D 1VDFA 2WSSH 5CCGC 2BCCG 2WSEJ 2H88C 1Q81Q 1EC5A 1SFCA 2C9LY 1L0NE 4U3FJ 5H2FH 3GHGA 3JC22 4HKZH 5H2FE 2E43A 1FZBA 3B71A 2M0BA 2P10A 5DJTB 3G6EP 3WUUA 4H44C 4UB8H 1S2EA 1NTZE 3CMAP 3FXDA 1YI2P 4WY4D 4UB8E 1JY3N 3H1HD 3L71E 4YTPC 1Q2NA 1LT9A 2W8ZA 3B8EB 4OVNF 3B4SA 3E1IA 1LTJC 3S4RA 4WWIA 1LTBC 3CCUP 3L73D 1GTWA 1FZFA 3MD0A 3HUSB 2IDBA 2D2CD 2OTJP 4Y99B 1OFCX 1NWQA 1NTMG 3SWFA 2KK7A 1ZW0A 2YKQA 1NAFA 1U7MA 2RMZA 3HD7C 2E76D 3OAKA 1HH0A 1OVVA 1X0TA 4BXLA 2LKMA 1SQXJ 3IR9A 1S9KD 1PPJD 1SP4A 2GUVA 2O1KA 2QJPC 1FZCC 1S3JA 4PV1C 3TSIA 1YJ9P 1NGMB 1U57A 2P67A 2QJYB 3GG2A 1PP9G 2KI7B 3P8CD 4IFDK 4LGDE 1ZR2A 4PD4D 1PGJA 1URQA 3PP5A 3BRTB 2RKLA 2W90A 2O1JA 1J1DB 3H1KD 1IC2A 3PJSK 2P1JA 1NU1E 3ITKA 1DD4A 1YTZT 1SQQJ 1KB9D 4C46A 4WY4C 3D6ZA 3CCMP 4XA4A 2YXRB 3HE4A 5KJ7A 3T97B 3V4QA 2QA4P 3D70A 3V2PA 3H1IG 1SQBE 4C7NA 1FAVA 2PAJA 5KLVE 2NZ2A 1DX7A 2IBZI 2K9JA 2D2CC 3TNUA 2C0WA 2WPRA 3L70E 5C39A 3MHVA 3PLNA 4XFJA 1CSBA 1X79B 1CZQA 1MZ9A 3CMEP 3O8ZA 3RK3E 1GL2A 3BCCJ 3W67A 1RY3A 1UIIA 1E5WA 1AQTA 1VQOP 1AQ5A 5AW4B 1BGYD 1KQGB 4IL6X 2FY8A 1JMBA 1WRGA 4NPFX 1S4XA 1HTLC 1MFZA 3H32A 2AXCA 1NVOA 2CPBA 2KXPB 3QH9A 4K35A 1VQMP 2YKOA 3B5NA 3OJAB 2P58A 1VL2A 5KKZB 2KNCB 1LP1B 2Z5HA 1X22A 3BATA 1KQFB 2L5GB 1L0LK 1FU1A 2AEMA 2B87A 3H1KG 2WPSA 3P7KA 2HLOA 2A45H 1QL1A 3H1JG 1ZR4A 4WBAA 1K04A 3M06A 3GF7A 2IBZE 1KC8Q
chains in the Genus database with same CATH topology
4HB1A 1EDLA 2UWJE 2KUBA 2LXCB 2KIKA 2QVAA 2OTKE 1EDJA 1Q2NA 1OVUA 2KS1B 1U7JA 4HJGH 2SPZA 1BDDA 1DEEG 3FXEA 2Q1KA 2K3RA 2KZJA 4WWIA 1LT1A 3RGUA 5EFWB 3ZDMA 2R44A 5CBOA 5C39A 1JM0A 2B87B 4GOFA 3PH0A 3MHVA 1OVRA 4GOEA 5DJUB 4CPGA 1Y47A 2HR3A 4EYYQ 1ZW0A 1U7MA 1ZXGA 1LP1A 1OVVA 1X0TA 4BXLA 2I8DA 4NPEA 1JMBA 4NPFX 2JWDA 1H0TA 2B88A 2KZIA 1SS1A 1S3JA 1NVOA 4MN4C 2QRXA 2WMMA 5CBNA 4ASWA 4K3AA 2M5AA 2LXBA 1EC5A 4JBZA 1EDKA 4K35A 4KJMA 4ZNCA 2KI7B 4GODA 2P58A 3QWOC 1EDIA 4ZMDA 5K5GB 4IOIH 4HKZH 1LP1B 2RKLA 4ASVA 1H0TB 2M0BA 2ZAEB 5DJTB 2B87A 3S1KA 1BDCA 1FC2C 3FXDA 2LR2A 2M5AB 2B89A 4NPDA 1MFTA 3MZWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HB1 A;  1EDL A;  2UWJ E;  2KUB A;  2LXC B;  2KIK A;  2QVA A;  2OTK E;  1EDJ A;  1Q2N A;  1OVU A;  2KS1 B;  1U7J A;  4HJG H;  2SPZ A;  1BDD A;  1DEE G;  3FXE A;  2Q1K A;  2K3R A;  2KZJ A;  4WWI A;  1LT1 A;  3RGU A;  5EFW B;  3ZDM A;  2R44 A;  5CBO A;  5C39 A;  1JM0 A;  2B87 B;  4GOF A;  3PH0 A;  3MHV A;  1OVR A;  4GOE A;  5DJU B;  4CPG A;  1Y47 A;  2HR3 A;  4EYY Q;  1ZW0 A;  1U7M A;  1ZXG A;  1LP1 A;  1OVV A;  1X0T A;  4BXL A;  2I8D A;  4NPE A;  1JMB A;  4NPF X;  2JWD A;  1H0T A;  2B88 A;  2KZI A;  1SS1 A;  1S3J A;  1NVO A;  4MN4 C;  2QRX A;  2WMM A;  5CBN A;  4ASW A;  4K3A A;  2M5A A;  2LXB A;  1EC5 A;  4JBZ A;  1EDK A;  4K35 A;  4KJM A;  4ZNC A;  2KI7 B;  4GOD A;  2P58 A;  3QWO C;  1EDI A;  4ZMD A;  5K5G B;  4IOI H;  4HKZ H;  1LP1 B;  2RKL A;  4ASV A;  1H0T B;  2M0B A;  2ZAE B;  5DJT B;  2B87 A;  3S1K A;  1BDC A;  1FC2 C;  3FXD A;  2LR2 A;  2M5A B;  2B89 A;  4NPD A;  1MFT A;  3MZW B; 
#chains in the Genus database with same CATH topology
 1VQL P;  2JP3 A;  3VP8 A;  1EDJ A;  2YIU B;  3AEG C;  2Y0C A;  4HJG H;  3LW5 J;  1USD A;  2B9B A;  2Q5U A;  1SQB K;  3L75 E;  4U3F D;  5KLV K;  1IFJ A;  3MIW A;  2K37 A;  1GU5 A;  3L37 A;  1M56 D;  1L0N J;  4DZO A;  3SWK A;  4D6T G;  4HYT B;  2M3E A;  1CI6 B;  3KZI H;  1EZV I;  1VQ7 P;  3KYQ A;  3GLM A;  4CPG A;  2KLU A;  1BCC E;  1URQ B;  3TGU E;  5BU8 B;  1NTZ J;  4NPE A;  2KS1 A;  2E75 D;  1AVY A;  2Z4E A;  2QJK B;  2KZI A;  2XZR A;  4OH8 B;  1AJY A;  2Y9Z A;  2Q7C A;  2QRX A;  3L72 G;  3HE4 B;  3L71 J;  2RN0 A;  1M8O B;  4JBZ A;  1AV1 A;  4KJM A;  1IO4 A;  2FXO A;  3V4W A;  1J1E C;  1LTS C;  3RBX A;  2E74 B;  2CK3 H;  3A2A A;  3MP7 B;  3AE1 C;  4L74 A;  1DH3 A;  2K9J B;  2OAR A;  3TNU B;  5GTI H;  1OZH A;  3P8M C;  2KYV A;  1JCC A;  3M9B A;  5AW7 B;  5GTI E;  1SQX D;  2WT7 A;  4H44 B;  1YIT P;  3RBZ A;  3NMD A;  4Z1M H;  2A06 E;  4W7Z A;  1PGQ A;  1N7S D;  2BAS A;  2HOD B;  3S9O A;  4RO0 A;  1EZV E;  1DEE G;  3AE8 C;  3RGU A;  1LTJ B;  5CJ4 A;  1KN7 A;  4BRY B;  2IPP A;  2KOG A;  3A5T A;  3A0H H;  4GOE A;  5DJU B;  1IFI A;  3A0H E;  1SQQ D;  1RF0 C;  3H1L E;  1Q82 Q;  1NU1 J;  2E75 C;  3HD7 B;  2I1K A;  3IAO A;  4UB6 H;  2BEQ D;  2QJP B;  1FZC B;  4PV1 B;  1SQB J;  5AVY B;  3A0B E;  5KLV J;  1M90 Q;  1BE3 E;  1T2K D;  1SQV G;  2NPS D;  1N8R Q;  1LTI C;  3WU2 H;  1R8E A;  1YTZ I;  3G9R A;  2IX7 C;  1E79 H;  1RE3 C;  3CPW O;  1M1K Q;  3EFF K;  3WU2 E;  3L70 J;  2QIW A;  4JPZ B;  1GK6 A;  1GK4 A;  3BCC D;  3HUS A;  5CCG D;  4WY4 B;  1Q7Y Q;  1N7S C;  1PL5 A;  1GMJ A;  1OVU A;  2KS1 B;  1XTG B;  1LNQ A;  1HGV A;  3CX5 D;  1JY3 O;  4WB4 A;  2K3R A;  3L74 G;  1JEK A;  3VMY A;  1DEB A;  2R5D A;  1SQP E;  4LC1 A;  4GOF A;  3V2R A;  2D2C B;  4DT0 A;  1P84 I;  2YKP A;  4AYC A;  3Q1M A;  1G1I A;  3CC2 P;  1WMK A;  3M0A A;  3L4F A;  2K1A A;  3M9Q A;  1QVF O;  2E76 B;  2H8P D;  5AVS B;  3CD6 P;  4MN4 C;  2WT7 B;  1KIL E;  1SVF A;  3T97 A;  2NPS C;  1L4A D;  1HWT C;  4EI2 A;  3L75 J;  1L0N D;  2JR8 A;  1EDI A;  4ZMD A;  1NTK G;  1CW5 A;  3O6Q A;  1VQN P;  1HJ0 A;  1OW7 A;  2YO3 A;  1BCC J;  2HYN A;  3FX0 A;  3TGU J;  1NTZ D;  1IFP A;  4PJ0 H;  5B66 H;  2FYN C;  2K88 A;  1N73 A;  1NTM E;  4KT0 J;  2GA1 A;  5B66 E;  1P84 H;  2R32 A;  3L71 D;  2GUS A;  2ZVO B;  2WSF H;  1P84 E;  3CCR P;  4H13 C;  2XU6 A;  2N9Y B;  4DJG A;  3CCS P;  3AE9 C;  1KIL C;  1PGO A;  1FOS F;  1AFO A;  2FYU G;  1LWU C;  1GU4 A;  1PP9 E;  1SQP K;  2FFD C;  2W6A A;  4RJT A;  1KZU B;  2KNC A;  1KD1 Q;  3TK1 A;  1LP1 A;  1DD3 A;  1WT6 A;  3CCQ P;  3AEF C;  2Q6Q A;  3MUD A;  1L2P A;  1OX3 A;  3CL3 D;  3Q5P A;  1L4A C;  3G4S P;  3H25 A;  1IK7 A;  5AW0 B;  1N7L A;  3BVH A;  3H1I E;  1W2E A;  1YJW P;  3QWO C;  1J1E B;  2PFX A;  5APT A;  2CPS A;  2J5U A;  1OWA A;  1NO4 A;  4TT3 H;  2O01 H;  1NU1 D;  1YJN P;  2KB7 P;  4YPC A;  1T3U A;  2MKV A;  1S5L H;  2P7J A;  3H1L J;  1RE4 C;  5AVW B;  1CI6 A;  1NJI Q;  3Q2Y A;  1S1C X;  1KV4 A;  1L0L E;  3BRV B;  1HUC A;  2IFM A;  1SQB D;  2LXC B;  1IFD A;  5KLV D;  1NTM K;  4I7Z B;  3OW2 O;  3L71 G;  1GW4 A;  3IFM A;  1BE3 J;  3L70 D;  3IN6 A;  2WPV B;  5CCG A;  1GW3 A;  2YXQ B;  3AEB C;  2IFN A;  3LIE A;  1G2C B;  3RK3 D;  3H1H G;  1NOH A;  1PFI A;  1LJ2 A;  1PV3 A;  2A45 I;  1IFN A;  3MTU E;  3O6Q B;  1VQK P;  3II6 A;  1EQ7 A;  2E75 B;  1JY2 N;  3RK2 D;  2ITA A;  1K73 Q;  2WQY C;  3L73 G;  1FJP A;  2OYH C;  1RQV A;  2MJZ A;  1EXJ A;  1N73 B;  2LXB A;  1QVG O;  3H1J E;  2HOD A;  5KAI H;  2W6J H;  2O3J A;  5BU5 A;  1SQP J;  5KAI E;  4OGQ D;  1PPJ G;  2OYI C;  1LTJ A;  3P32 A;  3F89 A;  2N1T D;  4BRY A;  3HE5 A;  2W6B A;  3CXH I;  1NKN A;  2E42 A;  4D6T E;  3CWB E;  3C9I A;  2GM4 A;  2LR2 A;  1RF1 C;  1QX8 A;  1R5S A;  1USE A;  2IBZ D;  3TDK A;  2JJL A;  3RL0 C;  3NXS A;  3FWN A;  4JF7 A;  1N7S B;  1N2D C;  1EXI A;  1DIP A;  1HVV A;  3HD7 A;  3IF4 A;  1M57 D;  3Q5S A;  3L75 D;  2HFE D;  1Z56 A;  1FZA A;  1FZC A;  3N4X A;  3ZDM A;  3L72 E;  3PH0 A;  3VP9 A;  2JDI H;  4I2L C;  3V5B A;  3E1R A;  3RK3 C;  1BCC D;  2WZ7 A;  3WMM 0;  3TGU D;  3RK2 C;  1QGK B;  1NHL A;  1LTG C;  2ZYD A;  1SS1 A;  1NTM J;  1M1J C;  1YYC A;  4L76 A;  1JNM A;  2FYZ A;  4WY4 A;  3Q5R A;  1PIX A;  1VQ8 P;  3KZI E;  4GT1 A;  5AVU B;  3CXH H;  2NPS B;  2WSF J;  2QEX P;  1Y9B A;  4GOD A;  3CXH E;  3M0D C;  4OGQ C;  1IZN B;  2WSE H;  5M1B A;  3AED C;  1BGY G;  1RH5 B;  2N1T C;  2P2U A;  4DCK A;  1PP9 J;  5CCH D;  1NAY A;  3TF5 A;  5AW3 B;  2KSE A;  4W80 A;  4N6J A;  3PRJ A;  4N78 E;  4Y99 C;  3HTK B;  2M5A B;  2B89 A;  2QE7 H;  1MFT A;  1SFC D;  2A06 D;  2KUB A;  3G71 P;  3NFQ A;  2Q3I A;  1YBK A;  1EZV D;  1BDD A;  5AVQ B;  1K9M Q;  3Q3D A;  4H13 B;  2XV5 A;  3KXD A;  3I5C A;  3F5H A;  4IL6 H;  3H1I J;  4WVZ A;  2NRG A;  1KIL B;  1ZP0 C;  3CCE P;  1VQ6 P;  1SQV E;  4GDO A;  3VN0 A;  3H1L D;  3UIA A;  1NKZ B;  2FFD B;  4IFF A;  2O01 J;  1BCC G;  4IFM A;  2N9B A;  3HE5 B;  4U3F G;  3ABV C;  1L0L J;  1JY3 P;  5AW1 B;  5APW A;  1X9V A;  1BE3 D;  5CHX A;  2Y0E A;  1L4A B;  3W68 A;  1ZRT E;  3CC4 P;  3AE2 C;  3PTZ A;  4ZKP A;  2AEJ A;  5CCH C;  3USS A;  1JOC A;  4UB6 E;  2IZ1 A;  3L74 E;  3S1K A;  1JMM A;  1Q90 D;  1FDI A;  1SFC C;  2Y9Y A;  1OW6 A;  4NPD A;  1G1J A;  1FJK A;  1HGZ A;  2ZYG A;  2QM7 A;  3I56 P;  3GHG C;  2XKM A;  1HF9 A;  2JKV A;  3H1J J;  3OA7 A;  3FXE A;  4AQR D;  3AEC C;  2R3S A;  1VQ4 P;  1AVO A;  1SQP D;  2WSC H;  3JCU H;  2R3C A;  2WPQ A;  2WWW A;  1SQX G;  3JCU E;  5KJ7 D;  1LTA C;  1W5C E;  3NTN A;  1X8Y A;  1LT9 C;  1NTK E;  5KKZ C;  1SQV K;  4H13 D;  2PP6 A;  4D6T J;  3FWL A;  5L8R J;  3CWB J;  2WTY A;  2J58 A;  2BCC E;  2IYO A;  1KIL D;  4ZKU A;  5CBN A;  3SWY A;  2OYH B;  4DOJ A;  1KYO I;  1SQQ G;  2J59 M;  1GL2 D;  3L72 J;  5BVZ A;  1FBM A;  3U59 A;  1J2J B;  1A02 F;  3CI9 A;  3CLQ A;  1FC2 C;  1KFM A;  2FYU E;  1NTM D;  1Y8A A;  1G2C A;  1RF1 B;  3AE6 C;  1RF0 A;  1JCD A;  1BSN A;  1FDO A;  1URQ C;  3B5N D;  2QVA A;  4A7P A;  1VQ9 P;  5AW5 B;  1P84 D;  1VF5 D;  2C9N Y;  4BWN A;  3C1L A;  5KLI C;  3BCC G;  2KZJ A;  2QJK C;  1SQQ K;  4HH2 A;  1YIJ P;  3FGA D;  2YMK A;  3M91 A;  4PJ0 E;  5KJ7 C;  2YNY A;  4YXD C;  1PP9 D;  3HRN A;  1NYH A;  1ZOY C;  4YXW H;  3RK3 B;  2QM8 A;  1ZXG A;  2E74 C;  1RE3 A;  3VMZ A;  1KYO H;  2H7H A;  1RQU A;  1W2B O;  2ZT9 D;  1KYO E;  3RK2 B;  1PGP A;  2R5B A;  1RHZ B;  1NTK K;  1M1J B;  4ASW A;  3MGN A;  2IYP A;  1JY2 O;  5AVR B;  1XTC C;  1GL2 C;  1N7S A;  3I55 P;  3H1I D;  2QG4 A;  5K5G B;  4OGQ B;  1T3J A;  2HPC B;  1JTH B;  4I6M C;  2N1T B;  5AW2 B;  4R4M A;  1SQV J;  2V7Q H;  4PD4 I;  4H0L D;  4L75 A;  2JO1 A;  3KQG A;  4Y28 J;  3B5N C;  3MZW B;  1L0L D;  4HB1 A;  2Z5I A;  1EDL A;  3H1H E;  1L0N G;  1VF5 C;  2FYU K;  5E79 H;  2OTK E;  1KB9 I;  3JSV C;  5E79 E;  5TJH A;  5APV A;  1VPC A;  1S5L E;  3L73 E;  1YHQ P;  1NTZ G;  2HG5 D;  3KHU A;  1Q86 Q;  2OTL P;  2NPS A;  3RL0 D;  3SFE C;  3E7K A;  2PGD A;  3L74 J;  2KSJ A;  4EOT A;  5APQ A;  2ZT9 C;  1H88 A;  3VTP C;  2JWD A;  1S9K E;  3G3Z A;  1PPJ E;  2M3B A;  1KFN A;  4W7Y A;  1LTT C;  1L0N K;  2ZXX A;  2E5Y A;  3PHL A;  4GIF A;  3AEE C;  3HTK A;  2M5A A;  1AA0 A;  3H1J D;  1IJD B;  1UIX A;  4U7J A;  4ZNC A;  4PD4 H;  3H6P A;  3P8C E;  4N3Y B;  1OW8 A;  4PD4 E;  1KMI Z;  1JUN A;  2VRS A;  5KAF H;  1NTZ K;  1A02 J;  3V2Q A;  2WSC J;  1MUU A;  5KAF E;  1YQ4 C;  2WIT A;  3AE7 C;  3H1K E;  1H0T B;  1KB9 H;  2ZAE B;  2OGU A;  1KB9 E;  4H0L C;  3CCJ P;  4C7R A;  4D6T D;  1KIL A;  3CWB D;  2ZVN B;  5AVV B;  1QEX A;  1NTK J;  1K8A Q;  1LWU A;  2AXT H;  1SFC B;  5CMZ A;  2FFD A;  1OIP A;  4KHX A;  2AXT E;  2BCC J;  2G8Y A;  2E76 C;  1L0L G;  3K5B A;  5AW6 B;  3EFG A;  1U7J A;  2SPZ A;  3GHG B;  3V2N A;  2H89 C;  2Q1K A;  1IFM A;  2H43 A;  4RES B;  1KQL A;  1NU1 G;  3L72 D;  2FXP A;  1N86 A;  1L4A A;  1OVR A;  2IZ0 A;  1ZME C;  1T6A A;  2XDJ A;  1HJB A;  3L35 A;  1SQB G;  1H89 A;  5KLV G;  1LT9 B;  2I8D A;  1BGY E;  4M3L A;  2FYU J;  4LLH A;  4RKU J;  3VMA A;  3L70 G;  4K3A A;  1RE4 A;  1EDK A;  5KTB A;  5AVZ B;  4B86 A;  1NH4 A;  3CXH D;  5CJ0 A;  3GMA A;  1NU1 K;  3U1C A;  2O01 N;  1GD2 E;  3WUV A;  1LGH B;  3D71 A;  3L36 A;  1BDC A;  4N78 D;  2YO2 A;  3CWB G;  1GZL A;  1SLQ A;  2UWJ E;  4L73 A;  1KQS O;  5AVT B;  2DW3 A;  3HUS C;  4U3F E;  1LT1 A;  2M8R A;  5KLI B;  2ZFC A;  4OWF A;  5CBO A;  2OQQ A;  2OYH A;  2FYN B;  2A45 G;  2FXM A;  1SQV D;  2AEF A;  2IBZ G;  5APU A;  1QLE D;  1FZE A;  4EDF A;  1GDT A;  3AEA C;  1FS0 E;  3M9H A;  1BSH A;  4JYB A;  4C7N B;  4GKG A;  2V7Q J;  4EIJ A;  2B88 A;  3L75 G;  2OYI A;  3KDP B;  3VOP A;  4IL6 E;  3H1H J;  5AW8 B;  2QJY C;  1LWU B;  3LID A;  2KP8 A;  3VMX A;  3WUT A;  1RF1 A;  1ZRT D;  3SSU A;  1KTM A;  3TGU G;  2V4H A;  1GL2 B;  3L73 J;  1J1D C;  4IOI H;  1KOR A;  1FZG A;  2JEE A;  4I7Z C;  2W27 A;  1H8A A;  5APY A;  3A3Y B;  2Q9I A;  2JWA A;  3L74 D;  4AUW A;  3H32 B;  3N7N A;  5AVX B;  5APX A;  1SQX E;  3BAS A;  1ZN5 A;  4ASV A;  1D7M A;  5AW9 B;  3AE3 C;  4QMA A;  3B5N B;  2KIK A;  2XNX A;  1VF5 B;  1PZQ A;  2WVR A;  2POH A;  2Q3E A;  3CC7 P;  1M1J A;  3A7O A;  2PRR A;  3CCL P;  5EFW B;  1VQ5 P;  1JM0 A;  2B87 B;  4JQ0 D;  2W83 C;  3A0B H;  3TYY A;  1N73 C;  4XE5 B;  3R4Y A;  2K9Y A;  1M7L A;  3D6Y A;  3CX5 I;  3H1K J;  1R5L A;  1Y47 A;  2A06 G;  3SFD C;  4EYY Q;  1SQQ E;  1URQ D;  2E5T A;  1NTK D;  3M0D A;  1FE6 A;  2HPC A;  1JB0 J;  1JTH A;  1EZV G;  2YMY A;  3U1A A;  3EWK A;  2ZT9 B;  2KLV A;  2N1T A;  2C0X A;  1QL2 A;  2BCC D;  3C8V A;  4TLF A;  3EQ2 A;  2ZJS E;  2ZYA A;  5APS A;  3V6I A;  1OMI A;  3H1L G;  2FBW C;  2E74 D;  3R2P A;  2L91 A;  2OYO A;  4I1L A;  3MUD C;  2RH0 A;  3KPE A;  3BCC E;  3GF3 A;  1HBW A;  1JO5 A;  1VQP P;  2FYU D;  1K05 A;  1BE3 G;  4H0L B;  4H44 D;  1BGY J;  3GW6 A;  2ZXE B;  1MKM A;  1SQX K;  2YIU C;  1FDM A;  1JY2 P;  2XND H;  3VYI A;  3CX5 H;  5TIS H;  2G3A A;  1S5L X;  2Y0D A;  2OYI B;  4R4L A;  3CX5 E;  5B5E H;  5TIS E;  1S72 P;  5B5E E;  2R44 A;  1MV8 A;  3CCV P;  1YQ3 C;  2QSI A;  3RL0 B;  1T2K C;  2BEZ F;  2HR3 A;  5GTH H;  3AE4 C;  1FOS E;  4JYC A;  3RL0 g;  1ZLL A;  5GTH E;  1T8Z A;  2FKW B;  3HD7 D;  1OXZ A;  1H0T A;  5CCH A;  1KYO D;  1IK9 A;  4O9B A;  1TU3 F;  3AE5 C;  1ZV8 A;  3LW5 H;  1SQP G;  2WMM A;  2I1J A;  4PV1 D;  1VDF A;  2WSS H;  5CCG C;  2BCC G;  2WSE J;  2H88 C;  1Q81 Q;  1EC5 A;  1SFC A;  2C9L Y;  1L0N E;  4U3F J;  5H2F H;  3GHG A;  3JC2 2;  4HKZ H;  5H2F E;  2E43 A;  1FZB A;  3B71 A;  2M0B A;  2P10 A;  5DJT B;  3G6E P;  3WUU A;  4H44 C;  4UB8 H;  1S2E A;  1NTZ E;  3CMA P;  3FXD A;  1YI2 P;  4WY4 D;  4UB8 E;  1JY3 N;  3H1H D;  3L71 E;  4YTP C;  1Q2N A;  1LT9 A;  2W8Z A;  3B8E B;  4OVN F;  3B4S A;  3E1I A;  1LTJ C;  3S4R A;  4WWI A;  1LTB C;  3CCU P;  3L73 D;  1GTW A;  1FZF A;  3MD0 A;  3HUS B;  2IDB A;  2D2C D;  2OTJ P;  4Y99 B;  1OFC X;  1NWQ A;  1NTM G;  3SWF A;  2KK7 A;  1ZW0 A;  2YKQ A;  1NAF A;  1U7M A;  2RMZ A;  3HD7 C;  2E76 D;  3OAK A;  1HH0 A;  1OVV A;  1X0T A;  4BXL A;  2LKM A;  1SQX J;  3IR9 A;  1S9K D;  1PPJ D;  1SP4 A;  2GUV A;  2O1K A;  2QJP C;  1FZC C;  1S3J A;  4PV1 C;  3TSI A;  1YJ9 P;  1NGM B;  1U57 A;  2P67 A;  2QJY B;  3GG2 A;  1PP9 G;  2KI7 B;  3P8C D;  4IFD K;  4LGD E;  1ZR2 A;  4PD4 D;  1PGJ A;  1URQ A;  3PP5 A;  3BRT B;  2RKL A;  2W90 A;  2O1J A;  1J1D B;  3H1K D;  1IC2 A;  3PJS K;  2P1J A;  1NU1 E;  3ITK A;  1DD4 A;  1YTZ T;  1SQQ J;  1KB9 D;  4C46 A;  4WY4 C;  3D6Z A;  3CCM P;  4XA4 A;  2YXR B;  3HE4 A;  5KJ7 A;  3T97 B;  3V4Q A;  2QA4 P;  3D70 A;  3V2P A;  3H1I G;  1SQB E;  4C7N A;  1FAV A;  2PAJ A;  5KLV E;  2NZ2 A;  1DX7 A;  2IBZ I;  2K9J A;  2D2C C;  3TNU A;  2C0W A;  2WPR A;  3L70 E;  5C39 A;  3MHV A;  3PLN A;  4XFJ A;  1CSB A;  1X79 B;  1CZQ A;  1MZ9 A;  3CME P;  3O8Z A;  3RK3 E;  1GL2 A;  3BCC J;  3W67 A;  1RY3 A;  1UII A;  1E5W A;  1AQT A;  1VQO P;  1AQ5 A;  5AW4 B;  1BGY D;  1KQG B;  4IL6 X;  2FY8 A;  1JMB A;  1WRG A;  4NPF X;  1S4X A;  1HTL C;  1MFZ A;  3H32 A;  2AXC A;  1NVO A;  2CPB A;  2KXP B;  3QH9 A;  4K35 A;  1VQM P;  2YKO A;  3B5N A;  3OJA B;  2P58 A;  1VL2 A;  5KKZ B;  2KNC B;  1LP1 B;  2Z5H A;  1X22 A;  3BAT A;  1KQF B;  2L5G B;  1L0L K;  1FU1 A;  2AEM A;  2B87 A;  3H1K G;  2WPS A;  3P7K A;  2HLO A;  2A45 H;  1QL1 A;  3H1J G;  1ZR4 A;  4WBA A;  1K04 A;  3M06 A;  3GF7 A;  2IBZ E;  1KC8 Q; 
#chains in the Genus database with same CATH homology
 4HB1 A;  1EDL A;  2UWJ E;  2KUB A;  2LXC B;  2KIK A;  2QVA A;  2OTK E;  1EDJ A;  1Q2N A;  1OVU A;  2KS1 B;  1U7J A;  4HJG H;  2SPZ A;  1BDD A;  1DEE G;  3FXE A;  2Q1K A;  2K3R A;  2KZJ A;  4WWI A;  1LT1 A;  3RGU A;  5EFW B;  3ZDM A;  2R44 A;  5CBO A;  5C39 A;  1JM0 A;  2B87 B;  4GOF A;  3PH0 A;  3MHV A;  1OVR A;  4GOE A;  5DJU B;  4CPG A;  1Y47 A;  2HR3 A;  4EYY Q;  1ZW0 A;  1U7M A;  1ZXG A;  1LP1 A;  1OVV A;  1X0T A;  4BXL A;  2I8D A;  4NPE A;  1JMB A;  4NPF X;  2JWD A;  1H0T A;  2B88 A;  2KZI A;  1SS1 A;  1S3J A;  1NVO A;  4MN4 C;  2QRX A;  2WMM A;  5CBN A;  4ASW A;  4K3A A;  2M5A A;  2LXB A;  1EC5 A;  4JBZ A;  1EDK A;  4K35 A;  4KJM A;  4ZNC A;  2KI7 B;  4GOD A;  2P58 A;  3QWO C;  1EDI A;  4ZMD A;  5K5G B;  4IOI H;  4HKZ H;  1LP1 B;  2RKL A;  4ASV A;  1H0T B;  2M0B A;  2ZAE B;  5DJT B;  2B87 A;  3S1K A;  1BDC A;  1FC2 C;  3FXD A;  2LR2 A;  2M5A B;  2B89 A;  4NPD A;  1MFT A;  3MZW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...