2B87A

Structural basis for molecular recognition in an affibody:affibody complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
58
structure length
58
Chain Sequence
VDNKFNKELGWATWEIFNLPNLNGVQVKAFIDSLRDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ZTaq affibody
publication title Structural basis for molecular recognition in an affibody:affibody complex.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 20
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2005-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2b87A00
2M0BA 2UWJE 2K3RA 2LXBA 4KJMA 3ZDMA 1JMBA 1OVUA 1U7JA 1ZXGA 3S1KA 4GODA 2JWDA 1JM0A 2QRXA 2KS1B 3FXEA 5C39A 5DJUB 3FXDA 1LP1B 4GOFA 3RGUA 2M5AB 2KZJA 2LR2A 4BXLA 1Q2NA 4ZNCA 3PH0A 2B89A 2P58A 4GOEA 1BDCA 3MZWB 1Y47A 2ZAEB 1EDIA 4WWIA 5CBOA 2KI7B 2KUBA 1X0TA 4NPDA 4NPEA 1LT1A 4HJGH 2I8DA 1U7MA 1H0TA 4ASVA 2LXCB 1BDDA 5DJTB 1ZW0A 2HR3A 2B87A 1OVRA 1DEEG 1EC5A 4ASWA 2R44A 1H0TB 2B88A 2RKLA 4ZMDA 2OTKE 1FC2C 2Q1KA 1MFTA 4IOIH 5K5GB 4JBZA 2KIKA 4NPFX 4K35A 3MHVA 4HKZH 5CBNA 1EDJA 1S3JA 5EFWB 4EYYQ 2QVAA 1EDKA 2WMMA 2SPZA 4HB1A 4K3AA 1EDLA 1NVOA 4MN4C 1LP1A 2M5AA 4CPGA 1OVVA 3QWOC 1SS1A 2B87B 2KZIA
chains in the Genus database with same CATH superfamily
1OX3A 5GTHH 3D71A 3AEAC 3KQGA 5CCHD 1LP1B 2M5AB 1GDTA 4LLHA 2A45G 4HH2A 2PRRA 1BGYD 1VQ7P 1FZCA 3EWKA 3SFEC 3CLQA 4PD4H 3H1HG 3O6QB 1P84D 5CBOA 3H1HE 5BU8B 1YITP 2M3BA 3RL0D 2BASA 1DIPA 2LXCB 1GL2D 3CD6P 1OWAA 2ZVOB 4C7RA 1NTMD 2P2UA 1ZMEC 4ASWA 1QL2A 1A02F 2QSIA 4L73A 4BWNA 1SQVG 3EFFK 2Z5IA 2H7HA 5BVZA 4ZMDA 2Y0DA 3A3YB 1KQLA 2OYHB 4JPZB 1VF5C 4IL6H 1N7SC 2OYOA 1S72P 1PP9G 1SQBK 2OYIC 2WMMA 1CI6B 1M1JA 1HH0A 1PP9E 2QJYB 1DEBA 4H0LB 3L75D 3P8MC 1HGZA 1SQQG 3S4RA 1L0NJ 3L72D 1Y9BA 2FBWC 3VYIA 3N7NA 3L37A 3BCCJ 1KB9I 2QE7H 2WT7B 3EQ2A 4D6TG 1S9KE 3AEFC 2ZFCA 5CCGA 3FGAD 2IX7C 1XTCC 1S1CX 2W27A 2WSSH 3D70A 2IBZD 1EXJA 4OGQB 4A7PA 3L35A 3MTUE 1L0LK 5AW9B 1X0TA 3AE1C 3AEEC 2ZXXA 2WSCJ 2HPCB 1IC2A 3C1LA 2HODA 2WSFH 5AW5B 2E5TA 2ZT9D 1OVRA 2FFDB 2W90A 1JY3N 3AE7C 3A0HE 2KLUA 1LGHB 4H0LD 4U7JA 3TYYA 2E76C 2YO3A 2N1TB 3RK3D 1YIJP 5B66E 1BGYJ 4IFMA 2KSEA 1JEKA 1RF1A 1LT9B 4R4LA 1IK9A 3BASA 4TLFA 1JOCA 1SQXK 3E1RA 4W7YA 2WZ7A 2P67A 2O3JA 4N78E 3CWBE 3JSVC 1JO5A 3H25A 2H43A 4EI2A 2NPSC 4OWFA 3G9RA 1ZXGA 4YXDC 1NTKD 4GOFA 5CJ4A 1L4AB 1A02J 1PPJG 1NU1K 4O9BA 2RMZA 3V4QA 1N86A 1PPJE 3K5BA 3H1JG 3L70D 1KFNA 1SQPJ 3VP8A 2J58A 3IFMA 2A06D 1T6AA 3H1JE 3MZWB 2J59M 2QG4A 2N1TD 3HTKA 3V2QA 2JEEA 3V6IA 3L75J 2V4HA 2K9JB 3L72J 3CCUP 1MKMA 1NH4A 3B5NA 2FYUD 1NYHA 2Q6QA 3HUSB 4C46A 4DT0A 1QLED 1JY3P 3RK2C 4H44C 3T97B 2R5BA 3CMAP 4IOIH 4JQ0D 1VQ5P 2K88A 2BEZF 1K9MQ 3L74G 4JBZA 5B5EH 4KT0J 3HE5B 2G8YA 4HKZH 2RH0A 2YXQB 2Q3EA 1EDLA 3H1HD 4C7NB 3CCVP 3CCJP 4ZKPA 4PD4I 4EOTA 1BGYE 5KJ7A 1PV3A 3MGNA 3P32A 1VF5D 1QEXA 3GHGA 3OAKA 4PV1B 2M0BA 5AW1B 1N7SD 2K3RA 1G1IA 1NKNA 1QX8A 1JM0A 3SWFA 4WY4A 3Q2YA 5KTBA 2C0WA 4BXLA 3T97A 2GM4A 1SQVD 1RE4A 2C0XA 3A0HH 1SQBG 2RN0A 1KQGB 1E79H 2WWWA 1NTME 1AV1A 5B66H 1LJ2A 3R4YA 3OA7A 1PP9D 2V7QH 2I8DA 2L91A 1OXZA 2OGUA 1HJ0A 1S5LX 3SFDC 5APXA 1SQQD 3Q5SA 3KYQA 2GUVA 1FZCC 4M3LA 1NTKJ 5AW4B 3M9QA 1IFDA 3NTNA 5GTHE 3AEGC 1S9KD 1NTZJ 1S5LE 5KLVK 3I5CA 1MFTA 4D6TD 3L72E 1KQFB 1L0LG 3L70J 4N3YB 2XNDH 2QVAA 2PFXA 1BE3G 2Z4EA 2E76D 2WSFJ 1LTIC 2FXPA 3UIAA 2IBZE 1OVVA 2QA4P 4RJTA 2FYUJ 1VPCA 1FDMA 2E75B 4L74A 3G71P 3U1CA 2KZJA 3HRNA 2XKMA 2BCCG 4W7ZA 1KYOI 2B89A 3A0BE 2NPSD 5GTIH 2FKWB 1XTGB 1SQXG 2ZAEB 2KUBA 1ZOYC 3C9IA 4IL6E 3H1HJ 4HJGH 2Y0CA 3L71G 3RK3E 3TNUB 2ZYGA 2JO1A 2D2CC 2QM7A 1N73B 1URQA 2IZ0A 2YXRB 2HR3A 5CCGC 3Q1MA 1EC5A 1NU1G 1ZLLA 1EZVG 2AXCA 1BSHA 1GU4A 4JF7A 2OTKE 1YBKA 1PIXA 1PPJD 1SQVJ 1M90Q 3MHVA 4EYYQ 3H1JD 3GW6A 1PZQA 1NTKE 2I1JA 2XU6A 4HB1A 4BRYB 1FE6A 1PP9J 3RK2D 1GK4A 4H44D 2KNCA 1M1KQ 4U3FG 3PLNA 3H1LE 2B87B 3CC4P 3KHUA 3L70E 1NOHA 1ZN5A 1J1EB 3RL0B 5AW6B 2QJPC 2A06E 1GL2B 1SQQJ 2O01H 4I1LA 1RF1C 1YTZI 4YPCA 3N4XA 1T2KC 1BCCE 1L0NK 1Q2NA 2WVRA 3I55P 2JP3A 1OMIA 1SFCA 2FYUE 4OVNF 3L74D 1S5LH 3USSA 1KMIZ 5KKZB 1EDIA 5E79E 1K04A 5CJ0A 4NPDA 4IFDK 1Q86Q 1U7MA 2ITAA 1LTJB 4I6MC 2B87A 5AVUB 1VQNP 3CMEP 1AJYA 2FY8A 3TDKA 3AE9C 2BEQD 2R5DA 3MP7B 1IFJA 2HG5D 2R32A 3ITKA 2WPRA 1K8AQ 2M8RA 5KAFE 1RQUA 2V7QJ 3M91A 1SQBD 3H1KG 1ZR2A 3A0BH 1NVOA 3B5NC 1Y8AA 1IFNA 1W2BO 1LP1A 1JY2O 2M5AA 5AW0B 1RHZB 1SQVE 2H8PD 3CWBJ 4WBAA 5AVYB 3I56P 1SS1A 2KZIA 3IR9A 2Y9YA 2K1AA 3W67A 1T8ZA 3A5TA 3S1KA 2JWDA 1FZGA 2KS1B 5KLVG 1T3JA 2ZT9B 1G1JA 1HTLC 3U59A 3VMZA 3O6QA 1LTBC 2QJKC 3RL0g 3U1AA 3H1IG 3RK3B 4UB6E 1USEA 1SQQE 4EDFA 3M06A 5B5EE 3H1JJ 1YHQP 1L0LD 3GHGC 3AE6C 1IK7A 3PP5A 1BE3D 1LWUB 1LTSC 1H89A 4D6TE 1PGQA 1SQPK 3CXHD 1ZW0A 1AFOA 2OYHA 2AXTE 3CCEP 1RE4C 2G3AA 1YQ4C 1KORA 3C8VA 2B88A 1CI6A 2NZ2A 1YJNP 2D2CD 2LKMA 3V2PA 1T3UA 4NPFX 2FYZA 1FAVA 1W2EA 1EDJA 3TGUG 2KB7P 3L74J 2IDBA 4WVZA 2W6AA 2IYPA 3KXDA 1NKZB 3TGUE 4K3AA 3CCQP 1LNQA 1SQXD 2WT7A 2WSEH 2M3EA 1VQ6P 2O01N 5E79H 3VMAA 2GUSA 3CC2P 2QRXA 5APUA 5TISE 2A45H 2NRGA 1NU1D 3CX5D 1HBWA 1EZVD 3BATA 5CHXA 3WUUA 3M0AA 1EXIA 1D7MA 2HPCA 1NTMJ 1SQBJ 1R5SA 2FFDA 1PGJA 5KAFH 2HLOA 1KILE 1P84I 2CPBA 1H8AA 1T2KD 2WQYC 2E74C 3OJAB 2N1TA 2O01J 3H1LD 3HD7C 2XDJA 4ZKUA 1OZHA 1LT9A 1VF5B 3R2PA 1N7SB 2W83C 1VQ8P 1ZR4A 1X22A 1H0TB 2OYIB 1KILC 1RE3A 1BCCD 3PJSK 2XNXA 1N7LA 1WMKA 3L73G 1FZEA 3IF4A 1FBMA 1L0LJ 1NTZK 5APTA 5GTIE 2KK7A 2Y0EA 4UB6H 1BE3J 1L4AA 4CPGA 1HWTC 4PJ0E 1IZNB 1VQLP 1KD1Q 2W6BA 1KTMA 3BVHA 1OIPA 3A7OA 3L74E 1Q7YQ 1JB0J 1YYCA 4GODA 4DZOA 3B5ND 2AXTH 4L75A 4JYBA 4RKUJ 1USDA 4Z1MH 4EIJA 3HE4B 5L8RJ 2K9JA 2YNYA 1KZUB 1JY2N 3L36A 1AVYA 3PRJA 1MUUA 1IJDB 1Q90D 4NPEA 3HUSA 2FYNC 3H1KD 3P8CD 3NXSA 2E76B 2YIUC 1VDFA 3HE5A 3V2NA 5AVSB 5AW2B 1SQBE 1SFCC 2RKLA 3MD0A 3PHLA 1VQMP 1G2CB 5KLVD 4C7NA 5TISH 4QMAA 2DW3A 3HE4A 5EFWB 3H32B 1RF0A 2E42A 2NPSB 1VQPP 2POHA 2KXPB 3CC7P 1IFMA 1SQPG 4MN4C 2Q7CA 1YTZT 1YJWP 3QWOC 1K73Q 3H6PA 4Y99C 3KZIE 3H1LJ 2LXBA 4GDOA 1JMBA 5KLIC 1J1DC 3HD7B 4H13C 1CZQA 1JTHB 1L0LE 4WB4A 1AA0A 3LW5H 1BE3E 5TJHA 1KILB 4AYCA 1N8RQ 1BCCJ 1VQ9P 3CXHE 2P58A 2FXOA 4GKGA 2WSEJ 4AUWA 1WT6A 3TGUD 2R3CA 3FWNA 1JY2P 3WUVA 1QGKB 3WU2E 1M56D 2VRSA 2WITA 3IN6A 1GD2E 2KSJA 2WPQA 3RK2B 1BDDA 1M1JC 4H44B 1OW7A 2BCCE 3M0DA 1SP4A 1NJIQ 3AE3C 1NAYA 4PJ0H 1VQKP 2R44A 1X79B 1SQXE 5APVA 2Q1KA 5K5GB 2E74D 3V4WA 1PL5A 3MIWA 3HD7D 1FZAA 1AQ5A 3KDPB 3NMDA 2A45I 3L71E 4YTPC 3KPEA 3VOPA 2JDIH 2P1JA 2GA1A 1KILD 1NU1E 3B4SA 3CX5E 2OYHC 1EZVE 3H1KJ 2R3SA 1YJ9P 1GK6A 1KFMA 1KB9D 2AEJA 3JC22 4LGDE 5APYA 5DJUB 2IZ1A 3Q3DA 1GZLA 3SWYA 3GLMA 1M57D 3AECC 3PH0A 2HYNA 3RBZA 3TNUA 1QVGO 4U3FE 1N73A 1NTZG 1Q81Q 2QEXP 1Y47A 2K37A 2OQQA 4WWIA 3L73D 2HFED 1NO4A 1FZCB 1HJBA 4OGQC 4D6TJ 3BRTB 5CCHA 4TT3H 2CPSA 1FU1A 1KQSO 5AVQB 1CW5A 1JNMA 3KZIH 2YKOA 4BRYA 3V5BA 4AQRD 4XE5B 1KYOE 3Q5RA 5AW8B 5APSA 5M1BA 4Y28J 1HUCA 2KIKA 2FFDC 3L4FA 3VN0A 2C9NY 4I2LC 2I1KA 4DJGA 2N1TC 2SPZA 3NFQA 1DD4A 3OW2O 1GL2A 3TGUJ 1SFCD 3CXHH 3JCUE 5AVZB 5KAIH 3SWKA 1LT9C 3B8EB 3CPWO 2JR8A 5APQA 1FOSE 3WU2H 2CK3H 1M1JB 3G4SP 1X8YA 1VQOP 2IFMA 1RE3C 3GG2A 3GMAA 3VMYA 2AEFA 2LR2A 5AVVB 3H1KE 3CCSP 1YQ3C 3P8CE 2W6JH 2JKVA 1DX7A 2D2CB 4HYTB 1LTJA 1MV8A 1L4AC 4H13D 1NWQA 2PP6A 4RESB 2FXMA 4LC1A 4R4MA 5KLVE 2KP8A 3BRVB 3CCMP 1MFZA 4GT1A 1SQPD 2OARA 4YXWH 1NTMK 1S4XA 3CX5H 3LW5J 1M7LA 1FZFA 4W80A 1HVVA 2PGDA 3H1IE 5KJ7C 1DD3A 3B71A 1YI2P 5H2FE 2HODB 1EQ7A 1S2EA 1ZRTD 4WY4C 5CBNA 3HUSC 3AE2C 1LTAC 1S3JA 3ABVC 2L5GB 3L73J 4UB8E 2QJPB 2KS1A 4PD4D 5AVTB 2C9LY 1RF1B 1FDIA 2MKVA 2E5YA 1HGVA 5AVRB 3VTPC 2UWJE 2YKPA 2BCCD 5CCGD 1FDOA 3FXEA 3FXDA 2Z5HA 2YKQA 4I7ZC 1R8EA 1KN7A 1GW3A 3G3ZA 4PV1C 1RF0C 3MUDA 1Q82Q 2WTYA 1LWUA 4XFJA 2JWAA 3E1IA 1E5WA 3L71D 1KYOH 1VQ4P 1AQTA 1UIXA 2J5UA 1LT1A 3II6A 3M9HA 2O1KA 1BSNA 3V2RA 3JCUH 2ZYAA 3HTKB 3LIEA 5AVWB 1GMJA 1RH5B 4GIFA 1OW8A 2YMYA 3CWBG 1M8OB 3CCLP 4RO0A 4OGQD 3B5NB 2OTLP 3LIDA 3CI9A 1R5LA 2WPVB 1KB9E 4U3FD 1ZV8A 3QH9A 4KHXA 1NTZD 3F5HA 1L0NG 1DH3A 3M0DC 2O1JA 3BCCG 1L0NE 2QM8A 3W68A 2ZJSE 1JCCA 2QJKB 3WUTA 3BCCE 4KJMA 3ZDMA 1U7JA 2N9YB 3F89A 2Q3IA 2KLVA 1FJKA 1NTKK 5C39A 3L73E 1URQC 2ZYDA 1PGPA 2Q9IA 1KYOD 3GHGB 3AEBC 2XV5A 4ZNCA 3GF3A 5H2FH 2E75C 4WY4B 1PGOA 5AW7B 2ZXEB 1N7SA 5CMZA 3AE8C 1VL2A 5BU5A 1H0TA 2OYIA 3TK1A 1QVFO 4ASVA 2Y9ZA 2IBZI 1N2DC 3AEDC 4UB8H 1FOSF 2FYUK 3IAOA 3M9BA 3CXHI 1KC8Q 2BCCJ 1L4AD 3GF7A 1RQVA 1SVFA 1BGYG 1SLQA 2B9BA 1N73C 4I7ZB 1SQXJ 2KOGA 1LTTC 1AVOA 4K35A 2IPPA 3L71J 1P84E 2W8ZA 5KJ7D 5CCHC 1OFCX 3Q5PA 1L2PA 1NU1J 3TSIA 1NTMG 4WY4D 1OVUA 2YO2A 2WPSA 3SSUA 3TF5A 1J2JB 1NHLA 1NAFA 3CCRP 1W5CE 3H1ID 1QL1A 1JUNA 3FWLA 4XA4A 3AE4C 2Q5UA 3EFGA 2E43A 2P10A 3G6EP 3CX5I 1J1EC 3P7KA 3RL0C 1SQVK 1EZVI 1SQPE 1GL2C 2E74B 4U3FJ 3D6YA 3L75G 3RBXA 1GW4A 1JCDA 2K9YA 1KB9H 3L72G 3L75E 4PV1D 5APWA 1GU5A 1G2CA 1LTGC 4IFFA 1ZRTE 5DJTB 4DCKA 5KKZC 5KAIE 4JYCA 1SQQK 2AEMA 5AW3B 2IFNA 3VP9A 3H32A 2IBZG 1OW6A 2JJLA 2NPSA 4PD4E 1LTJC 1URQB 1FZBA 3PTZA 2YMKA 1EDKA 2P7JA 3HD7A 1JTHA 4L76A 1FS0E 1WRGA 4IL6X 1K05A 1IO4A 1CSBA 2PAJA 1KILA 2WSCH 1IFIA 3D6ZA 1MZ9A 1IFPA 3E7KA 1H88A 3RGUA 1GTWA 2KNCB 3O8ZA 1JY3O 1Z56A 4N78D 3CWBD 1FJPA 4DOJA 2FYNB 2MJZA 2ZT9C 4GOEA 1BDCA 2XZRA 4B86A 2QJYC 2YIUB 2H89C 4H0LC 2KI7B 3VMXA 1ZP0C 1URQD 1PFIA 1UIIA 3RK3C 1KV4A 5KLVJ 1P84H 2N9BA 1SFCB 1L0ND 1X9VA 1HF9A 1JMMA 1RY3A 4N6JA 2E75D 1NTKG 3BCCD 5AVXB 3AE5C 1DEEG 3MUDC 1LWUC 1NGMB 3H1IJ 2H88C 1NTZE 2QIWA 3H1LG 3FX0A 3L70G 1FC2C 4OH8B 2IYOA 3S9OA 3CL3D 2A06G 2ZVNB 4Y99B 2KYVA 3WMM0 1U57A 5KLIB 1BCCG 1J1DB 2OTJP 1TU3F 4H13B 3A2AA 2FYUG
chains in the Genus database with same CATH topology
2M0BA 2UWJE 2K3RA 2LXBA 4KJMA 3ZDMA 1JMBA 1OVUA 1U7JA 1ZXGA 3S1KA 4GODA 2JWDA 1JM0A 2QRXA 2KS1B 3FXEA 5C39A 5DJUB 3FXDA 1LP1B 4GOFA 3RGUA 2M5AB 2KZJA 2LR2A 4BXLA 1Q2NA 4ZNCA 3PH0A 2B89A 2P58A 4GOEA 1BDCA 3MZWB 1Y47A 2ZAEB 1EDIA 4WWIA 5CBOA 2KI7B 2KUBA 1X0TA 4NPDA 4NPEA 1LT1A 4HJGH 2I8DA 1U7MA 1H0TA 4ASVA 2LXCB 1BDDA 5DJTB 1ZW0A 2HR3A 2B87A 1OVRA 1DEEG 1EC5A 4ASWA 2R44A 1H0TB 2B88A 2RKLA 4ZMDA 2OTKE 1FC2C 2Q1KA 1MFTA 4IOIH 5K5GB 4JBZA 2KIKA 4NPFX 4K35A 3MHVA 4HKZH 5CBNA 1EDJA 1S3JA 5EFWB 4EYYQ 2QVAA 1EDKA 2WMMA 2SPZA 4HB1A 4K3AA 1EDLA 1NVOA 4MN4C 1LP1A 2M5AA 4CPGA 1OVVA 3QWOC 1SS1A 2B87B 2KZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M0B A;  2UWJ E;  2K3R A;  2LXB A;  4KJM A;  3ZDM A;  1JMB A;  1OVU A;  1U7J A;  1ZXG A;  3S1K A;  4GOD A;  2JWD A;  1JM0 A;  2QRX A;  2KS1 B;  3FXE A;  5C39 A;  5DJU B;  3FXD A;  1LP1 B;  4GOF A;  3RGU A;  2M5A B;  2KZJ A;  2LR2 A;  4BXL A;  1Q2N A;  4ZNC A;  3PH0 A;  2B89 A;  2P58 A;  4GOE A;  1BDC A;  3MZW B;  1Y47 A;  2ZAE B;  1EDI A;  4WWI A;  5CBO A;  2KI7 B;  2KUB A;  1X0T A;  4NPD A;  4NPE A;  1LT1 A;  4HJG H;  2I8D A;  1U7M A;  1H0T A;  4ASV A;  2LXC B;  1BDD A;  5DJT B;  1ZW0 A;  2HR3 A;  2B87 A;  1OVR A;  1DEE G;  1EC5 A;  4ASW A;  2R44 A;  1H0T B;  2B88 A;  2RKL A;  4ZMD A;  2OTK E;  1FC2 C;  2Q1K A;  1MFT A;  4IOI H;  5K5G B;  4JBZ A;  2KIK A;  4NPF X;  4K35 A;  3MHV A;  4HKZ H;  5CBN A;  1EDJ A;  1S3J A;  5EFW B;  4EYY Q;  2QVA A;  1EDK A;  2WMM A;  2SPZ A;  4HB1 A;  4K3A A;  1EDL A;  1NVO A;  4MN4 C;  1LP1 A;  2M5A A;  4CPG A;  1OVV A;  3QWO C;  1SS1 A;  2B87 B;  2KZI A; 
#chains in the Genus database with same CATH topology
 1OX3 A;  5GTH H;  3D71 A;  3AEA C;  3KQG A;  5CCH D;  1LP1 B;  2M5A B;  1GDT A;  4LLH A;  2A45 G;  4HH2 A;  2PRR A;  1BGY D;  1VQ7 P;  1FZC A;  3EWK A;  3SFE C;  3CLQ A;  4PD4 H;  3H1H G;  3O6Q B;  1P84 D;  5CBO A;  3H1H E;  5BU8 B;  1YIT P;  2M3B A;  3RL0 D;  2BAS A;  1DIP A;  2LXC B;  1GL2 D;  3CD6 P;  1OWA A;  2ZVO B;  4C7R A;  1NTM D;  2P2U A;  1ZME C;  4ASW A;  1QL2 A;  1A02 F;  2QSI A;  4L73 A;  4BWN A;  1SQV G;  3EFF K;  2Z5I A;  2H7H A;  5BVZ A;  4ZMD A;  2Y0D A;  3A3Y B;  1KQL A;  2OYH B;  4JPZ B;  1VF5 C;  4IL6 H;  1N7S C;  2OYO A;  1S72 P;  1PP9 G;  1SQB K;  2OYI C;  2WMM A;  1CI6 B;  1M1J A;  1HH0 A;  1PP9 E;  2QJY B;  1DEB A;  4H0L B;  3L75 D;  3P8M C;  1HGZ A;  1SQQ G;  3S4R A;  1L0N J;  3L72 D;  1Y9B A;  2FBW C;  3VYI A;  3N7N A;  3L37 A;  3BCC J;  1KB9 I;  2QE7 H;  2WT7 B;  3EQ2 A;  4D6T G;  1S9K E;  3AEF C;  2ZFC A;  5CCG A;  3FGA D;  2IX7 C;  1XTC C;  1S1C X;  2W27 A;  2WSS H;  3D70 A;  2IBZ D;  1EXJ A;  4OGQ B;  4A7P A;  3L35 A;  3MTU E;  1L0L K;  5AW9 B;  1X0T A;  3AE1 C;  3AEE C;  2ZXX A;  2WSC J;  2HPC B;  1IC2 A;  3C1L A;  2HOD A;  2WSF H;  5AW5 B;  2E5T A;  2ZT9 D;  1OVR A;  2FFD B;  2W90 A;  1JY3 N;  3AE7 C;  3A0H E;  2KLU A;  1LGH B;  4H0L D;  4U7J A;  3TYY A;  2E76 C;  2YO3 A;  2N1T B;  3RK3 D;  1YIJ P;  5B66 E;  1BGY J;  4IFM A;  2KSE A;  1JEK A;  1RF1 A;  1LT9 B;  4R4L A;  1IK9 A;  3BAS A;  4TLF A;  1JOC A;  1SQX K;  3E1R A;  4W7Y A;  2WZ7 A;  2P67 A;  2O3J A;  4N78 E;  3CWB E;  3JSV C;  1JO5 A;  3H25 A;  2H43 A;  4EI2 A;  2NPS C;  4OWF A;  3G9R A;  1ZXG A;  4YXD C;  1NTK D;  4GOF A;  5CJ4 A;  1L4A B;  1A02 J;  1PPJ G;  1NU1 K;  4O9B A;  2RMZ A;  3V4Q A;  1N86 A;  1PPJ E;  3K5B A;  3H1J G;  3L70 D;  1KFN A;  1SQP J;  3VP8 A;  2J58 A;  3IFM A;  2A06 D;  1T6A A;  3H1J E;  3MZW B;  2J59 M;  2QG4 A;  2N1T D;  3HTK A;  3V2Q A;  2JEE A;  3V6I A;  3L75 J;  2V4H A;  2K9J B;  3L72 J;  3CCU P;  1MKM A;  1NH4 A;  3B5N A;  2FYU D;  1NYH A;  2Q6Q A;  3HUS B;  4C46 A;  4DT0 A;  1QLE D;  1JY3 P;  3RK2 C;  4H44 C;  3T97 B;  2R5B A;  3CMA P;  4IOI H;  4JQ0 D;  1VQ5 P;  2K88 A;  2BEZ F;  1K9M Q;  3L74 G;  4JBZ A;  5B5E H;  4KT0 J;  3HE5 B;  2G8Y A;  4HKZ H;  2RH0 A;  2YXQ B;  2Q3E A;  1EDL A;  3H1H D;  4C7N B;  3CCV P;  3CCJ P;  4ZKP A;  4PD4 I;  4EOT A;  1BGY E;  5KJ7 A;  1PV3 A;  3MGN A;  3P32 A;  1VF5 D;  1QEX A;  3GHG A;  3OAK A;  4PV1 B;  2M0B A;  5AW1 B;  1N7S D;  2K3R A;  1G1I A;  1NKN A;  1QX8 A;  1JM0 A;  3SWF A;  4WY4 A;  3Q2Y A;  5KTB A;  2C0W A;  4BXL A;  3T97 A;  2GM4 A;  1SQV D;  1RE4 A;  2C0X A;  3A0H H;  1SQB G;  2RN0 A;  1KQG B;  1E79 H;  2WWW A;  1NTM E;  1AV1 A;  5B66 H;  1LJ2 A;  3R4Y A;  3OA7 A;  1PP9 D;  2V7Q H;  2I8D A;  2L91 A;  1OXZ A;  2OGU A;  1HJ0 A;  1S5L X;  3SFD C;  5APX A;  1SQQ D;  3Q5S A;  3KYQ A;  2GUV A;  1FZC C;  4M3L A;  1NTK J;  5AW4 B;  3M9Q A;  1IFD A;  3NTN A;  5GTH E;  3AEG C;  1S9K D;  1NTZ J;  1S5L E;  5KLV K;  3I5C A;  1MFT A;  4D6T D;  3L72 E;  1KQF B;  1L0L G;  3L70 J;  4N3Y B;  2XND H;  2QVA A;  2PFX A;  1BE3 G;  2Z4E A;  2E76 D;  2WSF J;  1LTI C;  2FXP A;  3UIA A;  2IBZ E;  1OVV A;  2QA4 P;  4RJT A;  2FYU J;  1VPC A;  1FDM A;  2E75 B;  4L74 A;  3G71 P;  3U1C A;  2KZJ A;  3HRN A;  2XKM A;  2BCC G;  4W7Z A;  1KYO I;  2B89 A;  3A0B E;  2NPS D;  5GTI H;  2FKW B;  1XTG B;  1SQX G;  2ZAE B;  2KUB A;  1ZOY C;  3C9I A;  4IL6 E;  3H1H J;  4HJG H;  2Y0C A;  3L71 G;  3RK3 E;  3TNU B;  2ZYG A;  2JO1 A;  2D2C C;  2QM7 A;  1N73 B;  1URQ A;  2IZ0 A;  2YXR B;  2HR3 A;  5CCG C;  3Q1M A;  1EC5 A;  1NU1 G;  1ZLL A;  1EZV G;  2AXC A;  1BSH A;  1GU4 A;  4JF7 A;  2OTK E;  1YBK A;  1PIX A;  1PPJ D;  1SQV J;  1M90 Q;  3MHV A;  4EYY Q;  3H1J D;  3GW6 A;  1PZQ A;  1NTK E;  2I1J A;  2XU6 A;  4HB1 A;  4BRY B;  1FE6 A;  1PP9 J;  3RK2 D;  1GK4 A;  4H44 D;  2KNC A;  1M1K Q;  4U3F G;  3PLN A;  3H1L E;  2B87 B;  3CC4 P;  3KHU A;  3L70 E;  1NOH A;  1ZN5 A;  1J1E B;  3RL0 B;  5AW6 B;  2QJP C;  2A06 E;  1GL2 B;  1SQQ J;  2O01 H;  4I1L A;  1RF1 C;  1YTZ I;  4YPC A;  3N4X A;  1T2K C;  1BCC E;  1L0N K;  1Q2N A;  2WVR A;  3I55 P;  2JP3 A;  1OMI A;  1SFC A;  2FYU E;  4OVN F;  3L74 D;  1S5L H;  3USS A;  1KMI Z;  5KKZ B;  1EDI A;  5E79 E;  1K04 A;  5CJ0 A;  4NPD A;  4IFD K;  1Q86 Q;  1U7M A;  2ITA A;  1LTJ B;  4I6M C;  2B87 A;  5AVU B;  1VQN P;  3CME P;  1AJY A;  2FY8 A;  3TDK A;  3AE9 C;  2BEQ D;  2R5D A;  3MP7 B;  1IFJ A;  2HG5 D;  2R32 A;  3ITK A;  2WPR A;  1K8A Q;  2M8R A;  5KAF E;  1RQU A;  2V7Q J;  3M91 A;  1SQB D;  3H1K G;  1ZR2 A;  3A0B H;  1NVO A;  3B5N C;  1Y8A A;  1IFN A;  1W2B O;  1LP1 A;  1JY2 O;  2M5A A;  5AW0 B;  1RHZ B;  1SQV E;  2H8P D;  3CWB J;  4WBA A;  5AVY B;  3I56 P;  1SS1 A;  2KZI A;  3IR9 A;  2Y9Y A;  2K1A A;  3W67 A;  1T8Z A;  3A5T A;  3S1K A;  2JWD A;  1FZG A;  2KS1 B;  5KLV G;  1T3J A;  2ZT9 B;  1G1J A;  1HTL C;  3U59 A;  3VMZ A;  3O6Q A;  1LTB C;  2QJK C;  3RL0 g;  3U1A A;  3H1I G;  3RK3 B;  4UB6 E;  1USE A;  1SQQ E;  4EDF A;  3M06 A;  5B5E E;  3H1J J;  1YHQ P;  1L0L D;  3GHG C;  3AE6 C;  1IK7 A;  3PP5 A;  1BE3 D;  1LWU B;  1LTS C;  1H89 A;  4D6T E;  1PGQ A;  1SQP K;  3CXH D;  1ZW0 A;  1AFO A;  2OYH A;  2AXT E;  3CCE P;  1RE4 C;  2G3A A;  1YQ4 C;  1KOR A;  3C8V A;  2B88 A;  1CI6 A;  2NZ2 A;  1YJN P;  2D2C D;  2LKM A;  3V2P A;  1T3U A;  4NPF X;  2FYZ A;  1FAV A;  1W2E A;  1EDJ A;  3TGU G;  2KB7 P;  3L74 J;  2IDB A;  4WVZ A;  2W6A A;  2IYP A;  3KXD A;  1NKZ B;  3TGU E;  4K3A A;  3CCQ P;  1LNQ A;  1SQX D;  2WT7 A;  2WSE H;  2M3E A;  1VQ6 P;  2O01 N;  5E79 H;  3VMA A;  2GUS A;  3CC2 P;  2QRX A;  5APU A;  5TIS E;  2A45 H;  2NRG A;  1NU1 D;  3CX5 D;  1HBW A;  1EZV D;  3BAT A;  5CHX A;  3WUU A;  3M0A A;  1EXI A;  1D7M A;  2HPC A;  1NTM J;  1SQB J;  1R5S A;  2FFD A;  1PGJ A;  5KAF H;  2HLO A;  1KIL E;  1P84 I;  2CPB A;  1H8A A;  1T2K D;  2WQY C;  2E74 C;  3OJA B;  2N1T A;  2O01 J;  3H1L D;  3HD7 C;  2XDJ A;  4ZKU A;  1OZH A;  1LT9 A;  1VF5 B;  3R2P A;  1N7S B;  2W83 C;  1VQ8 P;  1ZR4 A;  1X22 A;  1H0T B;  2OYI B;  1KIL C;  1RE3 A;  1BCC D;  3PJS K;  2XNX A;  1N7L A;  1WMK A;  3L73 G;  1FZE A;  3IF4 A;  1FBM A;  1L0L J;  1NTZ K;  5APT A;  5GTI E;  2KK7 A;  2Y0E A;  4UB6 H;  1BE3 J;  1L4A A;  4CPG A;  1HWT C;  4PJ0 E;  1IZN B;  1VQL P;  1KD1 Q;  2W6B A;  1KTM A;  3BVH A;  1OIP A;  3A7O A;  3L74 E;  1Q7Y Q;  1JB0 J;  1YYC A;  4GOD A;  4DZO A;  3B5N D;  2AXT H;  4L75 A;  4JYB A;  4RKU J;  1USD A;  4Z1M H;  4EIJ A;  3HE4 B;  5L8R J;  2K9J A;  2YNY A;  1KZU B;  1JY2 N;  3L36 A;  1AVY A;  3PRJ A;  1MUU A;  1IJD B;  1Q90 D;  4NPE A;  3HUS A;  2FYN C;  3H1K D;  3P8C D;  3NXS A;  2E76 B;  2YIU C;  1VDF A;  3HE5 A;  3V2N A;  5AVS B;  5AW2 B;  1SQB E;  1SFC C;  2RKL A;  3MD0 A;  3PHL A;  1VQM P;  1G2C B;  5KLV D;  4C7N A;  5TIS H;  4QMA A;  2DW3 A;  3HE4 A;  5EFW B;  3H32 B;  1RF0 A;  2E42 A;  2NPS B;  1VQP P;  2POH A;  2KXP B;  3CC7 P;  1IFM A;  1SQP G;  4MN4 C;  2Q7C A;  1YTZ T;  1YJW P;  3QWO C;  1K73 Q;  3H6P A;  4Y99 C;  3KZI E;  3H1L J;  2LXB A;  4GDO A;  1JMB A;  5KLI C;  1J1D C;  3HD7 B;  4H13 C;  1CZQ A;  1JTH B;  1L0L E;  4WB4 A;  1AA0 A;  3LW5 H;  1BE3 E;  5TJH A;  1KIL B;  4AYC A;  1N8R Q;  1BCC J;  1VQ9 P;  3CXH E;  2P58 A;  2FXO A;  4GKG A;  2WSE J;  4AUW A;  1WT6 A;  3TGU D;  2R3C A;  3FWN A;  1JY2 P;  3WUV A;  1QGK B;  3WU2 E;  1M56 D;  2VRS A;  2WIT A;  3IN6 A;  1GD2 E;  2KSJ A;  2WPQ A;  3RK2 B;  1BDD A;  1M1J C;  4H44 B;  1OW7 A;  2BCC E;  3M0D A;  1SP4 A;  1NJI Q;  3AE3 C;  1NAY A;  4PJ0 H;  1VQK P;  2R44 A;  1X79 B;  1SQX E;  5APV A;  2Q1K A;  5K5G B;  2E74 D;  3V4W A;  1PL5 A;  3MIW A;  3HD7 D;  1FZA A;  1AQ5 A;  3KDP B;  3NMD A;  2A45 I;  3L71 E;  4YTP C;  3KPE A;  3VOP A;  2JDI H;  2P1J A;  2GA1 A;  1KIL D;  1NU1 E;  3B4S A;  3CX5 E;  2OYH C;  1EZV E;  3H1K J;  2R3S A;  1YJ9 P;  1GK6 A;  1KFM A;  1KB9 D;  2AEJ A;  3JC2 2;  4LGD E;  5APY A;  5DJU B;  2IZ1 A;  3Q3D A;  1GZL A;  3SWY A;  3GLM A;  1M57 D;  3AEC C;  3PH0 A;  2HYN A;  3RBZ A;  3TNU A;  1QVG O;  4U3F E;  1N73 A;  1NTZ G;  1Q81 Q;  2QEX P;  1Y47 A;  2K37 A;  2OQQ A;  4WWI A;  3L73 D;  2HFE D;  1NO4 A;  1FZC B;  1HJB A;  4OGQ C;  4D6T J;  3BRT B;  5CCH A;  4TT3 H;  2CPS A;  1FU1 A;  1KQS O;  5AVQ B;  1CW5 A;  1JNM A;  3KZI H;  2YKO A;  4BRY A;  3V5B A;  4AQR D;  4XE5 B;  1KYO E;  3Q5R A;  5AW8 B;  5APS A;  5M1B A;  4Y28 J;  1HUC A;  2KIK A;  2FFD C;  3L4F A;  3VN0 A;  2C9N Y;  4I2L C;  2I1K A;  4DJG A;  2N1T C;  2SPZ A;  3NFQ A;  1DD4 A;  3OW2 O;  1GL2 A;  3TGU J;  1SFC D;  3CXH H;  3JCU E;  5AVZ B;  5KAI H;  3SWK A;  1LT9 C;  3B8E B;  3CPW O;  2JR8 A;  5APQ A;  1FOS E;  3WU2 H;  2CK3 H;  1M1J B;  3G4S P;  1X8Y A;  1VQO P;  2IFM A;  1RE3 C;  3GG2 A;  3GMA A;  3VMY A;  2AEF A;  2LR2 A;  5AVV B;  3H1K E;  3CCS P;  1YQ3 C;  3P8C E;  2W6J H;  2JKV A;  1DX7 A;  2D2C B;  4HYT B;  1LTJ A;  1MV8 A;  1L4A C;  4H13 D;  1NWQ A;  2PP6 A;  4RES B;  2FXM A;  4LC1 A;  4R4M A;  5KLV E;  2KP8 A;  3BRV B;  3CCM P;  1MFZ A;  4GT1 A;  1SQP D;  2OAR A;  4YXW H;  1NTM K;  1S4X A;  3CX5 H;  3LW5 J;  1M7L A;  1FZF A;  4W80 A;  1HVV A;  2PGD A;  3H1I E;  5KJ7 C;  1DD3 A;  3B71 A;  1YI2 P;  5H2F E;  2HOD B;  1EQ7 A;  1S2E A;  1ZRT D;  4WY4 C;  5CBN A;  3HUS C;  3AE2 C;  1LTA C;  1S3J A;  3ABV C;  2L5G B;  3L73 J;  4UB8 E;  2QJP B;  2KS1 A;  4PD4 D;  5AVT B;  2C9L Y;  1RF1 B;  1FDI A;  2MKV A;  2E5Y A;  1HGV A;  5AVR B;  3VTP C;  2UWJ E;  2YKP A;  2BCC D;  5CCG D;  1FDO A;  3FXE A;  3FXD A;  2Z5H A;  2YKQ A;  4I7Z C;  1R8E A;  1KN7 A;  1GW3 A;  3G3Z A;  4PV1 C;  1RF0 C;  3MUD A;  1Q82 Q;  2WTY A;  1LWU A;  4XFJ A;  2JWA A;  3E1I A;  1E5W A;  3L71 D;  1KYO H;  1VQ4 P;  1AQT A;  1UIX A;  2J5U A;  1LT1 A;  3II6 A;  3M9H A;  2O1K A;  1BSN A;  3V2R A;  3JCU H;  2ZYA A;  3HTK B;  3LIE A;  5AVW B;  1GMJ A;  1RH5 B;  4GIF A;  1OW8 A;  2YMY A;  3CWB G;  1M8O B;  3CCL P;  4RO0 A;  4OGQ D;  3B5N B;  2OTL P;  3LID A;  3CI9 A;  1R5L A;  2WPV B;  1KB9 E;  4U3F D;  1ZV8 A;  3QH9 A;  4KHX A;  1NTZ D;  3F5H A;  1L0N G;  1DH3 A;  3M0D C;  2O1J A;  3BCC G;  1L0N E;  2QM8 A;  3W68 A;  2ZJS E;  1JCC A;  2QJK B;  3WUT A;  3BCC E;  4KJM A;  3ZDM A;  1U7J A;  2N9Y B;  3F89 A;  2Q3I A;  2KLV A;  1FJK A;  1NTK K;  5C39 A;  3L73 E;  1URQ C;  2ZYD A;  1PGP A;  2Q9I A;  1KYO D;  3GHG B;  3AEB C;  2XV5 A;  4ZNC A;  3GF3 A;  5H2F H;  2E75 C;  4WY4 B;  1PGO A;  5AW7 B;  2ZXE B;  1N7S A;  5CMZ A;  3AE8 C;  1VL2 A;  5BU5 A;  1H0T A;  2OYI A;  3TK1 A;  1QVF O;  4ASV A;  2Y9Z A;  2IBZ I;  1N2D C;  3AED C;  4UB8 H;  1FOS F;  2FYU K;  3IAO A;  3M9B A;  3CXH I;  1KC8 Q;  2BCC J;  1L4A D;  3GF7 A;  1RQV A;  1SVF A;  1BGY G;  1SLQ A;  2B9B A;  1N73 C;  4I7Z B;  1SQX J;  2KOG A;  1LTT C;  1AVO A;  4K35 A;  2IPP A;  3L71 J;  1P84 E;  2W8Z A;  5KJ7 D;  5CCH C;  1OFC X;  3Q5P A;  1L2P A;  1NU1 J;  3TSI A;  1NTM G;  4WY4 D;  1OVU A;  2YO2 A;  2WPS A;  3SSU A;  3TF5 A;  1J2J B;  1NHL A;  1NAF A;  3CCR P;  1W5C E;  3H1I D;  1QL1 A;  1JUN A;  3FWL A;  4XA4 A;  3AE4 C;  2Q5U A;  3EFG A;  2E43 A;  2P10 A;  3G6E P;  3CX5 I;  1J1E C;  3P7K A;  3RL0 C;  1SQV K;  1EZV I;  1SQP E;  1GL2 C;  2E74 B;  4U3F J;  3D6Y A;  3L75 G;  3RBX A;  1GW4 A;  1JCD A;  2K9Y A;  1KB9 H;  3L72 G;  3L75 E;  4PV1 D;  5APW A;  1GU5 A;  1G2C A;  1LTG C;  4IFF A;  1ZRT E;  5DJT B;  4DCK A;  5KKZ C;  5KAI E;  4JYC A;  1SQQ K;  2AEM A;  5AW3 B;  2IFN A;  3VP9 A;  3H32 A;  2IBZ G;  1OW6 A;  2JJL A;  2NPS A;  4PD4 E;  1LTJ C;  1URQ B;  1FZB A;  3PTZ A;  2YMK A;  1EDK A;  2P7J A;  3HD7 A;  1JTH A;  4L76 A;  1FS0 E;  1WRG A;  4IL6 X;  1K05 A;  1IO4 A;  1CSB A;  2PAJ A;  1KIL A;  2WSC H;  1IFI A;  3D6Z A;  1MZ9 A;  1IFP A;  3E7K A;  1H88 A;  3RGU A;  1GTW A;  2KNC B;  3O8Z A;  1JY3 O;  1Z56 A;  4N78 D;  3CWB D;  1FJP A;  4DOJ A;  2FYN B;  2MJZ A;  2ZT9 C;  4GOE A;  1BDC A;  2XZR A;  4B86 A;  2QJY C;  2YIU B;  2H89 C;  4H0L C;  2KI7 B;  3VMX A;  1ZP0 C;  1URQ D;  1PFI A;  1UII A;  3RK3 C;  1KV4 A;  5KLV J;  1P84 H;  2N9B A;  1SFC B;  1L0N D;  1X9V A;  1HF9 A;  1JMM A;  1RY3 A;  4N6J A;  2E75 D;  1NTK G;  3BCC D;  5AVX B;  3AE5 C;  1DEE G;  3MUD C;  1LWU C;  1NGM B;  3H1I J;  2H88 C;  1NTZ E;  2QIW A;  3H1L G;  3FX0 A;  3L70 G;  1FC2 C;  4OH8 B;  2IYO A;  3S9O A;  3CL3 D;  2A06 G;  2ZVN B;  4Y99 B;  2KYV A;  3WMM 0;  1U57 A;  5KLI B;  1BCC G;  1J1D B;  2OTJ P;  1TU3 F;  4H13 B;  3A2A A;  2FYU G; 
#chains in the Genus database with same CATH homology
 2M0B A;  2UWJ E;  2K3R A;  2LXB A;  4KJM A;  3ZDM A;  1JMB A;  1OVU A;  1U7J A;  1ZXG A;  3S1K A;  4GOD A;  2JWD A;  1JM0 A;  2QRX A;  2KS1 B;  3FXE A;  5C39 A;  5DJU B;  3FXD A;  1LP1 B;  4GOF A;  3RGU A;  2M5A B;  2KZJ A;  2LR2 A;  4BXL A;  1Q2N A;  4ZNC A;  3PH0 A;  2B89 A;  2P58 A;  4GOE A;  1BDC A;  3MZW B;  1Y47 A;  2ZAE B;  1EDI A;  4WWI A;  5CBO A;  2KI7 B;  2KUB A;  1X0T A;  4NPD A;  4NPE A;  1LT1 A;  4HJG H;  2I8D A;  1U7M A;  1H0T A;  4ASV A;  2LXC B;  1BDD A;  5DJT B;  1ZW0 A;  2HR3 A;  2B87 A;  1OVR A;  1DEE G;  1EC5 A;  4ASW A;  2R44 A;  1H0T B;  2B88 A;  2RKL A;  4ZMD A;  2OTK E;  1FC2 C;  2Q1K A;  1MFT A;  4IOI H;  5K5G B;  4JBZ A;  2KIK A;  4NPF X;  4K35 A;  3MHV A;  4HKZ H;  5CBN A;  1EDJ A;  1S3J A;  5EFW B;  4EYY Q;  2QVA A;  1EDK A;  2WMM A;  2SPZ A;  4HB1 A;  4K3A A;  1EDL A;  1NVO A;  4MN4 C;  1LP1 A;  2M5A A;  4CPG A;  1OVV A;  3QWO C;  1SS1 A;  2B87 B;  2KZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...