2B87A

Structural basis for molecular recognition in an affibody:affibody complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
58
structure length
58
Chain Sequence
VDNKFNKELGWATWEIFNLPNLNGVQVKAFIDSLRDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords ZTaq affibody
publication title Structural basis for molecular recognition in an affibody:affibody complex.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 20
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2005-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2b87A00
5C39A 1EC5A 2B88A 1OVVA 2SPZA 3MHVA 4K3AA 4HKZH 1U7MA 2LXBA 2M5AA 2ZAEB 4NPFX 1NVOA 1EDKA 1ZXGA 5DJUB 1U7JA 5CBNA 2QVAA 1Q2NA 2KUBA 2KS1B 2LXCB 1X0TA 2KIKA 1H0TB 2K3RA 1FC2C 4HJGH 3RGUA 2KZJA 5K5GB 5CBOA 2HR3A 3FXDA 4KJMA 2I8DA 3FXEA 4GOEA 4CPGA 2P58A 1EDIA 2KI7B 4K35A 4ZNCA 1BDDA 2B87A 2LR2A 4JBZA 2M5AB 3ZDMA 4NPEA 1LP1A 4WWIA 4GODA 1JMBA 5DJTB 4BXLA 4NPDA 4MN4C 1JM0A 1SS1A 4ZMDA 2WMMA 2UWJE 4IOIH 4GOFA 4ASWA 3PH0A 4EYYQ 1Y47A 1OVUA 2Q1KA 1MFTA 4HB1A 1EDLA 1ZW0A 2KZIA 5EFWB 2OTKE 1OVRA 1DEEG 1BDCA 2RKLA 2B89A 3QWOC 3MZWB 2M0BA 2QRXA 1LT1A 2B87B 4ASVA 2JWDA 1LP1B 1H0TA 2R44A 1S3JA 3S1KA 1EDJA
chains in the Genus database with same CATH superfamily
1BGYE 2ZVOB 3L35A 1SQQK 1NTZG 3H1KE 5KLVG 1QX8A 4N78D 2LXBA 1XTGB 1YQ4C 1BSHA 5B5EH 3A5TA 2FY8A 1DD3A 2E43A 1GW3A 1L2PA 1E79H 5CCGC 1P84E 1GMJA 3H1JD 5GTIH 4R4LA 4GIFA 5CJ0A 1OXZA 1SQBJ 4LGDE 3RK2C 2AXCA 3EWKA 2WQYC 4H0LD 2E75D 4K35A 2KI7B 2ZFCA 4GODA 1PV3A 2P67A 4NPDA 1J1EB 3PJSK 4W80A 3VMXA 2D2CB 2OTLP 2ZXXA 4GOFA 5CCGA 3L72J 3F89A 2B9BA 3Q3DA 3KYQA 3F5HA 1NTZE 3SWKA 1PP9J 2YIUC 2K9YA 2PGDA 3L75J 1PL5A 3SFEC 2FKWB 2WSEH 2Y0CA 2JWDA 1JTHA 3RBXA 1H0TA 2WZ7A 3L70D 5GTHE 4YXDC 3CL3D 4IFMA 2YKPA 1EC5A 1SQVG 4I1LA 1FJKA 2J59M 2YKQA 5DJUB 2KNCA 1EZVG 1NTZK 1OZHA 5TISE 4B86A 5KLVK 4U3FD 2P7JA 1FZCB 3H1LE 2QJYB 2O1KA 2W6JH 1PPJG 2IYOA 2JKVA 3IN6A 1BE3E 1SQPJ 1NKNA 3A0BE 4H44D 3RK2B 5M1BA 5KAFE 3OA7A 2LR2A 2GUSA 5AW5B 1KC8Q 3HTKA 1KILE 3CMAP 3G3ZA 1L4AB 1Q90D 1KFNA 1N86A 2YIUB 3MZWB 1NU1G 3G6EP 2V7QH 5AVXB 1Q82Q 1PGQA 1QVFO 4DZOA 1K04A 1BCCE 1EDJA 1U57A 1ZV8A 2KP8A 3G71P 1A02J 1USEA 3PTZA 1W2EA 2C0XA 5H2FH 3H1IE 1NTKE 2NPSC 3WUTA 1ZXGA 2OYOA 1SQVK 2IBZG 1JY3O 2IFNA 5B5EE 2WTYA 1Q2NA 3RK3B 1IJDB 3WU2E 3Q5RA 3AEBC 4EI2A 3L71E 1SQBD 4N3YB 3CI9A 4HJGH 1YBKA 5GTIE 2KZJA 1Q86Q 1YTZI 5CBOA 1J1DC 4N78E 1FBMA 1GD2E 4L73A 3SWYA 2J5UA 1NHLA 3D70A 2NPSA 3B5ND 2C9NY 2YO2A 3L73J 3E1RA 2FYUJ 3O6QB 3AE8C 3L72D 2LKMA 2RN0A 3CWBJ 1NTMG 1H8AA 3E1IA 4UB8H 3K5BA 1R5SA 1AVOA 3L75D 1N73B 4N6JA 1LWUC 1VF5C 1DEBA 1WT6A 2FXMA 2OGUA 1FOSF 1LT1A 2KLUA 2B87B 4U3FG 1MKMA 3P8CD 2J58A 1NU1K 2JR8A 5KJ7D 4GKGA 1BSNA 4K3AA 4C46A 2ZAEB 1URQB 1QEXA 1EDKA 1RE3A 3N7NA 1LWUA 3CC4P 4DCKA 1OIPA 3L74J 1IFNA 2JJLA 1YJNP 1SQXK 4BRYA 2R3SA 1GL2C 2M3BA 3L70E 2IYPA 3V5BA 1PFIA 3AE2C 1R8EA 2W27A 2HODA 3MTUE 2W6BA 1FC2C 1N7SD 3BATA 1EDIA 3UIAA 4ZKUA 3MIWA 1HUCA 1BDDA 2KSJA 2M5AB 4U7JA 3ZDMA 3R2PA 2AEJA 2W83C 5DJTB 3GHGC 1VQLP 4U3FE 3H1JJ 4MN4C 2KS1A 1SS1A 1LT9B 1ZR2A 4IOIH 4WY4C 2G3AA 1ZLLA 3CCVP 1GU5A 1GL2A 2P2UA 3CPWO 3TGUJ 1NTMK 2FXPA 4JYCA 2XNDH 2Y9ZA 1BDCA 2JP3A 4RJTA 1LWUB 3O8ZA 4H13B 1VF5B 3HD7D 5KLIC 1LP1B 1HH0A 4Y28J 3GHGA 2YMKA 4I6MC 2WPSA 1SLQA 3SWFA 2HODB 1OFCX 4JYBA 1G2CB 2L5GB 2E74D 3T97B 5AW3B 1RF1C 2JEEA 3KQGA 2MKVA 5H2FE 3SSUA 2A45H 3P8MC 5B66H 2QVAA 2ITAA 5APSA 1M90Q 2KS1B 1T2KC 1AVYA 3L72G 2HPCA 1YJ9P 1PP9G 5APVA 2IPPA 3LW5J 3VYIA 4JF7A 3CMEP 3L73D 1L0LK 2FYUD 2KOGA 5CCHC 1RF0C 2O01J 4GDOA 3CWBD 1SQBE 2QG4A 3TNUB 1YQ3C 3RL0D 4WY4B 1CSBA 1X22A 2A45I 1J1EC 2D2CC 1NAYA 3IF4A 2QEXP 2FYZA 2QRXA 3NFQA 4OGQC 2IX7C 1M1JC 3L72E 1JY2O 3AEGC 1VQ7P 4I7ZC 1RF0A 1SQPG 1PP9E 2B88A 1LTJC 2PAJA 3BRVB 4LC1A 3L75E 5CCGD 2WPRA 3JSVC 4DOJA 1SFCB 3B8EB 1RF1B 3L74D 3A0HH 1OX3A 3KDPB 2GA1A 2PRRA 3P8CE 1X8YA 1GZLA 1EXIA 5AW6B 1HJ0A 4ZKPA 2WPQA 3CX5I 1FZCC 1LTJA 2QJYC 4IFDK 4IL6X 3AE5C 1H88A 1OW6A 3TK1A 3PHLA 4WVZA 3AEEC 3C8VA 2YKOA 2XNXA 1CZQA 3M0DC 4D6TJ 3G4SP 4ZMDA 3VOPA 1YYCA 1VQOP 2N9YB 2H88C 1KFMA 1SQPE 1L0NJ 1YTZT 4JQ0D 5APQA 1JOCA 1EZVI 4IL6H 3TGUD 3PP5A 4Y99C 1X79B 1J2JB 1VQ9P 2CPBA 2POHA 1FZCA 2M0BA 3PLNA 2N1TB 2WT7A 1L4AC 1KQLA 3H1LG 2FFDB 1ZRTD 4OGQB 3EFFK 1BE3G 2QSIA 1T3JA 3HE4B 3CC2P 3M0DA 4AQRD 1ZP0C 1M1JB 3CXHI 4M3LA 2Q6QA 2NRGA 4I7ZB 4HKZH 1U7MA 5AVTB 4NPFX 1NVOA 3N4XA 1LTJB 1QL2A 4TLFA 1SQPK 3SFDC 2R32A 1VDFA 3CCJP 2BCCJ 1KILB 3D6ZA 4OH8B 1KV4A 1NH4A 1HGVA 4HYTB 1L4AA 3H1HD 4Z1MH 3CWBG 5B66E 2E75C 1YJWP 1N2DC 4PV1B 3RK3C 2ZXEB 1DX7A 3MD0A 1BGYJ 1JUNA 1NOHA 3H1KJ 2K9JA 3B4SA 2E76B 2WT7B 5CHXA 2QJKC 1BCCG 3LW5H 4ASWA 2IFMA 1IC2A 3IAOA 3H1IG 1LTTC 1NTKG 3TYYA 2QM8A 2XU6A 2ZT9D 2OTKE 3U59A 1KMIZ 2KYVA 3W67A 2ZVNB 2O01H 1IFJA 1IZNB 1UIIA 1ZOYC 3L73E 4Y99B 3EFGA 2FYUE 3L74G 3L71G 1K8AQ 1N73C 1KYOD 3B71A 2RH0A 4YXWH 2WITA 2Y0DA 3L36A 2R44A 3CWBE 2NPSD 5C39A 2V4HA 1M1KQ 4QMAA 1OVVA 1KTMA 2SPZA 4UB6H 1ZR4A 2OARA 1OW8A 3NXSA 3P32A 2QJPC 1KYOH 5KLVJ 3E7KA 2O3JA 2M8RA 2BEQD 3HRNA 2K9JB 3O6QA 5AW7B 3H1JG 1KN7A 1OW7A 1JNMA 1URQC 2WVRA 3RL0g 3A0HE 1N73A 1IK7A 2K3RA 1N7LA 5KKZB 5AW0B 1G1IA 1W5CE 2E75B 4KJMA 5E79H 2P58A 3AE4C 2B87A 3D6YA 1RH5B 1VPCA 3L74E 1LTGC 3OAKA 4D6TD 3ITKA 2OYIC 2WSFJ 2QJKB 1L0ND 1FDMA 1AA0A 1URQA 1KYOI 2Q1KA 1W2BO 3PRJA 3MP7B 1LT9C 2OTJP 1NTKK 4IL6E 4AYCA 3H1JE 1TU3F 3L70G 1MV8A 4XFJA 3HUSB 3H32A 2H8PD 1SQQD 1KD1Q 3D71A 1OMIA 2ZJSE 3JC22 4RO0A 1KORA 1S5LX 4H13C 4HH2A 5AVRB 3AEAC 3AEFC 3U1AA 3VN0A 3TGUE 2M5AA 2YO3A 1SQVJ 1VQ5P 2IZ0A 1GL2D 2BCCD 3A2AA 1NO4A 1YIJP 1LT9A 1K73Q 2QJPB 2KUBA 2BASA 2LXCB 4XE5B 1S5LH 5AVYB 2H7HA 2Q7CA 1ZRTE 3B5NC 4H44B 3CCUP 1BGYD 1JY3P 5AVZB 3H1KD 1LP1A 2FYNC 2YXRB 1GDTA 2QA4P 2KLVA 1VQMP 1NGMB 3GLMA 4OWFA 2XV5A 3H32B 1G2CA 3T97A 2OYIB 1ZN5A 3VMYA 2FBWC 3V2RA 3W68A 4PD4I 1MFZA 5KJ7C 4KT0J 1NU1J 2KB7P 5APUA 1S1CX 2XKMA 1MZ9A 2Q3EA 3USSA 1A02F 1NTZD 3I55P 5KLVD 1T2KD 3AE1C 2NZ2A 1U7JA 4UB6E 3M0AA 3G9RA 1SQXJ 1RQUA 5APTA 4D6TG 3TNUA 1SQBG 1KYOE 5KJ7A 2Y9YA 2Q3IA 4PJ0H 4WY4A 1L0NG 1SFCC 2OYHB 3RGUA 1P84I 1GK6A 3AECC 3FGAD 1DIPA 5AVSB 3B5NB 3A7OA 3M9HA 1KQGB 3AE6C 5E79E 2JDIH 1KQSO 1QGKB 1JM0A 3H1HJ 3KHUA 2FYNB 3KZIH 1QL1A 2A06D 2D2CD 1CI6A 1Y47A 2ZYDA 2YXQB 3L75G 1VL2A 3NMDA 1NKZB 1FDIA 1OVUA 1MFTA 1AV1A 1SFCA 1NTMJ 1RF1A 1OVRA 2O01N 1NWQA 3QWOC 3KPEA 2WSFH 2Q5UA 3VTPC 2I1JA 4D6TE 3CX5D 1HTLC 3L37A 2E74C 1GTWA 1L0NE 2N9BA 2DW3A 3FWNA 2QIWA 2N1TC 4W7ZA 4UB8E 1FU1A 1SQVD 1Y9BA 2FFDC 3CX5H 3IFMA 3V2NA 1RQVA 1EZVD 3V2QA 3OW2O 5CCHA 4RESB 1LTAC 2WPVB 3MGNA 1X0TA 2GUVA 3Q5SA 1IFDA 1CI6B 1IK9A 1PPJD 4C7RA 4WBAA 1SQBK 3AEDC 1KILC 1IFMA 1JCDA 5BU5A 2I8DA 1IO4A 2W6AA 4GOEA 2N1TA 3ABVC 1L0LJ 2C9LY 2PP6A 4JBZA 2BCCE 3CXHD 4GT1A 4NPEA 3RK2D 2FFDA 3BVHA 1AQ5A 1JY2N 1YI2P 4KHXA 3HE4A 1M8OB 4PV1C 1X9VA 1VQKP 2M3EA 2WMMA 1M1JA 3C9IA 2Z4EA 1E5WA 1FZAA 2ZYAA 2E76C 3CD6P 2PFXA 3V2PA 1RE4C 1L4AD 3CXHH 5L8RJ 1Q7YQ 1DD4A 5AVWB 3S4RA 1VQ8P 1KILA 1MUUA 2B89A 3HD7B 3GF7A 1FOSE 3WU2H 1NU1D 2ZYGA 1T6AA 1YHQP 2R5BA 2A45G 4ASVA 1JO5A 1S3JA 2FXOA 1WMKA 2E74B 1HWTC 2CK3H 3JCUH 4W7YA 1Y8AA 1RE4A 2W8ZA 1UIXA 1JY2P 1SQXD 1FJPA 3CLQA 2RMZA 3BCCJ 2IBZD 4L74A 4YPCA 2Z5HA 3NTNA 3RK3D 1SQQJ 2HG5D 2A06G 2AXTH 4O9BA 3FXDA 3WMM0 4PJ0E 2AEMA 3FXEA 3L73G 5KLVE 1JCCA 1OWAA 1M56D 1FZGA 2FYUG 1S4XA 3VMZA 3GF3A 3WUUA 5KKZC 2KXPB 1T3UA 4H0LC 2H43A 3RL0B 1HVVA 1PIXA 3KZIE 1NTMD 1H89A 3V4WA 3TF5A 1EDLA 1JB0J 3H25A 1CW5A 4AUWA 3I56P 5BU8B 2R5DA 1VQPP 1AJYA 2L91A 5KAIH 2A06E 2I1KA 3CCMP 3M9BA 2IBZI 2CPSA 1FZEA 3HUSC 1URQD 2MJZA 1PGJA 2E5TA 1USDA 1XTCC 3CX5E 3GW6A 2OQQA 3CCEP 1VQ6P 1JTHB 1H0TB 1JMMA 1Z56A 1AQTA 2XDJA 5APYA 1NTZJ 3LIEA 1L0LD 1SQVE 1KB9D 3FX0A 1M57D 1NYHA 1RHZB 5APXA 3Q5PA 3CCQP 2R3CA 3HUSA 3M06A 4DJGA 3CCLP 4BXLA 1EZVE 2KNCB 1LTSC 4H44C 1EQ7A 3MUDC 3KXDA 2FYUK 2ZT9C 2O1JA 4H0LB 1KB9H 3TGUG 5BVZA 1PPJE 3II6A 2AEFA 4HB1A 1S9KD 5CJ4A 3WUVA 2W90A 3CXHE 2H89C 5AW8B 5AVUB 2E5YA 1SQXG 2WWWA 4H13D 1VF5D 3GMAA 3A3YB 4YTPC 1T8ZA 5AW2B 3H1LJ 1HGZA 5AW1B 3S1KA 3HTKB 3MUDA 1YITP 4EOTA 1BE3J 1JY3N 3OJAB 3L4FA 1HF9A 3CCRP 3JCUE 2Y0EA 3BCCD 2P10A 4L75A 3BASA 1NU1E 2P1JA 1KB9I 4L76A 3H1HG 3Q1MA 2OYIA 3VP9A 1FZFA 4PD4D 1R5LA 4LLHA 5AW9B 2XZRA 3CC7P 5K5GB 3V6IA 1PP9D 3HE5A 4CPGA 2AXTE 1QVGO 1RE3C 4RKUJ 2OYHC 1SQXE 3M91A 4PD4H 2IBZE 1Q81Q 4C7NA 1DH3A 3R4YA 3RK3E 3TSIA 2WSCJ 3PH0A 1VQNP 1BCCJ 2ZT9B 1GK4A 1ZW0A 2KZIA 5EFWB 3H1IJ 4WY4D 2K37A 1NTKJ 5CMZA 2RKLA 4OVNF 1FS0E 3S9OA 1ZMEC 1P84D 2IZ1A 3H1HE 2NPSB 4BWNA 2OYHA 2WSSH 4WB4A 3L71J 1K05A 3B5NA 1SQPD 1NTME 5KAIE 1D7MA 1PGOA 4R4MA 3HE5B 1FE6A 1P84H 1L0LG 1LGHB 2C0WA 1LTIC 2BEZF 1IFPA 5AW4B 1SFCD 1J1DB 4EDFA 4C7NB 5APWA 3GG2A 2HLOA 2YNYA 2KIKA 2QE7H 2KSEA 2K1AA 1GU4A 3RBZA 2GM4A 2HR3A 3EQ2A 3IR9A 2Q9IA 1QLED 5AVVB 3AE3C 1N7SC 4IFFA 4WWIA 1M7LA 3VP8A 3VMAA 3V4QA 1WRGA 1SP4A 2UWJE 1KQFB 1LNQA 1NJIQ 2KK7A 4BRYB 1VQ4P 2Z5IA 5CCHD 2WSEJ 3BRTB 1FAVA 1L0LE 3U1CA 1KB9E 1DEEG 3TDKA 1G1JA 5GTHH 3BCCG 3LIDA 3I5CA 2N1TD 1N7SA 3H1LD 1SQQG 2VRSA 2E42A 3L70J 3HD7C 3C1LA 1BE3D 4OGQD 3P7KA 3MHVA 5TISH 1SVFA 1HBWA 1S9KE 1GL2B 2BCCG 2IDBA 5TJHA 2G8YA 5CBNA 3M9QA 1KILD 4U3FJ 4A7PA 3H6PA 3A0BH 2YMYA 1EXJA 1BGYG 3GHGB 5KAFH 1AFOA 1LTBC 1PGPA 3HD7A 3H1KG 4TT3H 1RY3A 4XA4A 1KZUB 1NAFA 4PV1D 3FWLA 4ZNCA 4JPZB 3Q2YA 3BCCE 3QH9A 1JMBA 1FZBA 4I2LC 2E76D 1SQQE 5KTBA 1N7SB 1S72P 5AVQB 2JO1A 4DT0A 1BCCD 1GW4A 4EYYQ 1IFIA 1PZQA 1S5LE 1JEKA 1HJBA 4PD4E 2V7QJ 2QM7A 2HPCB 1LJ2A 5KLIB 1L0NK 3H1ID 1S2EA 1NTKD 1FDOA 1K9MQ 2K88A 3AE7C 1N8RQ 3RL0C 2HYNA 2WSCH 2JWAA 3AE9C 3CCSP 2HFED 3L71D 4EIJA
chains in the Genus database with same CATH topology
5C39A 1EC5A 2B88A 1OVVA 2SPZA 3MHVA 4K3AA 4HKZH 1U7MA 2LXBA 2M5AA 2ZAEB 4NPFX 1NVOA 1EDKA 1ZXGA 5DJUB 1U7JA 5CBNA 2QVAA 1Q2NA 2KUBA 2KS1B 2LXCB 1X0TA 2KIKA 1H0TB 2K3RA 1FC2C 4HJGH 3RGUA 2KZJA 5K5GB 5CBOA 2HR3A 3FXDA 4KJMA 2I8DA 3FXEA 4GOEA 4CPGA 2P58A 1EDIA 2KI7B 4K35A 4ZNCA 1BDDA 2B87A 2LR2A 4JBZA 2M5AB 3ZDMA 4NPEA 1LP1A 4WWIA 4GODA 1JMBA 5DJTB 4BXLA 4NPDA 4MN4C 1JM0A 1SS1A 4ZMDA 2WMMA 2UWJE 4IOIH 4GOFA 4ASWA 3PH0A 4EYYQ 1Y47A 1OVUA 2Q1KA 1MFTA 4HB1A 1EDLA 1ZW0A 2KZIA 5EFWB 2OTKE 1OVRA 1DEEG 1BDCA 2RKLA 2B89A 3QWOC 3MZWB 2M0BA 2QRXA 1LT1A 2B87B 4ASVA 2JWDA 1LP1B 1H0TA 2R44A 1S3JA 3S1KA 1EDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C39 A;  1EC5 A;  2B88 A;  1OVV A;  2SPZ A;  3MHV A;  4K3A A;  4HKZ H;  1U7M A;  2LXB A;  2M5A A;  2ZAE B;  4NPF X;  1NVO A;  1EDK A;  1ZXG A;  5DJU B;  1U7J A;  5CBN A;  2QVA A;  1Q2N A;  2KUB A;  2KS1 B;  2LXC B;  1X0T A;  2KIK A;  1H0T B;  2K3R A;  1FC2 C;  4HJG H;  3RGU A;  2KZJ A;  5K5G B;  5CBO A;  2HR3 A;  3FXD A;  4KJM A;  2I8D A;  3FXE A;  4GOE A;  4CPG A;  2P58 A;  1EDI A;  2KI7 B;  4K35 A;  4ZNC A;  1BDD A;  2B87 A;  2LR2 A;  4JBZ A;  2M5A B;  3ZDM A;  4NPE A;  1LP1 A;  4WWI A;  4GOD A;  1JMB A;  5DJT B;  4BXL A;  4NPD A;  4MN4 C;  1JM0 A;  1SS1 A;  4ZMD A;  2WMM A;  2UWJ E;  4IOI H;  4GOF A;  4ASW A;  3PH0 A;  4EYY Q;  1Y47 A;  1OVU A;  2Q1K A;  1MFT A;  4HB1 A;  1EDL A;  1ZW0 A;  2KZI A;  5EFW B;  2OTK E;  1OVR A;  1DEE G;  1BDC A;  2RKL A;  2B89 A;  3QWO C;  3MZW B;  2M0B A;  2QRX A;  1LT1 A;  2B87 B;  4ASV A;  2JWD A;  1LP1 B;  1H0T A;  2R44 A;  1S3J A;  3S1K A;  1EDJ A; 
#chains in the Genus database with same CATH topology
 1BGY E;  2ZVO B;  3L35 A;  1SQQ K;  1NTZ G;  3H1K E;  5KLV G;  1QX8 A;  4N78 D;  2LXB A;  1XTG B;  1YQ4 C;  1BSH A;  5B5E H;  3A5T A;  2FY8 A;  1DD3 A;  2E43 A;  1GW3 A;  1L2P A;  1E79 H;  5CCG C;  1P84 E;  1GMJ A;  3H1J D;  5GTI H;  4R4L A;  4GIF A;  5CJ0 A;  1OXZ A;  1SQB J;  4LGD E;  3RK2 C;  2AXC A;  3EWK A;  2WQY C;  4H0L D;  2E75 D;  4K35 A;  2KI7 B;  2ZFC A;  4GOD A;  1PV3 A;  2P67 A;  4NPD A;  1J1E B;  3PJS K;  4W80 A;  3VMX A;  2D2C B;  2OTL P;  2ZXX A;  4GOF A;  5CCG A;  3L72 J;  3F89 A;  2B9B A;  3Q3D A;  3KYQ A;  3F5H A;  1NTZ E;  3SWK A;  1PP9 J;  2YIU C;  2K9Y A;  2PGD A;  3L75 J;  1PL5 A;  3SFE C;  2FKW B;  2WSE H;  2Y0C A;  2JWD A;  1JTH A;  3RBX A;  1H0T A;  2WZ7 A;  3L70 D;  5GTH E;  4YXD C;  3CL3 D;  4IFM A;  2YKP A;  1EC5 A;  1SQV G;  4I1L A;  1FJK A;  2J59 M;  2YKQ A;  5DJU B;  2KNC A;  1EZV G;  1NTZ K;  1OZH A;  5TIS E;  4B86 A;  5KLV K;  4U3F D;  2P7J A;  1FZC B;  3H1L E;  2QJY B;  2O1K A;  2W6J H;  1PPJ G;  2IYO A;  2JKV A;  3IN6 A;  1BE3 E;  1SQP J;  1NKN A;  3A0B E;  4H44 D;  3RK2 B;  5M1B A;  5KAF E;  3OA7 A;  2LR2 A;  2GUS A;  5AW5 B;  1KC8 Q;  3HTK A;  1KIL E;  3CMA P;  3G3Z A;  1L4A B;  1Q90 D;  1KFN A;  1N86 A;  2YIU B;  3MZW B;  1NU1 G;  3G6E P;  2V7Q H;  5AVX B;  1Q82 Q;  1PGQ A;  1QVF O;  4DZO A;  1K04 A;  1BCC E;  1EDJ A;  1U57 A;  1ZV8 A;  2KP8 A;  3G71 P;  1A02 J;  1USE A;  3PTZ A;  1W2E A;  2C0X A;  5H2F H;  3H1I E;  1NTK E;  2NPS C;  3WUT A;  1ZXG A;  2OYO A;  1SQV K;  2IBZ G;  1JY3 O;  2IFN A;  5B5E E;  2WTY A;  1Q2N A;  3RK3 B;  1IJD B;  3WU2 E;  3Q5R A;  3AEB C;  4EI2 A;  3L71 E;  1SQB D;  4N3Y B;  3CI9 A;  4HJG H;  1YBK A;  5GTI E;  2KZJ A;  1Q86 Q;  1YTZ I;  5CBO A;  1J1D C;  4N78 E;  1FBM A;  1GD2 E;  4L73 A;  3SWY A;  2J5U A;  1NHL A;  3D70 A;  2NPS A;  3B5N D;  2C9N Y;  2YO2 A;  3L73 J;  3E1R A;  2FYU J;  3O6Q B;  3AE8 C;  3L72 D;  2LKM A;  2RN0 A;  3CWB J;  1NTM G;  1H8A A;  3E1I A;  4UB8 H;  3K5B A;  1R5S A;  1AVO A;  3L75 D;  1N73 B;  4N6J A;  1LWU C;  1VF5 C;  1DEB A;  1WT6 A;  2FXM A;  2OGU A;  1FOS F;  1LT1 A;  2KLU A;  2B87 B;  4U3F G;  1MKM A;  3P8C D;  2J58 A;  1NU1 K;  2JR8 A;  5KJ7 D;  4GKG A;  1BSN A;  4K3A A;  4C46 A;  2ZAE B;  1URQ B;  1QEX A;  1EDK A;  1RE3 A;  3N7N A;  1LWU A;  3CC4 P;  4DCK A;  1OIP A;  3L74 J;  1IFN A;  2JJL A;  1YJN P;  1SQX K;  4BRY A;  2R3S A;  1GL2 C;  2M3B A;  3L70 E;  2IYP A;  3V5B A;  1PFI A;  3AE2 C;  1R8E A;  2W27 A;  2HOD A;  3MTU E;  2W6B A;  1FC2 C;  1N7S D;  3BAT A;  1EDI A;  3UIA A;  4ZKU A;  3MIW A;  1HUC A;  1BDD A;  2KSJ A;  2M5A B;  4U7J A;  3ZDM A;  3R2P A;  2AEJ A;  2W83 C;  5DJT B;  3GHG C;  1VQL P;  4U3F E;  3H1J J;  4MN4 C;  2KS1 A;  1SS1 A;  1LT9 B;  1ZR2 A;  4IOI H;  4WY4 C;  2G3A A;  1ZLL A;  3CCV P;  1GU5 A;  1GL2 A;  2P2U A;  3CPW O;  3TGU J;  1NTM K;  2FXP A;  4JYC A;  2XND H;  2Y9Z A;  1BDC A;  2JP3 A;  4RJT A;  1LWU B;  3O8Z A;  4H13 B;  1VF5 B;  3HD7 D;  5KLI C;  1LP1 B;  1HH0 A;  4Y28 J;  3GHG A;  2YMK A;  4I6M C;  2WPS A;  1SLQ A;  3SWF A;  2HOD B;  1OFC X;  4JYB A;  1G2C B;  2L5G B;  2E74 D;  3T97 B;  5AW3 B;  1RF1 C;  2JEE A;  3KQG A;  2MKV A;  5H2F E;  3SSU A;  2A45 H;  3P8M C;  5B66 H;  2QVA A;  2ITA A;  5APS A;  1M90 Q;  2KS1 B;  1T2K C;  1AVY A;  3L72 G;  2HPC A;  1YJ9 P;  1PP9 G;  5APV A;  2IPP A;  3LW5 J;  3VYI A;  4JF7 A;  3CME P;  3L73 D;  1L0L K;  2FYU D;  2KOG A;  5CCH C;  1RF0 C;  2O01 J;  4GDO A;  3CWB D;  1SQB E;  2QG4 A;  3TNU B;  1YQ3 C;  3RL0 D;  4WY4 B;  1CSB A;  1X22 A;  2A45 I;  1J1E C;  2D2C C;  1NAY A;  3IF4 A;  2QEX P;  2FYZ A;  2QRX A;  3NFQ A;  4OGQ C;  2IX7 C;  1M1J C;  3L72 E;  1JY2 O;  3AEG C;  1VQ7 P;  4I7Z C;  1RF0 A;  1SQP G;  1PP9 E;  2B88 A;  1LTJ C;  2PAJ A;  3BRV B;  4LC1 A;  3L75 E;  5CCG D;  2WPR A;  3JSV C;  4DOJ A;  1SFC B;  3B8E B;  1RF1 B;  3L74 D;  3A0H H;  1OX3 A;  3KDP B;  2GA1 A;  2PRR A;  3P8C E;  1X8Y A;  1GZL A;  1EXI A;  5AW6 B;  1HJ0 A;  4ZKP A;  2WPQ A;  3CX5 I;  1FZC C;  1LTJ A;  2QJY C;  4IFD K;  4IL6 X;  3AE5 C;  1H88 A;  1OW6 A;  3TK1 A;  3PHL A;  4WVZ A;  3AEE C;  3C8V A;  2YKO A;  2XNX A;  1CZQ A;  3M0D C;  4D6T J;  3G4S P;  4ZMD A;  3VOP A;  1YYC A;  1VQO P;  2N9Y B;  2H88 C;  1KFM A;  1SQP E;  1L0N J;  1YTZ T;  4JQ0 D;  5APQ A;  1JOC A;  1EZV I;  4IL6 H;  3TGU D;  3PP5 A;  4Y99 C;  1X79 B;  1J2J B;  1VQ9 P;  2CPB A;  2POH A;  1FZC A;  2M0B A;  3PLN A;  2N1T B;  2WT7 A;  1L4A C;  1KQL A;  3H1L G;  2FFD B;  1ZRT D;  4OGQ B;  3EFF K;  1BE3 G;  2QSI A;  1T3J A;  3HE4 B;  3CC2 P;  3M0D A;  4AQR D;  1ZP0 C;  1M1J B;  3CXH I;  4M3L A;  2Q6Q A;  2NRG A;  4I7Z B;  4HKZ H;  1U7M A;  5AVT B;  4NPF X;  1NVO A;  3N4X A;  1LTJ B;  1QL2 A;  4TLF A;  1SQP K;  3SFD C;  2R32 A;  1VDF A;  3CCJ P;  2BCC J;  1KIL B;  3D6Z A;  4OH8 B;  1KV4 A;  1NH4 A;  1HGV A;  4HYT B;  1L4A A;  3H1H D;  4Z1M H;  3CWB G;  5B66 E;  2E75 C;  1YJW P;  1N2D C;  4PV1 B;  3RK3 C;  2ZXE B;  1DX7 A;  3MD0 A;  1BGY J;  1JUN A;  1NOH A;  3H1K J;  2K9J A;  3B4S A;  2E76 B;  2WT7 B;  5CHX A;  2QJK C;  1BCC G;  3LW5 H;  4ASW A;  2IFM A;  1IC2 A;  3IAO A;  3H1I G;  1LTT C;  1NTK G;  3TYY A;  2QM8 A;  2XU6 A;  2ZT9 D;  2OTK E;  3U59 A;  1KMI Z;  2KYV A;  3W67 A;  2ZVN B;  2O01 H;  1IFJ A;  1IZN B;  1UII A;  1ZOY C;  3L73 E;  4Y99 B;  3EFG A;  2FYU E;  3L74 G;  3L71 G;  1K8A Q;  1N73 C;  1KYO D;  3B71 A;  2RH0 A;  4YXW H;  2WIT A;  2Y0D A;  3L36 A;  2R44 A;  3CWB E;  2NPS D;  5C39 A;  2V4H A;  1M1K Q;  4QMA A;  1OVV A;  1KTM A;  2SPZ A;  4UB6 H;  1ZR4 A;  2OAR A;  1OW8 A;  3NXS A;  3P32 A;  2QJP C;  1KYO H;  5KLV J;  3E7K A;  2O3J A;  2M8R A;  2BEQ D;  3HRN A;  2K9J B;  3O6Q A;  5AW7 B;  3H1J G;  1KN7 A;  1OW7 A;  1JNM A;  1URQ C;  2WVR A;  3RL0 g;  3A0H E;  1N73 A;  1IK7 A;  2K3R A;  1N7L A;  5KKZ B;  5AW0 B;  1G1I A;  1W5C E;  2E75 B;  4KJM A;  5E79 H;  2P58 A;  3AE4 C;  2B87 A;  3D6Y A;  1RH5 B;  1VPC A;  3L74 E;  1LTG C;  3OAK A;  4D6T D;  3ITK A;  2OYI C;  2WSF J;  2QJK B;  1L0N D;  1FDM A;  1AA0 A;  1URQ A;  1KYO I;  2Q1K A;  1W2B O;  3PRJ A;  3MP7 B;  1LT9 C;  2OTJ P;  1NTK K;  4IL6 E;  4AYC A;  3H1J E;  1TU3 F;  3L70 G;  1MV8 A;  4XFJ A;  3HUS B;  3H32 A;  2H8P D;  1SQQ D;  1KD1 Q;  3D71 A;  1OMI A;  2ZJS E;  3JC2 2;  4RO0 A;  1KOR A;  1S5L X;  4H13 C;  4HH2 A;  5AVR B;  3AEA C;  3AEF C;  3U1A A;  3VN0 A;  3TGU E;  2M5A A;  2YO3 A;  1SQV J;  1VQ5 P;  2IZ0 A;  1GL2 D;  2BCC D;  3A2A A;  1NO4 A;  1YIJ P;  1LT9 A;  1K73 Q;  2QJP B;  2KUB A;  2BAS A;  2LXC B;  4XE5 B;  1S5L H;  5AVY B;  2H7H A;  2Q7C A;  1ZRT E;  3B5N C;  4H44 B;  3CCU P;  1BGY D;  1JY3 P;  5AVZ B;  3H1K D;  1LP1 A;  2FYN C;  2YXR B;  1GDT A;  2QA4 P;  2KLV A;  1VQM P;  1NGM B;  3GLM A;  4OWF A;  2XV5 A;  3H32 B;  1G2C A;  3T97 A;  2OYI B;  1ZN5 A;  3VMY A;  2FBW C;  3V2R A;  3W68 A;  4PD4 I;  1MFZ A;  5KJ7 C;  4KT0 J;  1NU1 J;  2KB7 P;  5APU A;  1S1C X;  2XKM A;  1MZ9 A;  2Q3E A;  3USS A;  1A02 F;  1NTZ D;  3I55 P;  5KLV D;  1T2K D;  3AE1 C;  2NZ2 A;  1U7J A;  4UB6 E;  3M0A A;  3G9R A;  1SQX J;  1RQU A;  5APT A;  4D6T G;  3TNU A;  1SQB G;  1KYO E;  5KJ7 A;  2Y9Y A;  2Q3I A;  4PJ0 H;  4WY4 A;  1L0N G;  1SFC C;  2OYH B;  3RGU A;  1P84 I;  1GK6 A;  3AEC C;  3FGA D;  1DIP A;  5AVS B;  3B5N B;  3A7O A;  3M9H A;  1KQG B;  3AE6 C;  5E79 E;  2JDI H;  1KQS O;  1QGK B;  1JM0 A;  3H1H J;  3KHU A;  2FYN B;  3KZI H;  1QL1 A;  2A06 D;  2D2C D;  1CI6 A;  1Y47 A;  2ZYD A;  2YXQ B;  3L75 G;  1VL2 A;  3NMD A;  1NKZ B;  1FDI A;  1OVU A;  1MFT A;  1AV1 A;  1SFC A;  1NTM J;  1RF1 A;  1OVR A;  2O01 N;  1NWQ A;  3QWO C;  3KPE A;  2WSF H;  2Q5U A;  3VTP C;  2I1J A;  4D6T E;  3CX5 D;  1HTL C;  3L37 A;  2E74 C;  1GTW A;  1L0N E;  2N9B A;  2DW3 A;  3FWN A;  2QIW A;  2N1T C;  4W7Z A;  4UB8 E;  1FU1 A;  1SQV D;  1Y9B A;  2FFD C;  3CX5 H;  3IFM A;  3V2N A;  1RQV A;  1EZV D;  3V2Q A;  3OW2 O;  5CCH A;  4RES B;  1LTA C;  2WPV B;  3MGN A;  1X0T A;  2GUV A;  3Q5S A;  1IFD A;  1CI6 B;  1IK9 A;  1PPJ D;  4C7R A;  4WBA A;  1SQB K;  3AED C;  1KIL C;  1IFM A;  1JCD A;  5BU5 A;  2I8D A;  1IO4 A;  2W6A A;  4GOE A;  2N1T A;  3ABV C;  1L0L J;  2C9L Y;  2PP6 A;  4JBZ A;  2BCC E;  3CXH D;  4GT1 A;  4NPE A;  3RK2 D;  2FFD A;  3BVH A;  1AQ5 A;  1JY2 N;  1YI2 P;  4KHX A;  3HE4 A;  1M8O B;  4PV1 C;  1X9V A;  1VQK P;  2M3E A;  2WMM A;  1M1J A;  3C9I A;  2Z4E A;  1E5W A;  1FZA A;  2ZYA A;  2E76 C;  3CD6 P;  2PFX A;  3V2P A;  1RE4 C;  1L4A D;  3CXH H;  5L8R J;  1Q7Y Q;  1DD4 A;  5AVW B;  3S4R A;  1VQ8 P;  1KIL A;  1MUU A;  2B89 A;  3HD7 B;  3GF7 A;  1FOS E;  3WU2 H;  1NU1 D;  2ZYG A;  1T6A A;  1YHQ P;  2R5B A;  2A45 G;  4ASV A;  1JO5 A;  1S3J A;  2FXO A;  1WMK A;  2E74 B;  1HWT C;  2CK3 H;  3JCU H;  4W7Y A;  1Y8A A;  1RE4 A;  2W8Z A;  1UIX A;  1JY2 P;  1SQX D;  1FJP A;  3CLQ A;  2RMZ A;  3BCC J;  2IBZ D;  4L74 A;  4YPC A;  2Z5H A;  3NTN A;  3RK3 D;  1SQQ J;  2HG5 D;  2A06 G;  2AXT H;  4O9B A;  3FXD A;  3WMM 0;  4PJ0 E;  2AEM A;  3FXE A;  3L73 G;  5KLV E;  1JCC A;  1OWA A;  1M56 D;  1FZG A;  2FYU G;  1S4X A;  3VMZ A;  3GF3 A;  3WUU A;  5KKZ C;  2KXP B;  1T3U A;  4H0L C;  2H43 A;  3RL0 B;  1HVV A;  1PIX A;  3KZI E;  1NTM D;  1H89 A;  3V4W A;  3TF5 A;  1EDL A;  1JB0 J;  3H25 A;  1CW5 A;  4AUW A;  3I56 P;  5BU8 B;  2R5D A;  1VQP P;  1AJY A;  2L91 A;  5KAI H;  2A06 E;  2I1K A;  3CCM P;  3M9B A;  2IBZ I;  2CPS A;  1FZE A;  3HUS C;  1URQ D;  2MJZ A;  1PGJ A;  2E5T A;  1USD A;  1XTC C;  3CX5 E;  3GW6 A;  2OQQ A;  3CCE P;  1VQ6 P;  1JTH B;  1H0T B;  1JMM A;  1Z56 A;  1AQT A;  2XDJ A;  5APY A;  1NTZ J;  3LIE A;  1L0L D;  1SQV E;  1KB9 D;  3FX0 A;  1M57 D;  1NYH A;  1RHZ B;  5APX A;  3Q5P A;  3CCQ P;  2R3C A;  3HUS A;  3M06 A;  4DJG A;  3CCL P;  4BXL A;  1EZV E;  2KNC B;  1LTS C;  4H44 C;  1EQ7 A;  3MUD C;  3KXD A;  2FYU K;  2ZT9 C;  2O1J A;  4H0L B;  1KB9 H;  3TGU G;  5BVZ A;  1PPJ E;  3II6 A;  2AEF A;  4HB1 A;  1S9K D;  5CJ4 A;  3WUV A;  2W90 A;  3CXH E;  2H89 C;  5AW8 B;  5AVU B;  2E5Y A;  1SQX G;  2WWW A;  4H13 D;  1VF5 D;  3GMA A;  3A3Y B;  4YTP C;  1T8Z A;  5AW2 B;  3H1L J;  1HGZ A;  5AW1 B;  3S1K A;  3HTK B;  3MUD A;  1YIT P;  4EOT A;  1BE3 J;  1JY3 N;  3OJA B;  3L4F A;  1HF9 A;  3CCR P;  3JCU E;  2Y0E A;  3BCC D;  2P10 A;  4L75 A;  3BAS A;  1NU1 E;  2P1J A;  1KB9 I;  4L76 A;  3H1H G;  3Q1M A;  2OYI A;  3VP9 A;  1FZF A;  4PD4 D;  1R5L A;  4LLH A;  5AW9 B;  2XZR A;  3CC7 P;  5K5G B;  3V6I A;  1PP9 D;  3HE5 A;  4CPG A;  2AXT E;  1QVG O;  1RE3 C;  4RKU J;  2OYH C;  1SQX E;  3M91 A;  4PD4 H;  2IBZ E;  1Q81 Q;  4C7N A;  1DH3 A;  3R4Y A;  3RK3 E;  3TSI A;  2WSC J;  3PH0 A;  1VQN P;  1BCC J;  2ZT9 B;  1GK4 A;  1ZW0 A;  2KZI A;  5EFW B;  3H1I J;  4WY4 D;  2K37 A;  1NTK J;  5CMZ A;  2RKL A;  4OVN F;  1FS0 E;  3S9O A;  1ZME C;  1P84 D;  2IZ1 A;  3H1H E;  2NPS B;  4BWN A;  2OYH A;  2WSS H;  4WB4 A;  3L71 J;  1K05 A;  3B5N A;  1SQP D;  1NTM E;  5KAI E;  1D7M A;  1PGO A;  4R4M A;  3HE5 B;  1FE6 A;  1P84 H;  1L0L G;  1LGH B;  2C0W A;  1LTI C;  2BEZ F;  1IFP A;  5AW4 B;  1SFC D;  1J1D B;  4EDF A;  4C7N B;  5APW A;  3GG2 A;  2HLO A;  2YNY A;  2KIK A;  2QE7 H;  2KSE A;  2K1A A;  1GU4 A;  3RBZ A;  2GM4 A;  2HR3 A;  3EQ2 A;  3IR9 A;  2Q9I A;  1QLE D;  5AVV B;  3AE3 C;  1N7S C;  4IFF A;  4WWI A;  1M7L A;  3VP8 A;  3VMA A;  3V4Q A;  1WRG A;  1SP4 A;  2UWJ E;  1KQF B;  1LNQ A;  1NJI Q;  2KK7 A;  4BRY B;  1VQ4 P;  2Z5I A;  5CCH D;  2WSE J;  3BRT B;  1FAV A;  1L0L E;  3U1C A;  1KB9 E;  1DEE G;  3TDK A;  1G1J A;  5GTH H;  3BCC G;  3LID A;  3I5C A;  2N1T D;  1N7S A;  3H1L D;  1SQQ G;  2VRS A;  2E42 A;  3L70 J;  3HD7 C;  3C1L A;  1BE3 D;  4OGQ D;  3P7K A;  3MHV A;  5TIS H;  1SVF A;  1HBW A;  1S9K E;  1GL2 B;  2BCC G;  2IDB A;  5TJH A;  2G8Y A;  5CBN A;  3M9Q A;  1KIL D;  4U3F J;  4A7P A;  3H6P A;  3A0B H;  2YMY A;  1EXJ A;  1BGY G;  3GHG B;  5KAF H;  1AFO A;  1LTB C;  1PGP A;  3HD7 A;  3H1K G;  4TT3 H;  1RY3 A;  4XA4 A;  1KZU B;  1NAF A;  4PV1 D;  3FWL A;  4ZNC A;  4JPZ B;  3Q2Y A;  3BCC E;  3QH9 A;  1JMB A;  1FZB A;  4I2L C;  2E76 D;  1SQQ E;  5KTB A;  1N7S B;  1S72 P;  5AVQ B;  2JO1 A;  4DT0 A;  1BCC D;  1GW4 A;  4EYY Q;  1IFI A;  1PZQ A;  1S5L E;  1JEK A;  1HJB A;  4PD4 E;  2V7Q J;  2QM7 A;  2HPC B;  1LJ2 A;  5KLI B;  1L0N K;  3H1I D;  1S2E A;  1NTK D;  1FDO A;  1K9M Q;  2K88 A;  3AE7 C;  1N8R Q;  3RL0 C;  2HYN A;  2WSC H;  2JWA A;  3AE9 C;  3CCS P;  2HFE D;  3L71 D;  4EIJ A; 
#chains in the Genus database with same CATH homology
 5C39 A;  1EC5 A;  2B88 A;  1OVV A;  2SPZ A;  3MHV A;  4K3A A;  4HKZ H;  1U7M A;  2LXB A;  2M5A A;  2ZAE B;  4NPF X;  1NVO A;  1EDK A;  1ZXG A;  5DJU B;  1U7J A;  5CBN A;  2QVA A;  1Q2N A;  2KUB A;  2KS1 B;  2LXC B;  1X0T A;  2KIK A;  1H0T B;  2K3R A;  1FC2 C;  4HJG H;  3RGU A;  2KZJ A;  5K5G B;  5CBO A;  2HR3 A;  3FXD A;  4KJM A;  2I8D A;  3FXE A;  4GOE A;  4CPG A;  2P58 A;  1EDI A;  2KI7 B;  4K35 A;  4ZNC A;  1BDD A;  2B87 A;  2LR2 A;  4JBZ A;  2M5A B;  3ZDM A;  4NPE A;  1LP1 A;  4WWI A;  4GOD A;  1JMB A;  5DJT B;  4BXL A;  4NPD A;  4MN4 C;  1JM0 A;  1SS1 A;  4ZMD A;  2WMM A;  2UWJ E;  4IOI H;  4GOF A;  4ASW A;  3PH0 A;  4EYY Q;  1Y47 A;  1OVU A;  2Q1K A;  1MFT A;  4HB1 A;  1EDL A;  1ZW0 A;  2KZI A;  5EFW B;  2OTK E;  1OVR A;  1DEE G;  1BDC A;  2RKL A;  2B89 A;  3QWO C;  3MZW B;  2M0B A;  2QRX A;  1LT1 A;  2B87 B;  4ASV A;  2JWD A;  1LP1 B;  1H0T A;  2R44 A;  1S3J A;  3S1K A;  1EDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...