1R5SA

Connexin 43 carboxyl terminal domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
132
structure length
132
Chain Sequence
b'GPLGSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gap junction alpha-1 protein
molecule tags Membrane protein
source organism Rattus norvegicus
publication title Structural changes in the carboxyl terminus of the gap junction protein connexin43 indicates signaling between binding domains for c-Src and zonula occludens-1
pubmed doi rcsb
total genus 11
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2003-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03508 Connexin43 Gap junction alpha-1 protein (Cx43)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1130 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Connexin43 1r5sA01
1R5SA
chains in the Genus database with same CATH superfamily
1VPCA 1LWUB 1XTGB 2JR8A 3B5NC 2LXCB 1WMKA 1PP9E 3ZDMA 2JDIH 2GA1A 1IK7A 4OVNF 3CXHH 1KILC 5GTHE 2WSCJ 5GTHH 2OYIA 3V4WA 3JC22 3KDPB 1GW3A 3L71J 4C7NB 1FDIA 1IFIA 1KILD 1L0NE 1NTKE 3OA7A 4N3YB 2OTJP 3H1LD 3L74D 4H44B 1Y47A 1YBKA 1N7SB 2Z5HA 1SVFA 2YIUB 2YKQA 2AXTH 1JM0A 1VL2A 3KZIE 2N1TB 3L70G 4WY4C 1QL1A 4Z1MH 4JYCA 2FYZA 1N73B 1JB0J 1PL5A 2HODA 3CC4P 3H1JE 1URQC 5AW9B 2YXQB 1IFMA 3II6A 4KT0J 2FYNB 1K73Q 1SFCA 1GZLA 3CCVP 1ZW0A 2FYUD 2QRXA 2R5DA 2YKPA 4TT3H 3RK3C 2R32A 2PRRA 3BCCJ 1SQBK 2P2UA 1BCCJ 1EDKA 1RE3C 1MFZA 2KS1A 1U7JA 3H6PA 3EWKA 5GTIH 4Y99C 3AE1C 2IDBA 3B71A 1OX3A 3PH0A 1FU1A 5AVYB 1VF5C 1ZR2A 1YIJP 2NPSD 2Z4EA 1P84I 2IBZG 2D2CD 3HD7C 1EZVG 1GL2B 1L0NK 1NTKK 3T97A 5KAFH 1PP9D 1R5SA 3BRVB 3CCLP 2OYHC 2OYHB 2C0XA 2K9YA 1BE3E 3RBXA 4IL6E 1Z56A 1IFNA 2ITAA 2J59M 4AYCA 1PFIA 3EFFK 3KHUA 1AQTA 2ZXXA 2UWJE 1KQGB 3BRTB 2ZYAA 3A0HE 1FJKA 2C0WA 1BDCA 1KQLA 5KLVD 2BEZF 2E5YA 2GUVA 3H1JD 1H88A 1Q86Q 1KN7A 2B9BA 1LTGC 3A7OA 3GHGB 3M0DC 1M57D 2W8ZA 2V7QH 4NPEA 4BXLA 4DCKA 5CCGA 1CI6A 2IYOA 2K9JB 3MP7B 1QX8A 1NTME 1LTSC 1SQPG 3MGNA 1SQQE 2FBWC 4A7PA 2KYVA 4ASVA 4HJGH 1PGQA 3EFGA 2NZ2A 1PP9J 3JCUH 1EDLA 4IFDK 5KLIB 1HGZA 2KLUA 3KQGA 5KJ7A 1SQBD 4W7YA 1NAFA 3N7NA 2E75D 3D71A 2FYUK 1JY3P 4RESB 2E74D 2XKMA 3HE4B 3M91A 3MZWB 2Q5UA 1ZRTD 3ITKA 5AVSB 3AE8C 3H1KG 2ZVNB 1Q82Q 3CWBJ 5M1BA 5AVWB 3AE3C 3IR9A 1SLQA 3BCCG 3RL0D 3TGUE 1S2EA 3SWKA 3RL0C 4MN4C 2SPZA 3GHGC 5BVZA 2A45G 2QSIA 1ZXGA 3VP9A 2R5BA 1AV1A 4OGQB 4C7RA 1KILA 5H2FE 5KJ7D 3A0HH 1AA0A 1MUUA 3IF4A 3L37A 2E76D 1CSBA 4UB6E 1VQPP 4PJ0H 1H8AA 3H1KJ 1SQQG 5KAIE 2MKVA 3Q3DA 2FFDB 2POHA 1NTMD 5EFWB 3WUTA 3O6QA 1HGVA 2JP3A 5CCHA 3H1HE 1EXIA 4LGDE 1RF1B 2K9JA 2HYNA 3H1JG 1LT9B 5BU5A 2ZFCA 2JWDA 2WSFH 1A02F 2FYUE 1SQXG 2KK7A 2W6JH 2WZ7A 3CC7P 1SFCC 5APQA 1JEKA 1ZLLA 3MUDC 1PPJG 1R5LA 4HH2A 4R4LA 5GTIE 5KLIC 3RK3D 1S72P 5B66H 2QJYC 1YQ3C 1QL2A 3AE9C 4YXWH 2QA4P 1FZAA 1R8EA 5AW0B 3HE4A 3H1IG 1NTMK 1SQBG 1SQPE 4KJMA 3AEFC 1BCCG 3H25A 3OJAB 1BSNA 1J1EB 2K3RA 3V4QA 3TGUD 2O1JA 1RQVA 3HD7A 2QJPB 1IK9A 3HE5A 1BE3D 1M7LA 3LIEA 3PJSK 2Q9IA 1GD2E 3L72D 3AEDC 2CPBA 4EOTA 2GUSA 3O8ZA 4PV1B 3H1KD 1ZP0C 3FGAD 1GL2A 1PZQA 2D2CB 1CZQA 2E5TA 2O01N 2Q3EA 3TDKA 1VQ5P 1YITP 1KORA 1HWTC 4DOJA 1N7SD 4BWNA 1G1JA 2HPCA 1LP1A 2Q1KA 4H0LD 5KLVE 1FZCB 2IX7C 1QGKB 4OGQD 1SFCD 4AUWA 4W7ZA 3H1HD 4DT0A 1LT1A 1AJYA 2W27A 3Q1MA 3AEGC 5CCGC 3WU2H 4LC1A 2OTLP 5TISE 1GK4A 2WITA 1JCCA 1WRGA 3HTKB 1G2CA 1SQQD 2OGUA 2IZ1A 2AEFA 2O01J 1NTMG 3H1LG 1KC8Q 1KYOI 4D6TJ 2XDJA 1KB9H 1FZFA 1S1CX 3RK3E 2WPRA 1YI2P 1SQBE 2Y9YA 4PJ0E 3L72J 4EDFA 1GDTA 5KJ7C 1FC2C 3CI9A 2P67A 1T8ZA 3NXSA 3VMZA 2OYIB 2E76B 1Y9BA 1S9KE 2FFDC 1JY2P 1ZRTE 2JJLA 1RQUA 3V2NA 1N8RQ 3AE5C 1SQXE 2FYUJ 2B88A 3LW5J 3M9BA 2WWWA 1RE4C 3H1ID 1G2CB 3P32A 1SQVE 4I1LA 2FKWB 4L74A 1NU1K 1FZCA 4O9BA 3M06A 3V5BA 1BE3G 1VQ4P 2QE7H 1OW7A 2NPSB 3L72G 1NWQA 3GHGA 3G9RA 4GT1A 5CBOA 2WT7B 2KB7P 3B5NA 4CPGA 4EYYQ 1FOSE 3CC2P 4IFMA 2Q6QA 1KZUB 5CCGD 1EC5A 1J1DB 1DD3A 1FZBA 2NRGA 4R4MA 1UIXA 3WMM0 3NFQA 3O6QB 1E79H 1AVOA 1NTZJ 2B87B 1TU3F 3JCUE 3L73J 3V6IA 2N9YB 2ZXEB 3V2QA 1YJ9P 2BEQD 4YPCA 3RK2B 1GU4A 2WSCH 2IZ0A 2WSSH 5KKZB 2XNXA 1NU1J 2XNDH 3VOPA 4EI2A 3G71P 4WY4A 1RF1A 1MV8A 2Y0EA 2Q7CA 1IZNB 2QM7A 3AECC 1KV4A 1URQA 2KNCB 3Q2YA 3P7KA 1LNQA 5C39A 1H0TA 2G8YA 3CCMP 1LTJA 4ASWA 1KB9I 1NGMB 1SQPD 3L75J 3H1IE 1DEBA 2BCCJ 4L75A 1L4AB 1RE3A 1X9VA 2O1KA 3A0BE 3CXHI 1GMJA 1H89A 3D70A 1ZV8A 2JKVA 3FXDA 1L0LG 1N2DC 3L72E 5AW5B 3U1CA 2WTYA 2R44A 1SQBJ 2N1TD 3CLQA 4GODA 3H1KE 3VP8A 2N1TC 3HUSB 4GDOA 3FXEA 3RL0g 1YJNP 2WSFJ 4IL6X 2OARA 3BASA 5K5GB 3D6ZA 1NTZK 4JBZA 1N73A 2YXRB 2OYHA 1NOHA 1L2PA 5APTA 1HH0A 5AVXB 1SQVJ 2ZT9C 3F89A 1BCCE 3BCCD 3TK1A 4H44C 1E5WA 4ZNCA 2L5GB 2WSEH 2V4HA 3TGUJ 1L0LJ 1HUCA 1JTHB 2FXPA 2KI7B 2KS1B 4JYBA 4XFJA 3I56P 2KIKA 1AFOA 2QJKC 3CX5I 3S4RA 4IFFA 3SFEC 2H89C 1KB9E 2Y0CA 3LIDA 4RJTA 3I55P 2WPSA 1LTTC 3M0DA 1L4AC 1T6AA 1USEA 2W90A 3D6YA 2H43A 4GIFA 2FY8A 3WU2E 1AQ5A 4QMAA 1L0NJ 1NTKJ 1NTMJ 1M1JA 3CX5H 4XA4A 1PV3A 1LTJB 4AQRD 5AW8B 1S9KD 1U7MA 2KZIA 2XZRA 5AW4B 1MZ9A 1K05A 1SQXD 3CXHE 1K9MQ 1HF9A 2I1JA 2JO1A 1IJDB 2E75C 1SQVD 1VDFA 2IFMA 3CWBE 1PPJD 1W2EA 4YXDC 2GM4A 1N7SC 3RGUA 3R2PA 3NMDA 3C9IA 2YO2A 1FAVA 1LWUC 1FZEA 1NVOA 2LXBA 2H88C 2H8PD 3H32A 3PHLA 3B4SA 1BCCD 1EQ7A 2I1KA 3L71D 2ZYGA 3Q5RA 4IOIH 2ZAEB 2A45H 2OYOA 2RH0A 1L4AD 3F5HA 3H1HJ 4WVZA 2JWAA 1X0TA 4HKZH 1BE3J 1GW4A 3E7KA 1L0LE 1YYCA 2P7JA 3IAOA 4H13B 4U3FD 2QJYB 1KTMA 1SQQJ 2K37A 2QG4A 3PLNA 3VMAA 1S5LE 5E79E 1VQ7P 1KB9D 1YQ4C 1FBMA 5APXA 5B5EH 3CCSP 1NTZG 1W5CE 2HFED 3L73G 4H0LB 5AW6B 1RF1C 3NTNA 3L70E 4I2LC 3HUSA 3W67A 2A45I 2HODB 3RBZA 2CPSA 3H1HG 2NPSC 3L35A 3L36A 5CCHC 1BGYE 1L0LK 3E1IA 1YTZI 1K04A 3RK2D 3UIAA 1PGJA 1LP1B 3U1AA 1IC2A 1FS0E 2P58A 3HTKA 4PD4H 3CWBG 4XE5B 5KAIH 1A02J 1VQ6P 2N9BA 1LTJC 1SQVK 1BGYJ 1J1EC 2L91A 2WPVB 3A0BH 1PPJE 3H1IJ 1NKNA 3HRNA 3M0AA 5AVVB 3TSIA 1FJPA 4GOEA 2YNYA 4HYTB 2M3EA 3IN6A 2KSJA 3FX0A 1OFCX 4OH8B 1URQD 2YO3A 2HPCB 3RL0B 3L71E 2IYPA 2YMKA 2N1TA 3L74J 5DJUB 3GF3A 3Q5SA 1JY2O 1KFMA 4Y99B 1H0TB 4N78E 1FZGA 1X22A 2KUBA 1VQ9P 1KYOE 2KOGA 3BCCE 5AW7B 3C8VA 3WUVA 1GL2C 2HLOA 2OTKE 2P1JA 2JEEA 3H1JJ 3JSVC 1P84E 3A2AA 1GTWA 2ZT9B 3KPEA 3MTUE 3QH9A 1S3JA 1JO5A 5CMZA 3C1LA 5APSA 3SFDC 1P84H 4WY4B 1BGYD 2I8DA 1KYOH 4K3AA 1L4AA 3P8CE 3CCQP 5TJHA 2RN0A 1NO4A 1X79B 3AE6C 3IFMA 3MIWA 4PV1C 1DEEG 3WUUA 1QVGO 1YTZT 1M1JC 1HTLC 3S1KA 2RMZA 2VRSA 3L70J 2YIUC 1T3JA 4DZOA 1MFTA 1NTZE 2W6BA 3CXHD 3GG2A 3L73E 3CL3D 4WWIA 1N7LA 2G3AA 3PTZA 5DJTB 4KHXA 5AW3B 1Q2NA 3CWBD 3I5CA 1DH3A 2J58A 2BCCG 1BSHA 2PGDA 5APWA 3PRJA 3QWOC 3B8EB 2O01H 5TISH 1GU5A 1D7MA 3SSUA 1VQMP 4JF7A 5KTBA 1GK6A 2FXOA 1J2JB 2ZYDA 3G3ZA 3M9HA 4HB1A 4IL6H 1LWUA 4JPZB 3SWYA 1NAYA 4Y28J 1Q90D 2B87A 4UB8E 3TNUB 1DX7A 2BCCE 1FZCC 1P84D 5KAFE 1L0LD 3AEAC 3LW5H 4U3FE 5KLVK 1JCDA 2AXCA 1OVVA 3L75D 3AEBC 4NPDA 2V7QJ 3N4XA 1JTHA 1G1IA 2FYNC 1Y8AA 3H1LJ 1IFDA 2ZJSE 3AE2C 3L74G 4BRYA 3A5TA 2K1AA 3RK3B 4RO0A 4GKGA 2WQYC 1RHZB 2W6AA 3L70D 5AVUB 1FE6A 1NU1E 3H32B 1OXZA 1ZN5A 2AEJA 3KXDA 1KD1Q 2KP8A 4PD4I 1HVVA 1LT9A 2QJKB 4L76A 4PD4D 1OIPA 2XU6A 3PP5A 5BU8B 4OWFA 3FWNA 2FYUG 3RK2C 1Q81Q 1UIIA 1EXJA 1AVYA 2AXTE 3KZIH 1SP4A 2J5UA 3L75E 2BASA 3V2PA 5CCHD 4WY4D 4NPFX 3MD0A 4C7NA 1W2BO 3KYQA 1USDA 2LR2A 3V2RA 3K5BA 2IBZI 3B5NB 1ZOYC 1OVRA 2AEMA 1RF0C 1QEXA 2QIWA 5B66E 1IFJA 2IBZD 1T2KC 4D6TD 1IO4A 1SFCB 3T97B 3USSA 2KZJA 1PP9G 1CI6B 4ZKUA 1T2KD 1EDJA 1HJ0A 2BCCD 2Y0DA 2PFXA 3TYYA 5APUA 3CX5E 1SS1A 3OW2O 5L8RJ 4N78D 5AVTB 2C9LY 1YHQP 1SQXJ 3VN0A 1KYOD 1EZVE 1PGOA 2ZVOB 4RKUJ 1M1JB 1SQVG 3VMYA 3G6EP 5AVRB 4UB8H 1VF5D 1DIPA 3BATA 2E74B 2M0BA 3CCUP 1KQFB 1N73C 2KXPB 2WVRA 1KMIZ 2A06G 4WBAA 3CCRP 4LLHA 1NU1G 1URQB 2KNCA 3EQ2A 1NKZB 2M3BA 1LGHB 3HD7D 4UB6H 1KILB 3L71G 5KLVG 2E43A 3CD6P 1S4XA 1IFPA 2M5AB 4H44D 1JY3O 2RKLA 4H13C 2E76C 3OAKA 2E42A 5H2FH 2OYIC 2ZT9D 1OWAA 1WT6A 2WMMA 1JNMA 2A06E 2PP6A 4U3FG 4DJGA 2Y9ZA 1PGPA 3P8CD 2W83C 3AEEC 1JY3N 1L0NG 1NTKG 2QM8A 3L75G 4H13D 4JQ0D 1YJWP 2KSEA 3VYIA 1VF5B 2WSEJ 4ZKPA 2P10A 2M8RA 1LTIC 1U57A 4K35A 1OMIA 2XV5A 2HG5D 4U7JA 1NTZD 3L73D 3W68A 5CBNA 5APVA 5KLVJ 4TLFA 1MKMA 3GLMA 2E75B 3MUDA 2R3SA 1ZR4A 1QLED 4D6TE 1JY2N 1OW8A 3G4SP 1EZVI 2PAJA 2YKOA 5CHXA 2CK3H 1J1DC 1JOCA 3CPWO 2C9NY 4L73A 3B5ND 5AVZB 3TF5A 1SQPK 1OW6A 2LKMA 3P8MC 1K8AQ 1M56D 4I6MC 1CW5A 2WPQA 2Z5IA 4I7ZC 4D6TG 3CCJP 1VQOP 3HE5B 2B89A 1N7SA 1XTCC 2R3CA 2FXMA 1NH4A 2D2CC 3TNUA 1RH5B 1NJIQ 1QVFO 1JMBA 2KLVA 4M3LA 2WT7A 1JMMA 1M8OB 4ZMDA 1M90Q 1T3UA 4OGQC 2QJPC 1JUNA 1N86A 3CMEP 2IFNA 2IPPA 2A06D 3R4YA 4H0LC 1LJ2A 3ABVC 3U59A 1M1KQ 1NU1D 1OVUA 1FOSF 3HD7B 3SWFA 1VQNP 3GF7A 1S5LX 1PIXA 1Q7YQ 1X8YA 1KQSO 4PD4E 2QEXP 3S9OA 3FWLA 1LTBC 1LT9C 3MHVA 1HJBA 2QVAA 1GL2D 1KILE 1L0ND 1NTKD 1EDIA 1SQPJ 1SQXK 3HUSC 3H1LE 3L74E 2MJZA 3L4FA 1BGYG 2K88A 2NPSA 3GMAA 4I7ZB 3Q5PA 1RY3A 3VMXA 3BVHA 1NYHA 4EIJA 1KFNA 2OQQA 3AE4C 3AE7C 4U3FJ 3CMAP 5B5EE 1FDOA 5APYA 2IBZE 5CJ4A 2M5AA 1SQQK 5E79H 1S5LH 1VQKP 1RF0A 3GW6A 4GOFA 5CJ0A 2E74C 2YMYA 4N6JA 4WB4A 3TGUG 3VTPC 2FFDA 3CX5D 4B86A 1DD4A 1BDDA 4W80A 1VQ8P 5AW1B 5AW2B 1VQLP 1EZVD 1RE4A 4PV1D 4YTPC 1NHLA 1ZMEC 5AVQB 4C46A 1LTAC 3M9QA 5KKZC 2H7HA 1OZHA 2Q3IA 3A3YB 1HBWA 3CCEP 2HR3A 3E1RA 1FDMA 2O3JA 2DW3A 4BRYB
chains in the Genus database with same CATH topology
1R5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5S A; 
#chains in the Genus database with same CATH topology
 1VPC A;  1LWU B;  1XTG B;  2JR8 A;  3B5N C;  2LXC B;  1WMK A;  1PP9 E;  3ZDM A;  2JDI H;  2GA1 A;  1IK7 A;  4OVN F;  3CXH H;  1KIL C;  5GTH E;  2WSC J;  5GTH H;  2OYI A;  3V4W A;  3JC2 2;  3KDP B;  1GW3 A;  3L71 J;  4C7N B;  1FDI A;  1IFI A;  1KIL D;  1L0N E;  1NTK E;  3OA7 A;  4N3Y B;  2OTJ P;  3H1L D;  3L74 D;  4H44 B;  1Y47 A;  1YBK A;  1N7S B;  2Z5H A;  1SVF A;  2YIU B;  2YKQ A;  2AXT H;  1JM0 A;  1VL2 A;  3KZI E;  2N1T B;  3L70 G;  4WY4 C;  1QL1 A;  4Z1M H;  4JYC A;  2FYZ A;  1N73 B;  1JB0 J;  1PL5 A;  2HOD A;  3CC4 P;  3H1J E;  1URQ C;  5AW9 B;  2YXQ B;  1IFM A;  3II6 A;  4KT0 J;  2FYN B;  1K73 Q;  1SFC A;  1GZL A;  3CCV P;  1ZW0 A;  2FYU D;  2QRX A;  2R5D A;  2YKP A;  4TT3 H;  3RK3 C;  2R32 A;  2PRR A;  3BCC J;  1SQB K;  2P2U A;  1BCC J;  1EDK A;  1RE3 C;  1MFZ A;  2KS1 A;  1U7J A;  3H6P A;  3EWK A;  5GTI H;  4Y99 C;  3AE1 C;  2IDB A;  3B71 A;  1OX3 A;  3PH0 A;  1FU1 A;  5AVY B;  1VF5 C;  1ZR2 A;  1YIJ P;  2NPS D;  2Z4E A;  1P84 I;  2IBZ G;  2D2C D;  3HD7 C;  1EZV G;  1GL2 B;  1L0N K;  1NTK K;  3T97 A;  5KAF H;  1PP9 D;  1R5S A;  3BRV B;  3CCL P;  2OYH C;  2OYH B;  2C0X A;  2K9Y A;  1BE3 E;  3RBX A;  4IL6 E;  1Z56 A;  1IFN A;  2ITA A;  2J59 M;  4AYC A;  1PFI A;  3EFF K;  3KHU A;  1AQT A;  2ZXX A;  2UWJ E;  1KQG B;  3BRT B;  2ZYA A;  3A0H E;  1FJK A;  2C0W A;  1BDC A;  1KQL A;  5KLV D;  2BEZ F;  2E5Y A;  2GUV A;  3H1J D;  1H88 A;  1Q86 Q;  1KN7 A;  2B9B A;  1LTG C;  3A7O A;  3GHG B;  3M0D C;  1M57 D;  2W8Z A;  2V7Q H;  4NPE A;  4BXL A;  4DCK A;  5CCG A;  1CI6 A;  2IYO A;  2K9J B;  3MP7 B;  1QX8 A;  1NTM E;  1LTS C;  1SQP G;  3MGN A;  1SQQ E;  2FBW C;  4A7P A;  2KYV A;  4ASV A;  4HJG H;  1PGQ A;  3EFG A;  2NZ2 A;  1PP9 J;  3JCU H;  1EDL A;  4IFD K;  5KLI B;  1HGZ A;  2KLU A;  3KQG A;  5KJ7 A;  1SQB D;  4W7Y A;  1NAF A;  3N7N A;  2E75 D;  3D71 A;  2FYU K;  1JY3 P;  4RES B;  2E74 D;  2XKM A;  3HE4 B;  3M91 A;  3MZW B;  2Q5U A;  1ZRT D;  3ITK A;  5AVS B;  3AE8 C;  3H1K G;  2ZVN B;  1Q82 Q;  3CWB J;  5M1B A;  5AVW B;  3AE3 C;  3IR9 A;  1SLQ A;  3BCC G;  3RL0 D;  3TGU E;  1S2E A;  3SWK A;  3RL0 C;  4MN4 C;  2SPZ A;  3GHG C;  5BVZ A;  2A45 G;  2QSI A;  1ZXG A;  3VP9 A;  2R5B A;  1AV1 A;  4OGQ B;  4C7R A;  1KIL A;  5H2F E;  5KJ7 D;  3A0H H;  1AA0 A;  1MUU A;  3IF4 A;  3L37 A;  2E76 D;  1CSB A;  4UB6 E;  1VQP P;  4PJ0 H;  1H8A A;  3H1K J;  1SQQ G;  5KAI E;  2MKV A;  3Q3D A;  2FFD B;  2POH A;  1NTM D;  5EFW B;  3WUT A;  3O6Q A;  1HGV A;  2JP3 A;  5CCH A;  3H1H E;  1EXI A;  4LGD E;  1RF1 B;  2K9J A;  2HYN A;  3H1J G;  1LT9 B;  5BU5 A;  2ZFC A;  2JWD A;  2WSF H;  1A02 F;  2FYU E;  1SQX G;  2KK7 A;  2W6J H;  2WZ7 A;  3CC7 P;  1SFC C;  5APQ A;  1JEK A;  1ZLL A;  3MUD C;  1PPJ G;  1R5L A;  4HH2 A;  4R4L A;  5GTI E;  5KLI C;  3RK3 D;  1S72 P;  5B66 H;  2QJY C;  1YQ3 C;  1QL2 A;  3AE9 C;  4YXW H;  2QA4 P;  1FZA A;  1R8E A;  5AW0 B;  3HE4 A;  3H1I G;  1NTM K;  1SQB G;  1SQP E;  4KJM A;  3AEF C;  1BCC G;  3H25 A;  3OJA B;  1BSN A;  1J1E B;  2K3R A;  3V4Q A;  3TGU D;  2O1J A;  1RQV A;  3HD7 A;  2QJP B;  1IK9 A;  3HE5 A;  1BE3 D;  1M7L A;  3LIE A;  3PJS K;  2Q9I A;  1GD2 E;  3L72 D;  3AED C;  2CPB A;  4EOT A;  2GUS A;  3O8Z A;  4PV1 B;  3H1K D;  1ZP0 C;  3FGA D;  1GL2 A;  1PZQ A;  2D2C B;  1CZQ A;  2E5T A;  2O01 N;  2Q3E A;  3TDK A;  1VQ5 P;  1YIT P;  1KOR A;  1HWT C;  4DOJ A;  1N7S D;  4BWN A;  1G1J A;  2HPC A;  1LP1 A;  2Q1K A;  4H0L D;  5KLV E;  1FZC B;  2IX7 C;  1QGK B;  4OGQ D;  1SFC D;  4AUW A;  4W7Z A;  3H1H D;  4DT0 A;  1LT1 A;  1AJY A;  2W27 A;  3Q1M A;  3AEG C;  5CCG C;  3WU2 H;  4LC1 A;  2OTL P;  5TIS E;  1GK4 A;  2WIT A;  1JCC A;  1WRG A;  3HTK B;  1G2C A;  1SQQ D;  2OGU A;  2IZ1 A;  2AEF A;  2O01 J;  1NTM G;  3H1L G;  1KC8 Q;  1KYO I;  4D6T J;  2XDJ A;  1KB9 H;  1FZF A;  1S1C X;  3RK3 E;  2WPR A;  1YI2 P;  1SQB E;  2Y9Y A;  4PJ0 E;  3L72 J;  4EDF A;  1GDT A;  5KJ7 C;  1FC2 C;  3CI9 A;  2P67 A;  1T8Z A;  3NXS A;  3VMZ A;  2OYI B;  2E76 B;  1Y9B A;  1S9K E;  2FFD C;  1JY2 P;  1ZRT E;  2JJL A;  1RQU A;  3V2N A;  1N8R Q;  3AE5 C;  1SQX E;  2FYU J;  2B88 A;  3LW5 J;  3M9B A;  2WWW A;  1RE4 C;  3H1I D;  1G2C B;  3P32 A;  1SQV E;  4I1L A;  2FKW B;  4L74 A;  1NU1 K;  1FZC A;  4O9B A;  3M06 A;  3V5B A;  1BE3 G;  1VQ4 P;  2QE7 H;  1OW7 A;  2NPS B;  3L72 G;  1NWQ A;  3GHG A;  3G9R A;  4GT1 A;  5CBO A;  2WT7 B;  2KB7 P;  3B5N A;  4CPG A;  4EYY Q;  1FOS E;  3CC2 P;  4IFM A;  2Q6Q A;  1KZU B;  5CCG D;  1EC5 A;  1J1D B;  1DD3 A;  1FZB A;  2NRG A;  4R4M A;  1UIX A;  3WMM 0;  3NFQ A;  3O6Q B;  1E79 H;  1AVO A;  1NTZ J;  2B87 B;  1TU3 F;  3JCU E;  3L73 J;  3V6I A;  2N9Y B;  2ZXE B;  3V2Q A;  1YJ9 P;  2BEQ D;  4YPC A;  3RK2 B;  1GU4 A;  2WSC H;  2IZ0 A;  2WSS H;  5KKZ B;  2XNX A;  1NU1 J;  2XND H;  3VOP A;  4EI2 A;  3G71 P;  4WY4 A;  1RF1 A;  1MV8 A;  2Y0E A;  2Q7C A;  1IZN B;  2QM7 A;  3AEC C;  1KV4 A;  1URQ A;  2KNC B;  3Q2Y A;  3P7K A;  1LNQ A;  5C39 A;  1H0T A;  2G8Y A;  3CCM P;  1LTJ A;  4ASW A;  1KB9 I;  1NGM B;  1SQP D;  3L75 J;  3H1I E;  1DEB A;  2BCC J;  4L75 A;  1L4A B;  1RE3 A;  1X9V A;  2O1K A;  3A0B E;  3CXH I;  1GMJ A;  1H89 A;  3D70 A;  1ZV8 A;  2JKV A;  3FXD A;  1L0L G;  1N2D C;  3L72 E;  5AW5 B;  3U1C A;  2WTY A;  2R44 A;  1SQB J;  2N1T D;  3CLQ A;  4GOD A;  3H1K E;  3VP8 A;  2N1T C;  3HUS B;  4GDO A;  3FXE A;  3RL0 g;  1YJN P;  2WSF J;  4IL6 X;  2OAR A;  3BAS A;  5K5G B;  3D6Z A;  1NTZ K;  4JBZ A;  1N73 A;  2YXR B;  2OYH A;  1NOH A;  1L2P A;  5APT A;  1HH0 A;  5AVX B;  1SQV J;  2ZT9 C;  3F89 A;  1BCC E;  3BCC D;  3TK1 A;  4H44 C;  1E5W A;  4ZNC A;  2L5G B;  2WSE H;  2V4H A;  3TGU J;  1L0L J;  1HUC A;  1JTH B;  2FXP A;  2KI7 B;  2KS1 B;  4JYB A;  4XFJ A;  3I56 P;  2KIK A;  1AFO A;  2QJK C;  3CX5 I;  3S4R A;  4IFF A;  3SFE C;  2H89 C;  1KB9 E;  2Y0C A;  3LID A;  4RJT A;  3I55 P;  2WPS A;  1LTT C;  3M0D A;  1L4A C;  1T6A A;  1USE A;  2W90 A;  3D6Y A;  2H43 A;  4GIF A;  2FY8 A;  3WU2 E;  1AQ5 A;  4QMA A;  1L0N J;  1NTK J;  1NTM J;  1M1J A;  3CX5 H;  4XA4 A;  1PV3 A;  1LTJ B;  4AQR D;  5AW8 B;  1S9K D;  1U7M A;  2KZI A;  2XZR A;  5AW4 B;  1MZ9 A;  1K05 A;  1SQX D;  3CXH E;  1K9M Q;  1HF9 A;  2I1J A;  2JO1 A;  1IJD B;  2E75 C;  1SQV D;  1VDF A;  2IFM A;  3CWB E;  1PPJ D;  1W2E A;  4YXD C;  2GM4 A;  1N7S C;  3RGU A;  3R2P A;  3NMD A;  3C9I A;  2YO2 A;  1FAV A;  1LWU C;  1FZE A;  1NVO A;  2LXB A;  2H88 C;  2H8P D;  3H32 A;  3PHL A;  3B4S A;  1BCC D;  1EQ7 A;  2I1K A;  3L71 D;  2ZYG A;  3Q5R A;  4IOI H;  2ZAE B;  2A45 H;  2OYO A;  2RH0 A;  1L4A D;  3F5H A;  3H1H J;  4WVZ A;  2JWA A;  1X0T A;  4HKZ H;  1BE3 J;  1GW4 A;  3E7K A;  1L0L E;  1YYC A;  2P7J A;  3IAO A;  4H13 B;  4U3F D;  2QJY B;  1KTM A;  1SQQ J;  2K37 A;  2QG4 A;  3PLN A;  3VMA A;  1S5L E;  5E79 E;  1VQ7 P;  1KB9 D;  1YQ4 C;  1FBM A;  5APX A;  5B5E H;  3CCS P;  1NTZ G;  1W5C E;  2HFE D;  3L73 G;  4H0L B;  5AW6 B;  1RF1 C;  3NTN A;  3L70 E;  4I2L C;  3HUS A;  3W67 A;  2A45 I;  2HOD B;  3RBZ A;  2CPS A;  3H1H G;  2NPS C;  3L35 A;  3L36 A;  5CCH C;  1BGY E;  1L0L K;  3E1I A;  1YTZ I;  1K04 A;  3RK2 D;  3UIA A;  1PGJ A;  1LP1 B;  3U1A A;  1IC2 A;  1FS0 E;  2P58 A;  3HTK A;  4PD4 H;  3CWB G;  4XE5 B;  5KAI H;  1A02 J;  1VQ6 P;  2N9B A;  1LTJ C;  1SQV K;  1BGY J;  1J1E C;  2L91 A;  2WPV B;  3A0B H;  1PPJ E;  3H1I J;  1NKN A;  3HRN A;  3M0A A;  5AVV B;  3TSI A;  1FJP A;  4GOE A;  2YNY A;  4HYT B;  2M3E A;  3IN6 A;  2KSJ A;  3FX0 A;  1OFC X;  4OH8 B;  1URQ D;  2YO3 A;  2HPC B;  3RL0 B;  3L71 E;  2IYP A;  2YMK A;  2N1T A;  3L74 J;  5DJU B;  3GF3 A;  3Q5S A;  1JY2 O;  1KFM A;  4Y99 B;  1H0T B;  4N78 E;  1FZG A;  1X22 A;  2KUB A;  1VQ9 P;  1KYO E;  2KOG A;  3BCC E;  5AW7 B;  3C8V A;  3WUV A;  1GL2 C;  2HLO A;  2OTK E;  2P1J A;  2JEE A;  3H1J J;  3JSV C;  1P84 E;  3A2A A;  1GTW A;  2ZT9 B;  3KPE A;  3MTU E;  3QH9 A;  1S3J A;  1JO5 A;  5CMZ A;  3C1L A;  5APS A;  3SFD C;  1P84 H;  4WY4 B;  1BGY D;  2I8D A;  1KYO H;  4K3A A;  1L4A A;  3P8C E;  3CCQ P;  5TJH A;  2RN0 A;  1NO4 A;  1X79 B;  3AE6 C;  3IFM A;  3MIW A;  4PV1 C;  1DEE G;  3WUU A;  1QVG O;  1YTZ T;  1M1J C;  1HTL C;  3S1K A;  2RMZ A;  2VRS A;  3L70 J;  2YIU C;  1T3J A;  4DZO A;  1MFT A;  1NTZ E;  2W6B A;  3CXH D;  3GG2 A;  3L73 E;  3CL3 D;  4WWI A;  1N7L A;  2G3A A;  3PTZ A;  5DJT B;  4KHX A;  5AW3 B;  1Q2N A;  3CWB D;  3I5C A;  1DH3 A;  2J58 A;  2BCC G;  1BSH A;  2PGD A;  5APW A;  3PRJ A;  3QWO C;  3B8E B;  2O01 H;  5TIS H;  1GU5 A;  1D7M A;  3SSU A;  1VQM P;  4JF7 A;  5KTB A;  1GK6 A;  2FXO A;  1J2J B;  2ZYD A;  3G3Z A;  3M9H A;  4HB1 A;  4IL6 H;  1LWU A;  4JPZ B;  3SWY A;  1NAY A;  4Y28 J;  1Q90 D;  2B87 A;  4UB8 E;  3TNU B;  1DX7 A;  2BCC E;  1FZC C;  1P84 D;  5KAF E;  1L0L D;  3AEA C;  3LW5 H;  4U3F E;  5KLV K;  1JCD A;  2AXC A;  1OVV A;  3L75 D;  3AEB C;  4NPD A;  2V7Q J;  3N4X A;  1JTH A;  1G1I A;  2FYN C;  1Y8A A;  3H1L J;  1IFD A;  2ZJS E;  3AE2 C;  3L74 G;  4BRY A;  3A5T A;  2K1A A;  3RK3 B;  4RO0 A;  4GKG A;  2WQY C;  1RHZ B;  2W6A A;  3L70 D;  5AVU B;  1FE6 A;  1NU1 E;  3H32 B;  1OXZ A;  1ZN5 A;  2AEJ A;  3KXD A;  1KD1 Q;  2KP8 A;  4PD4 I;  1HVV A;  1LT9 A;  2QJK B;  4L76 A;  4PD4 D;  1OIP A;  2XU6 A;  3PP5 A;  5BU8 B;  4OWF A;  3FWN A;  2FYU G;  3RK2 C;  1Q81 Q;  1UII A;  1EXJ A;  1AVY A;  2AXT E;  3KZI H;  1SP4 A;  2J5U A;  3L75 E;  2BAS A;  3V2P A;  5CCH D;  4WY4 D;  4NPF X;  3MD0 A;  4C7N A;  1W2B O;  3KYQ A;  1USD A;  2LR2 A;  3V2R A;  3K5B A;  2IBZ I;  3B5N B;  1ZOY C;  1OVR A;  2AEM A;  1RF0 C;  1QEX A;  2QIW A;  5B66 E;  1IFJ A;  2IBZ D;  1T2K C;  4D6T D;  1IO4 A;  1SFC B;  3T97 B;  3USS A;  2KZJ A;  1PP9 G;  1CI6 B;  4ZKU A;  1T2K D;  1EDJ A;  1HJ0 A;  2BCC D;  2Y0D A;  2PFX A;  3TYY A;  5APU A;  3CX5 E;  1SS1 A;  3OW2 O;  5L8R J;  4N78 D;  5AVT B;  2C9L Y;  1YHQ P;  1SQX J;  3VN0 A;  1KYO D;  1EZV E;  1PGO A;  2ZVO B;  4RKU J;  1M1J B;  1SQV G;  3VMY A;  3G6E P;  5AVR B;  4UB8 H;  1VF5 D;  1DIP A;  3BAT A;  2E74 B;  2M0B A;  3CCU P;  1KQF B;  1N73 C;  2KXP B;  2WVR A;  1KMI Z;  2A06 G;  4WBA A;  3CCR P;  4LLH A;  1NU1 G;  1URQ B;  2KNC A;  3EQ2 A;  1NKZ B;  2M3B A;  1LGH B;  3HD7 D;  4UB6 H;  1KIL B;  3L71 G;  5KLV G;  2E43 A;  3CD6 P;  1S4X A;  1IFP A;  2M5A B;  4H44 D;  1JY3 O;  2RKL A;  4H13 C;  2E76 C;  3OAK A;  2E42 A;  5H2F H;  2OYI C;  2ZT9 D;  1OWA A;  1WT6 A;  2WMM A;  1JNM A;  2A06 E;  2PP6 A;  4U3F G;  4DJG A;  2Y9Z A;  1PGP A;  3P8C D;  2W83 C;  3AEE C;  1JY3 N;  1L0N G;  1NTK G;  2QM8 A;  3L75 G;  4H13 D;  4JQ0 D;  1YJW P;  2KSE A;  3VYI A;  1VF5 B;  2WSE J;  4ZKP A;  2P10 A;  2M8R A;  1LTI C;  1U57 A;  4K35 A;  1OMI A;  2XV5 A;  2HG5 D;  4U7J A;  1NTZ D;  3L73 D;  3W68 A;  5CBN A;  5APV A;  5KLV J;  4TLF A;  1MKM A;  3GLM A;  2E75 B;  3MUD A;  2R3S A;  1ZR4 A;  1QLE D;  4D6T E;  1JY2 N;  1OW8 A;  3G4S P;  1EZV I;  2PAJ A;  2YKO A;  5CHX A;  2CK3 H;  1J1D C;  1JOC A;  3CPW O;  2C9N Y;  4L73 A;  3B5N D;  5AVZ B;  3TF5 A;  1SQP K;  1OW6 A;  2LKM A;  3P8M C;  1K8A Q;  1M56 D;  4I6M C;  1CW5 A;  2WPQ A;  2Z5I A;  4I7Z C;  4D6T G;  3CCJ P;  1VQO P;  3HE5 B;  2B89 A;  1N7S A;  1XTC C;  2R3C A;  2FXM A;  1NH4 A;  2D2C C;  3TNU A;  1RH5 B;  1NJI Q;  1QVF O;  1JMB A;  2KLV A;  4M3L A;  2WT7 A;  1JMM A;  1M8O B;  4ZMD A;  1M90 Q;  1T3U A;  4OGQ C;  2QJP C;  1JUN A;  1N86 A;  3CME P;  2IFN A;  2IPP A;  2A06 D;  3R4Y A;  4H0L C;  1LJ2 A;  3ABV C;  3U59 A;  1M1K Q;  1NU1 D;  1OVU A;  1FOS F;  3HD7 B;  3SWF A;  1VQN P;  3GF7 A;  1S5L X;  1PIX A;  1Q7Y Q;  1X8Y A;  1KQS O;  4PD4 E;  2QEX P;  3S9O A;  3FWL A;  1LTB C;  1LT9 C;  3MHV A;  1HJB A;  2QVA A;  1GL2 D;  1KIL E;  1L0N D;  1NTK D;  1EDI A;  1SQP J;  1SQX K;  3HUS C;  3H1L E;  3L74 E;  2MJZ A;  3L4F A;  1BGY G;  2K88 A;  2NPS A;  3GMA A;  4I7Z B;  3Q5P A;  1RY3 A;  3VMX A;  3BVH A;  1NYH A;  4EIJ A;  1KFN A;  2OQQ A;  3AE4 C;  3AE7 C;  4U3F J;  3CMA P;  5B5E E;  1FDO A;  5APY A;  2IBZ E;  5CJ4 A;  2M5A A;  1SQQ K;  5E79 H;  1S5L H;  1VQK P;  1RF0 A;  3GW6 A;  4GOF A;  5CJ0 A;  2E74 C;  2YMY A;  4N6J A;  4WB4 A;  3TGU G;  3VTP C;  2FFD A;  3CX5 D;  4B86 A;  1DD4 A;  1BDD A;  4W80 A;  1VQ8 P;  5AW1 B;  5AW2 B;  1VQL P;  1EZV D;  1RE4 A;  4PV1 D;  4YTP C;  1NHL A;  1ZME C;  5AVQ B;  4C46 A;  1LTA C;  3M9Q A;  5KKZ C;  2H7H A;  1OZH A;  2Q3I A;  3A3Y B;  1HBW A;  3CCE P;  2HR3 A;  3E1R A;  1FDM A;  2O3J A;  2DW3 A;  4BRY B; 
#chains in the Genus database with same CATH homology
 1R5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...