1R5SA

Connexin 43 carboxyl terminal domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
132
structure length
132
Chain Sequence
GPLGSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Gap junction alpha-1 protein
publication title Structural changes in the carboxyl terminus of the gap junction protein connexin43 indicates signaling between binding domains for c-Src and zonula occludens-1
pubmed doi rcsb
source organism Rattus norvegicus
total genus 11
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2003-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03508 Connexin43 Gap junction alpha-1 protein (Cx43)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1130 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Connexin43 1r5sA01
1R5SA
chains in the Genus database with same CATH superfamily
1RE4C 3V4QA 3L75J 2Z4EA 2O01H 3TGUE 1JNMA 4OGQC 4A7PA 2IPPA 2WMMA 1YJ9P 3TGUG 1X22A 4U3FD 3KZIH 3RL0D 1SFCD 3I5CA 3LW5H 3U59A 3H1IJ 2K9JB 1HJ0A 5AW5B 3WUVA 3GMAA 1L4AD 1M1JC 3V5BA 1WRGA 1RHZB 3WU2E 3M0DC 2W83C 3QWOC 2WQYC 2IBZE 3H1KJ 2C9NY 1X9VA 3SFDC 1FZFA 1FJPA 2B89A 3VMAA 1S5LX 1S5LE 1T2KC 3GG2A 4NPDA 4WY4A 3UIAA 3MUDA 4HYTB 4UB8H 1LWUA 2WSFH 2E42A 5KLVK 2AEMA 3P8CD 2FYUJ 1G2CA 3P8MC 1LTTC 3IR9A 3H1LD 2A45H 2D2CD 1R8EA 2XZRA 4RESB 3HTKB 2JR8A 4IFDK 3EWKA 2M3BA 1G1IA 1GK6A 2Z5IA 3VYIA 4RJTA 2K1AA 5H2FE 2KS1B 1YJNP 2E76D 1YYCA 2E74C 1NTZJ 2V7QJ 3D70A 2L5GB 3RK3D 2C0WA 3HRNA 2W6AA 2V4HA 3FGAD 2PAJA 2WT7A 3C1LA 1IFDA 4U3FE 1YQ4C 5M1BA 4Y99B 1RF1A 1MZ9A 1DX7A 2YO2A 1NTKD 3A0HE 4PD4D 3NTNA 1HGZA 4GDOA 3L71G 4XA4A 3TSIA 3L74D 1JY2N 1URQB 2FYUK 2RMZA 3M9HA 3II6A 4B86A 1WMKA 2J59M 1M57D 2R32A 2YKQA 1BE3G 2GUSA 4H0LD 3B5NB 4K35A 4EOTA 4JF7A 3I56P 1GL2A 2PP6A 3H1LJ 3P8CE 2ZXEB 3O6QB 5B5EE 2V7QH 5KJ7C 4WBAA 3L35A 5KLIC 3H1LE 3CCEP 3H6PA 1PL5A 2N9BA 1NTZK 2J58A 2OYIA 1RF0C 1L0LD 1LT9C 1VQ4P 3RK2B 1KYOD 1JCCA 1KQSO 1KB9D 2IBZI 1VQNP 4WY4B 3TDKA 1OWAA 3V2RA 1L0ND 1RQUA 1R5LA 3RK3E 1LWUB 1OW6A 1NKZB 1QLED 1G2CB 3MP7B 5TISE 3BRVB 1OMIA 1FDIA 3Q3DA 1NTKE 1PP9J 2KP8A 1SQXJ 3A2AA 4PD4E 4PV1B 1KILD 1RF1C 2NPSA 3MTUE 1GMJA 3L74E 1M90Q 4LGDE 1K8AQ 4H13B 1P84D 2KLUA 1VQPP 5APSA 2E75B 4GT1A 1NTMD 5AVYB 1AQ5A 1VQ8P 3W67A 1X0TA 1BSNA 3RL0C 1SFCC 3SWYA 3MHVA 1FZCA 3HE5B 1ZR4A 2Q7CA 1SQQJ 5E79E 1L4AC 2XV5A 1N73C 1NH4A 3L72G 2IYPA 1L0LE 1LTBC 2OYIC 1KYOE 1KB9E 2BASA 1NTKK 1SQPD 3BCCG 3VTPC 1L0NE 2ZT9B 1SQXK 1L0NG 1GL2B 2JJLA 2HPCA 2WTYA 3PHLA 1LT1A 2C9LY 5AVUB 4I2LC 2D2CC 1HWTC 2JWDA 5AW7B 1SQBD 2IDBA 5GTHH 2UWJE 1KILE 1J1DB 2QSIA 1U57A 2YO3A 3SWKA 1JM0A 2E76C 3TYYA 3SWFA 2HFED 1P84E 1KD1Q 3RK3C 1SQQK 1WT6A 1OW8A 1NTME 3H1HG 3SFEC 5TJHA 1T3JA 1EZVG 2H89C 3CCMP 2ZJSE 1TU3F 2KZIA 1OVVA 1J1EB 4KHXA 4Z1MH 1BSHA 2QEXP 2Y9ZA 1NU1J 2NPSB 1R5SA 2QJYC 4PD4I 4R4LA 3T97A 1FZAA 3NXSA 3CC4P 2GUVA 1NAFA 1URQD 2A06D 2NRGA 3Q2YA 2K3RA 1YTZT 4R4MA 2OYHC 1VQMP 1J2JB 3R4YA 4H0LC 3B5ND 1SQPG 3Q5PA 4EIJA 1DEBA 2KSEA 2ZYGA 3NFQA 1D7MA 2O1JA 1FZCB 1PPJD 5KLVD 4AYCA 1SQBE 2BCCD 4KT0J 3GHGB 1HF9A 5AW2B 3RK2D 2Y9YA 1RQVA 3L75D 3VP9A 4WY4D 2FYNC 3B8EB 1W2BO 5AVQB 1A02F 1QX8A 1IC2A 1CZQA 4ASWA 1Y9BA 2WITA 1NU1K 1N8RQ 2L91A 2O3JA 1BCCG 1OFCX 3KXDA 2NZ2A 3H1ID 3HTKA 1IO4A 1FS0E 1YQ3C 1DIPA 1SQVD 2W90A 4HJGH 2I8DA 4MN4C 2AEJA 3JC22 4PV1D 3A5TA 3L73J 2P7JA 1NWQA 1EDLA 3AE9C 1KILC 3NMDA 3H1KD 1ZOYC 5AW6B 3KZIE 2HR3A 1BDCA 1AVOA 4C46A 2A06E 4H13D 2YMKA 1CSBA 1GU5A 2E75D 3G3ZA 1PGJA 2FYUD 1Q82Q 4PJ0H 1NAYA 1JTHB 1MFZA 3AE5C 4K3AA 2VRSA 1BGYG 4L74A 5AW9B 1PPJE 2N9YB 4O9BA 5KLVE 2M0BA 1BDDA 3IAOA 4UB8E 3T97B 1URQA 5KLVG 2BCCE 5GTIH 2HG5D 3SSUA 1E79H 1NTZD 1LTGC 3B5NA 3L75E 3HUSB 4I7ZB 5CBNA 2ZT9D 2QJPB 1Y47A 3O6QA 3CXHH 1GL2D 3OJAB 3HE4A 1K04A 1SQVJ 2LXCB 3PRJA 3H1IE 2CPSA 1H89A 1SQVE 1S1CX 1SS1A 1USEA 1NYHA 1UIIA 3AE3C 2JEEA 1AQTA 3BASA 2YXQB 2IBZG 3H1KE 3V2NA 4AQRD 1XTGB 1M1KQ 1ZR2A 2Q3EA 3C8VA 4DJGA 2W27A 1KORA 4ZMDA 2QG4A 3M06A 4NPFX 2FYUE 2R3CA 3CMEP 2Q9IA 3PP5A 4JYBA 3LIDA 1QGKB 2NPSD 1AFOA 1N7LA 1NTZE 1URQC 1SQVK 2YMYA 2JWAA 1YITP 2R5BA 2M3EA 2AXTH 3IF4A 2QM8A 1SVFA 5CMZA 1Y8AA 3B5NC 4U3FG 4M3LA 1ZRTD 1YI2P 3HE5A 3G71P 1KFMA 2OTLP 2R44A 1YHQP 1PP9D 1SQXD 1JY3O 4I6MC 2XKMA 2P58A 3B71A 3WUTA 1M8OB 1JY3P 5AW8B 2E5YA 3JCUE 1HBWA 5B66H 3RK2C 1PFIA 1FZBA 1FOSE 1EC5A 1BE3J 1X8YA 2A45I 5APQA 4WY4C 5KAIH 3MUDC 4JYCA 1LWUC 2Q1KA 3HE4B 4D6TJ 4WB4A 3H1LG 1MV8A 2N1TA 1SQQD 4I1LA 4BXLA 2FY8A 2W8ZA 2WSCJ 2WSEH 2LXBA 4PV1C 4L75A 2XU6A 3USSA 1DH3A 4H13C 3M9QA 3E7KA 3PH0A 1LGHB 5DJTB 2I1KA 1K9MQ 3FX0A 2E75C 1SP4A 3I55P 1ZRTE 3V2QA 1N2DC 1NTKG 1PP9E 1RY3A 4GOEA 5K5GB 4JQ0D 1SQXE 3K5BA 2QRXA 4OH8B 2POHA 2IYOA 2JDIH 4HKZH 2KLVA 3L74G 3BATA 2W6JH 2KK7A 2J5UA 2KYVA 3LIEA 3MZWB 3N7NA 3H25A 2JO1A 2G8YA 2WSCH 1LTSC 1LP1B 2ZT9C 5GTHE 3C9IA 1GL2C 1N7SB 1T8ZA 4L76A 2OTJP 4HB1A 2H43A 1SQQE 1USDA 2KI7B 2CPBA 4EI2A 1NU1D 1HUCA 2WPSA 2R5DA 3AEGC 4HH2A 2PFXA 3GHGA 1XTCC 4BRYB 2YIUB 5AVWB 1J1DC 1RE3A 1L0LG 3GF3A 3L72J 2KIKA 5APXA 4GOFA 3AEDC 4EYYQ 1LNQA 4EDFA 4JPZB 1JOCA 3BCCJ 2XNDH 1A02J 2FFDA 2AXCA 5CCHD 3A7OA 1GW3A 2Q5UA 3GW6A 2RKLA 1FC2C 1OVRA 2FKWB 1PV3A 1N86A 1GDTA 1E5WA 2N1TB 2B87A 4C7RA 1J1EC 1MUUA 2MJZA 5APYA 3A0BH 2NPSC 1IK7A 1GU4A 1Q2NA 3AE8C 3JSVC 3G6EP 2OARA 4AUWA 1SLQA 3CX5H 3CWBD 1ZMEC 1NTMG 1OVUA 3H1HJ 1JTHA 1H0TA 2WVRA 3EFFK 2R3SA 2M5AA 1KB9H 1FZCC 3F89A 1NJIQ 5APVA 4DCKA 3L73D 1NU1E 2IX7C 3AEAC 1L2PA 3PJSK 2LR2A 2WZ7A 3CXHD 1VQ7P 1AV1A 1LTJA 1OXZA 3H32A 3HUSA 3GHGC 3VMYA 3OAKA 3AEFC 5KKZB 1JY3N 2PRRA 4IL6H 1VQOP 3B4SA 5KAFH 2GA1A 1OW7A 4H44B 1YJWP 2ZYAA 1P84H 2KOGA 4YTPC 2WSSH 5APTA 2YNYA 1SQBG 1JY2P 2O1KA 3M9BA 4L73A 3HD7A 4ZNCA 2BEZF 3H1JJ 4PJ0E 2IZ1A 4NPEA 2FYZA 5CCHA 1JEKA 3CWBJ 3Q5SA 4YXWH 2B88A 2FFDB 2IFNA 3U1AA 3CWBE 1ZW0A 3P32A 1MFTA 3Q1MA 5AVRB 1KQFB 3AECC 1VF5B 5GTIE 3CCRP 2B87B 1S3JA 2KUBA 1VQKP 4XE5B 2P2UA 4ASVA 3M0DA 3L70J 1DD4A 2Z5HA 3EFGA 4UB6H 3L73E 1YIJP 2QVAA 3D6YA 3CXHE 4KJMA 2A06G 3V2PA 3ZDMA 3IN6A 3HUSC 4I7ZC 2RN0A 3IFMA 2OQQA 1MKMA 5BU8B 2WPQA 1H0TB 2JKVA 2QJPC 1AA0A 2K37A 3BVHA 3CCVP 1QL1A 3V6IA 2M5AB 1N7SD 1FZGA 1BGYJ 1UIXA 1PPJG 4RKUJ 4IFFA 1KQGB 1KFNA 2BCCG 1LTAC 1LTJB 1M56D 3H32B 3E1RA 2Q6QA 5AVTB 2KSJA 3L75G 2A45G 2I1JA 3OA7A 3TGUJ 3AE1C 4CPGA 3N4XA 2ZAEB 1FJKA 1FU1A 2B9BA 5CCHC 1IFIA 1S72P 2MKVA 3H1IG 1DEEG 2QJKB 2HYNA 1SQVG 2N1TD 2KNCA 4W80A 1HTLC 2AXTE 2QIWA 3HD7B 3L71D 3RGUA 3H1KG 1PIXA 3PLNA 1JCDA 1VDFA 2WPRA 1EXIA 4OGQB 1BE3D 1FDOA 3PTZA 3G4SP 1IK9A 1OX3A 3TNUA 2FYUG 4ZKUA 2K88A 5KJ7A 1U7MA 3KQGA 4D6TD 1AJYA 3AE4C 3WUUA 4Y99C 3FXEA 3CC7P 3TK1A 2Y0EA 1M1JB 1RH5B 5B66E 3TF5A 2HODA 1KTMA 1RF0A 1LT9A 5KAIE 1ZN5A 1QVGO 1JB0J 1NTZG 1JUNA 1K73Q 3CXHI 3MGNA 2P67A 1LP1A 3WU2H 2KB7P 2WSEJ 1QEXA 1GTWA 5BVZA 1S4XA 3E1IA 4U3FJ 1N7SA 5KTBA 1GK4A 5AVZB 3M0AA 1S5LH 3VMXA 1ZV8A 4H44D 3S9OA 5DJUB 3VOPA 4BWNA 3L71J 4BRYA 2M8RA 5L8RJ 4OWFA 4GODA 3ABVC 3L71E 2E74B 3L36A 1EDIA 3CC2P 4DOJA 1BE3E 1CI6A 2OYOA 1YBKA 4XFJA 4C7NA 4OVNF 5H2FH 3A3YB 3RBZA 3O8ZA 1SFCA 1VQLP 4D6TE 1VF5D 4TT3H 1Z56A 4D6TG 2KNCB 1Q90D 3D6ZA 1YTZI 1L4AA 4ZKPA 3CX5D 4WWIA 1N73A 1NHLA 3CCQP 3CD6P 3L4FA 5AW0B 3L72D 1IJDB 1IZNB 3A0HH 2CK3H 4N6JA 2ZVNB 1M7LA 2FXMA 3FWNA 3BCCD 1W2EA 3R2PA 3VN0A 2Q3IA 1KQLA 1JO5A 3TNUB 2G3AA 5EFWB 5KLIB 3G9RA 2KXPB 1T6AA 2DW3A 2XNXA 5AW1B 1AVYA 3JCUH 2OTKE 3S4RA 1LJ2A 1VQ6P 1PP9G 2FXPA 1N7SC 1SQXG 1NTKJ 3CMAP 2HODB 2Y0CA 1IFMA 1LT9B 5B5EH 2WPVB 3L74J 5CCGD 2BEQD 1ZXGA 2YIUC 1X79B 1LTIC 1HVVA 2ZYDA 1FBMA 2QE7H 3EQ2A 1VL2A 2O01N 3H1HD 5APUA 1S2EA 2WT7B 1VQ5P 1EZVD 4JBZA 4W7ZA 3A0BE 1QL2A 3OW2O 1SQQG 3CPWO 1RF1B 4RO0A 4N78D 2N1TC 1IFNA 3V4WA 3D71A 1OIPA 5APWA 3ITKA 3CX5E 2IFMA 1IFJA 3HD7D 1PGQA 1JMMA 3L72E 5CJ0A 5TISH 2WWWA 1L0LJ 3S1KA 1PZQA 1Q86Q 2OYHA 2AEFA 2JP3A 4PD4H 1CI6B 4OGQD 3BCCE 1L0NJ 1FOSF 4C7NB 1K05A 2P1JA 3P7KA 3RL0B 1SFCB 1KMIZ 1Q81Q 3KHUA 2FBWC 3VMZA 1L4AB 2XDJA 1HJBA 1KV4A 3FWLA 1FAVA 3CL3D 3AEBC 3CCUP 1N73B 3GLMA 2C0XA 1NVOA 4DT0A 3H1JD 2OYIB 1W5CE 4IL6X 4IL6E 1CW5A 1T3UA 3F5HA 1T2KD 2E5TA 5KAFE 2H7HA 1EQ7A 1NOHA 2QM7A 5E79H 5AW3B 1HGVA 2OGUA 4DZOA 1NTMJ 5KKZC 3H1HE 1BCCD 3AE6C 5CHXA 1KYOH 3CI9A 1EZVE 2D2CB 2LKMA 3RL0g 1NKNA 3MD0A 1L0LK 4H44C 3L70D 4N78E 1KILA 1NU1G 5CCGA 1L0NK 2YXRB 4QMAA 1KN7A 5C39A 3CCLP 2E76B 3KDPB 2E74D 2YKPA 2YKOA 3AE2C 1RE3C 3RK3B 1GZLA 2H88C 1NO4A 2PGDA 3FXDA 1KC8Q 1SQPJ 5AVVB 4IOIH 2K9YA 1SQPE 2FFDC 1JY2O 4UB6E 4LC1A 2E43A 4IFMA 1VF5C 1IFPA 2GM4A 2ZVOB 1BGYD 2Y0DA 2K9JA 1PGOA 4TLFA 1QVFO 4YXDC 2QJYB 1S9KD 1FE6A 1JMBA 2ZXXA 2RH0A 1RE4A 1SQBJ 1EXJA 4GIFA 3MIWA 5AVSB 3CX5I 1NTMK 1VQ9P 3H1JE 1ZLLA 4Y28J 2OYHB 3QH9A 3VP8A 2W6BA 3H1JG 2IZ0A 3Q5RA 4H0LB 3CCJP 1HH0A 2P10A 3TGUD 1VPCA 3KPEA 4W7YA 2QA4P 3CWBG 5AW4B 1KYOI 1KB9I 1BCCJ 2FXOA 5KJ7D 1BCCE 3CLQA 5BU5A 1M1JA 3KYQA 3L37A 1GD2E 2HPCB 3W68A 3BRTB 5CJ4A 5CBOA 1Q7YQ 3L70E 1SQPK 1FDMA 3L73G 3CCSP 3AEEC 2O01J 3L70G 2SPZA 2HLOA 2IBZD 2KS1A 3M91A 1PGPA 5CCGC 1KZUB 1LTJC 2FYNB 1FZEA 2H8PD 3LW5J 3WMM0 1ZP0C 1U7JA 4YPCA 1P84I 1EDJA 1SQBK 2ITAA 4N3YB 3GF7A 4WVZA 1NGMB 3RBXA 4GKGA 4LLHA 1EZVI 1BGYE 1G1JA 1H88A 1GW4A 2ZFCA 2QJKC 1OZHA 1EDKA 1KILB 1S9KE 5KLVJ 2KZJA 1H8AA 5AVXB 1DD3A 3U1CA 2BCCJ 2WSFJ 3AE7C 3HD7C 4U7JA
chains in the Genus database with same CATH topology
1R5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5S A; 
#chains in the Genus database with same CATH topology
 1RE4 C;  3V4Q A;  3L75 J;  2Z4E A;  2O01 H;  3TGU E;  1JNM A;  4OGQ C;  4A7P A;  2IPP A;  2WMM A;  1YJ9 P;  3TGU G;  1X22 A;  4U3F D;  3KZI H;  3RL0 D;  1SFC D;  3I5C A;  3LW5 H;  3U59 A;  3H1I J;  2K9J B;  1HJ0 A;  5AW5 B;  3WUV A;  3GMA A;  1L4A D;  1M1J C;  3V5B A;  1WRG A;  1RHZ B;  3WU2 E;  3M0D C;  2W83 C;  3QWO C;  2WQY C;  2IBZ E;  3H1K J;  2C9N Y;  1X9V A;  3SFD C;  1FZF A;  1FJP A;  2B89 A;  3VMA A;  1S5L X;  1S5L E;  1T2K C;  3GG2 A;  4NPD A;  4WY4 A;  3UIA A;  3MUD A;  4HYT B;  4UB8 H;  1LWU A;  2WSF H;  2E42 A;  5KLV K;  2AEM A;  3P8C D;  2FYU J;  1G2C A;  3P8M C;  1LTT C;  3IR9 A;  3H1L D;  2A45 H;  2D2C D;  1R8E A;  2XZR A;  4RES B;  3HTK B;  2JR8 A;  4IFD K;  3EWK A;  2M3B A;  1G1I A;  1GK6 A;  2Z5I A;  3VYI A;  4RJT A;  2K1A A;  5H2F E;  2KS1 B;  1YJN P;  2E76 D;  1YYC A;  2E74 C;  1NTZ J;  2V7Q J;  3D70 A;  2L5G B;  3RK3 D;  2C0W A;  3HRN A;  2W6A A;  2V4H A;  3FGA D;  2PAJ A;  2WT7 A;  3C1L A;  1IFD A;  4U3F E;  1YQ4 C;  5M1B A;  4Y99 B;  1RF1 A;  1MZ9 A;  1DX7 A;  2YO2 A;  1NTK D;  3A0H E;  4PD4 D;  3NTN A;  1HGZ A;  4GDO A;  3L71 G;  4XA4 A;  3TSI A;  3L74 D;  1JY2 N;  1URQ B;  2FYU K;  2RMZ A;  3M9H A;  3II6 A;  4B86 A;  1WMK A;  2J59 M;  1M57 D;  2R32 A;  2YKQ A;  1BE3 G;  2GUS A;  4H0L D;  3B5N B;  4K35 A;  4EOT A;  4JF7 A;  3I56 P;  1GL2 A;  2PP6 A;  3H1L J;  3P8C E;  2ZXE B;  3O6Q B;  5B5E E;  2V7Q H;  5KJ7 C;  4WBA A;  3L35 A;  5KLI C;  3H1L E;  3CCE P;  3H6P A;  1PL5 A;  2N9B A;  1NTZ K;  2J58 A;  2OYI A;  1RF0 C;  1L0L D;  1LT9 C;  1VQ4 P;  3RK2 B;  1KYO D;  1JCC A;  1KQS O;  1KB9 D;  2IBZ I;  1VQN P;  4WY4 B;  3TDK A;  1OWA A;  3V2R A;  1L0N D;  1RQU A;  1R5L A;  3RK3 E;  1LWU B;  1OW6 A;  1NKZ B;  1QLE D;  1G2C B;  3MP7 B;  5TIS E;  3BRV B;  1OMI A;  1FDI A;  3Q3D A;  1NTK E;  1PP9 J;  2KP8 A;  1SQX J;  3A2A A;  4PD4 E;  4PV1 B;  1KIL D;  1RF1 C;  2NPS A;  3MTU E;  1GMJ A;  3L74 E;  1M90 Q;  4LGD E;  1K8A Q;  4H13 B;  1P84 D;  2KLU A;  1VQP P;  5APS A;  2E75 B;  4GT1 A;  1NTM D;  5AVY B;  1AQ5 A;  1VQ8 P;  3W67 A;  1X0T A;  1BSN A;  3RL0 C;  1SFC C;  3SWY A;  3MHV A;  1FZC A;  3HE5 B;  1ZR4 A;  2Q7C A;  1SQQ J;  5E79 E;  1L4A C;  2XV5 A;  1N73 C;  1NH4 A;  3L72 G;  2IYP A;  1L0L E;  1LTB C;  2OYI C;  1KYO E;  1KB9 E;  2BAS A;  1NTK K;  1SQP D;  3BCC G;  3VTP C;  1L0N E;  2ZT9 B;  1SQX K;  1L0N G;  1GL2 B;  2JJL A;  2HPC A;  2WTY A;  3PHL A;  1LT1 A;  2C9L Y;  5AVU B;  4I2L C;  2D2C C;  1HWT C;  2JWD A;  5AW7 B;  1SQB D;  2IDB A;  5GTH H;  2UWJ E;  1KIL E;  1J1D B;  2QSI A;  1U57 A;  2YO3 A;  3SWK A;  1JM0 A;  2E76 C;  3TYY A;  3SWF A;  2HFE D;  1P84 E;  1KD1 Q;  3RK3 C;  1SQQ K;  1WT6 A;  1OW8 A;  1NTM E;  3H1H G;  3SFE C;  5TJH A;  1T3J A;  1EZV G;  2H89 C;  3CCM P;  2ZJS E;  1TU3 F;  2KZI A;  1OVV A;  1J1E B;  4KHX A;  4Z1M H;  1BSH A;  2QEX P;  2Y9Z A;  1NU1 J;  2NPS B;  1R5S A;  2QJY C;  4PD4 I;  4R4L A;  3T97 A;  1FZA A;  3NXS A;  3CC4 P;  2GUV A;  1NAF A;  1URQ D;  2A06 D;  2NRG A;  3Q2Y A;  2K3R A;  1YTZ T;  4R4M A;  2OYH C;  1VQM P;  1J2J B;  3R4Y A;  4H0L C;  3B5N D;  1SQP G;  3Q5P A;  4EIJ A;  1DEB A;  2KSE A;  2ZYG A;  3NFQ A;  1D7M A;  2O1J A;  1FZC B;  1PPJ D;  5KLV D;  4AYC A;  1SQB E;  2BCC D;  4KT0 J;  3GHG B;  1HF9 A;  5AW2 B;  3RK2 D;  2Y9Y A;  1RQV A;  3L75 D;  3VP9 A;  4WY4 D;  2FYN C;  3B8E B;  1W2B O;  5AVQ B;  1A02 F;  1QX8 A;  1IC2 A;  1CZQ A;  4ASW A;  1Y9B A;  2WIT A;  1NU1 K;  1N8R Q;  2L91 A;  2O3J A;  1BCC G;  1OFC X;  3KXD A;  2NZ2 A;  3H1I D;  3HTK A;  1IO4 A;  1FS0 E;  1YQ3 C;  1DIP A;  1SQV D;  2W90 A;  4HJG H;  2I8D A;  4MN4 C;  2AEJ A;  3JC2 2;  4PV1 D;  3A5T A;  3L73 J;  2P7J A;  1NWQ A;  1EDL A;  3AE9 C;  1KIL C;  3NMD A;  3H1K D;  1ZOY C;  5AW6 B;  3KZI E;  2HR3 A;  1BDC A;  1AVO A;  4C46 A;  2A06 E;  4H13 D;  2YMK A;  1CSB A;  1GU5 A;  2E75 D;  3G3Z A;  1PGJ A;  2FYU D;  1Q82 Q;  4PJ0 H;  1NAY A;  1JTH B;  1MFZ A;  3AE5 C;  4K3A A;  2VRS A;  1BGY G;  4L74 A;  5AW9 B;  1PPJ E;  2N9Y B;  4O9B A;  5KLV E;  2M0B A;  1BDD A;  3IAO A;  4UB8 E;  3T97 B;  1URQ A;  5KLV G;  2BCC E;  5GTI H;  2HG5 D;  3SSU A;  1E79 H;  1NTZ D;  1LTG C;  3B5N A;  3L75 E;  3HUS B;  4I7Z B;  5CBN A;  2ZT9 D;  2QJP B;  1Y47 A;  3O6Q A;  3CXH H;  1GL2 D;  3OJA B;  3HE4 A;  1K04 A;  1SQV J;  2LXC B;  3PRJ A;  3H1I E;  2CPS A;  1H89 A;  1SQV E;  1S1C X;  1SS1 A;  1USE A;  1NYH A;  1UII A;  3AE3 C;  2JEE A;  1AQT A;  3BAS A;  2YXQ B;  2IBZ G;  3H1K E;  3V2N A;  4AQR D;  1XTG B;  1M1K Q;  1ZR2 A;  2Q3E A;  3C8V A;  4DJG A;  2W27 A;  1KOR A;  4ZMD A;  2QG4 A;  3M06 A;  4NPF X;  2FYU E;  2R3C A;  3CME P;  2Q9I A;  3PP5 A;  4JYB A;  3LID A;  1QGK B;  2NPS D;  1AFO A;  1N7L A;  1NTZ E;  1URQ C;  1SQV K;  2YMY A;  2JWA A;  1YIT P;  2R5B A;  2M3E A;  2AXT H;  3IF4 A;  2QM8 A;  1SVF A;  5CMZ A;  1Y8A A;  3B5N C;  4U3F G;  4M3L A;  1ZRT D;  1YI2 P;  3HE5 A;  3G71 P;  1KFM A;  2OTL P;  2R44 A;  1YHQ P;  1PP9 D;  1SQX D;  1JY3 O;  4I6M C;  2XKM A;  2P58 A;  3B71 A;  3WUT A;  1M8O B;  1JY3 P;  5AW8 B;  2E5Y A;  3JCU E;  1HBW A;  5B66 H;  3RK2 C;  1PFI A;  1FZB A;  1FOS E;  1EC5 A;  1BE3 J;  1X8Y A;  2A45 I;  5APQ A;  4WY4 C;  5KAI H;  3MUD C;  4JYC A;  1LWU C;  2Q1K A;  3HE4 B;  4D6T J;  4WB4 A;  3H1L G;  1MV8 A;  2N1T A;  1SQQ D;  4I1L A;  4BXL A;  2FY8 A;  2W8Z A;  2WSC J;  2WSE H;  2LXB A;  4PV1 C;  4L75 A;  2XU6 A;  3USS A;  1DH3 A;  4H13 C;  3M9Q A;  3E7K A;  3PH0 A;  1LGH B;  5DJT B;  2I1K A;  1K9M Q;  3FX0 A;  2E75 C;  1SP4 A;  3I55 P;  1ZRT E;  3V2Q A;  1N2D C;  1NTK G;  1PP9 E;  1RY3 A;  4GOE A;  5K5G B;  4JQ0 D;  1SQX E;  3K5B A;  2QRX A;  4OH8 B;  2POH A;  2IYO A;  2JDI H;  4HKZ H;  2KLV A;  3L74 G;  3BAT A;  2W6J H;  2KK7 A;  2J5U A;  2KYV A;  3LIE A;  3MZW B;  3N7N A;  3H25 A;  2JO1 A;  2G8Y A;  2WSC H;  1LTS C;  1LP1 B;  2ZT9 C;  5GTH E;  3C9I A;  1GL2 C;  1N7S B;  1T8Z A;  4L76 A;  2OTJ P;  4HB1 A;  2H43 A;  1SQQ E;  1USD A;  2KI7 B;  2CPB A;  4EI2 A;  1NU1 D;  1HUC A;  2WPS A;  2R5D A;  3AEG C;  4HH2 A;  2PFX A;  3GHG A;  1XTC C;  4BRY B;  2YIU B;  5AVW B;  1J1D C;  1RE3 A;  1L0L G;  3GF3 A;  3L72 J;  2KIK A;  5APX A;  4GOF A;  3AED C;  4EYY Q;  1LNQ A;  4EDF A;  4JPZ B;  1JOC A;  3BCC J;  2XND H;  1A02 J;  2FFD A;  2AXC A;  5CCH D;  3A7O A;  1GW3 A;  2Q5U A;  3GW6 A;  2RKL A;  1FC2 C;  1OVR A;  2FKW B;  1PV3 A;  1N86 A;  1GDT A;  1E5W A;  2N1T B;  2B87 A;  4C7R A;  1J1E C;  1MUU A;  2MJZ A;  5APY A;  3A0B H;  2NPS C;  1IK7 A;  1GU4 A;  1Q2N A;  3AE8 C;  3JSV C;  3G6E P;  2OAR A;  4AUW A;  1SLQ A;  3CX5 H;  3CWB D;  1ZME C;  1NTM G;  1OVU A;  3H1H J;  1JTH A;  1H0T A;  2WVR A;  3EFF K;  2R3S A;  2M5A A;  1KB9 H;  1FZC C;  3F89 A;  1NJI Q;  5APV A;  4DCK A;  3L73 D;  1NU1 E;  2IX7 C;  3AEA C;  1L2P A;  3PJS K;  2LR2 A;  2WZ7 A;  3CXH D;  1VQ7 P;  1AV1 A;  1LTJ A;  1OXZ A;  3H32 A;  3HUS A;  3GHG C;  3VMY A;  3OAK A;  3AEF C;  5KKZ B;  1JY3 N;  2PRR A;  4IL6 H;  1VQO P;  3B4S A;  5KAF H;  2GA1 A;  1OW7 A;  4H44 B;  1YJW P;  2ZYA A;  1P84 H;  2KOG A;  4YTP C;  2WSS H;  5APT A;  2YNY A;  1SQB G;  1JY2 P;  2O1K A;  3M9B A;  4L73 A;  3HD7 A;  4ZNC A;  2BEZ F;  3H1J J;  4PJ0 E;  2IZ1 A;  4NPE A;  2FYZ A;  5CCH A;  1JEK A;  3CWB J;  3Q5S A;  4YXW H;  2B88 A;  2FFD B;  2IFN A;  3U1A A;  3CWB E;  1ZW0 A;  3P32 A;  1MFT A;  3Q1M A;  5AVR B;  1KQF B;  3AEC C;  1VF5 B;  5GTI E;  3CCR P;  2B87 B;  1S3J A;  2KUB A;  1VQK P;  4XE5 B;  2P2U A;  4ASV A;  3M0D A;  3L70 J;  1DD4 A;  2Z5H A;  3EFG A;  4UB6 H;  3L73 E;  1YIJ P;  2QVA A;  3D6Y A;  3CXH E;  4KJM A;  2A06 G;  3V2P A;  3ZDM A;  3IN6 A;  3HUS C;  4I7Z C;  2RN0 A;  3IFM A;  2OQQ A;  1MKM A;  5BU8 B;  2WPQ A;  1H0T B;  2JKV A;  2QJP C;  1AA0 A;  2K37 A;  3BVH A;  3CCV P;  1QL1 A;  3V6I A;  2M5A B;  1N7S D;  1FZG A;  1BGY J;  1UIX A;  1PPJ G;  4RKU J;  4IFF A;  1KQG B;  1KFN A;  2BCC G;  1LTA C;  1LTJ B;  1M56 D;  3H32 B;  3E1R A;  2Q6Q A;  5AVT B;  2KSJ A;  3L75 G;  2A45 G;  2I1J A;  3OA7 A;  3TGU J;  3AE1 C;  4CPG A;  3N4X A;  2ZAE B;  1FJK A;  1FU1 A;  2B9B A;  5CCH C;  1IFI A;  1S72 P;  2MKV A;  3H1I G;  1DEE G;  2QJK B;  2HYN A;  1SQV G;  2N1T D;  2KNC A;  4W80 A;  1HTL C;  2AXT E;  2QIW A;  3HD7 B;  3L71 D;  3RGU A;  3H1K G;  1PIX A;  3PLN A;  1JCD A;  1VDF A;  2WPR A;  1EXI A;  4OGQ B;  1BE3 D;  1FDO A;  3PTZ A;  3G4S P;  1IK9 A;  1OX3 A;  3TNU A;  2FYU G;  4ZKU A;  2K88 A;  5KJ7 A;  1U7M A;  3KQG A;  4D6T D;  1AJY A;  3AE4 C;  3WUU A;  4Y99 C;  3FXE A;  3CC7 P;  3TK1 A;  2Y0E A;  1M1J B;  1RH5 B;  5B66 E;  3TF5 A;  2HOD A;  1KTM A;  1RF0 A;  1LT9 A;  5KAI E;  1ZN5 A;  1QVG O;  1JB0 J;  1NTZ G;  1JUN A;  1K73 Q;  3CXH I;  3MGN A;  2P67 A;  1LP1 A;  3WU2 H;  2KB7 P;  2WSE J;  1QEX A;  1GTW A;  5BVZ A;  1S4X A;  3E1I A;  4U3F J;  1N7S A;  5KTB A;  1GK4 A;  5AVZ B;  3M0A A;  1S5L H;  3VMX A;  1ZV8 A;  4H44 D;  3S9O A;  5DJU B;  3VOP A;  4BWN A;  3L71 J;  4BRY A;  2M8R A;  5L8R J;  4OWF A;  4GOD A;  3ABV C;  3L71 E;  2E74 B;  3L36 A;  1EDI A;  3CC2 P;  4DOJ A;  1BE3 E;  1CI6 A;  2OYO A;  1YBK A;  4XFJ A;  4C7N A;  4OVN F;  5H2F H;  3A3Y B;  3RBZ A;  3O8Z A;  1SFC A;  1VQL P;  4D6T E;  1VF5 D;  4TT3 H;  1Z56 A;  4D6T G;  2KNC B;  1Q90 D;  3D6Z A;  1YTZ I;  1L4A A;  4ZKP A;  3CX5 D;  4WWI A;  1N73 A;  1NHL A;  3CCQ P;  3CD6 P;  3L4F A;  5AW0 B;  3L72 D;  1IJD B;  1IZN B;  3A0H H;  2CK3 H;  4N6J A;  2ZVN B;  1M7L A;  2FXM A;  3FWN A;  3BCC D;  1W2E A;  3R2P A;  3VN0 A;  2Q3I A;  1KQL A;  1JO5 A;  3TNU B;  2G3A A;  5EFW B;  5KLI B;  3G9R A;  2KXP B;  1T6A A;  2DW3 A;  2XNX A;  5AW1 B;  1AVY A;  3JCU H;  2OTK E;  3S4R A;  1LJ2 A;  1VQ6 P;  1PP9 G;  2FXP A;  1N7S C;  1SQX G;  1NTK J;  3CMA P;  2HOD B;  2Y0C A;  1IFM A;  1LT9 B;  5B5E H;  2WPV B;  3L74 J;  5CCG D;  2BEQ D;  1ZXG A;  2YIU C;  1X79 B;  1LTI C;  1HVV A;  2ZYD A;  1FBM A;  2QE7 H;  3EQ2 A;  1VL2 A;  2O01 N;  3H1H D;  5APU A;  1S2E A;  2WT7 B;  1VQ5 P;  1EZV D;  4JBZ A;  4W7Z A;  3A0B E;  1QL2 A;  3OW2 O;  1SQQ G;  3CPW O;  1RF1 B;  4RO0 A;  4N78 D;  2N1T C;  1IFN A;  3V4W A;  3D71 A;  1OIP A;  5APW A;  3ITK A;  3CX5 E;  2IFM A;  1IFJ A;  3HD7 D;  1PGQ A;  1JMM A;  3L72 E;  5CJ0 A;  5TIS H;  2WWW A;  1L0L J;  3S1K A;  1PZQ A;  1Q86 Q;  2OYH A;  2AEF A;  2JP3 A;  4PD4 H;  1CI6 B;  4OGQ D;  3BCC E;  1L0N J;  1FOS F;  4C7N B;  1K05 A;  2P1J A;  3P7K A;  3RL0 B;  1SFC B;  1KMI Z;  1Q81 Q;  3KHU A;  2FBW C;  3VMZ A;  1L4A B;  2XDJ A;  1HJB A;  1KV4 A;  3FWL A;  1FAV A;  3CL3 D;  3AEB C;  3CCU P;  1N73 B;  3GLM A;  2C0X A;  1NVO A;  4DT0 A;  3H1J D;  2OYI B;  1W5C E;  4IL6 X;  4IL6 E;  1CW5 A;  1T3U A;  3F5H A;  1T2K D;  2E5T A;  5KAF E;  2H7H A;  1EQ7 A;  1NOH A;  2QM7 A;  5E79 H;  5AW3 B;  1HGV A;  2OGU A;  4DZO A;  1NTM J;  5KKZ C;  3H1H E;  1BCC D;  3AE6 C;  5CHX A;  1KYO H;  3CI9 A;  1EZV E;  2D2C B;  2LKM A;  3RL0 g;  1NKN A;  3MD0 A;  1L0L K;  4H44 C;  3L70 D;  4N78 E;  1KIL A;  1NU1 G;  5CCG A;  1L0N K;  2YXR B;  4QMA A;  1KN7 A;  5C39 A;  3CCL P;  2E76 B;  3KDP B;  2E74 D;  2YKP A;  2YKO A;  3AE2 C;  1RE3 C;  3RK3 B;  1GZL A;  2H88 C;  1NO4 A;  2PGD A;  3FXD A;  1KC8 Q;  1SQP J;  5AVV B;  4IOI H;  2K9Y A;  1SQP E;  2FFD C;  1JY2 O;  4UB6 E;  4LC1 A;  2E43 A;  4IFM A;  1VF5 C;  1IFP A;  2GM4 A;  2ZVO B;  1BGY D;  2Y0D A;  2K9J A;  1PGO A;  4TLF A;  1QVF O;  4YXD C;  2QJY B;  1S9K D;  1FE6 A;  1JMB A;  2ZXX A;  2RH0 A;  1RE4 A;  1SQB J;  1EXJ A;  4GIF A;  3MIW A;  5AVS B;  3CX5 I;  1NTM K;  1VQ9 P;  3H1J E;  1ZLL A;  4Y28 J;  2OYH B;  3QH9 A;  3VP8 A;  2W6B A;  3H1J G;  2IZ0 A;  3Q5R A;  4H0L B;  3CCJ P;  1HH0 A;  2P10 A;  3TGU D;  1VPC A;  3KPE A;  4W7Y A;  2QA4 P;  3CWB G;  5AW4 B;  1KYO I;  1KB9 I;  1BCC J;  2FXO A;  5KJ7 D;  1BCC E;  3CLQ A;  5BU5 A;  1M1J A;  3KYQ A;  3L37 A;  1GD2 E;  2HPC B;  3W68 A;  3BRT B;  5CJ4 A;  5CBO A;  1Q7Y Q;  3L70 E;  1SQP K;  1FDM A;  3L73 G;  3CCS P;  3AEE C;  2O01 J;  3L70 G;  2SPZ A;  2HLO A;  2IBZ D;  2KS1 A;  3M91 A;  1PGP A;  5CCG C;  1KZU B;  1LTJ C;  2FYN B;  1FZE A;  2H8P D;  3LW5 J;  3WMM 0;  1ZP0 C;  1U7J A;  4YPC A;  1P84 I;  1EDJ A;  1SQB K;  2ITA A;  4N3Y B;  3GF7 A;  4WVZ A;  1NGM B;  3RBX A;  4GKG A;  4LLH A;  1EZV I;  1BGY E;  1G1J A;  1H88 A;  1GW4 A;  2ZFC A;  2QJK C;  1OZH A;  1EDK A;  1KIL B;  1S9K E;  5KLV J;  2KZJ A;  1H8A A;  5AVX B;  1DD3 A;  3U1C A;  2BCC J;  2WSF J;  3AE7 C;  3HD7 C;  4U7J A; 
#chains in the Genus database with same CATH homology
 1R5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...