1R5SA

Connexin 43 carboxyl terminal domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
132
structure length
132
Chain Sequence
GPLGSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gap junction alpha-1 protein
publication title Structural changes in the carboxyl terminus of the gap junction protein connexin43 indicates signaling between binding domains for c-Src and zonula occludens-1
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 11
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2003-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03508 Connexin43 Gap junction alpha-1 protein (Cx43)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1130 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Connexin43 1r5sA01
1R5SA
chains in the Genus database with same CATH superfamily
4ZNCA 2G3AA 1QEXA 3U1AA 4WY4B 1IFPA 1SVFA 3LIEA 3V2QA 1H8AA 3E1IA 2WVRA 1Q82Q 2HG5D 3GW6A 2XNDH 1LTGC 4D6TG 1SQPJ 2W6BA 2JWAA 1M7LA 2MJZA 5AVUB 3WUVA 1L4AC 2P7JA 2QEXP 3SWFA 1JEKA 1K04A 3AEFC 3A5TA 2FKWB 3C9IA 1FZAA 2NPSB 3OAKA 3HUSC 1JY3N 5APWA 3FXDA 1W2BO 2ZT9C 1FZBA 1G1JA 1R5SA 3MGNA 3H32B 3L75D 1NHLA 2L91A 1SQQJ 2BCCG 2I8DA 1U7MA 3L71G 3AE6C 3L36A 1EC5A 2WSCJ 3EFFK 5EFWB 2FYUD 1NO4A 3OW2O 2YO3A 2IBZG 2KP8A 2OYOA 2PAJA 1X22A 1NTZD 2GUSA 1MFZA 2WSEJ 1SQPG 4K3AA 1KD1Q 3SFEC 3RGUA 1RE3A 1DD3A 3PTZA 3H1IE 3L70D 2O3JA 1IFNA 3FWLA 3IN6A 5AVTB 1OFCX 4RJTA 5CCGC 4KT0J 3AE3C 4ZKPA 1RF0A 5KLVJ 1KILB 4OGQB 3G9RA 3VOPA 3CCRP 3AE4C 4GKGA 1E79H 3SWYA 2YMYA 3CXHD 1HVVA 3I55P 3V4WA 1SQQG 1VQPP 1Q7YQ 1J1DB 3W68A 3LIDA 2QJYB 4U3FE 3L71E 2QJPB 1HJBA 5KTBA 1S1CX 3P8CE 3H1HD 2YKOA 4AUWA 3PRJA 4OH8B 2QIWA 5AW4B 2A45G 2O01H 2QM8A 3MUDC 1KILE 1KV4A 1FOSF 2HODA 2C0XA 1KQFB 3BCCG 1FZCA 1YHQP 4Y99B 1URQD 1OVRA 2W90A 2MKVA 4I6MC 1URQC 1KC8Q 5AVSB 1AVOA 2CPSA 1SFCD 4JBZA 1VQKP 1NTKJ 1PPJE 2YXRB 1EZVE 4H44B 3WUUA 1SQBE 1IFDA 1SQVJ 2IYOA 1L0LG 1NKZB 4IFMA 1FJKA 1SFCA 2FXPA 3P7KA 1GMJA 4I1LA 1OW6A 2E42A 3L73D 3CWBD 3HE5B 3KHUA 1NAYA 3B4SA 1PP9E 4NPDA 1NU1J 3BCCE 3HTKA 1EZVI 3H1JE 3GHGC 2KK7A 1LJ2A 3CCJP 3HRNA 3TDKA 3F5HA 1GW3A 3BRTB 2M3EA 1IFJA 2ZVOB 5APQA 5M1BA 5BU5A 1AJYA 2E76D 4MN4C 1FE6A 1PIXA 3NFQA 1N73A 5K5GB 2Q6QA 2J5UA 2O1JA 5L8RJ 3CX5E 2GA1A 2V4HA 2WWWA 5APYA 3H1LG 4WWIA 2KIKA 3RL0B 4A7PA 1KZUB 3TGUE 2ITAA 1BGYE 5CJ0A 3K5BA 2IFMA 1X79B 2H7HA 3CX5H 4DJGA 5APSA 1CW5A 3L72G 1VDFA 2IBZD 1RHZB 2KUBA 4CPGA 2D2CB 3CCSP 3CX5I 1LT9C 3WMM0 1R5LA 1SQPD 5AW6B 1QLED 2FBWC 2KNCA 3PH0A 1EDIA 4I7ZC 4AQRD 1OW7A 3A0HE 2E74B 1QGKB 3H6PA 1VQNP 1IFIA 2QE7H 1W2EA 4TT3H 1M57D 1NTMJ 2WPVB 1BE3J 4W7YA 1NTKK 2G8YA 1EXJA 3H1LE 1KFMA 2QSIA 1BCCE 2WT7A 1Q86Q 3N7NA 1SQQD 3Q3DA 1YTZI 1LTIC 3A0HH 4IL6E 2KI7B 4ASWA 3L4FA 1T8ZA 3GF7A 3ABVC 2B87A 1R8EA 2PFXA 2Q7CA 4EOTA 3B5ND 2CK3H 1K8AQ 2M3BA 1PGQA 3RBZA 2W27A 4PV1D 1GK4A 3B5NC 4IL6H 1L0NJ 3NMDA 3VYIA 2W6AA 1VQ8P 1VQ5P 4PV1C 2VRSA 3G3ZA 2ZVNB 3VMZA 5KLVD 1NTMG 1H0TB 1MFTA 3TK1A 4GOEA 4HJGH 2E75D 3RK2B 1G2CA 1BE3G 3QH9A 4RKUJ 3M9BA 2Y0EA 1GL2A 3PLNA 5KJ7D 1QVGO 1KMIZ 1JY2O 5KJ7C 2C0WA 2PGDA 2QM7A 1UIXA 1JY2P 1YIJP 1DIPA 2KZIA 3D70A 1X8YA 1RF1C 4BRYA 3U1CA 5E79E 3N4XA 2OARA 2WSFH 1CI6B 3RK3D 2H89C 3HD7C 3CL3D 2N9BA 2YMKA 2OYHA 3CCVP 1FU1A 2LKMA 5KAFE 5GTHE 4EDFA 1OW8A 3L74G 5E79H 4GIFA 1YITP 1NTZE 1VL2A 2HODB 2A06E 2FYUK 1FZCB 3USSA 2Q5UA 1E5WA 1NTZK 1SQVD 1ZLLA 4D6TJ 1SQXE 5KAFH 5GTHH 4C46A 3H1IJ 2OGUA 1VQOP 2JKVA 2JR8A 2E5YA 4L74A 3G6EP 3E7KA 1JTHA 1NU1D 3CXHE 1XTCC 4EIJA 1KYOD 1KB9E 2Y9YA 1PFIA 1ZN5A 2QVAA 3LW5J 3WUTA 1A02F 1SFCB 2DW3A 4YXDC 4W7ZA 2YIUB 2FFDB 3IFMA 2UWJE 2BCCJ 4C7NA 3L74E 2P58A 3M0DC 5AW5B 1FDOA 3L71J 1LWUC 1X9VA 3CXHH 3HTKB 2M5AA 3IAOA 3SFDC 1KB9H 5TJHA 1JOCA 1HGVA 2ZJSE 1KB9I 2N1TC 1L4AD 1MZ9A 3H1IG 2OTKE 5H2FE 2M0BA 4PD4D 2WMMA 2ZT9D 2ZFCA 1OWAA 3AEBC 1N7SC 2KLVA 1SLQA 2ZYGA 1L4AA 1N73B 4YXWH 1NKNA 1SQBJ 4ZKUA 5CCHC 3W67A 5H2FH 1FAVA 4U3FG 3HUSA 2HPCA 1DX7A 3H1KE 1ZMEC 2AEJA 3L73E 3CWBE 1IK9A 2E76B 3L37A 5GTIE 1K05A 1LTJC 2IZ0A 1M1JC 1EDJA 1PL5A 1DEEG 1GU5A 1LTAC 3BCCJ 5CCGD 1NTMD 1S3JA 3KYQA 1LTJA 3PP5A 1BE3D 1X0TA 2YO2A 1J1EB 1PGPA 1IC2A 5GTIH 3ZDMA 1YJWP 2KNCB 2OYIC 1YQ4C 3MD0A 4L75A 2IPPA 2B9BA 5AVVB 1PPJG 1ZRTD 5AW1B 1EZVG 5CCGA 3FXEA 1K73Q 1SQBG 3MIWA 5KKZC 1MV8A 3KQGA 2OYIA 3S4RA 5AW8B 2WT7B 1L0LJ 2B88A 1HTLC 2W6JH 2XU6A 2AXTE 4H13D 5AVQB 1L0ND 4AYCA 5KAIE 2Y0DA 4H13C 1JMMA 1PP9G 4LLHA 4H0LB 3S1KA 2B87B 3H1JG 1WT6A 1YI2P 3TGUJ 5CMZA 1W5CE 1VF5B 1MKMA 3MUDA 3GLMA 2AXTH 3O6QA 4JYCA 3GF3A 2QJKC 1N2DC 4JYBA 2P10A 2RN0A 4EYYQ 5KAIH 5APUA 1OX3A 4XA4A 3VP8A 1SQPK 4XE5B 1G1IA 3VMXA 1JNMA 1URQA 4YPCA 1YYCA 4LC1A 1OVVA 3KZIE 1MUUA 1GL2B 3CCEP 3AE1C 3VMYA 3I56P 2Z5HA 5CBNA 4WY4C 2POHA 3H1LJ 1J2JB 2B89A 1QL1A 3AE5C 2E75B 2ZYAA 3AEGC 1YTZT 1SQQK 3A7OA 1SS1A 1IFMA 3TGUG 4BRYB 1BGYG 1JY3O 3KZIH 1S9KE 3FWNA 2JDIH 1JY3P 3L72J 1BDCA 4D6TD 2P67A 2OYHB 3GHGA 2NPSD 2O1KA 4Z1MH 2WSCH 3SWKA 3G71P 3H1ID 2R5BA 3TSIA 2JWDA 2ZXXA 1ZV8A 2JEEA 5KLVE 2KZJA 2NPSC 3OJAB 3RK3B 2WSEH 2IFNA 4DCKA 5KLVK 5DJUB 2R32A 2WPQA 2Y9ZA 1BCCG 2K9YA 1P84E 1KFNA 2AEFA 3PJSK 1FJPA 1Y9BA 2BCCD 3ITKA 1JB0J 3RL0g 1EDKA 3L71D 3MP7B 4GT1A 4W80A 2WPSA 2YNYA 5KLIB 4UB8E 3RK3E 3TNUB 1P84H 2H43A 3TF5A 4OGQD 2KSEA 2FYZA 1OIPA 1P84I 3OA7A 1KILC 4OGQC 2V7QJ 4C7NB 2FYNB 4WB4A 1LT9A 1NTKE 2M5AB 4UB8H 4LGDE 3M0AA 1HF9A 1J1DC 2QJYC 1SQVE 3MTUE 1PPJD 1FZGA 1EZVD 1KORA 2QJPC 1SQBD 4B86A 1GK6A 1SQVK 3CCUP 4UB6E 3CMEP 1RE4C 4EI2A 4L73A 1SQXJ 4YTPC 5B66E 2KOGA 3CC7P 1IZNB 4HH2A 1L4AB 4Y99C 2GM4A 3GG2A 1NU1K 3BCCD 3M9HA 4UB6H 2R3CA 2P1JA 2HR3A 4OWFA 3HUSB 2GUVA 2ZT9B 3HE4A 5B66H 2R3SA 1CSBA 4H44C 1JCCA 3Q5PA 1XTGB 2FYUG 3B5NA 5AVRB 3L74J 1NTZG 1FBMA 2A06G 2BEZF 2I1KA 3T97A 4DZOA 4IFDK 2W8ZA 3VTPC 1SQXG 1LTSC 1OMIA 1L0LD 3CC4P 2KSJA 1SP4A 1HJ0A 3A0BE 3JCUE 2RMZA 3NTNA 3BATA 4DT0A 4O9BA 3HD7D 5KJ7A 3CCMP 3L75E 2Z4EA 5CBOA 3TGUD 3H25A 1RF1A 4JPZB 3VMAA 2AEMA 3A0BH 1ZR4A 3D6YA 1IK7A 3JCUH 2FYUE 3HD7A 3H1KJ 4C7RA 1LT1A 2ZXEB 2L5GB 3BASA 3F89A 3L70E 1Q81Q 3E1RA 2XZRA 1LP1A 4IFFA 2E43A 1FZFA 2OTLP 3M9QA 3O6QB 3UIAA 1NTMK 2JJLA 3AECC 1AQ5A 4L76A 5AVXB 3IR9A 3RL0C 3H1LD 2WSSH 3KPEA 2NZ2A 1URQB 2O01J 3CMAP 1M56D 2D2CC 1JCDA 1FZEA 4K35A 4QMAA 1ZW0A 2JO1A 1L2PA 3L72D 1DEBA 2E74D 3H1HE 1NAFA 4U3FJ 3H1KG 5AW0B 3R4YA 1L0NE 3L73G 3CWBG 2E74C 2O01N 1L0NK 4WVZA 2N1TD 1AA0A 1FS0E 3CXHI 2LR2A 4I2LC 2QA4P 3M0DA 1U7JA 1LWUA 1EDLA 1HH0A 1KQLA 2H88C 1NYHA 1KQSO 3C1LA 2XNXA 4N78D 1N7SD 3GHGB 3JC22 4GODA 2N1TA 4TLFA 4M3LA 3CCQP 1ZOYC 5CCHD 2OQQA 2Q3EA 2YXQB 1FDIA 3V2NA 1M90Q 2FXMA 1CZQA 1PGOA 2QG4A 1N7SA 2BASA 2HFED 3AE7C 1YBKA 3JSVC 1LTTC 2RKLA 3RK2D 1USDA 5CCHA 1S4XA 3RK2C 1K9MQ 1QL2A 3A2AA 2YKQA 1PP9J 3NXSA 1RE3C 1DH3A 1RQVA 3H1JJ 4HB1A 1FDMA 1VQLP 1H0TA 1KTMA 1M1JA 3MHVA 1NWQA 2KLUA 2A06D 4D6TE 1RF0C 1QVFO 1A02J 1T3UA 1GW4A 4XFJA 1VQ6P 3KXDA 1TU3F 3B8EB 3AE9C 1SQXD 2HLOA 1Z56A 2IX7C 1LT9B 2KS1A 3M91A 1HUCA 2XDJA 1JO5A 2I1JA 4I7ZB 3EWKA 1RQUA 5AVZB 3BVHA 1S5LX 1YJNP 2FXOA 1DD4A 1HBWA 5C39A 1CI6A 1KB9D 4PJ0E 2BCCE 1Q90D 1FZCC 1AFOA 1D7MA 1ZP0C 3L74D 5AW2B 3A3YB 2IBZE 1OXZA 1BGYJ 4NPFX 2N9YB 3V2RA 1WRGA 3LW5H 2J59M 4KJMA 3VN0A 5BVZA 1KQGB 1SQPE 4PJ0H 1VQ9P 4OVNF 3HE4B 1S5LE 1LNQA 2K37A 1NJIQ 3B5NB 1UIIA 5AVWB 1HGZA 1ZR2A 5KLVG 1G2CB 2Z5IA 2K9JA 3CC2P 2NRGA 4PV1B 2IBZI 4WY4D 3G4SP 5APXA 1SFCC 3T97B 1BDDA 3BRVB 2PRRA 2YIUC 2FFDC 1SQQE 2JP3A 2WPRA 1N7LA 2FY8A 1S5LH 2Q1KA 1WMKA 1BCCJ 1SQBK 3MZWB 2ZAEB 3II6A 2FFDA 4WY4A 3H1KD 1IJDB 3CD6P 2KYVA 3AEEC 3U59A 1GTWA 1RF1B 4ASVA 3D6ZA 1BSNA 2SPZA 3D71A 1Q2NA 2WQYC 1USEA 4GOFA 1YQ3C 3HD7B 3KDPB 4GDOA 2A45H 3V4QA 1JY2N 1VQ4P 5BU8B 1N73C 1HWTC 1NTKG 1OZHA 2A45I 2H8PD 1Y47A 3AEDC 3FGAD 1SQVG 2HYNA 4HKZH 2NPSA 1LP1B 1N8RQ 3WU2E 4U7JA 2OTJP 2XV5A 3H32A 2WSFJ 3V6IA 1L0LE 1M1KQ 2E76C 3AE8C 4WBAA 1LGHB 4R4MA 4U3FD 1PV3A 1AV1A 1L0LK 2LXBA 1JTHB 1T6AA 3P8CD 1T3JA 3O8ZA 1JUNA 1NU1G 3PHLA 1YJ9P 3WU2H 1KILD 3P32A 3L75J 1J1EC 1VPCA 2IDBA 3CI9A 1PGJA 1T2KD 1VQMP 2K88A 2ZYDA 4IL6X 2Q3IA 3TYYA 5AW7B 5DJTB 2K1AA 1T2KC 2BEQD 1H88A 2FYUJ 3EFGA 3CCLP 1KILA 1NTZJ 1QX8A 1LWUB 1AQTA 2E5TA 1JMBA 3FX0A 1M8OB 5AW9B 5B5EE 3L70J 2R5DA 4H0LD 1IO4A 4N6JA 1GDTA 1GZLA 2N1TB 1EQ7A 4H0LC 2R44A 4NPEA 4N3YB 5APVA 1NU1E 1VF5D 3Q1MA 1RY3A 4Y28J 3SSUA 1KYOE 1RE4A 3L75G 1VF5C 1PP9D 2C9LY 5B5EH 1N7SB 3H1JD 1H89A 3C8VA 4H44D 1S72P 2HPCB 3L72E 1S9KD 4RESB 1VQ7P 2RH0A 5AW3B 5CHXA 2J58A 3IF4A 3H1HJ 1NOHA 1KYOH 5TISE 1GL2D 2WTYA 3QWOC 1KYOI 4BWNA 1GL2C 2LXCB 1RH5B 2K3RA 1FOSE 3L70G 4IOIH 1LTJB 1M1JB 4ZMDA 5AVYB 1KN7A 3P8MC 2IZ1A 4N78E 1ZXGA 2E75C 3V2PA 3AE2C 3CX5D 1AVYA 5TISH 4PD4E 2KB7P 2IYPA 4DOJA 2KS1B 1P84D 3B71A 4JF7A 2AXCA 3HE5A 2W83C 1GU4A 1FC2C 3Q2YA 1NH4A 4RO0A 2YKPA 2OYIB 2Y0CA 1BGYD 1Y8AA 4R4LA 2OYHC 4PD4H 5KKZB 3H1HG 3Q5RA 1N86A 1U57A 1L0NG 4PD4I 3L73J 3CWBJ 3RK3C 3CLQA 2KXPB 1S2EA 4KHXA 2Q9IA 1LTBC 3V5BA 1NTME 4BXLA 3M06A 3Q5SA 1GD2E 2CPBA 2XKMA 1BE3E 4H13B 1NTKD 1NGMB 4HYTB 3RL0D 3VP9A 3I5CA 3GMAA 2PP6A 1BSHA 3S9OA 2V7QH 1PZQA 2WITA 4JQ0D 1OVUA 1BCCD 5CJ4A 1ZRTE 1JM0A 5APTA 3R2PA 2D2CD 2QJKB 5KLIC 2K9JB 3AEAC 1SQXK 2QRXA 2C9NY 2M8RA 2P2UA 3CPWO 2FYNC 3L35A 3TNUA 3RBXA 2WZ7A 1EXIA 3EQ2A 1NVOA
chains in the Genus database with same CATH topology
1R5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5S A; 
#chains in the Genus database with same CATH topology
 4ZNC A;  2G3A A;  1QEX A;  3U1A A;  4WY4 B;  1IFP A;  1SVF A;  3LIE A;  3V2Q A;  1H8A A;  3E1I A;  2WVR A;  1Q82 Q;  2HG5 D;  3GW6 A;  2XND H;  1LTG C;  4D6T G;  1SQP J;  2W6B A;  2JWA A;  1M7L A;  2MJZ A;  5AVU B;  3WUV A;  1L4A C;  2P7J A;  2QEX P;  3SWF A;  1JEK A;  1K04 A;  3AEF C;  3A5T A;  2FKW B;  3C9I A;  1FZA A;  2NPS B;  3OAK A;  3HUS C;  1JY3 N;  5APW A;  3FXD A;  1W2B O;  2ZT9 C;  1FZB A;  1G1J A;  1R5S A;  3MGN A;  3H32 B;  3L75 D;  1NHL A;  2L91 A;  1SQQ J;  2BCC G;  2I8D A;  1U7M A;  3L71 G;  3AE6 C;  3L36 A;  1EC5 A;  2WSC J;  3EFF K;  5EFW B;  2FYU D;  1NO4 A;  3OW2 O;  2YO3 A;  2IBZ G;  2KP8 A;  2OYO A;  2PAJ A;  1X22 A;  1NTZ D;  2GUS A;  1MFZ A;  2WSE J;  1SQP G;  4K3A A;  1KD1 Q;  3SFE C;  3RGU A;  1RE3 A;  1DD3 A;  3PTZ A;  3H1I E;  3L70 D;  2O3J A;  1IFN A;  3FWL A;  3IN6 A;  5AVT B;  1OFC X;  4RJT A;  5CCG C;  4KT0 J;  3AE3 C;  4ZKP A;  1RF0 A;  5KLV J;  1KIL B;  4OGQ B;  3G9R A;  3VOP A;  3CCR P;  3AE4 C;  4GKG A;  1E79 H;  3SWY A;  2YMY A;  3CXH D;  1HVV A;  3I55 P;  3V4W A;  1SQQ G;  1VQP P;  1Q7Y Q;  1J1D B;  3W68 A;  3LID A;  2QJY B;  4U3F E;  3L71 E;  2QJP B;  1HJB A;  5KTB A;  1S1C X;  3P8C E;  3H1H D;  2YKO A;  4AUW A;  3PRJ A;  4OH8 B;  2QIW A;  5AW4 B;  2A45 G;  2O01 H;  2QM8 A;  3MUD C;  1KIL E;  1KV4 A;  1FOS F;  2HOD A;  2C0X A;  1KQF B;  3BCC G;  1FZC A;  1YHQ P;  4Y99 B;  1URQ D;  1OVR A;  2W90 A;  2MKV A;  4I6M C;  1URQ C;  1KC8 Q;  5AVS B;  1AVO A;  2CPS A;  1SFC D;  4JBZ A;  1VQK P;  1NTK J;  1PPJ E;  2YXR B;  1EZV E;  4H44 B;  3WUU A;  1SQB E;  1IFD A;  1SQV J;  2IYO A;  1L0L G;  1NKZ B;  4IFM A;  1FJK A;  1SFC A;  2FXP A;  3P7K A;  1GMJ A;  4I1L A;  1OW6 A;  2E42 A;  3L73 D;  3CWB D;  3HE5 B;  3KHU A;  1NAY A;  3B4S A;  1PP9 E;  4NPD A;  1NU1 J;  3BCC E;  3HTK A;  1EZV I;  3H1J E;  3GHG C;  2KK7 A;  1LJ2 A;  3CCJ P;  3HRN A;  3TDK A;  3F5H A;  1GW3 A;  3BRT B;  2M3E A;  1IFJ A;  2ZVO B;  5APQ A;  5M1B A;  5BU5 A;  1AJY A;  2E76 D;  4MN4 C;  1FE6 A;  1PIX A;  3NFQ A;  1N73 A;  5K5G B;  2Q6Q A;  2J5U A;  2O1J A;  5L8R J;  3CX5 E;  2GA1 A;  2V4H A;  2WWW A;  5APY A;  3H1L G;  4WWI A;  2KIK A;  3RL0 B;  4A7P A;  1KZU B;  3TGU E;  2ITA A;  1BGY E;  5CJ0 A;  3K5B A;  2IFM A;  1X79 B;  2H7H A;  3CX5 H;  4DJG A;  5APS A;  1CW5 A;  3L72 G;  1VDF A;  2IBZ D;  1RHZ B;  2KUB A;  4CPG A;  2D2C B;  3CCS P;  3CX5 I;  1LT9 C;  3WMM 0;  1R5L A;  1SQP D;  5AW6 B;  1QLE D;  2FBW C;  2KNC A;  3PH0 A;  1EDI A;  4I7Z C;  4AQR D;  1OW7 A;  3A0H E;  2E74 B;  1QGK B;  3H6P A;  1VQN P;  1IFI A;  2QE7 H;  1W2E A;  4TT3 H;  1M57 D;  1NTM J;  2WPV B;  1BE3 J;  4W7Y A;  1NTK K;  2G8Y A;  1EXJ A;  3H1L E;  1KFM A;  2QSI A;  1BCC E;  2WT7 A;  1Q86 Q;  3N7N A;  1SQQ D;  3Q3D A;  1YTZ I;  1LTI C;  3A0H H;  4IL6 E;  2KI7 B;  4ASW A;  3L4F A;  1T8Z A;  3GF7 A;  3ABV C;  2B87 A;  1R8E A;  2PFX A;  2Q7C A;  4EOT A;  3B5N D;  2CK3 H;  1K8A Q;  2M3B A;  1PGQ A;  3RBZ A;  2W27 A;  4PV1 D;  1GK4 A;  3B5N C;  4IL6 H;  1L0N J;  3NMD A;  3VYI A;  2W6A A;  1VQ8 P;  1VQ5 P;  4PV1 C;  2VRS A;  3G3Z A;  2ZVN B;  3VMZ A;  5KLV D;  1NTM G;  1H0T B;  1MFT A;  3TK1 A;  4GOE A;  4HJG H;  2E75 D;  3RK2 B;  1G2C A;  1BE3 G;  3QH9 A;  4RKU J;  3M9B A;  2Y0E A;  1GL2 A;  3PLN A;  5KJ7 D;  1QVG O;  1KMI Z;  1JY2 O;  5KJ7 C;  2C0W A;  2PGD A;  2QM7 A;  1UIX A;  1JY2 P;  1YIJ P;  1DIP A;  2KZI A;  3D70 A;  1X8Y A;  1RF1 C;  4BRY A;  3U1C A;  5E79 E;  3N4X A;  2OAR A;  2WSF H;  1CI6 B;  3RK3 D;  2H89 C;  3HD7 C;  3CL3 D;  2N9B A;  2YMK A;  2OYH A;  3CCV P;  1FU1 A;  2LKM A;  5KAF E;  5GTH E;  4EDF A;  1OW8 A;  3L74 G;  5E79 H;  4GIF A;  1YIT P;  1NTZ E;  1VL2 A;  2HOD B;  2A06 E;  2FYU K;  1FZC B;  3USS A;  2Q5U A;  1E5W A;  1NTZ K;  1SQV D;  1ZLL A;  4D6T J;  1SQX E;  5KAF H;  5GTH H;  4C46 A;  3H1I J;  2OGU A;  1VQO P;  2JKV A;  2JR8 A;  2E5Y A;  4L74 A;  3G6E P;  3E7K A;  1JTH A;  1NU1 D;  3CXH E;  1XTC C;  4EIJ A;  1KYO D;  1KB9 E;  2Y9Y A;  1PFI A;  1ZN5 A;  2QVA A;  3LW5 J;  3WUT A;  1A02 F;  1SFC B;  2DW3 A;  4YXD C;  4W7Z A;  2YIU B;  2FFD B;  3IFM A;  2UWJ E;  2BCC J;  4C7N A;  3L74 E;  2P58 A;  3M0D C;  5AW5 B;  1FDO A;  3L71 J;  1LWU C;  1X9V A;  3CXH H;  3HTK B;  2M5A A;  3IAO A;  3SFD C;  1KB9 H;  5TJH A;  1JOC A;  1HGV A;  2ZJS E;  1KB9 I;  2N1T C;  1L4A D;  1MZ9 A;  3H1I G;  2OTK E;  5H2F E;  2M0B A;  4PD4 D;  2WMM A;  2ZT9 D;  2ZFC A;  1OWA A;  3AEB C;  1N7S C;  2KLV A;  1SLQ A;  2ZYG A;  1L4A A;  1N73 B;  4YXW H;  1NKN A;  1SQB J;  4ZKU A;  5CCH C;  3W67 A;  5H2F H;  1FAV A;  4U3F G;  3HUS A;  2HPC A;  1DX7 A;  3H1K E;  1ZME C;  2AEJ A;  3L73 E;  3CWB E;  1IK9 A;  2E76 B;  3L37 A;  5GTI E;  1K05 A;  1LTJ C;  2IZ0 A;  1M1J C;  1EDJ A;  1PL5 A;  1DEE G;  1GU5 A;  1LTA C;  3BCC J;  5CCG D;  1NTM D;  1S3J A;  3KYQ A;  1LTJ A;  3PP5 A;  1BE3 D;  1X0T A;  2YO2 A;  1J1E B;  1PGP A;  1IC2 A;  5GTI H;  3ZDM A;  1YJW P;  2KNC B;  2OYI C;  1YQ4 C;  3MD0 A;  4L75 A;  2IPP A;  2B9B A;  5AVV B;  1PPJ G;  1ZRT D;  5AW1 B;  1EZV G;  5CCG A;  3FXE A;  1K73 Q;  1SQB G;  3MIW A;  5KKZ C;  1MV8 A;  3KQG A;  2OYI A;  3S4R A;  5AW8 B;  2WT7 B;  1L0L J;  2B88 A;  1HTL C;  2W6J H;  2XU6 A;  2AXT E;  4H13 D;  5AVQ B;  1L0N D;  4AYC A;  5KAI E;  2Y0D A;  4H13 C;  1JMM A;  1PP9 G;  4LLH A;  4H0L B;  3S1K A;  2B87 B;  3H1J G;  1WT6 A;  1YI2 P;  3TGU J;  5CMZ A;  1W5C E;  1VF5 B;  1MKM A;  3MUD A;  3GLM A;  2AXT H;  3O6Q A;  4JYC A;  3GF3 A;  2QJK C;  1N2D C;  4JYB A;  2P10 A;  2RN0 A;  4EYY Q;  5KAI H;  5APU A;  1OX3 A;  4XA4 A;  3VP8 A;  1SQP K;  4XE5 B;  1G1I A;  3VMX A;  1JNM A;  1URQ A;  4YPC A;  1YYC A;  4LC1 A;  1OVV A;  3KZI E;  1MUU A;  1GL2 B;  3CCE P;  3AE1 C;  3VMY A;  3I56 P;  2Z5H A;  5CBN A;  4WY4 C;  2POH A;  3H1L J;  1J2J B;  2B89 A;  1QL1 A;  3AE5 C;  2E75 B;  2ZYA A;  3AEG C;  1YTZ T;  1SQQ K;  3A7O A;  1SS1 A;  1IFM A;  3TGU G;  4BRY B;  1BGY G;  1JY3 O;  3KZI H;  1S9K E;  3FWN A;  2JDI H;  1JY3 P;  3L72 J;  1BDC A;  4D6T D;  2P67 A;  2OYH B;  3GHG A;  2NPS D;  2O1K A;  4Z1M H;  2WSC H;  3SWK A;  3G71 P;  3H1I D;  2R5B A;  3TSI A;  2JWD A;  2ZXX A;  1ZV8 A;  2JEE A;  5KLV E;  2KZJ A;  2NPS C;  3OJA B;  3RK3 B;  2WSE H;  2IFN A;  4DCK A;  5KLV K;  5DJU B;  2R32 A;  2WPQ A;  2Y9Z A;  1BCC G;  2K9Y A;  1P84 E;  1KFN A;  2AEF A;  3PJS K;  1FJP A;  1Y9B A;  2BCC D;  3ITK A;  1JB0 J;  3RL0 g;  1EDK A;  3L71 D;  3MP7 B;  4GT1 A;  4W80 A;  2WPS A;  2YNY A;  5KLI B;  4UB8 E;  3RK3 E;  3TNU B;  1P84 H;  2H43 A;  3TF5 A;  4OGQ D;  2KSE A;  2FYZ A;  1OIP A;  1P84 I;  3OA7 A;  1KIL C;  4OGQ C;  2V7Q J;  4C7N B;  2FYN B;  4WB4 A;  1LT9 A;  1NTK E;  2M5A B;  4UB8 H;  4LGD E;  3M0A A;  1HF9 A;  1J1D C;  2QJY C;  1SQV E;  3MTU E;  1PPJ D;  1FZG A;  1EZV D;  1KOR A;  2QJP C;  1SQB D;  4B86 A;  1GK6 A;  1SQV K;  3CCU P;  4UB6 E;  3CME P;  1RE4 C;  4EI2 A;  4L73 A;  1SQX J;  4YTP C;  5B66 E;  2KOG A;  3CC7 P;  1IZN B;  4HH2 A;  1L4A B;  4Y99 C;  2GM4 A;  3GG2 A;  1NU1 K;  3BCC D;  3M9H A;  4UB6 H;  2R3C A;  2P1J A;  2HR3 A;  4OWF A;  3HUS B;  2GUV A;  2ZT9 B;  3HE4 A;  5B66 H;  2R3S A;  1CSB A;  4H44 C;  1JCC A;  3Q5P A;  1XTG B;  2FYU G;  3B5N A;  5AVR B;  3L74 J;  1NTZ G;  1FBM A;  2A06 G;  2BEZ F;  2I1K A;  3T97 A;  4DZO A;  4IFD K;  2W8Z A;  3VTP C;  1SQX G;  1LTS C;  1OMI A;  1L0L D;  3CC4 P;  2KSJ A;  1SP4 A;  1HJ0 A;  3A0B E;  3JCU E;  2RMZ A;  3NTN A;  3BAT A;  4DT0 A;  4O9B A;  3HD7 D;  5KJ7 A;  3CCM P;  3L75 E;  2Z4E A;  5CBO A;  3TGU D;  3H25 A;  1RF1 A;  4JPZ B;  3VMA A;  2AEM A;  3A0B H;  1ZR4 A;  3D6Y A;  1IK7 A;  3JCU H;  2FYU E;  3HD7 A;  3H1K J;  4C7R A;  1LT1 A;  2ZXE B;  2L5G B;  3BAS A;  3F89 A;  3L70 E;  1Q81 Q;  3E1R A;  2XZR A;  1LP1 A;  4IFF A;  2E43 A;  1FZF A;  2OTL P;  3M9Q A;  3O6Q B;  3UIA A;  1NTM K;  2JJL A;  3AEC C;  1AQ5 A;  4L76 A;  5AVX B;  3IR9 A;  3RL0 C;  3H1L D;  2WSS H;  3KPE A;  2NZ2 A;  1URQ B;  2O01 J;  3CMA P;  1M56 D;  2D2C C;  1JCD A;  1FZE A;  4K35 A;  4QMA A;  1ZW0 A;  2JO1 A;  1L2P A;  3L72 D;  1DEB A;  2E74 D;  3H1H E;  1NAF A;  4U3F J;  3H1K G;  5AW0 B;  3R4Y A;  1L0N E;  3L73 G;  3CWB G;  2E74 C;  2O01 N;  1L0N K;  4WVZ A;  2N1T D;  1AA0 A;  1FS0 E;  3CXH I;  2LR2 A;  4I2L C;  2QA4 P;  3M0D A;  1U7J A;  1LWU A;  1EDL A;  1HH0 A;  1KQL A;  2H88 C;  1NYH A;  1KQS O;  3C1L A;  2XNX A;  4N78 D;  1N7S D;  3GHG B;  3JC2 2;  4GOD A;  2N1T A;  4TLF A;  4M3L A;  3CCQ P;  1ZOY C;  5CCH D;  2OQQ A;  2Q3E A;  2YXQ B;  1FDI A;  3V2N A;  1M90 Q;  2FXM A;  1CZQ A;  1PGO A;  2QG4 A;  1N7S A;  2BAS A;  2HFE D;  3AE7 C;  1YBK A;  3JSV C;  1LTT C;  2RKL A;  3RK2 D;  1USD A;  5CCH A;  1S4X A;  3RK2 C;  1K9M Q;  1QL2 A;  3A2A A;  2YKQ A;  1PP9 J;  3NXS A;  1RE3 C;  1DH3 A;  1RQV A;  3H1J J;  4HB1 A;  1FDM A;  1VQL P;  1H0T A;  1KTM A;  1M1J A;  3MHV A;  1NWQ A;  2KLU A;  2A06 D;  4D6T E;  1RF0 C;  1QVF O;  1A02 J;  1T3U A;  1GW4 A;  4XFJ A;  1VQ6 P;  3KXD A;  1TU3 F;  3B8E B;  3AE9 C;  1SQX D;  2HLO A;  1Z56 A;  2IX7 C;  1LT9 B;  2KS1 A;  3M91 A;  1HUC A;  2XDJ A;  1JO5 A;  2I1J A;  4I7Z B;  3EWK A;  1RQU A;  5AVZ B;  3BVH A;  1S5L X;  1YJN P;  2FXO A;  1DD4 A;  1HBW A;  5C39 A;  1CI6 A;  1KB9 D;  4PJ0 E;  2BCC E;  1Q90 D;  1FZC C;  1AFO A;  1D7M A;  1ZP0 C;  3L74 D;  5AW2 B;  3A3Y B;  2IBZ E;  1OXZ A;  1BGY J;  4NPF X;  2N9Y B;  3V2R A;  1WRG A;  3LW5 H;  2J59 M;  4KJM A;  3VN0 A;  5BVZ A;  1KQG B;  1SQP E;  4PJ0 H;  1VQ9 P;  4OVN F;  3HE4 B;  1S5L E;  1LNQ A;  2K37 A;  1NJI Q;  3B5N B;  1UII A;  5AVW B;  1HGZ A;  1ZR2 A;  5KLV G;  1G2C B;  2Z5I A;  2K9J A;  3CC2 P;  2NRG A;  4PV1 B;  2IBZ I;  4WY4 D;  3G4S P;  5APX A;  1SFC C;  3T97 B;  1BDD A;  3BRV B;  2PRR A;  2YIU C;  2FFD C;  1SQQ E;  2JP3 A;  2WPR A;  1N7L A;  2FY8 A;  1S5L H;  2Q1K A;  1WMK A;  1BCC J;  1SQB K;  3MZW B;  2ZAE B;  3II6 A;  2FFD A;  4WY4 A;  3H1K D;  1IJD B;  3CD6 P;  2KYV A;  3AEE C;  3U59 A;  1GTW A;  1RF1 B;  4ASV A;  3D6Z A;  1BSN A;  2SPZ A;  3D71 A;  1Q2N A;  2WQY C;  1USE A;  4GOF A;  1YQ3 C;  3HD7 B;  3KDP B;  4GDO A;  2A45 H;  3V4Q A;  1JY2 N;  1VQ4 P;  5BU8 B;  1N73 C;  1HWT C;  1NTK G;  1OZH A;  2A45 I;  2H8P D;  1Y47 A;  3AED C;  3FGA D;  1SQV G;  2HYN A;  4HKZ H;  2NPS A;  1LP1 B;  1N8R Q;  3WU2 E;  4U7J A;  2OTJ P;  2XV5 A;  3H32 A;  2WSF J;  3V6I A;  1L0L E;  1M1K Q;  2E76 C;  3AE8 C;  4WBA A;  1LGH B;  4R4M A;  4U3F D;  1PV3 A;  1AV1 A;  1L0L K;  2LXB A;  1JTH B;  1T6A A;  3P8C D;  1T3J A;  3O8Z A;  1JUN A;  1NU1 G;  3PHL A;  1YJ9 P;  3WU2 H;  1KIL D;  3P32 A;  3L75 J;  1J1E C;  1VPC A;  2IDB A;  3CI9 A;  1PGJ A;  1T2K D;  1VQM P;  2K88 A;  2ZYD A;  4IL6 X;  2Q3I A;  3TYY A;  5AW7 B;  5DJT B;  2K1A A;  1T2K C;  2BEQ D;  1H88 A;  2FYU J;  3EFG A;  3CCL P;  1KIL A;  1NTZ J;  1QX8 A;  1LWU B;  1AQT A;  2E5T A;  1JMB A;  3FX0 A;  1M8O B;  5AW9 B;  5B5E E;  3L70 J;  2R5D A;  4H0L D;  1IO4 A;  4N6J A;  1GDT A;  1GZL A;  2N1T B;  1EQ7 A;  4H0L C;  2R44 A;  4NPE A;  4N3Y B;  5APV A;  1NU1 E;  1VF5 D;  3Q1M A;  1RY3 A;  4Y28 J;  3SSU A;  1KYO E;  1RE4 A;  3L75 G;  1VF5 C;  1PP9 D;  2C9L Y;  5B5E H;  1N7S B;  3H1J D;  1H89 A;  3C8V A;  4H44 D;  1S72 P;  2HPC B;  3L72 E;  1S9K D;  4RES B;  1VQ7 P;  2RH0 A;  5AW3 B;  5CHX A;  2J58 A;  3IF4 A;  3H1H J;  1NOH A;  1KYO H;  5TIS E;  1GL2 D;  2WTY A;  3QWO C;  1KYO I;  4BWN A;  1GL2 C;  2LXC B;  1RH5 B;  2K3R A;  1FOS E;  3L70 G;  4IOI H;  1LTJ B;  1M1J B;  4ZMD A;  5AVY B;  1KN7 A;  3P8M C;  2IZ1 A;  4N78 E;  1ZXG A;  2E75 C;  3V2P A;  3AE2 C;  3CX5 D;  1AVY A;  5TIS H;  4PD4 E;  2KB7 P;  2IYP A;  4DOJ A;  2KS1 B;  1P84 D;  3B71 A;  4JF7 A;  2AXC A;  3HE5 A;  2W83 C;  1GU4 A;  1FC2 C;  3Q2Y A;  1NH4 A;  4RO0 A;  2YKP A;  2OYI B;  2Y0C A;  1BGY D;  1Y8A A;  4R4L A;  2OYH C;  4PD4 H;  5KKZ B;  3H1H G;  3Q5R A;  1N86 A;  1U57 A;  1L0N G;  4PD4 I;  3L73 J;  3CWB J;  3RK3 C;  3CLQ A;  2KXP B;  1S2E A;  4KHX A;  2Q9I A;  1LTB C;  3V5B A;  1NTM E;  4BXL A;  3M06 A;  3Q5S A;  1GD2 E;  2CPB A;  2XKM A;  1BE3 E;  4H13 B;  1NTK D;  1NGM B;  4HYT B;  3RL0 D;  3VP9 A;  3I5C A;  3GMA A;  2PP6 A;  1BSH A;  3S9O A;  2V7Q H;  1PZQ A;  2WIT A;  4JQ0 D;  1OVU A;  1BCC D;  5CJ4 A;  1ZRT E;  1JM0 A;  5APT A;  3R2P A;  2D2C D;  2QJK B;  5KLI C;  2K9J B;  3AEA C;  1SQX K;  2QRX A;  2C9N Y;  2M8R A;  2P2U A;  3CPW O;  2FYN C;  3L35 A;  3TNU A;  3RBX A;  2WZ7 A;  1EXI A;  3EQ2 A;  1NVO A; 
#chains in the Genus database with same CATH homology
 1R5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...