1R5SA

Connexin 43 carboxyl terminal domain
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
132
structure length
132
Chain Sequence
GPLGSPSKDCGSPKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNAKKVAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gap junction alpha-1 protein
publication title Structural changes in the carboxyl terminus of the gap junction protein connexin43 indicates signaling between binding domains for c-Src and zonula occludens-1
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 11
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2003-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03508 Connexin43 Gap junction alpha-1 protein (Cx43)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1130 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Connexin43 1r5sA01
1R5SA
chains in the Genus database with same CATH superfamily
4RJTA 4ASWA 1H89A 3HD7A 3E1IA 3CXHE 3CXHH 2KLVA 2C0XA 3L70D 3P7KA 1JCDA 1N7SB 2HPCA 3Q3DA 2ZT9C 2WSFH 1LP1A 3L37A 5AW0B 4AQRD 1U57A 4L74A 4I1LA 1ZR4A 1KILE 3L35A 3GLMA 5AW5B 1T3JA 3BCCJ 3CCVP 3BCCG 2O1KA 2QIWA 3I55P 1DX7A 2N1TB 4PV1D 1JM0A 1HJBA 2FYUJ 4JF7A 4KJMA 3BATA 5AVYB 3L72J 3L72G 2KB7P 1AQTA 1ZLLA 4YXDC 1KORA 3QH9A 1HGZA 3H1LJ 4N3YB 4U3FJ 2YMYA 3H1LG 4U3FG 2ZAEB 4EYYQ 3N7NA 4PD4E 4PD4H 3SFDC 2ZJSE 1NWQA 2NPSD 1PPJE 3CXHI 3IN6A 3L71E 2E75D 2LR2A 2BCCD 4WY4D 3S4RA 2IBZG 3AE1C 2UWJE 3BRVB 2YMKA 1YYCA 2O01H 1KYOE 1J2JB 4H13D 4H13C 4HYTB 1K05A 2Z4EA 3D70A 3I5CA 2Q1KA 2HPCB 2K1AA 1YJ9P 3MZWB 3M0DA 2IZ1A 3CMEP 1LTJA 1ZOYC 1QVGO 3VP8A 5KAFE 5KAFH 2VRSA 1AV1A 1QEXA 2L91A 5KKZC 2IPPA 3H25A 5CCHD 3C9IA 1KFMA 1NO4A 1NTZK 2NPSB 1IC2A 1FDOA 2W6JH 4MN4C 2E75B 3D6YA 5AVQB 1SQPE 2J5UA 3AE6C 4PD4I 2KOGA 4C46A 3M9BA 3VMZA 1BCCE 3GF3A 3U1AA 1EC5A 4H13B 1SQXK 1KYOI 3G3ZA 1FDMA 3MHVA 2WT7B 3M9HA 1W2EA 3FWNA 1T2KD 3H1JD 1GL2A 1JY2P 3CPWO 3M9QA 5KKZB 2GUVA 2HLOA 1RF0A 2M0BA 2BEZF 1GW3A 1SQQK 1ZRTD 2AXTE 2AXTH 1YI2P 3AE5C 5KLVJ 5KLVG 1YQ3C 4IFDK 4GOFA 3B5NC 1GMJA 1JOCA 2FXOA 3HE5B 1XTGB 1L0LD 1LTBC 2AEJA 5B5EE 5B5EH 3R2PA 1GZLA 1M1JA 3G9RA 2E5TA 1FU1A 3MD0A 1SQVG 1ZXGA 1T6AA 1EZVG 1SVFA 3OAKA 1M8OB 4K3AA 2E42A 1FOSE 1FZCA 4U7JA 4H44D 1T3UA 2A45G 3PLNA 1FDIA 1M56D 1L4AC 3CCLP 1T8ZA 2XV5A 2K3RA 3MP7B 2JJLA 3FX0A 3HRNA 2N9BA 1M1JC 1PFIA 2KSEA 1URQA 3GHGC 4UB6E 1NHLA 3B5NB 4ZNCA 2FYUE 3TDKA 1VQMP 1AVOA 2YKPA 1NU1E 1AJYA 1GD2E 2AXCA 4I2LC 3V4QA 1JNMA 4NPEA 2GA1A 3D6ZA 1H88A 3T97B 1L0NJ 3PRJA 1L0NG 3KYQA 1BDCA 4R4MA 1L4AB 1JB0J 2P1JA 4W7ZA 1Y8AA 5AW9B 4EOTA 3HE4B 2R3SA 1EDLA 1RE4A 3GHGB 3ZDMA 4BXLA 1HTLC 2ZYAA 2B87A 3QWOC 1KC8Q 4O9BA 5AW6B 1OW8A 1IO4A 1QL1A 4IL6H 3IF4A 1K9MQ 3H32A 2WSEH 4N78E 2QVAA 1KQLA 3A2AA 1NTMD 2QRXA 3RK3D 1USEA 2KS1A 1S4XA 1NAYA 4CPGA 1S3JA 4RESB 1NTKE 4ZKPA 2WSFJ 4W80A 2JO1A 3II6A 2WPSA 2YXQB 3FGAD 2ZVOB 3H1HE 2WPRA 2WPQA 5AVUB 5KLVD 3B71A 1EDIA 2KI7B 1VQKP 3AE8C 3PH0A 3HTKA 2RKLA 1RH5B 3B8EB 4IOIH 1VQLP 4KT0J 2PFXA 3Q5RA 4Z1MH 1SQVD 1ZR2A 2SPZA 1EZVD 2JWDA 3G4SP 1U7JA 1VQ8P 4OH8B 3NTNA 3L75E 4C7RA 1OMIA 2P58A 4TLFA 2H8PD 3L71J 1PPJG 2KNCB 3L71G 1BE3D 1VQ9P 3KZIE 3KZIH 2O01J 1EXJA 1EDKA 2Q3IA 4BRYA 1S5LE 4XE5B 1S9KD 1UIIA 2M3EA 1LTSC 5APWA 1VL2A 2D2CC 1ZW0A 2QSIA 1RF1A 1L0ND 2Y0EA 1IK7A 5KLIB 2QEXP 1OVUA 2W6BA 4LC1A 5CCGC 1BDDA 1PIXA 3TK1A 3KXDA 1JO5A 4D6TD 1VF5D 1LT9C 1SQPJ 1SQPG 1MKMA 2N9YB 2I8DA 2K88A 1BCCJ 1DIPA 1BCCG 3F5HA 1IFDA 4PJ0E 4PJ0H 1Q2NA 5APTA 2H89C 1YJNP 2ZVNB 4ZKUA 3PJSK 2D2CB 2RMZA 1LGHB 4IFMA 3CMAP 1N7SD 4OGQC 2M3BA 1M90Q 2YNYA 3JCUE 3JCUH 1NTZE 3H1KD 3VN0A 5GTHE 5GTHH 1FZAA 1SFCA 2WZ7A 1R5LA 4H0LC 1CW5A 1LWUA 1N73A 5KJ7A 1LT9B 4QMAA 1KILC 1VF5B 1JTHB 1YQ4C 2NRGA 3AEAC 1KN7A 3AE7C 1IJDB 2N1TD 4RKUJ 1KQSO 3CCUP 1KB9E 1KB9H 1SQXE 2KK7A 2C9NY 1FZGA 1K73Q 1MFTA 1N7LA 3D71A 1DD4A 1BGYD 1LWUC 1PGJA 2OYIA 3O6QB 2AEFA 2ZT9D 1KFNA 2YO3A 1Q7YQ 2FBWC 1N8RQ 3GF7A 1UIXA 2K9JA 3Q1MA 1PPJD 1NTMK 1SQQE 1DH3A 4H0LB 4XFJA 2Q7CA 1KQFB 5APUA 1KILB 3L73E 2OTKE 3HD7C 1H0TB 2IFNA 1KYOD 2FYNC 1G2CA 2M5AB 2OYIC 2PP6A 2XNXA 2BASA 2R3CA 2FYUG 3KHUA 5AVZB 1NU1J 3SWFA 1RHZB 1KB9I 1NU1G 4JBZA 2I1KA 1FZEA 2FYZA 1Q81Q 5EFWB 5C39A 4L73A 4WY4A 3R4YA 4C7NB 2ZT9B 4HKZH 2V7QH 3IFMA 2QM7A 1OW7A 3B4SA 1JY3N 3HD7B 3L74D 3KQGA 1BCCD 1JMMA 2IZ0A 3PHLA 1FZBA 1LP1B 2POHA 2Z5HA 2OTJP 2YXRB 3RBXA 3CLQA 5BU8B 2AEMA 1PP9E 3SWYA 1IFNA 1FBMA 5APVA 3W67A 2A06D 3HUSA 1NTKJ 3H1IE 1SQBD 1NTKG 4DJGA 1ZV8A 2QE7H 3G6EP 4L76A 3P8CE 3H1HJ 3M0DC 1LTJC 3H1HG 2OGUA 1OZHA 2BCCE 3CC4P 2B9BA 1IK9A 3C8VA 1HH0A 2MKVA 1X9VA 5TISE 5TISH 4NPDA 3MIWA 1FOSF 5APXA 2PRRA 3WUVA 1JCCA 1Z56A 2IYOA 2W8ZA 3UIAA 3L75J 4JYCA 3EQ2A 3L75G 1P84D 4HB1A 1MZ9A 3RBZA 5AVRB 1S5LX 1NGMB 3BCCD 3RL0g 2GM4A 2P67A 1LTJB 2G3AA 3B5ND 2E43A 1GL2C 2WSCH 2V4HA 2FYUD 4M3LA 4WWIA 1RF0C 3V2QA 1J1EC 1YBKA 3L72D 1LTIC 3CCQP 1NU1D 3H6PA 2BEQD 3H1LD 4U3FD 2WQYC 4A7PA 3TGUE 2OTLP 2QM8A 1L4AD 3MTUE 1PGPA 2WVRA 1VQ6P 3H1JE 2XKMA 2IBZD 2FFDA 3SSUA 2JWAA 1GK4A 1K8AQ 3M0AA 3P32A 5AW8B 2Q5UA 1KMIZ 1GL2B 2PAJA 1FZCC 1JEKA 1AA0A 3A5TA 5AVVB 1VQOP 1A02J 3NXSA 1YIJP 4EIJA 1J1EB 2ITAA 1L0LE 1AFOA 3LIEA 3A0BH 1NAFA 1URQD 1URQC 1OXZA 2XU6A 2HG5D 1XTCC 3MUDA 1NYHA 4GKGA 3EFGA 2ZFCA 5CMZA 1NTZJ 1NTZG 3A7OA 1H8AA 3CL3D 5AW2B 3S9OA 2QA4P 1M1JB 2RH0A 5AVXB 3H1HD 2J59M 1CI6A 1JY3O 4L75A 3VP9A 1M7LA 1R8EA 1OWAA 3O8ZA 1FZCB 1SQXJ 3MUDC 1SQXG 4IL6E 2IFMA 3CWBE 1QL2A 1OIPA 1OFCX 5K5GB 5DJTB 1CZQA 1VPCA 1YTZI 2HODA 1URQB 2CPBA 1RE4C 1EDJA 2KP8A 3CX5D 5E79H 5E79E 2Q3EA 3L75D 2Y9YA 2E74C 1N2DC 2KLUA 3V2PA 2R44A 1GK6A 1SQQJ 1KD1Q 3C1LA 1SQQG 3CCRP 1NOHA 3WMM0 1Y47A 3L73J 1J1DC 1HUCA 3L73G 1SQBK 3OJAB 4OWFA 5BU5A 3FXEA 2H88C 3P8MC 3LW5H 1IFMA 1LTGC 2W83C 1MFZA 4AYCA 1GU5A 1AVYA 3WUTA 2FXPA 2P2UA 2FKWB 2QG4A 3N4XA 1CI6B 5AVWB 2B87B 1NTME 3TSIA 2E74B 3RK3E 4OVNF 1PGOA 3SWKA 3H32B 4LLHA 1OVVA 3EFFK 1HWTC 4W7YA 1J1DB 4WBAA 3USSA 1A02F 3W68A 1FE6A 2LXCB 2PGDA 1OVRA 2KS1B 2KUBA 1RQVA 1SS1A 1LNQA 4BWNA 3BVHA 2ZYGA 2D2CD 3CCMP 1L0LK 5GTIE 5GTIH 1U7MA 3F89A 1RE3A 4HH2A 1SQVE 1PP9J 3HTKB 4I7ZC 1PP9G 5B66H 1IFIA 3NFQA 1VQ7P 2G8YA 1LJ2A 2B88A 5CCGD 3Q5PA 4WB4A 3H1IJ 1NVOA 3TNUA 3H1IG 1BSNA 4K35A 2A45H 3U59A 2P10A 3U1CA 1RF1C 4EI2A 2BCCJ 1BE3E 2BCCG 3BASA 2B89A 1SQXD 3CD6P 2J58A 1EQ7A 1FZFA 1DEEG 2R5DA 5APSA 3CXHD 4OGQD 3AEGC 4AUWA 4I7ZB 5AW3B 4BRYB 4ZMDA 4N6JA 3KPEA 4H0LD 1VQ5P 2N1TA 1KILD 1SQQD 4DT0A 4RO0A 3GW6A 3L73D 2ZYDA 3M06A 4UB8E 4UB8H 1RF1B 2XNDH 2A45I 4D6TE 1JMBA 2WSCJ 3I56P 1Q82Q 4NPFX 5CJ0A 1SFCC 1USDA 5KJ7D 1N73C 5KJ7C 3L4FA 2K37A 4OGQB 2WTYA 5CBNA 1CSBA 3TGUJ 1FC2C 3KDPB 3RL0C 3TGUG 1LTAC 4PD4D 2YIUC 3H1JJ 3L71D 4GT1A 3H1JG 2LXBA 1GU4A 3H1KE 1YHQP 1JY3P 3HD7D 2OYHA 3V4WA 5TJHA 1G1JA 5KLVK 2Q9IA 5BVZA 2YO2A 1SFCB 3ABVC 2NPSA 1LTTC 1L0LJ 1LWUB 4PV1C 1N73B 2JP3A 1L0LG 5M1BA 3MGNA 1VQ4P 2JEEA 1SQVK 2OYHC 1Q90D 1KZUB 1PP9D 3SFEC 1FAVA 3GMAA 2IX7C 3RL0B 2ZXEB 1SP4A 1BGYE 2YIUB 2OQQA 1X22A 3H1ID 3L70E 1SQPD 2JKVA 1Q86Q 1PGQA 4IL6X 2WT7A 3P8CD 2NPSC 2FYNB 3TYYA 3CC7P 2E75C 2OYIB 3WU2E 3WU2H 4WY4C 1YITP 5APQA 1QVFO 1BSHA 3CWBJ 3V2NA 1KTMA 1KYOH 3CWBG 2K9JB 3V2RA 2YKQA 5CCHA 2WSEJ 3G71P 4PV1B 1OX3A 2OYHB 2ZXXA 3IR9A 2IYPA 1G2CB 3CCEP 1TU3F 1L0NK 3IAOA 1HF9A 3HE5A 1GW4A 1G1IA 2XDJA 1IFJA 1N86A 3CCSP 4YXWH 5CCHC 2KZIA 3AE3C 3CC2P 1HBWA 2E5YA 4WY4B 2CK3H 1X79B 4DCKA 3HUSC 1DD3A 3L74E 3LW5J 4WVZA 4GODA 1ZP0C 3E7KA 3RGUA 2C9LY 2R32A 3VMYA 3E1RA 1S72P 4YTPC 2QJYC 3AECC 3TGUD 1PV3A 3B5NA 1NTMJ 1T2KC 1NTMG 3AEFC 4TT3H 2W27A 2A06E 1AQ5A 1SQBE 3AEDC 1GL2D 3T97A 2E76D 2E76C 2O1JA 2P7JA 4KHXA 2JR8A 5L8RJ 3OA7A 3HUSB 2OARA 1L4AA 1IFPA 2YKOA 1FJPA 1MV8A 3AEBC 3HE4A 2QJYB 4LGDE 1SQVJ 2MJZA 3GHGA 1M1KQ 2L5GB 2O3JA 3V6IA 5DJUB 3L36A 2DW3A 2KSJA 1JY2N 2RN0A 4H44C 3A0HE 3A0HH 2R5BA 3Q5SA 1P84E 1P84H 2C0WA 1ZRTE 4JYBA 2Q6QA 3EWKA 2KXPB 1BE3J 1RY3A 3BCCE 1BE3G 3K5BA 2E76B 3CCJP 3CWBD 4UB6H 2JDIH 3V5BA 3CI9A 3A0BE 2FFDC 4N78D 1ZN5A 3L72E 3OW2O 1NTKD 1KV4A 2O01N 3H1LE 4U3FE 2KIKA 1QGKB 1VQPP 4DZOA 3M91A 4H44B 3VTPC 2Y0CA 1NH4A 1R5SA 2IBZE 3TF5A 2HFED 1HVVA 2LKMA 3FXDA 4D6TJ 1SQPK 5H2FE 5H2FH 3AE9C 4D6TG 3LIDA 1P84I 4GOEA 1S2EA 4Y28J 1HJ0A 1QX8A 2FFDB 2QJPC 2KNCA 2H43A 3WUUA 1E79H 2E74D 2Y9ZA 3BRTB 4EDFA 2I1JA 1QLED 3RK3C 1ZMEC 1PZQA 2FY8A 3NMDA 3H1KJ 1WRGA 3H1KG 2WITA 3PTZA 1RQUA 4GDOA 1W5CE 4I6MC 1EXIA 2W90A 2WWWA 5CHXA 2IBZI 1Y9BA 2WPVB 2Y0DA 4R4LA 2HYNA 1W2BO 2QJPB 3S1KA 2WSSH 3VOPA 1NKNA 3A3YB 1YJWP 1LT1A 1DEBA 1OW6A 3ITKA 1MUUA 2V7QJ 4HJGH 1BGYJ 1SLQA 3VMXA 1KQGB 1BGYG 3L70J 3RK3B 3L70G 2IDBA 3FWLA 5KLIC 5AW1B 3CX5E 3CX5H 1GDTA 2GUSA 5KAIE 5KAIH 1M57D 2KYVA 5AW4B 1FJKA 1WT6A 2HODB 5KLVE 2KZJA 5AVTB 2Z5IA 1HGVA 4JPZB 4XA4A 1S5LH 3VMAA 5CCGA 2FYUK 1GTWA 1IZNB 2K9YA 1LT9A 1NU1K 5B66E 1JTHA 2CPSA 1EZVE 1NTZD 1E5WA 2M8RA 4JQ0D 4IFFA 2XZRA 1K04A 1JY2O 4Y99C 4B86A 2H7HA 3AE4C 3Q2YA 1L2PA 1RE3C 1KB9D 3CX5I 4ASVA 1X0TA 1VF5C 3O6QA 1N7SA 1YTZT 3PP5A 3L74J 1S9KE 2QJKC 3L74G 3AE2C 1VDFA 2NZ2A 3RK2D 5KTBA 3RK2C 3JC22 1FS0E 1WMKA 1KILA 1NKZB 1NJIQ 1H0TA 1L0NE 1VQNP 2M5AA 4YPCA 3JSVC 5CBOA 1N7SC 3AEEC 1EZVI 1X8YA 1NTKK 4Y99B 2FXMA 2A06G 1SQBJ 3GG2A 1SQBG 4DOJA 5APYA 1S1CX 5CJ4A 5AVSB 2OYOA 4C7NA 1SFCD 2W6AA 1PL5A 2WMMA 2QJKB 3TNUB 2N1TC 1JUNA 5AW7B 3RK2B 2HR3A 1D7MA 4GIFA 3RL0D 3VYIA
chains in the Genus database with same CATH topology
1R5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5S A; 
#chains in the Genus database with same CATH topology
 4RJT A;  4ASW A;  1H89 A;  3HD7 A;  3E1I A;  3CXH E;  3CXH H;  2KLV A;  2C0X A;  3L70 D;  3P7K A;  1JCD A;  1N7S B;  2HPC A;  3Q3D A;  2ZT9 C;  2WSF H;  1LP1 A;  3L37 A;  5AW0 B;  4AQR D;  1U57 A;  4L74 A;  4I1L A;  1ZR4 A;  1KIL E;  3L35 A;  3GLM A;  5AW5 B;  1T3J A;  3BCC J;  3CCV P;  3BCC G;  2O1K A;  2QIW A;  3I55 P;  1DX7 A;  2N1T B;  4PV1 D;  1JM0 A;  1HJB A;  2FYU J;  4JF7 A;  4KJM A;  3BAT A;  5AVY B;  3L72 J;  3L72 G;  2KB7 P;  1AQT A;  1ZLL A;  4YXD C;  1KOR A;  3QH9 A;  1HGZ A;  3H1L J;  4N3Y B;  4U3F J;  2YMY A;  3H1L G;  4U3F G;  2ZAE B;  4EYY Q;  3N7N A;  4PD4 E;  4PD4 H;  3SFD C;  2ZJS E;  1NWQ A;  2NPS D;  1PPJ E;  3CXH I;  3IN6 A;  3L71 E;  2E75 D;  2LR2 A;  2BCC D;  4WY4 D;  3S4R A;  2IBZ G;  3AE1 C;  2UWJ E;  3BRV B;  2YMK A;  1YYC A;  2O01 H;  1KYO E;  1J2J B;  4H13 D;  4H13 C;  4HYT B;  1K05 A;  2Z4E A;  3D70 A;  3I5C A;  2Q1K A;  2HPC B;  2K1A A;  1YJ9 P;  3MZW B;  3M0D A;  2IZ1 A;  3CME P;  1LTJ A;  1ZOY C;  1QVG O;  3VP8 A;  5KAF E;  5KAF H;  2VRS A;  1AV1 A;  1QEX A;  2L91 A;  5KKZ C;  2IPP A;  3H25 A;  5CCH D;  3C9I A;  1KFM A;  1NO4 A;  1NTZ K;  2NPS B;  1IC2 A;  1FDO A;  2W6J H;  4MN4 C;  2E75 B;  3D6Y A;  5AVQ B;  1SQP E;  2J5U A;  3AE6 C;  4PD4 I;  2KOG A;  4C46 A;  3M9B A;  3VMZ A;  1BCC E;  3GF3 A;  3U1A A;  1EC5 A;  4H13 B;  1SQX K;  1KYO I;  3G3Z A;  1FDM A;  3MHV A;  2WT7 B;  3M9H A;  1W2E A;  3FWN A;  1T2K D;  3H1J D;  1GL2 A;  1JY2 P;  3CPW O;  3M9Q A;  5KKZ B;  2GUV A;  2HLO A;  1RF0 A;  2M0B A;  2BEZ F;  1GW3 A;  1SQQ K;  1ZRT D;  2AXT E;  2AXT H;  1YI2 P;  3AE5 C;  5KLV J;  5KLV G;  1YQ3 C;  4IFD K;  4GOF A;  3B5N C;  1GMJ A;  1JOC A;  2FXO A;  3HE5 B;  1XTG B;  1L0L D;  1LTB C;  2AEJ A;  5B5E E;  5B5E H;  3R2P A;  1GZL A;  1M1J A;  3G9R A;  2E5T A;  1FU1 A;  3MD0 A;  1SQV G;  1ZXG A;  1T6A A;  1EZV G;  1SVF A;  3OAK A;  1M8O B;  4K3A A;  2E42 A;  1FOS E;  1FZC A;  4U7J A;  4H44 D;  1T3U A;  2A45 G;  3PLN A;  1FDI A;  1M56 D;  1L4A C;  3CCL P;  1T8Z A;  2XV5 A;  2K3R A;  3MP7 B;  2JJL A;  3FX0 A;  3HRN A;  2N9B A;  1M1J C;  1PFI A;  2KSE A;  1URQ A;  3GHG C;  4UB6 E;  1NHL A;  3B5N B;  4ZNC A;  2FYU E;  3TDK A;  1VQM P;  1AVO A;  2YKP A;  1NU1 E;  1AJY A;  1GD2 E;  2AXC A;  4I2L C;  3V4Q A;  1JNM A;  4NPE A;  2GA1 A;  3D6Z A;  1H88 A;  3T97 B;  1L0N J;  3PRJ A;  1L0N G;  3KYQ A;  1BDC A;  4R4M A;  1L4A B;  1JB0 J;  2P1J A;  4W7Z A;  1Y8A A;  5AW9 B;  4EOT A;  3HE4 B;  2R3S A;  1EDL A;  1RE4 A;  3GHG B;  3ZDM A;  4BXL A;  1HTL C;  2ZYA A;  2B87 A;  3QWO C;  1KC8 Q;  4O9B A;  5AW6 B;  1OW8 A;  1IO4 A;  1QL1 A;  4IL6 H;  3IF4 A;  1K9M Q;  3H32 A;  2WSE H;  4N78 E;  2QVA A;  1KQL A;  3A2A A;  1NTM D;  2QRX A;  3RK3 D;  1USE A;  2KS1 A;  1S4X A;  1NAY A;  4CPG A;  1S3J A;  4RES B;  1NTK E;  4ZKP A;  2WSF J;  4W80 A;  2JO1 A;  3II6 A;  2WPS A;  2YXQ B;  3FGA D;  2ZVO B;  3H1H E;  2WPR A;  2WPQ A;  5AVU B;  5KLV D;  3B71 A;  1EDI A;  2KI7 B;  1VQK P;  3AE8 C;  3PH0 A;  3HTK A;  2RKL A;  1RH5 B;  3B8E B;  4IOI H;  1VQL P;  4KT0 J;  2PFX A;  3Q5R A;  4Z1M H;  1SQV D;  1ZR2 A;  2SPZ A;  1EZV D;  2JWD A;  3G4S P;  1U7J A;  1VQ8 P;  4OH8 B;  3NTN A;  3L75 E;  4C7R A;  1OMI A;  2P58 A;  4TLF A;  2H8P D;  3L71 J;  1PPJ G;  2KNC B;  3L71 G;  1BE3 D;  1VQ9 P;  3KZI E;  3KZI H;  2O01 J;  1EXJ A;  1EDK A;  2Q3I A;  4BRY A;  1S5L E;  4XE5 B;  1S9K D;  1UII A;  2M3E A;  1LTS C;  5APW A;  1VL2 A;  2D2C C;  1ZW0 A;  2QSI A;  1RF1 A;  1L0N D;  2Y0E A;  1IK7 A;  5KLI B;  2QEX P;  1OVU A;  2W6B A;  4LC1 A;  5CCG C;  1BDD A;  1PIX A;  3TK1 A;  3KXD A;  1JO5 A;  4D6T D;  1VF5 D;  1LT9 C;  1SQP J;  1SQP G;  1MKM A;  2N9Y B;  2I8D A;  2K88 A;  1BCC J;  1DIP A;  1BCC G;  3F5H A;  1IFD A;  4PJ0 E;  4PJ0 H;  1Q2N A;  5APT A;  2H89 C;  1YJN P;  2ZVN B;  4ZKU A;  3PJS K;  2D2C B;  2RMZ A;  1LGH B;  4IFM A;  3CMA P;  1N7S D;  4OGQ C;  2M3B A;  1M90 Q;  2YNY A;  3JCU E;  3JCU H;  1NTZ E;  3H1K D;  3VN0 A;  5GTH E;  5GTH H;  1FZA A;  1SFC A;  2WZ7 A;  1R5L A;  4H0L C;  1CW5 A;  1LWU A;  1N73 A;  5KJ7 A;  1LT9 B;  4QMA A;  1KIL C;  1VF5 B;  1JTH B;  1YQ4 C;  2NRG A;  3AEA C;  1KN7 A;  3AE7 C;  1IJD B;  2N1T D;  4RKU J;  1KQS O;  3CCU P;  1KB9 E;  1KB9 H;  1SQX E;  2KK7 A;  2C9N Y;  1FZG A;  1K73 Q;  1MFT A;  1N7L A;  3D71 A;  1DD4 A;  1BGY D;  1LWU C;  1PGJ A;  2OYI A;  3O6Q B;  2AEF A;  2ZT9 D;  1KFN A;  2YO3 A;  1Q7Y Q;  2FBW C;  1N8R Q;  3GF7 A;  1UIX A;  2K9J A;  3Q1M A;  1PPJ D;  1NTM K;  1SQQ E;  1DH3 A;  4H0L B;  4XFJ A;  2Q7C A;  1KQF B;  5APU A;  1KIL B;  3L73 E;  2OTK E;  3HD7 C;  1H0T B;  2IFN A;  1KYO D;  2FYN C;  1G2C A;  2M5A B;  2OYI C;  2PP6 A;  2XNX A;  2BAS A;  2R3C A;  2FYU G;  3KHU A;  5AVZ B;  1NU1 J;  3SWF A;  1RHZ B;  1KB9 I;  1NU1 G;  4JBZ A;  2I1K A;  1FZE A;  2FYZ A;  1Q81 Q;  5EFW B;  5C39 A;  4L73 A;  4WY4 A;  3R4Y A;  4C7N B;  2ZT9 B;  4HKZ H;  2V7Q H;  3IFM A;  2QM7 A;  1OW7 A;  3B4S A;  1JY3 N;  3HD7 B;  3L74 D;  3KQG A;  1BCC D;  1JMM A;  2IZ0 A;  3PHL A;  1FZB A;  1LP1 B;  2POH A;  2Z5H A;  2OTJ P;  2YXR B;  3RBX A;  3CLQ A;  5BU8 B;  2AEM A;  1PP9 E;  3SWY A;  1IFN A;  1FBM A;  5APV A;  3W67 A;  2A06 D;  3HUS A;  1NTK J;  3H1I E;  1SQB D;  1NTK G;  4DJG A;  1ZV8 A;  2QE7 H;  3G6E P;  4L76 A;  3P8C E;  3H1H J;  3M0D C;  1LTJ C;  3H1H G;  2OGU A;  1OZH A;  2BCC E;  3CC4 P;  2B9B A;  1IK9 A;  3C8V A;  1HH0 A;  2MKV A;  1X9V A;  5TIS E;  5TIS H;  4NPD A;  3MIW A;  1FOS F;  5APX A;  2PRR A;  3WUV A;  1JCC A;  1Z56 A;  2IYO A;  2W8Z A;  3UIA A;  3L75 J;  4JYC A;  3EQ2 A;  3L75 G;  1P84 D;  4HB1 A;  1MZ9 A;  3RBZ A;  5AVR B;  1S5L X;  1NGM B;  3BCC D;  3RL0 g;  2GM4 A;  2P67 A;  1LTJ B;  2G3A A;  3B5N D;  2E43 A;  1GL2 C;  2WSC H;  2V4H A;  2FYU D;  4M3L A;  4WWI A;  1RF0 C;  3V2Q A;  1J1E C;  1YBK A;  3L72 D;  1LTI C;  3CCQ P;  1NU1 D;  3H6P A;  2BEQ D;  3H1L D;  4U3F D;  2WQY C;  4A7P A;  3TGU E;  2OTL P;  2QM8 A;  1L4A D;  3MTU E;  1PGP A;  2WVR A;  1VQ6 P;  3H1J E;  2XKM A;  2IBZ D;  2FFD A;  3SSU A;  2JWA A;  1GK4 A;  1K8A Q;  3M0A A;  3P32 A;  5AW8 B;  2Q5U A;  1KMI Z;  1GL2 B;  2PAJ A;  1FZC C;  1JEK A;  1AA0 A;  3A5T A;  5AVV B;  1VQO P;  1A02 J;  3NXS A;  1YIJ P;  4EIJ A;  1J1E B;  2ITA A;  1L0L E;  1AFO A;  3LIE A;  3A0B H;  1NAF A;  1URQ D;  1URQ C;  1OXZ A;  2XU6 A;  2HG5 D;  1XTC C;  3MUD A;  1NYH A;  4GKG A;  3EFG A;  2ZFC A;  5CMZ A;  1NTZ J;  1NTZ G;  3A7O A;  1H8A A;  3CL3 D;  5AW2 B;  3S9O A;  2QA4 P;  1M1J B;  2RH0 A;  5AVX B;  3H1H D;  2J59 M;  1CI6 A;  1JY3 O;  4L75 A;  3VP9 A;  1M7L A;  1R8E A;  1OWA A;  3O8Z A;  1FZC B;  1SQX J;  3MUD C;  1SQX G;  4IL6 E;  2IFM A;  3CWB E;  1QL2 A;  1OIP A;  1OFC X;  5K5G B;  5DJT B;  1CZQ A;  1VPC A;  1YTZ I;  2HOD A;  1URQ B;  2CPB A;  1RE4 C;  1EDJ A;  2KP8 A;  3CX5 D;  5E79 H;  5E79 E;  2Q3E A;  3L75 D;  2Y9Y A;  2E74 C;  1N2D C;  2KLU A;  3V2P A;  2R44 A;  1GK6 A;  1SQQ J;  1KD1 Q;  3C1L A;  1SQQ G;  3CCR P;  1NOH A;  3WMM 0;  1Y47 A;  3L73 J;  1J1D C;  1HUC A;  3L73 G;  1SQB K;  3OJA B;  4OWF A;  5BU5 A;  3FXE A;  2H88 C;  3P8M C;  3LW5 H;  1IFM A;  1LTG C;  2W83 C;  1MFZ A;  4AYC A;  1GU5 A;  1AVY A;  3WUT A;  2FXP A;  2P2U A;  2FKW B;  2QG4 A;  3N4X A;  1CI6 B;  5AVW B;  2B87 B;  1NTM E;  3TSI A;  2E74 B;  3RK3 E;  4OVN F;  1PGO A;  3SWK A;  3H32 B;  4LLH A;  1OVV A;  3EFF K;  1HWT C;  4W7Y A;  1J1D B;  4WBA A;  3USS A;  1A02 F;  3W68 A;  1FE6 A;  2LXC B;  2PGD A;  1OVR A;  2KS1 B;  2KUB A;  1RQV A;  1SS1 A;  1LNQ A;  4BWN A;  3BVH A;  2ZYG A;  2D2C D;  3CCM P;  1L0L K;  5GTI E;  5GTI H;  1U7M A;  3F89 A;  1RE3 A;  4HH2 A;  1SQV E;  1PP9 J;  3HTK B;  4I7Z C;  1PP9 G;  5B66 H;  1IFI A;  3NFQ A;  1VQ7 P;  2G8Y A;  1LJ2 A;  2B88 A;  5CCG D;  3Q5P A;  4WB4 A;  3H1I J;  1NVO A;  3TNU A;  3H1I G;  1BSN A;  4K35 A;  2A45 H;  3U59 A;  2P10 A;  3U1C A;  1RF1 C;  4EI2 A;  2BCC J;  1BE3 E;  2BCC G;  3BAS A;  2B89 A;  1SQX D;  3CD6 P;  2J58 A;  1EQ7 A;  1FZF A;  1DEE G;  2R5D A;  5APS A;  3CXH D;  4OGQ D;  3AEG C;  4AUW A;  4I7Z B;  5AW3 B;  4BRY B;  4ZMD A;  4N6J A;  3KPE A;  4H0L D;  1VQ5 P;  2N1T A;  1KIL D;  1SQQ D;  4DT0 A;  4RO0 A;  3GW6 A;  3L73 D;  2ZYD A;  3M06 A;  4UB8 E;  4UB8 H;  1RF1 B;  2XND H;  2A45 I;  4D6T E;  1JMB A;  2WSC J;  3I56 P;  1Q82 Q;  4NPF X;  5CJ0 A;  1SFC C;  1USD A;  5KJ7 D;  1N73 C;  5KJ7 C;  3L4F A;  2K37 A;  4OGQ B;  2WTY A;  5CBN A;  1CSB A;  3TGU J;  1FC2 C;  3KDP B;  3RL0 C;  3TGU G;  1LTA C;  4PD4 D;  2YIU C;  3H1J J;  3L71 D;  4GT1 A;  3H1J G;  2LXB A;  1GU4 A;  3H1K E;  1YHQ P;  1JY3 P;  3HD7 D;  2OYH A;  3V4W A;  5TJH A;  1G1J A;  5KLV K;  2Q9I A;  5BVZ A;  2YO2 A;  1SFC B;  3ABV C;  2NPS A;  1LTT C;  1L0L J;  1LWU B;  4PV1 C;  1N73 B;  2JP3 A;  1L0L G;  5M1B A;  3MGN A;  1VQ4 P;  2JEE A;  1SQV K;  2OYH C;  1Q90 D;  1KZU B;  1PP9 D;  3SFE C;  1FAV A;  3GMA A;  2IX7 C;  3RL0 B;  2ZXE B;  1SP4 A;  1BGY E;  2YIU B;  2OQQ A;  1X22 A;  3H1I D;  3L70 E;  1SQP D;  2JKV A;  1Q86 Q;  1PGQ A;  4IL6 X;  2WT7 A;  3P8C D;  2NPS C;  2FYN B;  3TYY A;  3CC7 P;  2E75 C;  2OYI B;  3WU2 E;  3WU2 H;  4WY4 C;  1YIT P;  5APQ A;  1QVF O;  1BSH A;  3CWB J;  3V2N A;  1KTM A;  1KYO H;  3CWB G;  2K9J B;  3V2R A;  2YKQ A;  5CCH A;  2WSE J;  3G71 P;  4PV1 B;  1OX3 A;  2OYH B;  2ZXX A;  3IR9 A;  2IYP A;  1G2C B;  3CCE P;  1TU3 F;  1L0N K;  3IAO A;  1HF9 A;  3HE5 A;  1GW4 A;  1G1I A;  2XDJ A;  1IFJ A;  1N86 A;  3CCS P;  4YXW H;  5CCH C;  2KZI A;  3AE3 C;  3CC2 P;  1HBW A;  2E5Y A;  4WY4 B;  2CK3 H;  1X79 B;  4DCK A;  3HUS C;  1DD3 A;  3L74 E;  3LW5 J;  4WVZ A;  4GOD A;  1ZP0 C;  3E7K A;  3RGU A;  2C9L Y;  2R32 A;  3VMY A;  3E1R A;  1S72 P;  4YTP C;  2QJY C;  3AEC C;  3TGU D;  1PV3 A;  3B5N A;  1NTM J;  1T2K C;  1NTM G;  3AEF C;  4TT3 H;  2W27 A;  2A06 E;  1AQ5 A;  1SQB E;  3AED C;  1GL2 D;  3T97 A;  2E76 D;  2E76 C;  2O1J A;  2P7J A;  4KHX A;  2JR8 A;  5L8R J;  3OA7 A;  3HUS B;  2OAR A;  1L4A A;  1IFP A;  2YKO A;  1FJP A;  1MV8 A;  3AEB C;  3HE4 A;  2QJY B;  4LGD E;  1SQV J;  2MJZ A;  3GHG A;  1M1K Q;  2L5G B;  2O3J A;  3V6I A;  5DJU B;  3L36 A;  2DW3 A;  2KSJ A;  1JY2 N;  2RN0 A;  4H44 C;  3A0H E;  3A0H H;  2R5B A;  3Q5S A;  1P84 E;  1P84 H;  2C0W A;  1ZRT E;  4JYB A;  2Q6Q A;  3EWK A;  2KXP B;  1BE3 J;  1RY3 A;  3BCC E;  1BE3 G;  3K5B A;  2E76 B;  3CCJ P;  3CWB D;  4UB6 H;  2JDI H;  3V5B A;  3CI9 A;  3A0B E;  2FFD C;  4N78 D;  1ZN5 A;  3L72 E;  3OW2 O;  1NTK D;  1KV4 A;  2O01 N;  3H1L E;  4U3F E;  2KIK A;  1QGK B;  1VQP P;  4DZO A;  3M91 A;  4H44 B;  3VTP C;  2Y0C A;  1NH4 A;  1R5S A;  2IBZ E;  3TF5 A;  2HFE D;  1HVV A;  2LKM A;  3FXD A;  4D6T J;  1SQP K;  5H2F E;  5H2F H;  3AE9 C;  4D6T G;  3LID A;  1P84 I;  4GOE A;  1S2E A;  4Y28 J;  1HJ0 A;  1QX8 A;  2FFD B;  2QJP C;  2KNC A;  2H43 A;  3WUU A;  1E79 H;  2E74 D;  2Y9Z A;  3BRT B;  4EDF A;  2I1J A;  1QLE D;  3RK3 C;  1ZME C;  1PZQ A;  2FY8 A;  3NMD A;  3H1K J;  1WRG A;  3H1K G;  2WIT A;  3PTZ A;  1RQU A;  4GDO A;  1W5C E;  4I6M C;  1EXI A;  2W90 A;  2WWW A;  5CHX A;  2IBZ I;  1Y9B A;  2WPV B;  2Y0D A;  4R4L A;  2HYN A;  1W2B O;  2QJP B;  3S1K A;  2WSS H;  3VOP A;  1NKN A;  3A3Y B;  1YJW P;  1LT1 A;  1DEB A;  1OW6 A;  3ITK A;  1MUU A;  2V7Q J;  4HJG H;  1BGY J;  1SLQ A;  3VMX A;  1KQG B;  1BGY G;  3L70 J;  3RK3 B;  3L70 G;  2IDB A;  3FWL A;  5KLI C;  5AW1 B;  3CX5 E;  3CX5 H;  1GDT A;  2GUS A;  5KAI E;  5KAI H;  1M57 D;  2KYV A;  5AW4 B;  1FJK A;  1WT6 A;  2HOD B;  5KLV E;  2KZJ A;  5AVT B;  2Z5I A;  1HGV A;  4JPZ B;  4XA4 A;  1S5L H;  3VMA A;  5CCG A;  2FYU K;  1GTW A;  1IZN B;  2K9Y A;  1LT9 A;  1NU1 K;  5B66 E;  1JTH A;  2CPS A;  1EZV E;  1NTZ D;  1E5W A;  2M8R A;  4JQ0 D;  4IFF A;  2XZR A;  1K04 A;  1JY2 O;  4Y99 C;  4B86 A;  2H7H A;  3AE4 C;  3Q2Y A;  1L2P A;  1RE3 C;  1KB9 D;  3CX5 I;  4ASV A;  1X0T A;  1VF5 C;  3O6Q A;  1N7S A;  1YTZ T;  3PP5 A;  3L74 J;  1S9K E;  2QJK C;  3L74 G;  3AE2 C;  1VDF A;  2NZ2 A;  3RK2 D;  5KTB A;  3RK2 C;  3JC2 2;  1FS0 E;  1WMK A;  1KIL A;  1NKZ B;  1NJI Q;  1H0T A;  1L0N E;  1VQN P;  2M5A A;  4YPC A;  3JSV C;  5CBO A;  1N7S C;  3AEE C;  1EZV I;  1X8Y A;  1NTK K;  4Y99 B;  2FXM A;  2A06 G;  1SQB J;  3GG2 A;  1SQB G;  4DOJ A;  5APY A;  1S1C X;  5CJ4 A;  5AVS B;  2OYO A;  4C7N A;  1SFC D;  2W6A A;  1PL5 A;  2WMM A;  2QJK B;  3TNU B;  2N1T C;  1JUN A;  5AW7 B;  3RK2 B;  2HR3 A;  1D7M A;  4GIF A;  3RL0 D;  3VYI A; 
#chains in the Genus database with same CATH homology
 1R5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...