3M9BA

Crystal structure of the amino terminal coiled coil domain and the inter domain of the mycobacterium tuberculosis proteasomal atpase mpa
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
186
structure length
186
Chain Sequence
b'SARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQPPSGYGVLLATHDDDTVDVFTSGRKMRLTCSPNIDAASLKKGQTVRLNEALTVVEAGTFEAVGEISTLREILADGHRALVVGHADEERVVWLADPLIAEDLPDGLPEALNDDTRPRKLRPGDSLLVDTKAGYAFERIPLVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome-associated ATPase
publication title Binding-induced folding of prokaryotic ubiquitin-like protein on the Mycobacterium proteasomal ATPase targets substrates for degradation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Chaperone
total genus 31
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16450 Prot_ATP_ID_OB Proteasomal ATPase OB C-terminal domain
A PF17758 Prot_ATP_OB_N Proteasomal ATPase OB N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3m9bA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m9bA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m9bA02
4JI5Q 2MQHA 2KHIA 1Q46A 1VQBA 3OYYA 5AVZB 4QIWE 3P32A 4BBSH 3CD6A 1KD1C 4A3IH 2VQEL 2OTJA 1A62A 4JI3Q 3I4OA 1I6HH 2I5LX 5LMUQ 3L36A 3CCMA 2UXDL 5IYDH 3K80C 3GTOH 1FL0A 4DR2Q 3OAKA 2IHEA 1EUJA 4IFDG 1PYBA 4NB3A 1I5FA 4A3JH 1EYGA 1AE2A 2EQSA 4BBSG 3KF8B 2N8NA 3CF5A 2N78A 4P72A 4A3IG 2R93H 2JEBI 2KENA 2H5XA 4HIKA 4BBRH 1JB7A 3PF4A 2NVYH 3PSIA 5IYDG 1XNRQ 3WWVA 4DR3L 4RMFA 1WCMH 3JC66 5IWAQ 5C4XH 1T9HA 2Y0SG 3NBHB 4HJ9A 4A3JG 1IBKL 5FJ8H 3GTLH 3KJOA 3TQYA 3OW2A 3D0FA 4Y52H 1C7YA 1SLQA 1HBWA 3FP9A 2R93G 2P7JA 2XTIA 4BBRG 1PH9A 1CSPA 1CSBA 1YNXA 1WCMG 5C4XG 4A3EG 4GT1A 3GD7A 1H95A 1YEZA 1XNQQ 3KLWA 1IBLL 5FJ8G 1Q81C 2K14A 1YYCA 4IJHA 1QVCA 3RN2A 3P7KA 1GD7A 2WAQE 3GTQH 4B3SQ 3STBC 3HOXH 3H0GH 3PV0A 2UXCL 1VQGA 2Q2TA 1XPUA 2WB1E 1JNMA 3CCVA 4A3KH 4O0AA 1Q82C 5APQA 2AKWB 3HKZE 4I6MC 1DGSA 3H15A 3H3VH 3J81i 2K52A 2VL6A 4DR1Q 1IZ6A 1X8YA 4RG1A 4IPHA 3EIVA 1PHJA 5APXA 3S1QH 2Q2IA 4OO1G 1KRTA 3BJUA 3DM3A 3M0AA 2FXQA 1X56A 3HOXG 3H0GG 3RR5A 2P2UA 2JA5H 3HOZH 2YTXA 2VZAA 3U4ZA 4JI1L 2NVQH 4A3KG 5APVA 2BH8A 2WPRA 1C9OA 2NVXH 1NY4A 1VQHA 1VCIA 4JOIC 4R1JA 2GVBA 1M90C 2R92H 1GM5A 3GTJH 1VQAA 1YJNA 4OX9Q 2UUAL 3ER0A 2HIVA 3K0XA 1TWFH 3M4QA 2XGTA 1OXUA 2JA5G 3HOZG 3RNUA 3J81j 4MZ9A 1L1OA 4MTNA 1JJ2A 1FOSE 2QM7A 1X54A 4DR7L 3KF6B 3RLFA 1X3GA 4B3MQ 2CFMA 4TQUS 4K0KQ 5AVWB 1CKNB 1EOVA 3T1HL 2R92G 1P8LA 2NZHA 4A3BH 2UXBL 3E0EA 5C0XG 3U50C 1PH1A 4X65Q 4C46A 2D0OA 4GKJQ 1D7QA 3A3YB 3MXNB 4BY7H 5AVRB 1GO3E 2ES2A 4RESB 4LF8L 1RL2A 5AVYB 1TWHH 1HNWQ 3S16H 4IOAA 3S1NH 4GNXC 4LF9Q 1SN8A 1OXTA 3M9HA 5AW8B 1LYLA 3F1ZA 1HNZQ 2E5LL 4A3BG 4UP7A 3PUYA 1SR3A 3J80i 3NFQA 2CWPA 4AQYL 1N36Q 3A5ZB 4KHXA 4C2MH 3CAMA 4BY7G 2RHSB 5AW0B 2OTLA 1XMQQ 1UE6A 4X64L 3VMYA 4AIMA 3LIDA 3M91A 5M5XH 3ULPA 4JYAQ 1QZGA 2Q5UA 3M0DA 3HFZB 5FLMH 1N32Q 4DV7L 1JJCB 1B8AA 2YTYA 3VMXA 2IX0A 1Z9FA 1HNXL 4B3TL 1SE8A 5AVQB 4A76A 5LMNW 2R6GA 4NXML 4LF4L 4DR6L 4LF6Q 1J5EQ 3K8AA 1U5KA 1ASZA 1YJ9A 5FLMG 1WOCA 3NELA 1G291 1FJGL 3G48A 4KI0A 4APVA 4JYCA 1QZHA 2HT1A 4DAYB 3T1YQ 4LFBL 3VDYA 1HZBA 3HOYH 5AW6B 1Q12A 1VQEA 1CZQA 1X3FA 1XJVA 4DNIA 1YHQA 1TXYA 1PH4A 4FDBA 2UU9L 2IHFA 1SP4A 2K75A 2JJLA 3TEHB 4KHPQ 1J6QA 1HJBA 2W6AA 4WJ3M 4PZ7A 2Q2UA 4R4CA 1PFSA 5JEAJ 1YJWA 4DK6C 1S9KE 1OWAA 5ELOA 1VQ7A 1Q1BA 3HOYG 2ZXEB 1V1QA 1CI6A 1J2JB 2ZM6L 2NVTH 4GKKL 4JI7L 3M9BA 4JI2Q 3S1RH 3PUWA 1W3SA 3IRBA 3W5OA 5AJ3L 1UE1A 2MO1A 2F4VL 4LWCA 3VN0A 2KCTA 4NXNQ 3L35A 2B29A 5J3BA 3K7UC 3HTKA 5AVUB 2PMZE 1OXVA 1NE3A 1E22A 2HHHL 4X6AH 3M85A 3F8TA 1K8GA 1MIUA 2LXJA 5LMNQ 1L1OB 2VW9A 3I5CA 1IXRA 4JBWA 3ULLA 2IT1A 2YYZA 3L2PA 5AW7B 1BVSA 5BR8Q 1M1KC 1JMCA 3CW2C 3CCLA 3CC7A 4B3RQ 3UE0A 3KOJA 1LM0A 5IYCH 1KC8C 1YHBA 3M3YH 3NMDA 1A0IA 2YO2A 4XIGS 1I94Q 4YWLA 5HGQA 4LFCQ 4DV5Q 3S15H 2F3IA 4DR4Q 4XTCS 1NMGA 3PO2H 4YY3Q 4P73A 2WTYA 1JJGA 4GLVB 4JG2A 4A3EH 1SFOH 2UUCL 4DZOA 1HR0L 4JI8L 1EWIA 5AW3B 3J7A5 2D0PA 3B8EB 4GN3B 1SRUA 2F52A 2P67A 5IYCG 2ATWA 1XPRA 2PNHA 5AW4B 3V4WA 2JA7H 4X62L 4R4TA 3A74A 3HOVH 1A02F 4L5SA 2JJQA 2IPPA 1GKHA 1YHAA 4GN5A 4JV5Q 3PO2G 1XMOL 1G6PA 4OXPA 3CXCA 5AVXB 2YO3A 5EAYA 5JJKA 5IY0A 2AHOB 1VQIA 2KHJA 2LXKA 1MFZA 3J7ZC 5GQOA 1YVCA 2QEXA 2E5LQ 2B3GA 2JA7G 1A02J 2ZTCA 1YI2A 1B70B 2VQFQ 3HOVG 2IX1A 1X55A 4UP9A 2Z5IA 2KCMA 3ERSX 2I5MX 1GTWA 2AWNA 2AMCB 4JOIA 4IOCA 1IBML 2K50A 3JAMi 4A3DH 4DV2L 4OWXB 3L0OA 4POFA 2NN6I 2K5VA 3CQZH 2C35B 2XZRA 4JI5L 1WI5A 4JI4Q 5CMZA 3PUZA 2ASBA 1NMFA 5HY6A 4C3HH 4LC1A 3UIAA 3TK1A 4JI3L 1FVIA 4DV1Q 3I2ZA 5LMUL 4HIDA 4LNQA 5GAEC 4DUZL 4A3DG 1NTGA 3G4SA 2N49A 2C9NY 1BKBA 3UDXA 2WWWA 4DR2L 3RN5A 4DPGA 3GTKH 1MKHA 1HZ9A 3PCOB 1GD2E 1N33Q 4A93H 4MNOA 3TNUA 1G51A 2R5DA 4EX5A 4BA2I 1YBYA 4DV4L 4GOPA 2UUBQ 2ZFCA 1VQFA 4JBMA 1KL9A 3FKIH 3GTPH 4OWWB 3GTMH 3OTOL 1QVFA 4JI6Q 4P71A 1A63A 3PIPA 1CI6B 2RCNA 2E2IH 1XNRL 4LF7Q 1S72A 1W2BA 5IP7H 1O7IA 4R4IA 4GLAC 4QQBX 4C7NA 2VRSA 5IWAL 4LFAQ 3B6YA 4A93G 1PH2A 1K0RA 3W1GA 4DV0Q 2DGYA 3MD0A 3F2DA 3HOWH 4LF5Q 3FKIG 4EOTA 1NWQA 3CCUA 2XV5A 1UWVA 5JEAG 4JYBA 4JC0A 2E42A 2R7DA 3CCSA 1VQCA 2JK8A 1IL2A 4LUZA 5IP7G 1N34Q 1AE3A 3LIEA 3CMAA 2JEAI 4DUYQ 2Z5HA 3CPWA 3AFQA 4GKGA 1WYDA 3PUXA 2MFIA 1XNQL 3U58A 3HE5A 3KJPA 3S2HH 2H7HA 3A7OA 1L1OC 3G6EA 1PH3A 5ELNA 2EXDA 4L5QA 2A1AA 4AH6A 1Q86C 3HOWG 4C3JH 4DV3L 2RF4A 2RHQB 1E1OA 3ULJA 3Q8DA 2VQEQ 4B3SL 1A8VA 2Q3IA 5AVSB 3BU2A 1RIPA 4HJ7A 2UXDQ 1OXZA 5C3EH 4PZ6A 3F2BA 1TWAH 1X6OA 3HE4A 3RZOH 3I56A 4A3CH 1E24A 3CCEA 4DR1L 4I2LC 3E9IA 2JA8H 3M7NA 1H89A 2CWAA 2ID0A 2L15A 3L37A 1NBWA 1PV4A 5C3EG 2JQOA 4DKAC 1CUKA 1L0WA 1OTCA 5C44H 4DR3Q 2N3SA 2WT7A 4OONA 1PH8A 2UUCQ 1C0AA 5AW2B 3UE1A 3KDPB 2I5HA 1KXLA 2I0QA 3AFPA 1HUCA 4A3CG 3D31A 1IBKQ 1NJIC 4OWTB 3TS0A 2A19A 4L5TA 4OX9L 2JA8G 4TVAB 2ZJPA 1FOSF 1VQ8A 5DLQE 1VQ4A 2PQAA 3J81c 2ZJRA 1I3QH 5M3MG 4IJLA 4POGA 3BZCA 4JBKA 1Y14B 2CKZB 3KQGA 2B63H 5C44G 1PH7A 4A3FH 1TWCH 4B3ML 1Z47A 2K5NA 2D62A 4K0KL 5AW1B 1GK4A 3AYHB 1IBLQ 3NEMA 1SLJA 3VMZA 4GLXA 2WPQA 2E8GA 3V4QA 3TRZA 5GAGC 4X65L 1KHIA 1KIXA 1R9TH 3PO3G 3KDFB 2BA1A 5AW9B 2YU9H 4YCVA 1GVPA 1MV8A 1VQOA 4EQ5A 2UXCQ 1SMXA 2NN6G 4YCUA 3NTNA 3CCQA 2B63G 4A3FG 3KYHC 2EIFA 3MEFA 4LF9L 2ZTDA 3LGJA 2LSSA 4AYBG 3G71A 3NENA 3ICEA 3TNUB 3S24A 4PG3A 4J15A 1N36L 4GOPB 4AQRD 1XMQL 3CPFA 5APSA 1EQQA 3A5TA 5FLXc 4JI1Q 1P16A 4GNXB 1K73C 1GZLA 2VY3A 3W1BA 2R3CA 4NPSA 2QM8A 3CCRA 2HQLA 1H8AA 4KHZA 2WPSA 4DUZQ 4JYAL 2ZTEA 1DH3A 3HOUH 4ALPA 1N32L 2R32A 3I55A 4C7NB 3TREA 2Y0SE 1H88A 2E2JH 2UUAQ 5JJLA 2Z6KC 5M5WH 1N8RC 1OXXK 1T2KD 4DV4Q 4A3MH 3STBD 3OTOQ 1U0LA 4LF6L 1J5EL 4DR7Q 4H02A 1YZ6A 2HIXA 4GS3A 3J80c 4YWMA 4JI0L 2ZJQA 2KBNA 3HOUG 3I7FA 2CCZA 2E43A 3M06A 3DLLA 3T1HQ 5H1SE 1Y1VH 1X9NA 2UXBQ 1MJEA 3L7ZC 1EIFA 1VQ5A 3HE5B 1CKMA 2MNAA 3VYIA 3S14H 2Q2HA 3T1YL 4DR5L 4A3MG 4QJFA 1Q8KA 3K7AH 4DV6L 2OQKA 2R5BA 1YITA 3FHWA 4YHHL 4LF8Q 4PZ8A 1X65A 1WJJA 1VQ6A 1JE5A 2OWOA 1QUQA 4X66L 1Y1VG 3AEVA 3HE4B 4KHPL 3SWFA 3E9HA 3F2CA 4A3GH 4HIMA 3TS2A 2K5HA 5M5YH 4AQYQ 1Q1EA 3CCJA 2VS1A 1S9KD 3S1MH 4DV3Q 2JA6H 2CQOA 1QVGA 1T2KC 1HWTC 4X64Q 2N9BA 1V9PA 4ME3A 1CKOA 4JI2L 1OXSC 3M4PA 1S40A 1E1TA 3CC4A 4DV7Q 1PA6A 2WT7B 3KDFA 3V5BA 1FAVA 1GK6A 2WAQG 3A0JA 1I50H 1PYSB 1FGUA 2AWOA 4A3GG 5APUA 2GVAA 2PI2E 4NXNL 4XE5B 1HNXQ 5IYBH 1VQPA 1Q7YC 4BY1H 4B3TQ 4IO9A 2WB1G 1B7YB 2VUMH 4NXMQ 1D8LA 4BA1I 2JA6G 4KLKA 4LF4Q 3HKZG 4DR6Q 4DAMA 2PQAB 5LMNL 3CC2A 1NAFA 3PUVA 1PH6A 4UPAA 4IFDJ 1YIJA 4GN4B 2BH2A 4B86A 2A8VA 4O2DA 5BR8L 5IE8A 1FJGQ 5AVVB 4R4OA 4C3IH 4A75A 4B3RL 2XU6A 3UDFA 3PGZA 1PVOA 4HIOA 1VQMA 5APTA 3PF5A 1ASYA 4IFDI 5IYBG 4YWKA 4BY1G 4LUVA 3PIOA 4GNXA 4LFBQ 2VUMG 1S3OA 1I94L 1K83H 2W27A 4LFCL 1KRSA 4DV5L 2YNYA 1HR0W 1HH2P 4DR4L 1VQ9A 4YY3L 2C9LY 4DK3C 1L2FA 2DUDA 2BA0A 3S2DH 2WFWA 4L5RC 2UU9Q 1EQRA 3GTGH 5APYA 1GU4A 3I4MH 5GAHC 1KQLA 5M3FH 4QL5A 1E7ZA 1UE5A 4JBJA 4A3LH 3UDGA 4AYCA 1MUUA 4UY8C 1MJCA 2ZM6Q 5IT9c 2BASA 2YTVA 4GKKQ 4JI7Q 2QA4A 4JV5L 5GROA 2WP8J 2E2HH 3RZDH 4HJ5A 3BZKA 1JUNA 4HJ8A 1EIYB 4A4IA 4GOPC 5AJ3Q 2ALYB 4QY7A 1XPOA 2F4VQ 4LUOA 5IP9H 3I4MG 5M3FG 4JCVE 2IY5B 2Q7CA 2VQFL 2QGQA 1VQKA 5C4JH 4A3LG 2HHHQ 3EBEA 3A2AA 2MO0A 3TYYA 2OQ0A 2JE6I 1KQSA 5GADC 1Y1WH 2KP8A 1G2CB 4M3LA 2V1CC 4R4QA 5IP9G 1E3PA 4WJ4A 4QGUA 5JJIA 1CSQA 1IO4A 2OCEA 1VQJA 3AQQA 4PMWA 4JI4L 1WFQA 3T97A 5K36G 4YCWA 4UP8A 1V43A 1K3RA 5M3MH 4BXXH 1N9WA 4OO1I 3A5UA 1VQNA 4IPDA 5AW5B 1VQLA 4DV1L 1Y1WG 3SGIA 4HYTB 2PI2A 3UDIA 3M4OH 4IPCA 1HR0Q 2R7ZH 3I4NH 4JI8Q 3P8MC 3GDEA 4JI0Q 3RLNA 3NXSA 1HJPA 1X3EA 4Y7NH 1N33L 1QUQB 1SROA 1JT8A 5E7NA 3MGNA 3PO3H 4X62Q 3JAMc 1KAWA 3H3VI 5APWA 1PH5A 3S17H 1EFWA 2UUBL 1TWGH 1LUZA 3CP0A 2GN5A 1K8AC 4BXXG 4JI6L 3RLOA 3U4VA 1GU5A 3CMEA 4DR5Q 1XTDA 2JA9A 1LTLA 1XMOQ 1IYJB 2NZOA 4DV6Q 1VS0A 4LF7L 4YHHQ 2R7ZG 3I4NG 1UEBA 3GO5A 1UE7A 3VTPC 1BBWA 5C0XJ 4LFAL 3KFUA 4X66Q 4LW1A 1AH9A 2VNUD 4AUWA 4DV0L 4P75A 3O8ZA 4GKJL 5AVTB 3IR9A 1K9MC 4AYBE 1HZAA 5C0XI 4LF5L 3HKSA 2K4KA 4P74A 2R7FA 1HNWL 3KF6A 1IBMQ 4IPGA 2YV5A 1VQDA 4DV2Q 1N34L 2Z0SA 1CKNA 4DUYL 1HNZL 2Z6KA 3K81C 3ZJYC 4HJAA 1HZCA 3EN2A 1BBUA
chains in the Genus database with same CATH superfamily
3OMCA 4JI5Q 2MQHA 2KHIA 2RBMA 1Q46A 1VQBA 1ILQA 1ENAA 3TP5A 2E74B 3OYYA 5AVZB 4QIWE 3P32A 3WUVA 2F0EA 1D6EC 2L1BA 5CCGC 4BBSH 1L0LK 3CD6A 3MXNA 1KD1C 2OTKE 1GOZA 2B2TC 1JY3P 4A3IH 3IAOA 1J1DC 3SFDC 4FXDA 1EEFD 5EBDA 3L73G 2N1TD 2VQEL 2OTJA 1YQ4C 1A3TA 1A62A 1Y8NB 4JI3Q 2F0KA 2A73B 3SWYA 1PGOA 1XXGA 3I4OA 2I5LX 5LMUQ 1I6HH 1FU1A 1NTMJ 3L36A 4HKZH 3CCMA 3C8VA 1K0SA 2EJMA 2UXDL 5C5LA 5IYDH 4Q5VA 3K80C 3U1AA 1ZRTD 3GTOH 3CCRP 2RSOA 1JY2P 3NQTA 2O01J 1FL0A 4DR2Q 3OAKA 2IHEA 1EUJA 5CBNA 3CCLP 4WJWA 2Q1KA 5KLVG 3CC7P 3Q1MA 3O13A 4IFDG 1PYBA 2HDLA 3HOUB 1VDZA 2V7QJ 2XNXA 4NB3A 1I5FA 2KOLA 2R61A 4PJ0H 1DIPA 2EJGC 3L74G 2NPSB 4X3UA 1Q81Q 4A3JH 1O78A 2JSOA 4R4LA 3II6A 1EYGA 2JN4A 1AE2A 4CBVA 3D8GA 2DY8A 2EQSA 3AEEC 4K6LA 2PPBC 1M1JB 4V0BA 2FXMA 4BBSG 1LTAC 4RO0A 3KF8B 1I6VC 2N8NA 4FP5D 3AE4C 3CF5A 1GL2A 5JVH3 3V2QA 1XWEA 1D5XC 5M5WB 3T4AC 2N78A 4P72A 1W6KA 4A3IG 3DHQA 4L73A 1IL8A 1NTKE 1PIXA 3W2DA 1EZ8A 2B2VA 2IJ0A 1ICWA 4WWIA 1G2CA 3LW5H 2JEBI 5D65A 2KENA 3A54A 2O01N 2ZVNB 2H5XA 4HIKA 4DK0A 1LTJC 1ZYRD 4ILWA 4A3MB 4BBRH 1JB7A 1HFGA 2JYOA 5IT9E 1KABA 3PF4A 3PO2B 3IFDA 2NVYH 2YKOA 2RSNA 5FO9B 3PSIA 1SAPA 4U673 1SQXE 1HGVA 5IYDG 3WWVA 5KJ7C 1XNRQ 1SFOB 1BCPF 3F89A 5KLIB 1KDBA 1FNUA 1M7LA 2K33A 4RH6A 3H94A 1WD1A 2WVRA 2EYFA 4DR3L 1S5LX 1RY3A 2M3EA 1SNDA 2G8YA 4RMFA 1JQYD 1PPJD 2NZ2A 1BGYG 3RK2D 1WCMH 3GV6A 3JC66 4RFBA 5C4XH 4BRYA 3OOCA 1T9HA 1I4PA 2FFDC 1ZOYC 1BCPD 1S5BD 1IFIA 1BE3D 3IN6A 1VMPA 1PFMA 5H2FE 2Y0SG 1AA0A 1RHPA 2DNCA 1TR5A 3NBHB 4HJ9A 4H44D 1D5MC 1ZMEC 3HD7B 2KJXA 4A3JG 2AXTE 3RK3C 3TSSA 1IBKL 2PCFB 5FJ8H 2IX3A 5DJTB 3VA5A 2JKVA 2JWDA 3GTLH 2K32A 3TDQA 1BNZA 5CV5A 1EZ6A 1I4HA 3B5NA 4GOFA 2EYOA 3KJOA 3TQYA 3OW2A 3HRZC 3S14B 1ZV8A 2QJKC 1KN7A 3D0FA 5CV6A 4Y52H 1C7YA 4O9BA 1SLQA 1HBWA 2M00A 3FP9A 2R93G 1K04A 2Y9YA 4PD4E 2P7JA 3AEGC 2K5WA 1IJDB 2XTIA 4J8QA 4KKTA 5KIXA 3B71A 1GUSA 4BBRG 3K7AB 1SQPG 2N1TC 2FYUG 4KT0J 3CWBG 1N7LA 3FXEA 5CV4A 3KUPA 3IAYA 2E75D 3CRKC 5J39A 2ITAA 4DOJA 1PH9A 2DW3A 3L75D 2MKVA 1CSPA 1CSBA 4N6JA 1PTOH 1VQ6P 2KUBA 1YNXA 2QJYB 3NTKA 3U9SA 1WCMG 2GA1A 5C4XG 4A3EG 3C46A 1W2EA 3UI2A 5FO7B 1KAAA 4GT1A 3CXHH 3GD7A 3K5OA 2QEXP 4HEDA 1EL0A 3E7KA 1NGMB 1H95A 1O7LA 1YEZA 1XNQQ 2ZAEB 1EYDA 5HGTA 1T3UA 3KLWA 1IBLL 1M90Q 3PJSK 1GJXA 1KB9E 1S3JA 3OHXC 2RVLA 2QW7A 1ZEQX 5FJ8G 1GW3A 1Q81C 2K14A 2FYZA 4DAYA 1EY7A 3HUSA 2WAQB 1U4PA 5JAVA 2A45H 1YYCA 3HEJA 4ZQ3A 1P84D 4IJHA 5TSSA 1QVCA 1SNMA 4OO1H 3RN2A 3P7KA 1GD7A 4IUQA 4RA8A 1M4VA 2WAQE 3TMEA 1S5FD 3T97B 3GTQH 3D3RA 1NCVA 4B3SQ 3STBC 3HOXH 1BSNA 3H0GH 3PV0A 2UXCL 1VQGA 3S1MB 3MXPA 2IYPA 4RGTA 2Q2TA 1XPUA 5EKIA 2RH0A 1V8QA 2B87A 1T6AA 2WB1E 1JNMA 3HKZB 3CCVA 4A3KH 1JICA 3AU7A 4GDOA 4O0AA 4XT3B 4BWGB 4R8NA 4X3KA 3H32A 1Q82C 5APQA 1TY0A 1RF0A 1SQQD 1NSNS 2AKWB 2BDOA 1IKMA 3HKZE 2BOSA 5CJ0A 4CDEC 4EVOA 3J7AV 3KHUA 4I6MC 2O5JC 3VP9A 1DGSA 3H15A 2QDLA 1L0YB 3CQZB 1CA6A 1EZVG 5KKZC 4CJ1B 1T5XD 2FYNB 3H1KE 3ITKA 1FZCC 3SHLA 3H3VH 3J81i 5KLVD 3RK2C 3BCCD 2K52A 1IW7D 3DWQA 1L0LE 1PP9J 2W83C 4PV1D 2VL6A 1BCPC 4L63B 3AE9C 1IZ6A 4DR1Q 1X8YA 5B5EH 4RG1A 3N52A 1IYUA 1NTZG 4IPHA 3Q5RA 3EIVA 1FDIA 4H44C 3NK9A 2A45G 1PHJA 1JORA 3H1JE 5APXA 4XFJA 3S1QH 2Q2IA 4OO1G 1KRTA 1FGBD 1P84I 2CH4W 3BJUA 3DM3A 3M0AA 1L0ND 3RL0B 2FXQA 4RGNA 4BY1B 1SQQJ 3CL3D 4C3HB 1DEEG 2E74D 1X56A 3HOXG 2K1AA 1EXIA 1E2ZA 2F0TA 2G5DA 2P2UA 2F1MA 3H0GG 3P1HA 3RR5A 1CM9A 1JC7A 1SQBG 3L72D 4C7RA 3D4RA 5I2XA 5DNFA 2JA5H 2VUMB 3HOZH 3BRTB 1SSOA 3TP8A 1S2EA 2YTXA 2VZAA 2XRQD 2I1JA 2XVSA 3U4ZA 4JI1L 4CGYB 2NVQH 4OWFA 4A3KG 1DJRD 2VB3X 2BCCG 3ND9A 1DZ1A 5APVA 3R3OA 3CC2P 3VR5A 2OT2A 2BH8A 2WPRA 5KNBA 4XA4A 3A8JE 4KMUC 2E75C 1KILC 1YIJP 1C9OA 3V2RA 3NPPA 3NTHA 4XQQA 2KS1A 1QLED 4CHTB 2NVXH 3GTKB 1NY4A 4A93B 1L0NJ 5CBOA 4U3FE 2F0QA 1LTSD 1MHWC 1VQHA 1VCIA 2RDHA 4JOIC 1KMIZ 2GVBA 2QEJC 4R1JA 1M90C 1RF1C 5GTHE 5KRUA 1B3AA 2R92H 3MUDC 2XNAC 1GM5A 3GTJH 1VQAA 2K05A 2CVRA 2WSCJ 5C0XH 1X0TA 2OYOA 4IOIH 4C3IB 3TSIA 3SR1A 2HODB 1YJNA 1VQMP 2EY5A 4OX9Q 2O4XA 2UUAL 3ER0A 4YXWH 2HIVA 2JWAA 4KY7A 2K37A 1WTPA 3K0XA 2NPSD 3FKIB 1TWFH 1SXTA 3GTPB 3M4QA 1Q86Q 1FBMA 5CBAE 2XGTA 2KSJA 2A06D 2KVMA 2CHBD 1OXUA 2JA5G 2D2CB 2WSFH 1WVLA 2O3JA 3RNUA 3HOZG 3J81j 4MZ9A 2OYIC 1L1OA 1Y8OB 4MTNA 1JJ2A 1K83B 4HSPA 4RHRA 5JVG3 3CX5D 2E76B 3R4YA 1GDTA 5GTIE 2NYZD 1BBXC 4MHEA 1FOSE 3MTUE 3H1IG 1A3UA 4K6DA 4ZK9B 2QM7A 3BDOA 4OGQB 2FYUD 4L76A 1X54A 4DR7L 4KJNA 3KF6B 3RLFA 3GLMA 5K5PA 2KI7B 1KYOD 1X3GA 2CFMA 4TQUS 4B3MQ 1DD2A 2B2UA 4K0KQ 5AVWB 5CC4A 1TVXA 1Q90A 1RD9D 3O6QB 2KNCA 1IK7A 1NAYA 1BDCA 1F9QA 1PZKD 2KA7A 5CV9A 1M1JA 1CKNB 1EOVA 3T1HL 3P8CD 4OELB 1P8LA 2R92G 2NZHA 2RDFA 4A3BH 2UXBL 1JMBA 4JBZA 1B50A 3E0EA 3EFFK 5C0XG 1NTKJ 1SE4A 3GHGC 2W6BA 5JPNC 1UAPA 3U50C 4WVZA 3CU7A 2XNDH 1PH1A 4PV1C 2F0PA 4X65Q 2Q9IA 1BQQT 3QJYA 5M3FB 1XYIA 3HOWB 1F2LA 4C46A 2D0OA 4FF4A 1KDCA 5LL6S 4Y99C 1SE2A 4GKJQ 1SQXJ 1WMKA 1D7QA 3Q22A 4B9WA 3PIP3 2HQEA 2KHSA 3A3YB 3OW2O 3LWEA 3MXNB 4BY7H 1KNEA 4JQ0D 2H8PD 1JWMD 5AVRB 3MP7B 1GO3E 2QKIC 2ES2A 4A3DG 4S3SA 2QA4P 2SNMA 4LLHA 4RESB 3CX5I 3CLQA 4LF8L 2Y0EA 1RL2A 1NYHA 1M8OB 5AVYB 1TWHH 1ENFA 1HNWQ 1EQ7A 3S16H 3SFEC 2LR2A 3HD7A 2E2HB 3RZDB 1KYOI 2IW3A 2HG5D 4IOAA 3TGUG 4TKOB 3S1NH 1OVRA 4GNXC 4LF9Q 1ICFB 1SN8A 4RKLA 1URQA 3G6EP 1OXTA 3M9HA 5AW8B 4IALA 1LWUC 1LYLA 3BYTB 3F1ZA 5EKLA 1HNZQ 2KSEA 2E5LL 4A3BG 1D2BA 4ZKBB 4K14A 1LT9A 1QCBD 1FJKA 1LTSC 5D3IB 4UP7A 3QG1A 1HA6A 2PFXA 2Z6BA 3PUYA 1SR3A 1NJIQ 4HB1A 4G57A 4C3JB 4DJGA 1TU3F 4RWSC 3NFQA 3J80i 2AEFA 4H13B 4KJMA 2MJZA 1VQKP 5EJWA 3K5NA 4UB6H 2CWPA 1FJPA 3OMGA 1EC5A 1HPCA 4AQYL 1N36Q 1FDMA 3A5ZB 1WTQA 5C4JB 4M1UB 2KEEA 4KHXA 1FNVA 4C2MH 3CAMA 4BY7G 2RHSB 5AW0B 3VYRA 1GL2B 1K3BC 4IFDK 4KTAA 2OTLA 3L4FA 1XMQQ 1HVVA 1UE6A 2EXZA 2F3VA 2YXRB 4X64L 2F4IA 3VMYA 2Q6QA 3MHVA 4QCLA 4AIMA 2PZWA 4ASVA 4XQNA 1J9OA 3MIWA 3LIDA 5G3LD 3M91A 2OARA 1NU1G 5M5XH 2BEZF 3ULPA 1EY0A 4JYAQ 1TWAB 2V4DA 2Q5UA 1QZGA 2LKMA 3FGAD 5C6AA 3BYYB 2R3SA 3M0DA 3I56P 1HTLD 3KLSA 1SYDA 3HFZB 5FLMH 1N32Q 2XWBB 3SEBA 4DV7L 1JJCB 4FVMA 4WORA 4A7PA 1KQFB 1WTRA 1QJOA 4BRYB 4KD3A 3RL0g 1B8AA 2YTYA 1SBBB 1EY9A 5KLIC 1EY6A 1TS3A 2K1BA 3OIQA 4L8JA 1L4AA 2LKVA 2OYHC 1EFID 3T51B 3VMXA 1E2WA 2IX0A 1Z9FA 5I4DA 5FKAC 2Q8RE 1HNXL 2FXOA 2M9VA 3IFMA 3G3ZA 1LV9A 4B3TL 1SE8A 5AVQB 1L0XB 2CW0D 2EY6A 4A76A 2HLOA 2Z1CA 5LMNW 1MD2D 2R6GA 4G7ZC 4NXML 1PGPA 4G7HC 1VQNP 4BWNA 4LF4L 5M3MB 5T1GA 2WQYC 3RL0D 4DR6L 3FX0A 4LF6Q 4U68A 1J5EQ 3K8AA 1U5KA 4O1NA 3V6IA 1ASZA 1G91A 1YJ9A 5DM63 1L0LJ 1AVYA 3H1ID 5IGFA 5J1ZA 2WSEH 2AQ3B 4JK1C 4WRDA 3MFYA 3M4OB 2H88C 5FLMG 2R7ZB 1UUPA 1W6JA 5CBEE 3I4NB 1WOCA 3NELA 1G291 1FJGL 3N7NA 4K5VA 1PZJD 4I7ZC 1M56D 1PRTD 2EZVA 3G48A 5CCHA 1SQPK 4KI0A 4APVA 1OMIA 1PGQA 1JTHA 4QF4A 4JYCA 1CT1D 1QZHA 1N73C 2I46A 2HT1A 1VQ8P 3G6JB 1WT6A 1VQ4P 3PO3B 1FR3A 3I91A 3L71D 1MZ9A 4DAYB 3DUZA 1CZWA 3T1YQ 2ZYDA 5A35A 4LFBL 2YIUC 2L4NA 3VDYA 1J8IA 1JOKA 5C3WA 2KUMA 1L2PA 1HZBA 3HOYH 1XTGB 5AW6B 3NBIA 2QJPC 1I3QB 5D3DA 1KTKA 3P20A 3RBXA 1Q12A 4K8JA 3MZWB 5BU5A 3Q0AA 2RKSA 3H1LE 1VQEA 4WY4A 3E3XA 1D1KA 2W8ZA 3H09A 1CZQA 1PPJG 1U57A 1X3FA 1EEID 4NMZA 3WOFA 5EPKA 2QF7A 2D2CD 1BE3G 3BASA 3QOJA 1XJVA 4DNIA 3MAQA 2DJFC 1K73Q 5KEEA 4DCKA 1YHQA 1TXYA 1PH4A 1GW4A 2EPBA 1PLFA 1KILE 1Y8AA 3H32B 1IFPA 2DY7A 1N7SD 3FVQA 3L71J 4FDBA 2UU9L 2IHFA 3TGUD 4OGQD 1SP4A 2XIWA 2K75A 1A2UA 1DCZA 2JJLA 2B2TA 1P84H 3TEHB 4KHPQ 3L70E 1R4PB 1J1EC 2LMCB 4C56C 1J6QA 1MBYA 1HJBA 2W6AA 4IL6E 3H1HD 1DOKA 1GHJA 3BDCA 4WJ3M 4PZ7A 5IWAQ 2YMYA 1JMMA 2F0GA 4EQOA 1STEA 2SEBD 1SQVD 1VQOP 2Q2UA 2Q8TA 1O7ZA 3HZXA 2YU9B 4R4CA 3RGUA 1JWSD 1PFSA 5JEAJ 1ZLLA 1YJWA 4DK6C 1S9KE 1OWAA 4ODGA 1ZP0C 1Q1BA 5ELOA 1VQ7A 3HOYG 1N8RQ 2CW0C 2ZXEB 2ENBA 3L75G 1V1QA 2H1EA 1AQ5A 3H6MA 1CI6A 1SMYD 1J2JB 2ZM6L 2NVTH 4GKKL 4JI7L 3M9BA 4JI2Q 3S1RH 1NTZK 1HF9A 3PUWA 3RL0C 1W3SA 3LX0A 3L73E 1HCZA 2A69D 3IRBA 3OWEB 1LTID 3W5OA 2F0SA 2X6GA 3D70A 2MGSA 1UE1A 1SQVJ 5AJ3L 1NTMD 2MO1A 2N88A 2F4VL 2ZT9D 4ASWA 1TS5A 3G71P 4LWCA 2KS1B 5CJ4A 3FXDA 3VN0A 1QE6A 2EYLA 1SQBK 1I4QA 3QH9A 2F0WA 2KCTA 1OVVA 1F2MA 1DM0B 2K88A 2HDMA 3S9OA 2FJ2A 1LTJA 2PMZB 4IUPA 1IKLA 1PRTC 1SVFA 3JCUH 3L35A 3CPWO 4NXNQ 2B29A 3W3AA 3U9OA 2L5GB 5J3BA 3K7UC 1TQOA 4CDDC 3HTKA 5EFWB 1S4ZA 5AVUB 2PMZE 3MVVA 1OXVA 2CPBA 2FKWB 3D4WA 1NE3A 2HYNA 2PQEA 1E22A 3L74E 1LTRD 2HHHL 4X6AH 5IGDA 2AQ2B 3M85A 4N78E 4UDUC 2OTJP 4A3IB 4NPFX 1HQMC 3F8TA 4H13D 1STAA 1RE4C 4RGMA 3TZDA 1K8GA 5TISH 1SQQG 2FFDA 1MIUA 3R2PA 1AFOA 2LXJA 4HMIA 3FMCA 4MIUA 5FO8B 5LMNQ 2K3RA 3CCMP 4DU9A 1LTBC 1I6HB 1FYCA 3FEWX 1L1OB 3VYTA 1GL2D 3VR6A 2VW9A 1WRGA 3I5CA 1IXRA 4JBWA 3BCCG 3ULLA 5FOBB 2IT1A 2YYZA 3K5MA 4CKBA 1V1OA 3L2PA 3GTOB 5AW7B 3I55P 2D2CC 1BVSA 3A55A 5BR8Q 4XQJA 1DONA 2O2LD 1USEA 1M1KC 3PH0A 1JMCA 5NUCA 5CV7A 1SNQA 4RJTA 4K35A 3K59A 3CW2C 4LAAA 1N7SC 3CCLA 2KNCB 1C48A 5ELBA 3CC7A 4B3RQ 1IFJA 2WIIB 3UE0A 3AE7C 2KXPB 1L0NG 3KOJA 2E2JB 1LM0A 5IYCH 2K04A 1BGYE 4TSSA 1KC8C 3GW6A 1RTNA 2IBZD 2N1TA 1PFIA 1YHBA 3M3YH 4LMQD 3L72G 1H9SB 3SSUA 4PJ0E 3NMDA 1R8EA 1A0IA 1Q2NA 1SJHD 4K8IA 2YO2A 4XIGS 3CX5H 2WKCA 1WTWA 1JY3N 1I94Q 4YWLA 3SK8A 5HGQA 2M5AA 4LFCQ 1JCKB 3AE8C 4DV5Q 1EDLA 1T5EA 3S15H 2EYMA 5C4HA 2F3IA 1SS1A 4DR4Q 1KYOH 2K9JB 3VR4A 4XTCS 1X3PA 1NMGA 1UIXA 3PO2H 4YY3Q 3AE1C 4P73A 3B5ND 2WTYA 4G4KA 1RF2D 2K9YA 1JJGA 3NWSA 4GLVB 1NNXA 4JG2A 4A3EH 1SFOH 2J5UA 2ZYAA 1LT5D 1AZQA 2UUCL 5BN4A 3J81L 4DZOA 4EI2A 1SNPA 1HR0L 3AEAC 1HFNA 4ZRZA 2I07B 4JI8L 1SQPE 2POHA 1EWIA 2A69C 4ZKUA 1O7YA 5AW3B 2IPKD 2X69A 1LTIC 3CWBE 3L9AX 3B4SA 3J7A5 1XTCC 1Y1VB 5C4XB 5EPJA 1VQ5P 1R4QB 1HGZA 2D0PA 3B8EB 4OH8B 2ZT9C 4TLFA 4GN3B 5IIFA 1URQB 2KZIA 2KYVA 1SFCA 1EXJA 4D6TD 1X9VA 1GUTA 1SRUA 2P67A 2F52A 3JC22 2ICEC 5IYCG 2D5DA 2ATWA 3FRPB 1XPRA 2PNHA 1KV4A 1A15A 5AW4B 3V4WA 2JA7H 1IFNA 1LT9B 4X62L 4R4TA 2A06G 2XRSD 3A74A 2IBZI 2WV6D 1JOQA 2VXWA 3HOVH 2QIWA 2H4OA 2OQQA 2OXPA 2RCFA 2NWGA 1SYFA 1A02F 4L5SA 2JJQA 1Q7YQ 1YITP 1RQUA 2QG4A 2IPPA 1EIHA 1N86A 1GKHA 1YHAA 1F9PA 4GN5A 3V2TA 4JV5Q 1H9JA 3EJIA 2WMMA 3PO2G 1KTMA 1XMOL 1VF7A 2B2WC 3PP5A 3E6ZX 2PZTA 1U4LA 1D7MA 1G6PA 3M9QA 4D6TJ 4OXPA 3CXCA 5AVXB 4J6HA 1GL2C 2YO3A 5EAYA 5JJKA 4HH2A 1N2DC 1BDDA 1PTOB 2EYJA 1KNAA 3HP3A 4ABNA 5IY0A 2MJ8A 4XYQA 2Z4HA 2AHOB 3IKJA 3M4YA 1VQIA 2KHJA 4ULLA 2QILA 2LXKA 1D5ZC 1MFZA 4CKCA 3J7ZC 5GQOA 1YVCA 2QEXA 2GM4A 2E5LQ 4A3GB 3OJAB 2B3GA 3CXHE 2EYHA 2JA7G 4IZ8A 1A02J 2ZTCA 3CCJP 1YI2A 1B70B 2VQFQ 1EZVE 5M5YB 3USSA 3HOVG 1NU1K 3H1LJ 1L4AB 1V1PA 2RN0A 1SDFA 1PP9D 1G1IA 1B9MA 2IX1A 2WB1B 1X55A 5CORA 2B2YC 4Y28J 2Z5IA 4UP9A 2KCMA 1KILA 4IL6X 1NTZE 1AEXA 3ERSX 2BEQD 2TMPA 2I5MX 2JA6B 2JR8A 1EU3A 3GTQB 1PV3A 1ZYRC 1GTWA 4RGOS 2AWNA 2AQ1B 3JSVC 3S1KA 3H0GB 3D6CA 4MTKA 2AMCB 4JOIA 4IOCA 3MHBA 1OFCX 2RMZA 1RF1A 1JE4A 3X3NA 1IBML 2K50A 1JCDA 3JAMi 4A3DH 1SEBD 3CC4P 2LY7A 1G6ZA 1QG7A 4CDCC 1CHPD 3MZ5A 3B5NC 4DV2L 1SQBE 2JEEA 1LP1A 3L0OA 2Z4EA 4OWXB 4A3KB 1E2VA 2HUGA 4POFA 5FLXL 1E5WA 4U7JA 1C4QA 2NN6I 4FF3A 4GIFA 2A74C 2BCCE 5HURA 2K5VA 3CQZH 5COYA 1I50B 4DFAA 2C35B 2M3BA 2XZRA 1U7MA 1JB0J 4JVZA 5KNCA 1VQPP 2EY2A 4JI5L 1K28A 2IDBA 3EROA 4F7XA 2OYIA 2R3ZA 1WI5A 5E4XA 3CI9A 4JI4Q 5CMZA 3PUZA 3R93A 3PTZA 2B39A 2ASBA 2L9HA 2DNEA 3S1QB 2G3AA 1JTHB 2JP1A 4K5WA 5B5EE 2WACA 1NMFA 4JPBW 1GMJA 3L73J 5HY6A 4C3HH 1FD7D 1SNOA 1BF4A 1E79H 4LC1A 5L8RJ 3UIAA 3E1RA 3TK1A 4JI3L 1MSHA 5CMDA 1FVIA 1ILPA 2P5ZX 3AEDC 1X22A 4KHVA 4DV1Q 3I2ZA 2PGDA 5LMUL 4HIDA 1CTMA 4LNQA 3VP8A 3TDKA 3HOZB 1LT6D 5GAEC 1WD0A 1QGKB 3J81E 3KYQA 1JY3O 1ZW0A 3HUSC 4H0LB 2C9NY 4WY4B 1NTGA 2F0HA 2N49A 3G4SA 3QO2A 2B8GA 1BKBA 3VOPA 1IFDA 3S9WA 2KQ3A 1FC2C 4DN4M 3UDXA 5J22A 2WWWA 5M9OA 3Q23A 4DR2L 3RN5A 1PFBA 1BCCE 4N8FA 2J0TD 1JM0A 4DPGA 1SJED 3GTKH 1MKHA 1HZ9A 2FINB 1NOHA 1HA5A 1GD2E 1MSGA 1YTZT 3A7AB 3PCOB 4DAPA 1N33Q 4A93H 2NVXB 2QDBA 1KLGD 4LGDE 3U59A 1UNSA 4MNOA 1JOOA 1JY2O 4KV6A 3J80L 1ZKOA 3TNUA 1IC2A 1G51A 3FPPA 2R5DA 1YJNP 2NZ1D 3C1EA 3MEHA 4R9WA 4EX5A 1JCCA 2JXMB 1J1DB 2MPMA 2X6LA 1YBYA 4BA2I 4IUNA 1I4XA 3C1FA 1Q90D 4DV4L 1A6XA 4GOPA 1RF0C 2UUBQ 1RJTA 2ZFCA 1VQFA 4JBMA 1NTKD 2XDJA 1KL9A 3MC0B 1B9NA 3FKIH 4C3HG 3GTPH 2K01A 4OWWB 3GTMH 3OTOL 1QVFA 4JI6Q 1TWFB 1XX8A 4P71A 1VQ9P 1A63A 3A0BH 1DOLA 2KB7P 1ESFA 1NUCA 3PIPA 5JEAH 3Q5SA 2K28A 1SQXD 3G9RA 1MI2A 1CI6B 2RCNA 2O5IC 2E2IH 1XNRL 4LF7Q 1B2TA 2FMCA 2E5TA 1S72A 1W2BA 1TIID 1O7IA 3VYSA 5IP7H 3S2DB 4X3SA 1VF5B 2ZXOA 2JP3A 5I2YA 1RDPD 4R4IA 4GLAC 1BGYJ 1NH4A 2F0LA 4QQBX 2J58A 4C7NA 2VRSA 2F0IA 3BS1A 3GTGB 5IWAL 1X32A 4LFAQ 3GMAA 3NTIA 3B6YA 3AE3C 4A93G 1PH2A 1H9SA 1IW7C 3I4MB 3AEBC 3A0HH 4ZKPA 1K0RA 3W1GA 1WTOA 3L71G 4DV0Q 4RHSA 2DGYA 5M1BA 3Q5PA 4A3BB 3MD0A 3HD7D 3PIO3 2NTTA 3F2DA 5B66H 5AFWA 2J7ZA 3T16A 1B4OA 1LTJB 2K9JA 3Q3DA 1JR0D 1URQD 2BDNA 3HOWH 3QOLA 1HQRD 4ZCKA 2R93H 4LF5Q 1SYCA 3FKIG 4IUVA 3TBIB 5KTBA 2E74C 3HTKB 4EOTA 4PD4D 1NWQA 3NSWA 2XV5A 3CCUA 1USDA 2B8FA 3H6PA 1IFMA 1UWVA 5FK9C 5JEAG 4JYBA 4JC0A 5IODA 2E42A 2R7DA 1O80A 5BU8B 5IGBA 3CCSA 1FS0E 3SE0A 1VQCA 4K5XA 4IN3A 2JK8A 1IL2A 1X79B 4LUZA 2FFDB 3OSOA 4DXFA 5IP7G 4DAVA 1N34Q 1T8ZA 1ET9A 5FLXE 4XYOA 1AE3A 3K57A 2OYHA 3LIEA 3CMAA 2O01H 2ZXRA 2JEAI 4DUYQ 3S16B 2Z5HA 4F87A 3CPWA 3NUCA 3AFQA 4GKGA 1BOSA 1LNQA 2CK3H 1WYDA 3H1HG 3A7LA 3TP7A 3PUXA 1GUOA 3L3OC 3QIAA 2MFIA 3S1NB 1KB9D 1XNQL 3U58A 3HE5A 1NU1E 3KJPA 3RK3E 1I4RA 1ONLA 3S2HH 2L0CA 4EGVA 1SQVG 2V7QH 1TS2A 2H7HA 5IGEA 4C1NI 3A7OA 1L1OC 2F0NA 3G6EA 1SQQK 2QJKB 4Z9CB 3WU2H 1EWCA 1PH3A 5ELNA 2BCOA 4BXLA 3BZDB 2EXDA 4L5QA 1HJ0A 5A2QL 3I90A 2HPCA 2A1AA 4AH6A 1Q86C 3HOWG 4C3JH 5C4ZA 2M0BA 1AQTA 5KLVK 3DEPA 3GQBA 2ZXPA 1RE3C 1M57D 2NPSC 2B2UC 4DV3L 2N1TB 4K2LA 3MXUA 2RF4A 1MGSA 2RHQB 4K2KA 1S5CD 1E1OA 3ULJA 3Q8DA 4KY6A 2VQEQ 2FMMA 4PD4I 1M1JC 3KLSX 1LJ2A 2OTLP 1A8VA 4OL7A 4B3SL 2A68D 2Q3IA 2LS01 2N9YB 4C2MB 1C8CA 3PLNA 5AVSB 4UB6E 3BU2A 1RIPA 1K8AQ 4HJ7A 2M5AB 1DXMA 1L0NK 2UXDQ 1OXZA 1NTMG 1Y1WB 4OVNF 5C3EH 1ZR2A 4OEMB 4DNRB 4PMCA 4PZ6A 4ZNCA 1HXYD 3DMUA 1ZRTE 3E5SA 1QVGO 5EGTA 4IFFA 3R2IA 4FXGC 5JOBA 3F2BA 1N73A 2KOGA 2B9BA 1TWAH 3KXDA 3BDLA 1X6OA 4QMGA 3HE4A 3H1KD 2HCCA 5C5MA 3J80E 3RZOH 1L0LD 3M7GA 5C39A 1KB9I 3K58A 3I56A 2P1JA 1CW5A 2ZXXA 2A6HD 4A3CH 4OIJA 1E24A 3CCEA 4DR1L 5KAFH 2K7VA 3I8ZA 3H1JD 3HS0C 4N8X1 2MUYA 4GOEA 4I2LC 1JEKA 1SFCB 2DJGC 3EQLC 4B9XA 3E9IA 2IWHA 4C3JG 2BE5D 3HD7C 2YMKA 1S5LH 3Q6SA 4HTHA 1AW7A 2JA8H 4QB4A 1K8OA 1EU4A 2J4XA 3M7NA 2R44A 3EWKA 1PDQA 1H89A 4LK1C 2ZYGA 3AEFC 2CWAA 1VQLP 1SQBJ 1ET6A 1K9MQ 4KK7A 5EBCA 2F0MA 1EQVA 2ID0A 5F2DA 3H1KJ 1VL2A 2TSSA 2L15A 4DK1A 3L37A 1NBWA 2L55A 1PV4A 3KZIH 1NO4A 2BCCJ 2P10A 1Z56A 2JQOA 5C3EG 2FFKB 1YJ9P 3V2NA 4DKAC 3FWLA 3H1JJ 3OW7A 1FZCB 1CUKA 3SK4A 1L0WA 3RK2B 1OTCA 5C44H 5D14A 4DR3Q 2ZVOB 3AE5C 2N3SA 2WT7A 3CRLC 4OONA 1ENCA 1PH8A 1DD3A 2UUCQ 1C0AA 5AW2B 4U3FD 3UE1A 3KDPB 1B1ZA 4Y7NB 1PPJE 4H44B 4H0LD 2I5HA 2IBZG 4UB8H 4WY4D 2PYKA 4G7OC 1KXLA 2FYUK 2I0QA 3AFPA 1M8AA 1BE3E 3V2PA 1HUCA 2QJYC 1QL2A 3K5BA 4W7YA 4A3CG 3D31A 1IBKQ 1EDIA 1VDFA 1FZGA 4OWTB 1NJIC 3TS0A 2A19A 4L5TA 4OX9L 2EOTA 3S17B 1MKMA 2JA8G 4TVAB 4PQXA 1TWGB 2C0WA 2ZJPA 2MHVA 3CMEP 1FOSF 1VQ8A 5DLQE 1VQ4A 1LO5D 1V1PB 3EQ2A 2A5HA 1KD1Q 3D4DA 2PQAA 4U3FJ 3J81c 1OW6A 2FHTA 4FO2A 2ZJRA 1I3QH 1BCCJ 2E75B 1KILB 2WZ7A 5E79H 1QVFO 5M3MG 4IJLA 2AXCA 4POGA 1ZN5A 2A68C 1D1IA 3E0JA 2NN6H 3BZCA 1FDOA 2G9HD 4JBKA 1Y14B 2CKZB 2E76D 3KQGA 3RD4A 2B63H 1NKNA 1YTZI 5CCGA 1B3QA 5C44G 2UWJE 3L75E 4A3FH 2OGUA 1PH7A 1RF1B 1TWCH 4B3ML 1Z47A 2K5NA 5IT9L 2D62A 2IX7C 3C1LA 4IFMA 2EJFC 3ONAB 4D6TG 4OIKA 4K0KL 1HTLC 5AW1B 5DM73 1WTVA 1W2BO 1GK4A 1LP1B 3AYHB 3T56B 3NEMA 1IBLQ 4YTPC 1SLJA 3VMZA 4GLXA 5EPLA 2WPQA 1VF5D 5I9OA 1EYCA 2E8GA 5TJHA 3V4QA 4WB4A 1RHZB 5KGUA 5A2QE 1RE4A 2A6HC 3TRZA 2FYNC 5GAGC 2QVAA 4X65L 3FPUB 1BUVT 4RKBA 1KHIA 5E1FA 1KIXA 1P84E 1R9TH 1YBKA 2KIKA 3KDFB 3DXJC 4KKUA 5BN5A 2OYIB 3PO3G 2BA1A 3GV3A 3AB9A 5AW9B 4IUTA 2YU9H 3IFTA 4YCVA 1GVPA 1MV8A 2IZ1A 2BE5C 1CK1A 1VQ7P 2OF1A 3H1LG 5KNDA 1VQOA 1Y69U 1PXUA 3GG2A 4I7AA 1GUGA 4EQ5A 1DOMA 2UXCQ 2WKDA 3U1CA 4HCSA 5KAIH 1K05A 1PMRA 3FWNA 1SMXA 2NN6G 4YCUA 3NTNA 1EQTA 4EDFA 1BR9A 3FDTA 2NVTB 3CCQA 2PRRA 3VA7A 2B63G 3I4LA 4A3FG 3QWNA 3KYHC 2EIFA 3IL8A 5C3XA 3J7AF 3MEFA 2E2DC 1SQQE 4H7BA 1EYAA 1A2TA 3GHGB 4HR7B 4LF9L 2ZTDA 1FZEA 4PV1B 2QE7H 4E6IA 1Y9BA 1ZXGA 4PNYA 3LGJA 5KLVE 2LSSA 3BCCE 4AYBG 4Y99B 3G71A 1PP9G 1DYQA 1HTPA 3CD6P 5KJ7A 3NENA 3T13A 2WSCH 3KLRA 3ICEA 1U4RA 2GUSA 3TNUB 1CQVA 4BBSB 4HSVA 3SK6A 3S24A 4PG3A 4WBAA 1FE6A 2KLVA 4J15A 1VPCA 3ZYYX 1L0NE 1BSHA 1STHA 1N36L 4FF2A 2NRGA 3JCUE 3AECC 2C0XA 2RQXA 2O1JA 4GOPB 4AQRD 1STBA 2XN9C 1PZQA 1XMQL 1F77A 3L72E 3CPFA 5APSA 3MTSA 1EQQA 3A5TA 2OEOA 4B08A 5FLXc 4JI1Q 3P75A 2CQAA 1P16A 4GNXB 1K73C 3R2TA 1GZLA 2VY3A 3W1BA 1NU1J 4KKSA 1FZAA 1G1JA 2R3CA 1LACA 4NPSA 2QM8A 3CCRA 2HQLA 1LWUB 1H8AA 4KHZA 1PL5A 2Z4IA 2WPSA 5TISE 4DUZQ 4XXEA 2ZTEA 4JYAL 4JF7A 2E76C 1DH3A 1YQ3C 3HOUH 5EKKA 3KPEA 4ALPA 1KQSO 4OGQC 1Q8IA 1H9KA 1N32L 2R32A 2Y0SB 3MFGA 3I55A 4C7NB 4J1MA 2EY1A 3TREA 4A3JB 2PP6A 3P7JA 2Y0SE 2PW5A 2V4HA 1H88A 1VF5C 4W80A 3TP6A 3ND8A 2E2JH 2O1KA 2UUAQ 4I65A 2B2WA 5JJLA 2AUJD 4HMJA 2Z6KC 5M5WH 2WITA 3M3YB 2XSCA 1N8RC 1H0TA 2W6JH 1NR2A 1KFNA 1OXXK 1T2KD 1AV1A 2R93B 4DV4Q 2XKMA 4A3MH 3DWPA 1SFCD 3STBD 1SMYC 2A06E 1IHZA 3URYA 3JAML 1QL1A 4BBRB 3OTOQ 2NVYB 2QSIA 2IYOA 1GXDC 3S15B 1JY2N 4ZYSA 3CX5E 1U0LA 5CGKA 4LF6L 2HCIA 1J5EL 5K5GB 4DR7Q 1UIIA 4H02A 1YZ6A 2KK7A 5H2FH 1KZUB 2FYUE 1IYVA 2HIXA 4GS3A 3J80c 4YWMA 4JI0L 2ZJQA 4EYYQ 3RUZA 1WCMB 2KBNA 2AXTH 1KYOE 1SYEA 4A3EB 1LTTD 4IQZA 1EDKA 5IGGA 3I7FA 4L74A 3R8BA 3HOUG 2CCZA 2E43A 2SNSA 3VR2A 1Q82Q 2G9DA 4TT3H 1HUMA 2OYHB 3M06A 1GHKA 1U7JA 3WUUA 3DLLA 3T1HQ 1JB3A 5H1SE 1Y1VH 2B2YA 1X9NA 2UXBQ 1RODA 1MJEA 3L7ZC 3P8CE 1EIFA 1CQFA 1PFNA 2IL8A 1CFMA 3GTLB 1Q3LA 1NTKG 1VQ5A 3HE5B 1CKMA 2MNAA 1LTGD 1JOCA 3VYIA 3S14H 4PD4H 2Q2HA 2HFED 3D6ZA 1S5DD 3HRNA 1S1CX 4KJOA 2JA7B 3OA7A 3HOVB 3T1YL 2PZUA 1SQXG 2HPCB 4NP5A 4DR5L 1HHVA 4A3MG 4QJFA 1F9SA 1FZCA 1Q8KA 1KFMA 3K7AH 2GA4B 4DV6L 4H13C 2OQKA 3H1LD 3HG9A 2R5BA 3I70A 2RDGA 4FYDA 1EY5A 1YITA 1SQVK 1KORA 3FHWA 1RCVD 4NDXA 4YHHL 4LF8Q 4DT0A 2Y0CA 4PZ8A 5I6YA 1X65A 1BE3J 2WSEJ 5CR3A 1WJJA 3WOEA 3ERQA 3ABVC 1KB9H 1VQ6A 1JE5A 2NTSA 4I7ZB 1KILD 2B2VC 1X3QA 4NW2A 2OWOA 3N4XA 3DEOA 2B88A 2EDGA 1QUQA 2KZJA 4X66L 2GUVA 4FXKC 2M8RA 2B89A 1N73B 1Y1VG 3AEVA 4CJ2C 3L70D 2F0DA 3HE4B 5ELCA 3SXHA 3V96A 1AP0A 4KHPL 3EVQA 3SWFA 1RH5B 3NXWA 3E9HA 3F2CA 3AMUA 2YIUB 4NKLA 3K5LA 1NTMK 4A3GH 3KBGA 4HIMA 1AZPA 2IZ0A 1YNJD 1YI2P 4CDFC 3TS2A 5BN3A 3F5HA 2IFMA 1OW8A 2QJPB 2K5HA 4PMBA 5M5YH 1BO0A 4AQYQ 1H9MA 1LT3D 1Q1EA 4K3AA 2Q8IB 3CCJA 2VS1A 3I3CA 1S9KD 3HOXB 2C9OA 3S1MH 4Q0FA 4DV3Q 3L75J 3WDNA 1IK9A 2JA6H 2CQOA 1QVGA 1T2KC 1HWTC 2F0JA 3MUDA 3CCVP 4X64Q 3BRVB 1AFPA 1PZID 3OWFA 4KD4A 2N9BA 1SFCC 1RKNA 2M2LA 3L70J 1V9PA 4ME3A 1R5LA 1EWHA 4ZUJA 1CKOA 2K5QA 4JI2L 3L73D 3ZDMA 2H89C 4IURA 1OXSC 3DWAA 3M4PA 2Y0DA 4A3DB 1S40A 1STYA 1J1EB 1E1TA 2K03A 3CC4A 2NUCA 4CJ0B 4DV7Q 1PA6A 2WT7B 1LTTC 2PO4A 5ISRA 1G8ZD 3KDFA 3V5BA 3WMM0 1AJYA 1FAVA 1GK6A 2E5YA 1A3VA 2WAQG 3A0JA 4N9TA 1I50H 1PYSB 4UHVA 1FGUA 2H43A 2AWOA 4A3GG 1HRJA 5APUA 2GVAA 2PI2E 1CI3M 4XE5B 4NXNL 3MA2B 2L11A 1HNXQ 4QMAA 5IYBH 1VQPA 1Q7YC 3NQIA 3OIPA 2JDIH 4XT1B 1LTGC 4B3TQ 4HN7A 4IO9A 4BY1H 4ZUIA 3L74D 3LNNA 1R5SA 1QB5D 2WB1G 1B7YB 4N78D 4KY5A 2YXQB 1BXTA 3JAME 2VUMH 4NXMQ 1NKZB 1D8LA 5T1IA 4BA1I 2JA6G 2JA5B 1BDOA 4EIJA 1LGHB 3NE5B 4HAEA 4KLKA 4LF4Q 3Q2YA 5CV8A 3HKZG 2SPZA 4DR6Q 4DAMA 2N55A 1DX7A 5L37A 2NVQB 5ELDA 3GHGA 3A8IE 2NBFA 2PQAB 4EQNA 5LMNL 3H1KG 4ZKCB 3G4SP 1KLUD 1NAFA 3CC2A 3PUVA 3IF4A 5KLVJ 1PH6A 3BCCJ 2L12A 4UPAA 1L0LG 4IFDJ 5GTHH 4OHJA 4F8MA 3H1IE 1YIJA 4GN4B 2BH2A 1TY2A 4B86A 2A8VA 1HH0A 2KECA 4O2DA 5BR8L 5IE8A 3L74J 1W5CE 3H1JG 1FJGQ 2ZJSE 1PRTB 3PQIA 2QCPX 2ICIA 2L91A 5AVVB 1SYGA 2R92B 3GTJB 4R4OA 2LXCB 2F3WA 4C3IH 4YPCA 3CKIB 4A75A 4B3RL 1LABA 2XU6A 3UDFA 1BGYD 3BVMA 3PGZA 4DF7A 2CPSA 4HIOA 1PVOA 3UDGA 1VQMA 4EQPA 5APTA 1YNND 3PF5A 1ASYA 4IFDI 1S4XA 5IYBG 3L72J 4YWKA 2Z9HA 4BY1G 4LUVA 1F2ZA 1KQGB 2F03A 1Y47A 2KLUA 1YNJC 1EIGA 1TS4A 3PIOA 2LXBA 4GNXA 3L71E 5GTIH 4LFBQ 2VUMG 1TKWB 1S3OA 1I94L 1LWUA 3D6WA 1K83H 2W27A 4GZYC 1SNCA 1CHQD 1QNKA 4LFCL 3GTMB 1KRSA 5ELEA 4DV5L 1E0BA 4JPZB 3K6OA 3NWTA 2YNYA 1HR0W 1I4GA 1HH2P 4DR4L 2WINB 3N6RA 1GUNA 1VQ9A 4U3FG 4YY3L 2C9LY 3H25A 2PAJA 4DK3C 1S72P 1L2FA 1BCCG 2DUDA 4GODA 3F2UA 4ZLTF 3A0BE 3SK5A 2BA0A 2E2IB 1N7SB 1SQPD 3S2DH 2WFWA 4QUCA 2KCNA 1FZFA 3T53B 4L5RC 3CWBD 2UU9Q 4DA2A 1EQRA 1K8MA 4WFN3 3GTGH 1RE3A 2NPSA 1NHLA 5APYA 1LLRD 2KEDA 3TGUE 3SVMA 3QWOC 1LT1A 4C3IG 4BS9A 2WPVB 1GU4A 3I4MH 5GAHC 5E3FA 2AUKA 1EOTA 1KQLA 2W90A 5I9PA 4QUFA 3KF8A 4QL5A 5M3FH 5DEHA 4P2CB 1E7ZA 1RTOA 1EDJA 1UE5A 2EVBA 3PRJA 3H1HE 4DNTB 3LW5J 4JBJA 5LL6X 3A0HE 1SQVE 4A3LH 2EYPA 1QOHA 3RMHA 4LJZC 1SQPJ 4AYCA 1JO5A 2F0UA 3V05A 1MFTA 1OX3A 5CHXA 2FYUJ 3CCUP 4BY7B 1MUUA 4UY8C 1MJCA 2HR3A 3CWBJ 1IZNB 5B66E 1SYBA 3K0YA 2ZM6Q 1ZR4A 1Z6HA 4R4MA 5IT9c 2BASA 2YTVA 4GKKQ 4JI7Q 2QA4A 4JV5L 4N3YB 2PNRC 4HCEA 3CCSP 5GROA 4FNFA 2WP8J 1TWHB 5DJUB 2E2HH 3RZDH 3RK3B 4RCOA 1LT4D 1PTOF 4HJ5A 3BZKA 3AE6C 1JUNA 5EQ0A 3TN2A 4HJ8A 2ZT9B 1SE3A 4A4IA 1EIYB 3CMAP 4GOPC 5AJ3Q 2ALYB 4QY7A 1XPOA 2F4VQ 3NBHA 4LUOA 1B44D 2JO1A 1NTME 2RKLA 5IP9H 1PTOD 4NPDA 2YKQA 2AEJA 1EY8A 3VYUA 3I4MG 2MP1A 5M3FG 3CXHD 3S2HB 1OVUA 3CHBD 1EZVD 2Z8LA 3A8KE 4JCVE 1STNA 4YIJA 2IY5B 2Q7CA 2VQFL 2QGQA 1QEXA 1G2TA 3MXGA 1VQKA 5C4JH 4A3LG 2AEMA 5K36H 4DXGA 1YNNC 2HHHQ 3WU2E 3A56A 1OIPA 3OPOA 1NTZD 4RKUJ 2Y9ZA 1L4AD 3BVZA 1T3JA 3EBEA 3A2AA 2MO0A 5LHY1 1H0TB 3TYYA 2OQ0A 2JE6I 1KDAA 5G3LF 1FNWA 1KQSA 4RCNA 3GF3A 2SDFA 5M5XB 1OZHA 5GADC 1QNUA 1Y1WH 3AE2C 3TZUA 1SQBD 2KP8A 2Q3EA 1G2CB 4M3LA 2V1CC 5KYLA 3Q24A 5C3EB 2A6ED 2LFNA 1NVOA 3BVGA 3KK7A 4R4QA 3BATA 1ML0D 2BCCD 5IP9G 1JWUD 3C9IA 1NTZJ 1E3PA 1F9RA 2CH4A 4KN7C 2K5DA 3PHLA 3RZOB 4WJ4A 4QGUA 4KN4C 5JJIA 3CCEP 1CSQA 5JPMC 3D71A 3CXHI 1IO4A 1Z7TA 2OCEA 1VQJA 3AQQA 5IOCA 1NAPA 3BVHA 1PGJA 1EZVI 4F88A 4PMWA 4JI4L 2IBZE 1WFQA 3T97A 4I1LA 4V190 5K36G 1URQC 4UAIA 2I1KA 5CCHD 4YCWA 4X3TA 5KAFE 1Y8PB 4TRDA 1V43A 4UP8A 2JA8B 3MWYW 1LT9C 1G2SA 2L5TA 2A45I 1K3RA 3SDZA 1TU2B 5M3MH 4BXXH 1N9WA 4OO1I 3A5UA 1VQNA 5E4WC 3EFGA 1F2YA 3B5NB 1S5LE 4MN3A 5KKZB 3E1IA 4IPDA 5AW5B 1VQLA 4DV1L 5I6WA 1DD4A 1NTKK 1Y1WG 1BCPB 3SGIA 4HYTB 2PI2A 3UDIA 3M4OH 5CYUA 4IPCA 1HR0Q 3EFXD 1ESRA 2HD3A 2R7ZH 4MN4C 3I4NH 1BCCD 4JI8Q 1OW7A 3P8MC 4ID6A 3KZIE 3SWKA 5C44B 2RA4A 1SQXK 2VB2X 3GDEA 4JI0Q 2J59M 2P58A 3RLNA 1PRTF 1UEAB 3NXSA 1HJPA 1II3A 1QWYA 1X3EA 2DN8A 4Z1MH 3KBXA 4Y7NH 1N33L 3W68A 1QUQB 1SROA 2WSSH 1PTOC 1JT8A 5E7NA 4D6TE 3VR3A 5CCGD 3MGNA 2NB0A 3PO3H 3H91A 4N9PA 4X62Q 3JAMc 4UB8E 1CZGA 5APWA 1KAWA 1PH5A 3H3VI 3M0DC 3S17H 4DUZL 1DEBA 4C1NK 4CKEA 1EFWA 2C5CA 2IFNA 2UUBL 1B53A 5ELFA 1TWGH 1LUZA 3CP0A 3GP7A 3X3MA 1U9RA 1WTXA 3HOYB 2GN5A 1K8AC 3S4RA 3NHHA 4BXXG 5KYIA 4JI6L 3HUSB 3H1IJ 3RLOA 3U4VA 1GU5A 3CMEA 4DR5Q 1L4AC 1XTDA 2JA9A 1LTLA 2D9UA 1XMOQ 1IYJB 1STGA 2NZOA 2F0VA 4DV6Q 3HGBA 1VS0A 4W7ZA 2SOBA 1EY4A 1YHQP 1LTBD 4O42A 1GUWA 2F0FA 3W67A 4LF7L 4YHHQ 2R7ZG 3I4NG 5E79E 2B63B 1UEBA 3GO5A 3DM1A 4A3FB 4HJGH 1UE7A 3VTPC 4IL6H 1TWCB 1BBWA 2F0OA 4DGZA 5IGCA 5C0XJ 4LFAL 3VMAA 2B87B 1AN8A 2A6EC 3J7YW 3KFUA 3NP8A 4RAUC 1WTHA 4R8IA 2FXPA 2HODA 4X66Q 4LW1A 1AH9A 1M1KQ 2YKPA 1AVOA 2VNUD 4AUWA 4DV0L 1OO9B 1LTAD 3I72A 1TT2A 2FY8A 4P75A 3O8ZA 5BVZA 4AYBB 2PW7A 4GKJL 5AVTB 2XWJB 3D6YA 3IR9A 3WUTA 2QRXA 1YJWP 2WSFJ 1KC8Q 3H3VC 4M8AA 1K9MC 1ZXTA 2KCCA 4AYBE 1HZAA 5C0XI 1PP9E 4XDXA 1R9TB 4LF5L 1HUNA 4L75A 3HKSA 1VMCA 5CCHC 4L6TB 3BG3A 3QB3A 3G7LA 1N7SA 2K6AA 3TF5A 2K4KA 3QR8A 5KJ7D 3ITPA 4P74A 3EA6A 2R7FA 4IUUA 3S1RB 3KF6A 1HNWL 3C2PA 1IBMQ 4ZMDA 4CPGA 4IPGA 2YV5A 3TGUJ 1VQDA 3CCQP 4JW0A 1FZBA 5JJZA 1RQVA 1QX8A 3O6QA 3GF7A 1U4MA 4DV2Q 1N34L 1PYWD 2Z0SA 2FBWC 1QILA 1NR4A 3L70G 4NPEA 5KAIE 1CKNA 2I8DA 3PMFA 3RBZA 4FF1A 1H9RA 4DUYL 1HNZL 3C3LA 2Z6KA 3K81C 3H1HJ 3ZJYC 4ZAIA 4H0LC 4YXDC 5DAUA 4WY4C 1NU1D 1S5ED 3RK3D 1XTCD 3I73A 3LWUA 4IFDH 4HJAA 4ME5A 1HZCA 2EE1A 1CA5A 3EN2A 4QIWB 1BBUA
chains in the Genus database with same CATH topology
4JI5Q 2MQHA 2KHIA 1Q46A 1VQBA 3OYYA 5AVZB 4QIWE 3P32A 5CCGC 4BBSH 1L0LK 3CD6A 1KD1C 1JY3P 4A3IH 1J1DC 2N1TD 2VQEL 2OTJA 1A62A 4JI3Q 3SWYA 3I4OA 1I6HH 2I5LX 5LMUQ 1FU1A 3L36A 3CCMA 2UXDL 5IYDH 3K80C 3U1AA 3GTOH 1JY2P 1FL0A 4DR2Q 3OAKA 2IHEA 1EUJA 4IFDG 1PYBA 2XNXA 4NB3A 1I5FA 2NPSB 4A3JH 3II6A 1EYGA 1AE2A 2EQSA 1M1JB 2FXMA 4BBSG 1LTAC 3KF8B 2N8NA 3CF5A 1GL2A 3V2QA 2N78A 4P72A 4A3IG 2R93H 2JEBI 1G2CA 3LW5H 2KENA 2H5XA 4HIKA 1LTJC 4BBRH 1JB7A 3PF4A 2NVYH 2YKOA 3PSIA 5IYDG 1HGVA 1XNRQ 3WWVA 5KJ7C 1M7LA 4DR3L 1RY3A 4RMFA 1WCMH 3JC66 5IWAQ 3RK2D 5C4XH 1T9HA 2FFDC 1IFIA 2Y0SG 3NBHB 4HJ9A 3HD7B 4A3JG 3RK3C 1IBKL 5FJ8H 3GTLH 3B5NA 3KJOA 3TQYA 3OW2A 1ZV8A 3D0FA 4Y52H 1C7YA 4O9BA 1SLQA 1HBWA 3FP9A 2R93G 2P7JA 2XTIA 1IJDB 4BBRG 2N1TC 1N7LA 4DOJA 1PH9A 1CSPA 1CSBA 4N6JA 1YNXA 1WCMG 5C4XG 4A3EG 1W2EA 4GT1A 3GD7A 1H95A 1YEZA 1XNQQ 1T3UA 3KLWA 1IBLL 5FJ8G 1GW3A 1Q81C 2K14A 2FYZA 3HUSA 2A45H 1YYCA 4IJHA 1QVCA 3RN2A 3P7KA 1GD7A 2WAQE 3GTQH 4B3SQ 3STBC 3HOXH 3H0GH 3PV0A 2UXCL 1VQGA 2Q2TA 1XPUA 2WB1E 1JNMA 3CCVA 4A3KH 4O0AA 3H32A 1Q82C 5APQA 1RF0A 2AKWB 3HKZE 5CJ0A 4I6MC 3VP9A 1DGSA 3H15A 3H3VH 1FZCC 3J81i 3RK2C 2K52A 2VL6A 4DR1Q 1IZ6A 1X8YA 4RG1A 4IPHA 3EIVA 2A45G 1PHJA 5APXA 3S1QH 2Q2IA 4OO1G 1KRTA 3BJUA 3DM3A 3M0AA 3RL0B 2FXQA 3CL3D 1X56A 3HOXG 3H0GG 3RR5A 2P2UA 4C7RA 2JA5H 3HOZH 3BRTB 2YTXA 2VZAA 2I1JA 3U4ZA 4JI1L 2NVQH 4A3KG 5APVA 2BH8A 2WPRA 4XA4A 1KILC 1C9OA 3V2RA 2NVXH 1NY4A 1VQHA 1VCIA 4JOIC 4R1JA 2GVBA 1M90C 1RF1C 2R92H 1GM5A 3GTJH 1VQAA 3TSIA 1YJNA 2HODB 4OX9Q 2UUAL 3ER0A 2HIVA 3K0XA 2NPSD 1TWFH 3M4QA 1FBMA 2XGTA 2KSJA 1OXUA 2JA5G 2WSFH 3HOZG 3RNUA 3J81j 4MZ9A 2OYIC 1L1OA 4MTNA 1JJ2A 1GDTA 1FOSE 3MTUE 2QM7A 1X54A 4DR7L 3KF6B 3RLFA 1X3GA 4B3MQ 2CFMA 4TQUS 4K0KQ 5AVWB 1M1JA 1CKNB 1EOVA 3T1HL 3P8CD 2R92G 1P8LA 2NZHA 4A3BH 2UXBL 3E0EA 5C0XG 3GHGC 2W6BA 3U50C 1PH1A 4X65Q 2Q9IA 4C46A 2D0OA 4Y99C 4GKJQ 1D7QA 3A3YB 3MXNB 4BY7H 2H8PD 5AVRB 1GO3E 2ES2A 4LLHA 4RESB 3CLQA 4LF8L 1RL2A 5AVYB 1TWHH 1HNWQ 1EQ7A 3S16H 3HD7A 2HG5D 4IOAA 3S1NH 4GNXC 4LF9Q 1SN8A 1URQA 1OXTA 3M9HA 5AW8B 1LWUC 1LYLA 3F1ZA 1HNZQ 2E5LL 4A3BG 1LT9A 1FJKA 1LTSC 4UP7A 3PUYA 1SR3A 3J80i 3NFQA 2MJZA 2CWPA 1FJPA 4AQYL 1N36Q 1FDMA 3A5ZB 4KHXA 4C2MH 3CAMA 4BY7G 2RHSB 5AW0B 1GL2B 4IFDK 2OTLA 3L4FA 1XMQQ 1HVVA 1UE6A 4X64L 3VMYA 4AIMA 3MIWA 3LIDA 3M91A 2OARA 5M5XH 3ULPA 4JYAQ 1QZGA 2Q5UA 2LKMA 3M0DA 3HFZB 5FLMH 1N32Q 4DV7L 1JJCB 1B8AA 2YTYA 1L4AA 2OYHC 3VMXA 2IX0A 1Z9FA 1HNXL 3IFMA 3G3ZA 4B3TL 1SE8A 5AVQB 4A76A 2HLOA 5LMNW 2R6GA 4NXML 4LF4L 3RL0D 4DR6L 4LF6Q 1J5EQ 3K8AA 1U5KA 1ASZA 1YJ9A 2WSEH 5FLMG 1WOCA 3NELA 1G291 1FJGL 3N7NA 3G48A 5CCHA 1SQPK 4KI0A 4APVA 1JTHA 4JYCA 1QZHA 1N73C 2HT1A 1WT6A 1MZ9A 4DAYB 3T1YQ 4LFBL 3VDYA 1HZBA 3HOYH 1XTGB 5AW6B 1Q12A 5BU5A 1VQEA 4WY4A 1CZQA 1X3FA 3BASA 1XJVA 4DNIA 1YHQA 1TXYA 1PH4A 1GW4A 3H32B 1N7SD 4FDBA 2UU9L 2IHFA 1SP4A 2K75A 2JJLA 3TEHB 4KHPQ 1J1EC 1J6QA 1HJBA 2W6AA 4WJ3M 4PZ7A 2YMYA 1JMMA 2Q2UA 4R4CA 1PFSA 5JEAJ 1ZLLA 1YJWA 4DK6C 1S9KE 1OWAA 5ELOA 1VQ7A 1Q1BA 3HOYG 2ZXEB 1V1QA 1AQ5A 1CI6A 1J2JB 2ZM6L 2NVTH 4GKKL 4JI7L 3M9BA 4JI2Q 3S1RH 1NTZK 3PUWA 3RL0C 1W3SA 3IRBA 3W5OA 5AJ3L 1UE1A 2MO1A 2F4VL 4LWCA 5CJ4A 3VN0A 1SQBK 2KCTA 1LTJA 4NXNQ 1SVFA 3L35A 2B29A 2L5GB 5J3BA 3K7UC 3HTKA 5AVUB 2PMZE 1OXVA 2CPBA 2FKWB 1NE3A 2HYNA 1E22A 2HHHL 4X6AH 3M85A 4N78E 3F8TA 1RE4C 1K8GA 2FFDA 1MIUA 3R2PA 1AFOA 2LXJA 5LMNQ 1LTBC 1L1OB 1GL2D 2VW9A 1WRGA 3I5CA 1IXRA 4JBWA 3ULLA 2IT1A 2YYZA 3L2PA 5AW7B 1BVSA 5BR8Q 1M1KC 1JMCA 3CW2C 1N7SC 3CCLA 3CC7A 4B3RQ 1IFJA 3UE0A 3KOJA 1LM0A 5IYCH 1KC8C 1YHBA 2N1TA 1PFIA 3M3YH 3NMDA 1A0IA 2YO2A 4XIGS 1I94Q 1JY3N 4YWLA 5HGQA 4LFCQ 4DV5Q 3S15H 2F3IA 4DR4Q 4XTCS 1NMGA 3PO2H 4YY3Q 4P73A 3B5ND 2WTYA 1JJGA 4GLVB 4JG2A 4A3EH 1SFOH 2UUCL 4DZOA 1HR0L 4JI8L 2POHA 1EWIA 4ZKUA 5AW3B 1LTIC 3J7A5 1XTCC 2D0PA 1HGZA 3B8EB 4OH8B 4GN3B 1URQB 2KYVA 1SRUA 1SFCA 1X9VA 2F52A 2P67A 5IYCG 2ATWA 1XPRA 2PNHA 5AW4B 3V4WA 2JA7H 1IFNA 1LT9B 4X62L 4R4TA 3A74A 3HOVH 1A02F 4L5SA 2JJQA 2IPPA 1N86A 1GKHA 1YHAA 4GN5A 4JV5Q 3PO2G 1XMOL 3PP5A 1G6PA 3M9QA 4OXPA 3CXCA 5AVXB 1GL2C 2YO3A 5EAYA 5JJKA 4HH2A 1N2DC 5IY0A 2AHOB 1VQIA 2KHJA 2LXKA 1MFZA 3J7ZC 5GQOA 1YVCA 2QEXA 2GM4A 2E5LQ 3OJAB 2B3GA 2JA7G 1A02J 2ZTCA 1YI2A 1B70B 2VQFQ 3HOVG 1NU1K 1L4AB 1G1IA 2IX1A 1X55A 4UP9A 2Z5IA 2KCMA 1KILA 3ERSX 2I5MX 1GTWA 2AWNA 2AMCB 4JOIA 4IOCA 1RF1A 1IBML 2K50A 1JCDA 3JAMi 4A3DH 3B5NC 4DV2L 2JEEA 4OWXB 3L0OA 2Z4EA 4POFA 1E5WA 2NN6I 4GIFA 2K5VA 3CQZH 2C35B 2M3BA 2XZRA 4JI5L 2OYIA 1WI5A 3CI9A 4JI4Q 5CMZA 3PUZA 2ASBA 1JTHB 1NMFA 5HY6A 4C3HH 4LC1A 3UIAA 3TK1A 4JI3L 1FVIA 4DV1Q 3I2ZA 5LMUL 4HIDA 4LNQA 3VP8A 5GAEC 4DUZL 4A3DG 1NTGA 3G4SA 3KYQA 1JY3O 3HUSC 2C9NY 4WY4B 2N49A 1BKBA 3VOPA 1IFDA 3UDXA 2WWWA 4DR2L 3RN5A 4DPGA 3GTKH 1MKHA 1HZ9A 3PCOB 1NOHA 1GD2E 1YTZT 1N33Q 4A93H 4LGDE 3U59A 4MNOA 1JY2O 3TNUA 1IC2A 1G51A 2R5DA 4EX5A 1JCCA 1J1DB 4BA2I 1YBYA 4DV4L 4GOPA 1RF0C 2UUBQ 2ZFCA 1VQFA 4JBMA 2XDJA 1KL9A 3FKIH 3GTPH 4OWWB 3GTMH 3OTOL 1QVFA 4JI6Q 4P71A 1A63A 2KB7P 3PIPA 1CI6B 2RCNA 2E2IH 1XNRL 4LF7Q 1S72A 1W2BA 5IP7H 1O7IA 4R4IA 4GLAC 1NH4A 4QQBX 2J58A 4C7NA 2VRSA 5IWAL 4LFAQ 3B6YA 4A93G 1PH2A 4ZKPA 1K0RA 3W1GA 4DV0Q 2DGYA 3MD0A 3HD7D 3F2DA 1LTJB 3HOWH 1URQD 4LF5Q 3FKIG 5KTBA 3HTKB 4EOTA 1NWQA 3CCUA 2XV5A 3H6PA 1IFMA 1UWVA 5JEAG 4JYBA 4JC0A 2E42A 2R7DA 5BU8B 3CCSA 1VQCA 2JK8A 1IL2A 1X79B 4LUZA 2FFDB 5IP7G 1N34Q 1T8ZA 1AE3A 2OYHA 3LIEA 3CMAA 2O01H 2JEAI 4DUYQ 2Z5HA 3CPWA 3AFQA 4GKGA 1WYDA 3PUXA 2MFIA 1XNQL 3U58A 3HE5A 3KJPA 3S2HH 2H7HA 3A7OA 1L1OC 3G6EA 1SQQK 1PH3A 5ELNA 2EXDA 4L5QA 2HPCA 2A1AA 4AH6A 1Q86C 3HOWG 4C3JH 5KLVK 1RE3C 2NPSC 4DV3L 2N1TB 2RF4A 2RHQB 1E1OA 3ULJA 3Q8DA 2VQEQ 1M1JC 4B3SL 1A8VA 2Q3IA 5AVSB 3BU2A 1RIPA 4HJ7A 1L0NK 2UXDQ 1OXZA 5C3EH 1ZR2A 4PZ6A 4IFFA 3F2BA 1N73A 2KOGA 1TWAH 1X6OA 3HE4A 3RZOH 3I56A 2P1JA 1CW5A 4A3CH 1E24A 3CCEA 4DR1L 4I2LC 1SFCB 3E9IA 3HD7C 2JA8H 3M7NA 1H89A 2CWAA 2ID0A 2L15A 3L37A 1NBWA 1PV4A 1NO4A 1Z56A 2JQOA 5C3EG 3V2NA 4DKAC 1FZCB 1CUKA 1L0WA 3RK2B 1OTCA 5C44H 4DR3Q 2N3SA 2WT7A 4OONA 1PH8A 2UUCQ 1C0AA 5AW2B 3UE1A 3KDPB 2I5HA 4WY4D 1KXLA 2FYUK 2I0QA 3AFPA 3V2PA 1HUCA 4W7YA 1QL2A 4A3CG 3D31A 1IBKQ 1VDFA 1FZGA 1NJIC 4OWTB 3TS0A 2A19A 4L5TA 4OX9L 2JA8G 4TVAB 2C0WA 2ZJPA 1FOSF 1VQ8A 5DLQE 1VQ4A 3EQ2A 2PQAA 3J81c 2ZJRA 1I3QH 1KILB 2WZ7A 5M3MG 4IJLA 4POGA 1ZN5A 3BZCA 4JBKA 1Y14B 2CKZB 3KQGA 2B63H 1NKNA 1YTZI 5CCGA 5C44G 1PH7A 4A3FH 1RF1B 1TWCH 4B3ML 1Z47A 2K5NA 2D62A 2IX7C 4IFMA 4K0KL 1HTLC 5AW1B 1GK4A 3AYHB 1IBLQ 3NEMA 1SLJA 3VMZA 4GLXA 2WPQA 2E8GA 3V4QA 4WB4A 1RE4A 3TRZA 5GAGC 4X65L 1KHIA 1KIXA 1R9TH 3PO3G 3KDFB 2OYIB 2BA1A 5AW9B 2YU9H 4YCVA 1GVPA 1MV8A 1VQOA 4EQ5A 2UXCQ 3U1CA 1SMXA 2NN6G 4YCUA 3NTNA 3CCQA 2B63G 4A3FG 3KYHC 2EIFA 3MEFA 3GHGB 4LF9L 2ZTDA 1FZEA 3LGJA 2LSSA 4AYBG 4Y99B 3G71A 5KJ7A 3NENA 2WSCH 3ICEA 2GUSA 3TNUB 3S24A 4PG3A 4WBAA 2KLVA 4J15A 1VPCA 1N36L 2C0XA 2O1JA 4GOPB 4AQRD 1XMQL 3CPFA 5APSA 1EQQA 3A5TA 5FLXc 4JI1Q 1P16A 4GNXB 1K73C 1GZLA 2VY3A 3W1BA 1FZAA 1G1JA 2R3CA 4NPSA 2QM8A 3CCRA 2HQLA 1LWUB 1H8AA 4KHZA 2WPSA 4DUZQ 4JYAL 2ZTEA 4JF7A 1DH3A 3HOUH 3KPEA 4ALPA 1N32L 2R32A 3I55A 4C7NB 3TREA 2PP6A 2Y0SE 1H88A 4W80A 2E2JH 2O1KA 2UUAQ 5JJLA 2Z6KC 5M5WH 2WITA 1N8RC 1KFNA 1OXXK 1T2KD 4DV4Q 2XKMA 4A3MH 1SFCD 3STBD 1QL1A 3OTOQ 1JY2N 1U0LA 4LF6L 1J5EL 4DR7Q 4H02A 1YZ6A 1KZUB 2HIXA 4GS3A 3J80c 4YWMA 4JI0L 2ZJQA 2KBNA 3HOUG 3I7FA 2CCZA 2E43A 2OYHB 3M06A 3DLLA 3T1HQ 5H1SE 1Y1VH 1X9NA 2UXBQ 1MJEA 3L7ZC 3P8CE 1EIFA 1VQ5A 3HE5B 1CKMA 2MNAA 1JOCA 3VYIA 3S14H 2Q2HA 2HFED 3HRNA 3OA7A 3T1YL 2HPCB 4DR5L 4A3MG 4QJFA 1FZCA 1Q8KA 1KFMA 3K7AH 4DV6L 2OQKA 2R5BA 1YITA 1SQVK 3FHWA 4YHHL 4LF8Q 4PZ8A 1X65A 1WJJA 1VQ6A 1JE5A 2OWOA 1KILD 3N4XA 1QUQA 4X66L 2GUVA 2M8RA 1Y1VG 1N73B 3AEVA 3HE4B 4KHPL 3SWFA 3E9HA 3F2CA 4A3GH 1NTMK 4HIMA 3TS2A 2IFMA 2K5HA 5M5YH 4AQYQ 1Q1EA 3CCJA 2VS1A