3M9BA

Crystal structure of the amino terminal coiled coil domain and the inter domain of the mycobacterium tuberculosis proteasomal atpase mpa
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
186
structure length
186
Chain Sequence
SARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQPPSGYGVLLATHDDDTVDVFTSGRKMRLTCSPNIDAASLKKGQTVRLNEALTVVEAGTFEAVGEISTLREILADGHRALVVGHADEERVVWLADPLIAEDLPDGLPEALNDDTRPRKLRPGDSLLVDTKAGYAFERIPLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding-induced folding of prokaryotic ubiquitin-like protein on the Mycobacterium proteasomal ATPase targets substrates for degradation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Chaperone
molecule keywords Proteasome-associated ATPase
total genus 31
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16450 Prot_ATP_ID_OB Proteasomal ATPase OB C-terminal domain
A PF17758 Prot_ATP_OB_N Proteasomal ATPase OB N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3m9bA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m9bA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m9bA02
1XMQL 1T2KC 1VQCA 2KBNA 1OWAA 2ES2A 4A3LH 4LF8Q 4P73A 5M3FG 1QVCA 4DV4Q 5AJ3Q 3NMDA 1TWHH 5AW5B 4A3CG 1VQJA 3PUXA 4DV7Q 3PCOB 3LGJA 2HHHQ 4LF9Q 4R4IA 4LW1A 4NXNL 3V5BA 3FHWA 4HIKA 2PMZE 3GTKH 4R4CA 3P7KA 4DV6L 1N36Q 3HOVG 4BBSH 1MUUA 1NJIC 3S2HH 1TWFH 5C44G 5LMNW 4DUYL 4DUZQ 5AW8B 1YJWA 4X66L 2R7FA 1GD7A 2ZTDA 4P72A 1EQRA 1X54A 4JBWA 4A4IA 5APTA 4JYCA 5GADC 5GAEC 2UU9L 2VUMG 3M4OH 2Z0SA 4B3SL 1RL2A 1JJ2A 1VQIA 2K5HA 3GTQH 1PVOA 4YY3L 2BA1A 3VDYA 3TNUA 1DH3A 2N9BA 2D0OA 3SGIA 3CMEA 4GOPC 1HUCA 1HR0L 5K36G 1AE2A 4L5QA 5C4XH 4DV6Q 3STBC 1N36L 3ICEA 3GTGH 3B6YA 5IYBH 2XGTA 4HYTB 1NMFA 4DV2L 4O2DA 1XTDA 4YWLA 3PO3G 4LUZA 1VS0A 3KF6A 4GNXA 2VRSA 3MXNB 2A19A 4HJ7A 4A3GH 3GD7A 3U50C 4HIDA 4GOPA 2NVXH 1MV8A 2Q3IA 4Y7NH 4FDBA 2E2JH 4JI2L 1HNZQ 1EOVA 4EX5A 3BJUA 3NFQA 4LF8L 4BXXG 2GN5A 4JYBA 3GO5A 3J80c 4B3TL 3HOVH 2PQAB 3FKIH 1YYCA 4EOTA 1QZGA 1V9PA 3I4NG 1QUQB 1BBWA 3S17H 4OXPA 4UP8A 5IYCG 1N33Q 3GTMH 1H89A 4JOIC 2IHEA 4DR3Q 3HE4B 2JA6H 3HOZH 2E5LQ 3A7OA 1I50H 2ATWA 5APVA 3H0GG 2KCTA 4AQYQ 1U0LA 3VYIA 2BASA 1SLQA 3RNUA 4JI0Q 4LF6L 1I94L 1KC8C 5AW0B 3TYYA 1P8LA 4GN4B 2UUAQ 1VQ5A 4HIMA 4C2MH 3NBHB 5H1SE 2VUMH 3RZOH 2OWOA 2E43A 3UE0A 4A3EH 5APWA 3B8EB 4R4TA 3U58A 2UXBQ 3G71A 1Z9FA 2B3GA 1X65A 1K0RA 2P67A 5AVUB 1HZ9A 2CWPA 3CCQA 4UY8C 1PH4A 2F4VL 4PZ7A 4RG1A 1Q1EA 4JOIA 4X62L 4ALPA 3A74A 2XZRA 1UWVA 3L0OA 3I55A 4JI7Q 1OXVA 4BBRG 4C3IH 3CC2A 3TRZA 3I7FA 2ZXEB 4IFDG 3G6EA 3MD0A 4B3ML 4DR5Q 1IBKQ 3L2PA 2VQEQ 3VMYA 2BA0A 1UEBA 3FP9A 5DLQE 5BR8Q 3TS0A 4A3LG 4A3MH 3SWFA 1PFSA 1T9HA 1YHQA 1QUQA 4KHXA 2W6AA 4J15A 1Q46A 3GDEA 3PUYA 1XPRA 3T1HL 3AFPA 4DR7Q 1JJGA 2JE6I 4C3HH 2OQ0A 1C7YA 4R4OA 4UP7A 3JAMi 2CCZA 4JI6Q 4HJAA 2QM7A 3HOYG 1OXSC 4A3FH 1FAVA 1E1OA 4IO9A 2OTLA 2GVBA 1WCMG 2GVAA 4A93G 2VY3A 1L1OA 4LF9L 1LTLA 3CF5A 4A3JG 5LMUL 1IBKL 1N34Q 2N3SA 1MIUA 2N8NA 1HR0Q 3RLOA 5M5WH 1Y14B 3S1MH 4K0KL 2E42A 4X65L 3K7AH 1X56A 4KHPQ 4AH6A 1SP4A 3BU2A 2B29A 4IPDA 2Y0SE 1IBML 3HKSA 4OX9Q 2UU9Q 1HZBA 3PO2H 4OO1G 1GVPA 3AQQA 1VQ8A 3EN2A 4YCWA 3F1ZA 1C0AA 1HNZL 3PF5A 1Q82C 1VQ7A 1K9MC 1C9OA 3STBD 3PO3H 4IPCA 4DPGA 2I5HA 1WCMH 4LF4L 4OONA 4LFCL 3I4MG 2H5XA 4LUOA 3ZJYC 4A3BH 4L5SA 2ZJPA 1GKHA 1OTCA 1I5FA 2E2HH 2ZTCA 3CCRA 2CWAA 2JA9A 2OCEA 4KI0A 4POFA 5AW6B 3L36A 2QM8A 1K83H 2WP8J 3FKIG 3PUZA 4KHPL 1JNMA 1SMXA 3KJPA 1HJPA 3TEHB 4DK6C 5APQA 2PI2E 1S3OA 1CSBA 2EXDA 3K8AA 3L35A 5FLXc 1R9TH 1PH9A 2P7JA 1ASZA 3TREA 2AHOB 1V1QA 5M5YH 2PNHA 4YHHQ 1Q86C 1GZLA 4AIMA 2KENA 2UXCQ 2RHSB 4OWWB 1HNXL 1OXUA 5C0XJ 2EQSA 3PF4A 1KRSA 1YEZA 2WFWA 1GD2E 1VQ6A 3KFUA 1VQFA 3J80i 4GKJQ 4QIWE 4A3IH 4JBMA 4JI5Q 2JA7G 2NN6I 2B63H 3HOXG 4X65Q 2ZFCA 3JAMc 2VS1A 3F2CA 1PV4A 4DR6Q 4DR4L 2K50A 2K14A 3I56A 3TS2A 5IWAL 5C0XI 4LF6Q 3RLNA 5AVWB 3KF8B 4JCVE 5IYCH 2UUAL 2VQEL 3S16H 2XV5A 3TNUB 2AKWB 1FOSE 4GN3B 1NAFA 2JA6G 4L5RC 5AVZB 3PUVA 4YHHL 1KRTA 1U5KA 2K4KA 2YO3A 1K73C 4LF4Q 2QA4A 3K7UC 2HIXA 1J5EL 1YHBA 5IT9c 1SN8A 2WTYA 2K75A 2B63G 4JI6L 1N32Q 3OTOQ 2JA5G 1CKOA 3H3VI 4IOAA 1XNQL 3LIEA 3BZCA 1KIXA 3T97A 3NENA 2IHFA 2K52A 4EQ5A 1G51A 4JI4L 4WJ4A 1FOSF 1FL0A 1M90C 2IX0A 2WPSA 5IWAQ 2WPQA 3M9BA 3MEFA 2WAQE 5M5XH 4LWCA 4DKAC 2ID0A 1VQMA 2LXJA 4GKKQ 2UXDL 1KQLA 4AYCA 4LUVA 2KCMA 1S9KE 5IP7H 3CCVA 1WYDA 3CAMA 3BZKA 4NXMQ 4OO1I 1CSPA 4HJ9A 4JBJA 1L0WA 1G6PA 1CI6A 5JJLA 5JEAJ 3D31A 5IY0A 1IBMQ 1PA6A 1S9KD 1EWIA 5APYA 4M3LA 2NZOA 2RF4A 4R1JA 4JI5L 4UPAA 3PIOA 2JA7H 1FVIA 1A02J 1A8VA 2ASBA 1SROA 4YCVA 2WT7A 1UE5A 3A0JA 4DR6L 3W1GA 4LFBL 1VQLA 1GTWA 2R93H 4PZ8A 3M3YH 1WOCA 4JI4Q 3GTLH 4DR1L 1XMOL 3J81i 5IP7G 1JE5A 2YYZA 2WB1E 4DR5L 3CCJA 4B86A 1HR0W 2IPPA 3P32A 1L2FA 5BR8L 4GKKL 3ERSX 3NTNA 4OWTB 4PG3A 3PIPA 1PH2A 1YI2A 4KLKA 3M0AA 4JI3L 4NB3A 1QVGA 1A02F 2C9NY 3T1YL 4GKGA 2F52A 3W1BA 2WPRA 5FLMG 2MNAA 5IYBG 4MNOA 1DGSA 3M9HA 2OQKA 4BY1G 4DV3Q 2JA5H 4DV5Q 5M3MG 3UDGA 3W5OA 5M3FH 2Z6KA 2R32A 4A3JH 1XJVA 1X3EA 3RN5A 1PHJA 4A3CH 3HE4A 4ME3A 1B70B 4LFBQ 1X55A 3PV0A 1S40A 4A93H 3M0DA 3IRBA 2W27A 4QGUA 5LMUQ 2R7DA 1JUNA 1JJCB 3PUWA 4GN5A 4AYBG 2IT1A 5GROA 4JV5Q 1CSQA 5CMZA 1HWTC 2WAQG 3CMAA 3CCLA 3I4NH 2VZAA 4DR4Q 3J7ZC 1D7QA 2JQOA 3H0GH 4P71A 5GQOA 5C44H 3M06A 4IPGA 1BBUA 1A62A 3HOWH 1L1OB 3CQZH 3WWVA 3RN2A 4A76A 3CC4A 4DV5L 1MFZA 3CPFA 4XIGS 5IP9G 3L7ZC 5M3MH 4BY7H 4B3RL 4C7NB 4IFDJ 1Q7YC 1CZQA 1NY4A 2MO1A 1UE1A 2VW9A 2VL6A 1BVSA 2Q7CA 1HH2P 3PGZA 3S1NH 3KF6B 3HE5B 4QJFA 4DAYB 4GKJL 1VQEA 1AE3A 4H02A 2VQFL 3CCUA 5HY6A 4P75A 4GOPB 1PYSB 3UDXA 4BBRH 4GNXC 4JV5L 2R5BA 2E5LL 4YCUA 5APSA 4IJLA 4JI3Q 1EUJA 3CD6A 4DZOA 2R6GA 1Q8KA 4RMFA 4X66Q 1GM5A 2C9LY 5AW7B 4OX9L 2CQOA 3RR5A 3IR9A 4IOCA 3E9IA 1V43A 4A3BG 3A5UA 3K80C 4A3EG 3VMZA 3AEVA 2WB1G 2R93G 5APUA 1EYGA 1VQ9A 2UXBL 2ZJQA 2YV5A 4MTNA 2NVTH 1GO3E 4DV7L 2Z6KC 1B8AA 2BH8A 1HNWQ 1HNXQ 5AW3B 1E3PA 5FJ8G 3OTOL 3HKZE 4LNQA 2Q2IA 2A8VA 2IX1A 1N32L 2NVYH 4PMWA 3HE5A 2YU9H 2CKZB 2N49A 1OXTA 2LSSA 3KQGA 3A3YB 4I2LC 2NZHA 4DUZL 1VQKA 5AW9B 5GAHC 2AWOA 2CFMA 5FLMH 1NE3A 4DR1Q 1IYJB 3D0FA 2ZM6L 1SLJA 3DLLA 1HZCA 2KHJA 1CKMA 2UXDQ 3GTJH 4DNIA 5IP9H 5APXA 2R5DA 1NBWA 1PH8A 1TWAH 2KP8A 5AVRB 1IZ6A 3CCSA 4DAMA 5JJIA 1GU5A 2E8GA 1WJJA 3O8ZA 4B3TQ 3KOJA 1KHIA 2D0PA 1VQHA 3CCMA 4AQRD 1E24A 1XNRL 3HOUH 4DV3L 1J2JB 1KL9A 2RHQB 3S15H 1MKHA 2V1CC 4QQBX 4OWXB 1KQSA 4LF7Q 4X64L 3S2DH 4A3FG 4GLXA 3OW2A 2D62A 1Q12A 5EAYA 4LFCQ 1LYLA 3VMXA 2EIFA 4GNXB 4A3MG 1VQ4A 3KDPB 1VCIA 4IPHA 4JC0A 4JI2Q 5IYDH 5AVXB 1IBLL 4HIOA 4JYAQ 1XPOA 1I3QH 2I5MX 4JI8Q 2E2IH 3E0EA 3KYHC 1NTGA 2YNYA 3KDFA 2ZJRA 4L5TA 1SFOH 2AMCB 1PH5A 4JI1Q 3V4WA 1PYBA 1J6QA 3M4QA 1YHAA 3S24A 5LMNQ 4DR2Q 3S1RH 4X62Q 1XMQQ 1B7YB 3OAKA 1E7ZA 4TVAB 4B3SQ 3ER0A 4IJHA 2YTVA 2JJLA 2QGQA 3KLWA 4X64Q 4DR3L 1M1KC 1Z47A 4PZ6A 3HOWG 2UXCL 3LIDA 4YY3Q 4GT1A 2N78A 1KD1C 3VTPC 2HQLA 4A3GG 4NXNQ 3NELA 4HJ8A 4A3DH 3OYYA 3E9HA 3L37A 4LFAQ 1NWQA 2VQFQ 4TQUS 2R7ZG 1KXLA 3G4SA 3EBEA 3A5ZB 1LUZA 1E22A 2JEBI 4KHZA 3GTOH 2H7HA 1RIPA 3U4VA 1G2CB 1EFWA 3M7NA 4X6AH 1K3RA 3TK1A 4DR7L 1PH7A 1H8AA 2F3IA 1YIJA 1VQBA 3U4ZA 4C3JH 3HOUG 3M4PA 2UUCQ 1YNXA 1NMGA 3V4QA 3AFQA 3CP0A 1A0IA 3RLFA 4B3RQ 1JT8A 3MGNA 1YVCA 4JBKA 3AYHB 4YWMA 4LF7L 1VQOA 3F8TA 1XNQQ 4QL5A 4GLVB 5C3EG 4QY7A 3VN0A 1G291 4B3MQ 3M91A 3I2ZA 5C3EH 3H3VH 1CKNB 3H15A 1W3SA 3CPWA 1HBWA 4A3IG 1OXXK 1Q81C 2K5VA 1X8YA 1K8AC 4DV0L 4JYAL 3JC66 2JA8G 5ELOA 2Z5HA 5AVQB 2Y0SG 4JI8L 5JEAG 3S14H 1KAWA 5AVSB 4DK3C 5C4JH 3KJOA 4AQYL 4JI0L 3K0XA 4JI1L 2ZM6Q 5LMNL 5C0XG 1YJNA 1PH6A 1JMCA 1FJGQ 4Y52H 2C35B 2XTIA 3K81C 2P2UA 3TQYA 3HKZG 1N8RC 4GS3A 2DUDA 1Y1WG 2WT7B 1E1TA 2NN6G 1EIFA 2AWNA 1SR3A 3CCEA 3RZDH 1ASYA 4LF5Q 5E7NA 1J5EQ 3PSIA 2R7ZH 1H95A 1SE8A 4GLAC 2HHHL 2UUBL 2L15A 5IE8A 4A75A 1OXZA 1GK6A 1Y1VH 1YITA 1YJ9A 3HOXH 1CKNA 2Q5UA 2MFIA 4P74A 1LM0A 1Q1BA 1N33L 2BH2A 3GTPH 4K0KQ 1FGUA 4JG2A 3CW2C 4DUYQ 3ULPA 3I5CA 2MQHA 3S1QH 4APVA 4A3KG 2QEXA 1IXRA 4DV1Q 1MJEA 1HZAA 1I94Q 1IO4A 1WFQA 2R92H 5AVTB 3PO2G 2JJQA 2K5NA 2PI2A 2JEAI 2R3CA 1JB7A 3DM3A 5GAGC 5FJ8H 1EIYB 4MZ9A 3NXSA 2FXQA 3A2AA 4HJ5A 2Q2TA 1X3GA 5AW1B 2YTYA 2YO2A 1BKBA 3I4OA 3UDIA 3KDFB 4LC1A 3F2BA 3P8MC 1VQPA 1MJCA 1S72A 4LF5L 2PQAA 5ELNA 3NEMA 1CI6B 4O0AA 3T1YQ 1VQNA 1X6OA 4POGA 1HNWL 2OTJA 4DR2L 1HJBA 3J7A5 5AVYB 4BA1I 2HT1A 2MO0A 1I6HH 3UIAA 2IY5B 2YTXA 1N9WA 4R4QA 5HGQA 1YZ6A 1UE7A 4AUWA 1CUKA 4DV4L 1GK4A 1SRUA 1XMOQ 1GU4A 4DV1L 1Y1WH 1EQQA 1H88A 4AYBE 5AVVB 1N34L 4UP9A 5J3BA 1QVFA 1IBLQ 5AW2B 4BBSG 4C7NA 2ALYB 2LXKA 4RESB 1VQDA 2I0QA 1TWCH 3F2DA 1VQGA 4A3DG 3G48A 3HTKA 2VNUD 2UUBQ 3EIVA 1UE6A 2F4VQ 3UE1A 1PH3A 2ZTEA 3CC7A 1VQAA 2A1AA 1X3FA 2DGYA 3UDFA 2UUCL 1A63A 3A5TA 3HFZB 1D8LA 5JJKA 3J81c 4JI7L 5AW4B 4BY1H 3M85A 2R92G 3ULLA 5IYDG 4C46A 4BXXH 5AJ3L 1O7IA 4IFDI 4A3KH 3ULJA 1IL2A 1AH9A 4XTCS 4BY7G 2RCNA 2Z5IA 1P16A 4LFAL 1T2KD 1WI5A 2HIVA 2I5LX 2Q2UA 1XPUA 4YWKA 4XE5B 1QZHA 1L1OC 2Q2HA 1TXYA 2WWWA 3CXCA 4DV0Q 1W2BA 1K8GA 3HOYH 4BA2I 2KHIA 3I4MH 4NXML 3Q8DA 3J81j 3HOZG 1YBYA 4DV2Q 1TWGH 4NPSA 3T1HQ 2NVQH 4WJ3M 5C4XG 1Y1VG 2JK8A 1X9NA 1XNRQ 4I6MC 1FJGL 2XU6A 1PH1A 2JA8H
chains in the Genus database with same CATH superfamily
3BYTB 3CC4P 1STGA 2KBNA 1OWAA 1LTBC 2MGSA 1N7LA 4B9XA 2CPBA 3NMDA 3L9AX 5AW5B 5B5EE 4DV7Q 3LGJA 4JK1C 3L3OC 4BY7B 4DNRB 3DEPA 4HSPA 4BBSH 3P7KA 2F4IA 2WINB 1JWSD 1NJIC 3S2HH 5LMNW 1YJWA 1STAA 4H44C 3VR6A 4P72A 5M1BA 2ZXRA 4P2CB 5GAEC 2K1BA 3RL0C 1EIGA 4B3SL 3H1LE 1RL2A 1MGSA 3I73A 2BA1A 3L74G 3MUDC 1F9SA 4PV1D 1STHA 2D0OA 3E1IA 1IJDB 5C4XH 3ONAB 4DV6Q 3ICEA 1ZN5A 1FD7D 5D65A 4EQNA 2XGTA 4HYTB 1NMFA 4DV2L 4O9BA 4O2DA 1PZKD 3KF6A 1KV4A 2PZTA 2VRSA 3MXNB 1N8RQ 4HJ7A 5I4DA 4QIWB 4Y7NH 4MIUA 1SQVD 3U1AA 1B9MA 2BOSA 3NFQA 1PP9E 2W90A 2GN5A 4JYBA 2ITAA 5ELCA 3O6QB 3DUZA 1KQSO 4F8MA 4UHVA 2OYOA 3IAYA 4RFBA 3HOVH 2QSIA 1J8IA 2JWDA 1V9PA 4JW0A 1QZGA 4OELB 4U3FD 1ZRTE 1BBWA 4NDXA 3H1KD 2NYZD 5IYCG 1VDZA 4ZQ3A 1SQXK 4ZCKA 5IT9E 5KJ7A 3RNUA 4HR7B 1KDBA 3VYIA 1N7SC 1HF9A 1QB5D 4IFFA 1BCPD 1DCZA 4FO2A 1S3JA 5J1ZA 3TSIA 2BCCG 3CXHD 3CCRP 5CYUA 5KNBA 2UXBQ 1QGKB 1X65A 3CCQA 1M7LA 4OO1H 3AEFC 1L0LG 2CWPA 4PZ7A 1II3A 5KLIB 5ELBA 4JOIA 1JB3A 2XZRA 2HCCA 4KKTA 3TRZA 1LJ2A 3M9QA 1RCVD 1P84H 2A06E 2M5AA 3FKIB 2XIWA 3C3LA 3G6EA 1CHPD 3NPPA 1GUNA 2FXPA 3PTZA 5KJ7D 3ND8A 4OIKA 1BE3J 2W6AA 3U9OA 1AA0A 2KNCB 5FK9C 3GDEA 1Q3LA 1BGYE 1SE4A 3L72G 2F0JA 1C7YA 2CCZA 4D6TD 1IK9A 4HJAA 2L0CA 4K5WA 1EDIA 1NGMB 4G7ZC 1D2BA 4IZ8A 4MTKA 1RE4A 5E79H 2G5DA 2JO1A 4A93G 1Y9BA 1RF1A 2VY3A 5C3EB 1KILD 1L1OA 4LF9L 1Z7TA 3S4RA 5LMUL 1LTAC 1HR0Q 3RK2C 4K0KL 3AE2C 2EDGA 4KHPQ 1S5LX 1BCCD 1SP4A 3KLSX 1LTGC 2B2WC 2Y0SE 3S14B 3HKSA 3H1KJ 4OX9Q 1GVPA 2WSSH 1VQ8A 3MEHA 3L71E 2MKVA 4XQNA 5M5WB 1Q82C 3STBD 4DPGA 1R5SA 3ITPA 1PP9D 2RDHA 1D6EC 4LUOA 5C6AA 3TDKA 2D5DA 1RF1C 5KAFE 4A3BH 4L5SA 1GKHA 1TS4A 1I5FA 2E2HH 4IUUA 2CWAA 2B88A 2JA9A 3G71P 3T56B 3PO2B 3H1HJ 1KFMA 3BDLA 5E1FA 1K83H 3QO2A 3PUZA 3CD6A 1JNMA 2QJKB 4DK6C 5APQA 1EEID 3WUTA 3D6WA 1R9TH 1N73B 1QCBD 1VQOP 3P7JA 1ASZA 1V1QA 3GHGA 1B9NA 1NU1E 2PNHA 4IL6E 2RBMA 4AIMA 2UXCQ 1BOSA 4OWWB 1BDDA 1OXUA 2OTJP 1F2YA 1KRSA 1ZXGA 1J1DC 5K5GB 5KAIH 3AB9A 4DA2A 4JI5Q 2JA7G 2KS1A 5CCGA 3HOXG 2ZFCA 3AE8C 1JE4A 2V4HA 2BDNA 1W2BO 2K88A 4DR4L 4IFMA 1MZ9A 1NSNS 5C0XI 2IBZG 2EXZA 3KF8B 2H89C 2UUAL 2E76C 5C0XH 5CBOA 2F0VA 3MFGA 2AXTH 2AKWB 4GN3B 3GV6A 3PUVA 1ILPA 1K8AQ 1JCCA 2F0UA 2K4KA 2QA4A 1Y1WB 3K7UC 3TP7A 2F1MA 1KLUD 2WTYA 1STNA 3OTOQ 2JA5G 3CWBJ 3KYQA 4IOAA 1EZVI 2MJZA 4ZKCB 3BZCA 1EOTA 5L37A 3GTPB 2K9JA 1SQVK 1OZHA 2PNRC 2NVYB 4JI4L 1FZAA 2XNDH 1O7LA 1FL0A 4C1NI 5IGFA 1M90C 1XPUA 2ID0A 2UXDL 2B87B 3ITKA 2KCMA 5CV8A 4DK1A 1GUGA 4NXMQ 2B2VC 4L76A 2KZJA 1L0WA 1Z56A 5JJLA 2FY8A 3D31A 5CV6A 1IBMQ 3C46A 1S9KD 1EWIA 3SK8A 1EY9A 4UPAA 1PGPA 1A8VA 3II6A 2XVSA 1VQ8P 3RGUA 1UE5A 2R93H 1EXIA 2MJ8A 4PZ8A 2W6BA 3FXEA 1JTHA 4H13D 4WRDA 1JE5A 5J22A 2DY8A 2WB1E 3BVZA 2IPPA 5BR8L 3ERSX 3SK4A 4OWTB 2NPSD 4UB6H 2YKPA 2LKVA 4JI3L 1NR4A 1QVGA 1A02F 2C9NY 3T1YL 3D4DA 3EJIA 5IYBG 4MNOA 4BY1G 2OQKA 1L4AC 1Y8NB 3URYA 4DV5Q 1XJVA 1BCCE 4N9TA 2ICEC 4ME3A 1F2ZA 1KD1Q 3K5LA 3H3VC 3S1NB 1EDKA 4ZKPA 3PV0A 1G91A 1FZCA 4HMJA 2QILA 1Y69U 2A73B 4QGUA 2BCCJ 2Q1KA 1JUNA 1EWHA 3ERQA 3V2TA 2AQ3B 3PUWA 2F03A 4AYBG 2IT1A 5CMZA 1KB9H 3CCLA 1PPJG 4DR4Q 3J7ZC 1AVYA 3MIWA 4G7OC 3GTOB 1HTPA 1SFCD 1SQBK 3OA7A 4KKSA 3CC4A 2FYUD 2HYNA 1P84I 1JWMD 4BY7H 1YNJD 3VYTA 5GTHE 4Q5VA 1EWCA 1UE1A 2QF7A 2VL6A 3GTLB 2P1JA 3IF4A 3I91A 3NTKA 4GKJL 3EFFK 1URQA 1QVFO 2VQFL 1RF2D 5IODA 1HA6A 3JCUE 2E75C 1F9RA 3NQTA 1PGOA 2OYHB 1SFOB 2K01A 3A7LA 4RMFA 1GM5A 5AFWA 1URQC 2AQ1B 1K0SA 3A5UA 3K80C 3AEVA 2UXBL 2AUJD 3CXHE 3CXHI 4HEDA 2F0LA 1HNXQ 2WIIB 5AW3B 1HNWQ 5CCHC 1CW5A 1LP1A 3A8JE 3OTOL 3HE5A 2CKZB 4JF7A 1NTMG 5ELFA 1I6HB 1LWUA 1ZMEC 3H1ID 1QNUA 1Q90D 4DAVA 1VQKA 5AW9B 5GAHC 4IUTA 2CFMA 3L71J 2E74D 4U3FE 1PYWD 4X3UA 1SSOA 1HZCA 2KHJA 1I4RA 2DN8A 3H1JD 5BN3A 3GTJH 3L75D 2G8YA 4DNIA 1NBWA 1Q8IA 2W83C 5IP9H 2KP8A 1V1OA 2K37A 3Q5PA 1KDCA 1GU5A 4N8FA 3O8ZA 4NPDA 1I50B 1WRGA 1KHIA 1VQHA 3HOUH 4PD4D 1I6VC 3S15H 4ID6A 2BEQD 2CK3H 1BDOA 1MKHA 3DXJC 2DJFC 3RK2B 4LF7Q 4GLXA 2NZ1D 3QOJA 2J0TD 3OW2A 2D62A 5EAYA 4ZNCA 2EJFC 2YMKA 1V1PA 3VMXA 1DD3A 4EQPA 3KDPB 4JC0A 4JI2Q 2Y0EA 5AVXB 3JAML 1KB9I 1HPCA 3NWTA 3AEGC 1X9VA 1EZVE 1I3QH 3E0EA 1JB0J 2POHA 3KYHC 3BVGA 5FOBB 3G9RA 1YIJP 4XXEA 2AMCB 1PH5A 1EY4A 2E74C 4G4KA 3AECC 3OMGA 3S1RH 2PYKA 3OMCA 3S24A 5JEAH 5EBCA 3H6MA 3OAKA 4TVAB 4IJHA 5KLVJ 1E0BA 2FFKB 4TRDA 1M1KC 1IK7A 1AZPA 4PZ6A 2W8ZA 4YY3Q 2A68C 2D2CD 1IKLA 1VQPP 1YI2P 4HJ8A 4QMAA 1JY3N 3OYYA 4LFAQ 1SYDA 5M3MB 1T6AA 3G4SA 2IFMA 3A5ZB 5CGKA 2H7HA 1QE6A 1NCVA 1RIPA 1G2CB 4Y99C 1TQOA 3GP7A 1K3RA 3G7LA 2I46A 1NJIQ 5L8RJ 2F3IA 1PH7A 2NVQB 1HTLC 2KUBA 2F0EA 2O01J 1SNDA 1YNXA 1JT8A 1OVVA 3AFQA 3CP0A 3RLFA 1G1JA 2DJGC 2E75D 2FYUG 2P58A 3BDCA 4QL5A 5GTIE 4IL6X 4GLVB 5C3EG 2B2YA 1IFNA 5IGGA 3I72A 4K8JA 1WTVA 3H3VH 2VB2X 1XX8A 1HBWA 2KEDA 2PW7A 5CORA 1QEXA 1X8YA 4KD4A 4DV0L 3JC66 1YNJC 3KLRA 1SQPJ 2PAJA 3S14H 1ICWA 1NU1G 2Y0CA 1ET9A 1ZP0C 3EQ2A 5C4JH 4JI0L 4LMQD 4DCKA 2EJGC 3K0XA 5LMNL 5C0XG 1PH6A 4Y52H 5CCHA 3HKZG 1Y1WG 2WT7B 2R3ZA 2JWAA 1M90Q 2R7ZH 2UUBL 3GHGC 2L15A 1YJ9A 1EEFD 1OXZA 1L0LD 4NPEA 3VA5A 1YITA 5NUCA 2B2WA 1I4PA 1LM0A 5TISH 1T3UA 2I1JA 1FGUA 1P84D 5KTBA 1XTCD 3S1QH 2MQHA 4A3KG 2QEXA 1IXRA 1HZAA 2XWJB 1I94Q 1WFQA 4BRYB 1DD2A 2WSEH 3OPOA 1NTKK 1FZFA 1FZCC 5TSSA 1EIYB 3NXSA 4BBSG 2ZT9B 2ZYAA 1O7ZA 1X3GA 4LC1A 4BS9A 2D2CB 3F5HA 1CI6B 4K3AA 3T1YQ 1VQNA 1X6OA 3VYSA 1HNWL 2OTJA 4WVZA 3J7A5 5AVYB 1QX8A 4C3IB 1AEXA 2IY5B 2JR8A 3CC7P 1Y8AA 2KYVA 1J1EC 1PZQA 3FXDA 1ML0D 4HMIA 1OW7A 4R4QA 5HGQA 1Q81Q 3I55P 1EQQA 4AYBE 4A7PA 4EDFA 4L63B 1SYGA 3RBZA 2RKSA 1QVFA 1EXJA 2KECA 4C7NA 2I0QA 4RESB 3N7NA 1X3QA 4A3DG 2QA4P 3SEBA 4RO0A 3D3RA 3Q2YA 1MHWC 3S1QB 2E5TA 1PH3A 4FF1A 2UWJE 1HRJA 2ZTEA 3D6CA 1VQAA 2DGYA 1AQ5A 3UDFA 2EYOA 1A63A 1D8LA 2EZVA 4WY4D 4JI7L 2F3WA 2R92G 3QG1A 4C46A 4BXXH 4IFDI 3ULJA 1IL2A 1VQMP 2FYUK 4NKLA 2F0KA 5FKAC 2M3BA 1SQVG 4LFAL 1K8MA 2F0DA 4ZMDA 3PO3B 1X0TA 4XE5B 1K8GA 2Q2HA 1TXYA 3CXCA 5BN4A 2O5IC 4N8X1 2CQAA 3HOYH 3CQZB 2N88A 2C0WA 1VQ6P 4NPSA 4XDXA 1SXTA 4WJ3M 1FU1A 1SQVJ 1PTOH 3I4NB 1HUNA 1EY6A 1NU1K 4QF4A 1BSNA 1L4AB 2FBWC 1T2KC 5D3IB 3T13A 4K2LA 1SNCA 4LF8Q 4FP5D 1QVCA 1LTJC 2XWBB 4ABNA 2KSJA 1V8QA 3FPUB 2O1KA 3PCOB 3PUXA 3D71A 4YTPC 4LW1A 3V5BA 1MFTA 2PMZE 3GTKH 4DV6L 1S5LE 3HOVG 3AEDC 5A2QE 1RY3A 2N1TA 3T97B 2NB0A 1TWFH 1JC7A 3SFEC 1GD7A 1WTQA 1U4LA 3K7AB 4JBWA 5GADC 3M4OH 5CCGD 1C8CA 4BBSB 2EY5A 2I07B 1BDCA 2V7QH 2K5HA 2NTTA 2WKDA 5F2DA 4YY3L 3VDYA 4A3KB 3TNUA 3KZIH 4JPZB 2N9BA 3CMEA 5K36G 4OH8B 2EVBA 3GTGH 1YJ9P 3B6YA 2HODB 1XTDA 3IN6A 4DAYA 1DOMA 4GNXA 1LTGD 1I3QB 5CJ0A 3R3OA 2NVXH 3U50C 2HT1A 2UXDQ 1MV8A 2Q3IA 4PJ0E 4FDBA 1YTZT 4L74A 1UIXA 2PMZB 3K0YA 5CBNA 1NTKJ 3PJSK 4B3TL 1RDPD 1BGYJ 2HPCA 2JA6B 4CJ2C 3NUCA 4UP8A 1N33Q 1JO5A 4EGVA 1QLED 2YU9B 2P5ZX 1D1KA 3S15B 2JA6H 3A7OA 1TVXA 3MXPA 1SMYC 2ATWA 4HH2A 3WUUA 4AQYQ 1YNNC 2A06G 1IFJA 2GA4B 1I94L 1P8LA 2UUAQ 3RBXA 4C2MH 2VUMH 1GUWA 2GUVA 2E43A 1KB9E 3UE0A 4A3EH 5APWA 3B8EB 5K5PA 1H9MA 2QDLA 1LTID 1PH4A 4K14A 4X62L 2EY2A 4ALPA 1ZEQX 3A74A 1UWVA 4JI7Q 3CC2A 1L0NG 4BBRG 2LMCB 4JQ0D 1SNMA 1U4PA 2WSFJ 1X32A 2X69A 3MD0A 1CZWA 1U7MA 5C5LA 2BA0A 2RSNA 1UEBA 3FP9A 5DLQE 4WY4A 3QR8A 1NHLA 3SWFA 3MTSA 1YHQA 3BCCE 4KHXA 1NTKE 1HTLD 1SYEA 2E5YA 5KLVG 2CW0D 5DM63 1GL2A 1XPRA 2QVAA 3Q6SA 3T1HL 1JJGA 1PPJD 2JE6I 2OQ0A 4UP7A 1N7SD 2L91A 1D5MC 2CPSA 1E1OA 2BCOA 2E2DC 2OTLA 1IFPA 2J59M 1QG7A 2GVBA 1JICA 5LHY1 1GMJA 4A3BB 4ZYSA 1UUPA 1NU1J 1VQ4P 1BXTA 1SQBJ 1A15A 3RZDB 2Z8LA 4H7BA 1MIUA 1FNWA 2N8NA 1WVLA 4QUFA 3BATA 5IGEA 1Y14B 3TP6A 3S1MH 2ZVNB 3LWUA 1NTKD 3Q5SA 1EFID 3V2QA 3K7AH 1RF0A 3CWBE 4C3JB 1BGYD 4IPDA 3H0GB 1EQVA 4E6IA 1LTTD 2F0SA 2EOTA 2UU9Q 3CX5H 4C7RA 5EKIA 4CKCA 2FYNB 1SQQJ 1VF5B 3DM1A 3PF5A 4H0LD 1PL5A 2I5HA 3PMFA 4LF4L 4OVNF 2FYZA 3ZJYC 1TWHB 3TGUD 2FYUE 4KHVA 4CKEA 1WTPA 2ZTCA 2O01H 4PQXA 3CCRA 2B89A 5M3FB 4K6DA 4A3FB 3OWEB 3RL0D 1BCPF 4RGMA 2WP8J 3KJPA 1HJPA 3TEHB 3P8CD 1TS2A 2ZJSE 1PH9A 1RE3A 2P7JA 3PLNA 1LO5D 2W6JH 2AHOB 4QUCA 2EYFA 3TREA 5M5YH 4YHHQ 2GA1A 2JEEA 1IKMA 4D6TE 2KENA 2RHSB 1J1EB 3KK7A 1S5ED 1DZ1A 2EQSA 2Z4IA 1LTJA 5JVG3 2WFWA 1VQ6A 4PD4H 3HUSA 1S72P 4XQQA 1FYCA 3KFUA 5H2FE 1M1KQ 3S2DB 2ZVOB 1I4GA 4X65Q 5CCHD 4KJMA 1LGHB 4N78D 2N1TC 3A0BH 3Q23A 5AVWB 4JCVE 1GW4A 4KY5A 1JY3P 3R93A 2RH0A 2VQEL 2RVLA 2JA6G 2K5DA 1F2MA 1PIXA 2F0FA 2L4NA 5T1IA 4YHHL 1U5KA 1XXGA 4J8QA 3V96A 2YO3A 5M5XB 1K04A 3SFDC 4LF4Q 3R8BA 3I70A 2HCIA 1SN8A 2FFDC 1VPCA 4JI6L 3FVQA 2VXWA 4I7AA 4V190 1KORA 3CCMP 1L0ND 4FXGC 1KIXA 4EQ5A 2IHFA 1G51A 3GV3A 1FOSF 4BRYA 3QIAA 4O1NA 4GKKQ 4KK7A 1KQLA 2AXCA 4WJWA 4LUVA 3CCVA 3CAMA 3EWKA 3S9OA 3BZKA 1CSPA 4HJ9A 1JOQA 5DJUB 1PFIA 1HQRD 1SDFA 2F0NA 5IY0A 4R1JA 5APYA 2RF4A 3H94A 2IWHA 3PIOA 4OGQB 2JA7H 1GUOA 3VR5A 1X3PA 3SSUA 2WT7A 3A0JA 4DR6L 1CHQD 4GOEA 1VQLA 1GTWA 2LXBA 4JI4Q 4DXFA 1EY7A 2FINB 3P75A 1V1PB 2DNCA 1NTZE 2BEZF 2YYZA 3CCJA 4TSSA 4ZUJA 3P32A 1M1JA 1GXDC 1WT6A 4PG3A 1EY8A 2IJ0A 2QDBA 4WFN3 2A69C 3BYYB 4Y99B 2JP1A 1FNUA 5FLXE 2YKQA 1GOZA 3LW5J 2MNAA 1FJPA 2H88C 2JA5H 2EYPA 5M3MG 1R5LA 2KSEA 3H1LD 1ET6A 1PHJA 3E1RA 3RN5A 4H13C 3HE4A 3USSA 4LFBQ 1X55A 5IT9L 5KKZB 1S40A 3LWEA 3H1JG 2W27A 2KK7A 5LMUQ 1LT3D 3H1IJ 2K5WA 1JJCB 1WTWA 1SQXD 2JA5B 3HOWB 2C0XA 1D7QA 4P71A 1MKMA 1LP1B 3H1JJ 1TWGB 4IPGA 1A62A 3HOWH 1O7YA 3WWVA 4B3RL 1SNOA 4DV5L 4UDUC 3L7ZC 2Q9IA 3B4SA 1VDFA 1EC5A 1NY4A 1Q7YC 1NKNA 1CM9A 1KYOD 1BVSA 2J7ZA 4A3DB 3O6QA 2QKIC 2Q7CA 1NTMK 3F89A 4QJFA 1NKZB 1AE3A 5EKLA 5HY6A 1C4QA 1E79H 4GNXC 4JV5L 3R2IA 3ZDMA 2R5BA 3JC22 2WITA 1PTOB 1FBMA 1U4RA 4OHJA 4R8NA 2O5JC 1AFOA 5KYIA 2BE5D 2FFDA 1EIHA 2V7QJ 2C9LY 2E2IB 2CQOA 3RR5A 3QOLA 3GW6A 4EI2A 3NQIA 1V43A 4A3BG 2E76D 3VMZA 1OX3A 5APUA 1HUMA 1EYGA 2ZJQA 4MTNA 2NVTH 1GO3E 4DV7L 2Z6KC 1B8AA 4H13B 2L5TA 1E3PA 1SE3A 2V4DA 3NK9A 5FJ8G 2Q2IA 2A8VA 3B5ND 5KLVD 1DEEG 4PMWA 5I2YA 2YU9H 2N49A 1USDA 4N3YB 2OYHC 1OXTA 3E0JA 3W2DA 3S17B 3A3YB 4ASWA 4PV1B 1G2SA 2JKVA 2AWOA 1NE3A 4DR1Q 3RUZA 1TWCB 3H1LJ 1SLJA 1T5XD 1DX7A 3DLLA 4TLFA 4BWNA 2M0BA 4W7ZA 2HDLA 2LKMA 1H0TA 3CCSA 1AN8A 2E2JB 1RE3C 5JJIA 1EYDA 2M5AB 2RDFA 2NZ2A 4B3TQ 3KOJA 3T4AC 1PTOD 4AQRD 1ZKOA 1KL9A 1I4XA 1MBYA 4OWXB 1BF4A 4X64L 4YPCA 5KAFH 1R4QB 1Q12A 1PTOC 5E3FA 4KN7C 1VCIA 1JMMA 5M5YB 2X6LA 4HAEA 3M4OB 3VOPA 2I5MX 2IW3A 4JI8Q 1EFWA 3KDFA 4F88A 1OW8A 1W2EA 2M00A 3HG9A 1PYBA 1J6QA 1GL2D 2Y0DA 3BDOA 3MC0B 5LMNQ 4HKZH 1CQVA 4DR2Q 3DMUA 1B7YB 1LTAD 1EZ8A 3SK5A 1ZLLA 4DR3L 4X64Q 4KTAA 4G7HC 1Z47A 3LIDA 3KPEA 4LLHA 3VTPC 5JOBA 1W6JA 3L37A 4O42A 2R7ZG 3AE1C 3HS0C 4N6JA 3PIP3 4CJ0B 3M7NA 4DR7L 1H8AA 4WB4A 2FHTA 4H44B 3M4PA 4B3RQ 1Q2NA 1A2TA 1NMGA 1BE3G 1ENCA 3S1MB 2OTLP 1L2PA 1M8OB 3AYHB 4RWSC 4RA8A 1VQOA 1HVVA 3FX0A 4XT3B 4QY7A 1G291 4B3MQ 1YTZI 3M91A 1CT1D 3MHVA 1OIPA 3CPWA 4A3IG 1OXXK 3MXNA 3P1HA 3JSVC 1K8AC 2YMYA 4JYAL 2PZWA 5ELOA 2Z5HA 5AVQB 2ZXOA 2JA8G 2Y0SG 3HGBA 3U9SA 1KAWA 3FEWX 3CLQA 1PZJD 3OWFA 2WSCJ 1DD4A 1GUSA 1FJGQ 2C35B 1M4VA 3K81C 1D5ZC 3TQYA 2ZYDA 4GIFA 5KIXA 4GS3A 2NN6G 1EIFA 3VYRA 1SR3A 3RZDH 4LF5Q 2E74B 2EYJA 1J5EQ 3PSIA 1H95A 4L8JA 5KNDA 4ZKUA 3L72J 5IE8A 4DFAA 1GK6A 3VP9A 3Q3DA 1CKNA 2Q5UA 2MFIA 4HN7A 1Q1BA 3FWNA 3GTPH 3GLMA 2F0GA 2EJMA 1KNAA 4JG2A 2RSOA 4DXGA 1T3JA 3K5NA 2Y9ZA 2R92H 1JOKA 2JJQA 2K5NA 2IZ1A 3OSOA 2R3CA 2TMPA 2A69D 2JEAI 1TWAB 4YXDC 2AEJA 3L70G 3DM3A 4HTHA 2FXQA 4MZ9A 5FJ8H 3WUVA 2M2LA 3I4OA 1BKBA 3P8MC 3NBIA 1ZYRD 2J4XA 4KD3A 2PQAA 4CKBA 1VQPA 4FYDA 4POGA 3CCSP 4DR2L 1RODA 1NTME 3H1KG 5EPLA 1N9WA 3FGAD 1UE7A 2JN4A 1CUKA 1GK4A 1SRUA 2TSSA 2A45G 2BDOA 1Y1WH 1KMIZ 1H88A 5AVVB 2NPSA 2ZT9C 1WMKA 3TP8A 1AVOA 4C2MB 2ALYB 2KLVA 4NP5A 1N7SA 5EPJA 2VNUD 2UUBQ 4LJZC 5CC4A 2F4VQ 5JPMC 3J81L 1U7JA 2A1AA 3CC7A 2PRRA 2UUCL 3KUPA 3A5TA 3HFZB 3H1IG 2B63B 5JJKA 2R3SA 4K5XA 3M85A 5IYDG 2WVRA 3HD7B 1E2VA 3CL3D 2A5HA 2EPBA 4A3KH 4DJGA 1AH9A 5JJZA 2RCNA 3D8GA 2IBZI 2I5LX 4C3HG 3TF5A 5GTIH 4YWKA 2Q2UA 2DW3A 3KBGA 4BA2I 3OIPA 4DV0Q 3U59A 2K04A 2KHIA 3I4MH 5BU8B 1GL2B 4NXML 4ILWA 1TWGH 3C1LA 5IGDA 2XDJA 4LK1C 1FZCB 3T1HQ 1K83B 2HD3A 3WDNA 3NXWA 1FJGL 1RF0C 3GTGB 2FYNC 2B8GA 3OOCA 1XMQL 1A3UA 3OIQA 1SQQG 1VF5C 4YIJA 1HGVA 4CHTB 2F0QA 4A3LH 2ES2A 1PRTF 4P73A 2OQQA 3B5NB 1NAPA 3A56A 3SK6A 2EYLA 3MUDA 1B4OA 2L55A 5AJ3Q 1VQJA 4DV4Q 4A3CG 1P84E 1JY3O 5KKZC 2HHHQ 3C1EA 4LF9Q 2AXTE 1RJTA 1OVRA 4HIKA 1L0LE 2E76B 2N9YB 1ONLA 2G9DA 1N36Q 1Y8PB 2LXCB 2WSCH 5C44G 4DUYL 2HQEA 5C3XA 1XTGB 3RK3E 3BCCD 1EQRA 2PP6A 2RKLA 1TKWB 1X54A 1SE2A 4A4IA 2ZT9D 5APTA 1IL8A 2VUMG 3GTKB 3HOYB 4EYYQ 5BU5A 2Z0SA 3BVMA 3PQIA 4F87A 1JJ2A 1RTOA 5G3LF 3GTQH 3R2PA 2Q8IB 1PMRA 1DH3A 1TT2A 1STYA 3T53B 1UNSA 2CVRA 1CK1A 4KJNA 1AE2A 4L5QA 3CX5E 4C1NK 2G9HD 4UB6E 1ZYRC 1S5LH 2HODA 1STEA 1W6KA 4LUZA 1KLGD 4C3HB 2KVMA 1LTTC 2A19A 1LNQA 3KHUA 1A3VA 3GD7A 4GOPA 4PMBA 4JBZA 3I56P 4JI2L 1EOVA 2WQYC 3L70D 2HR3A 3BJUA 1SVFA 1I4QA 4BXXG 1B50A 3BVHA 1QL2A 3HZXA 4ZUIA 3FKIH 3J81E 1LT9C 1YYCA 4EOTA 1EU3A 1B44D 4MN3A 1QUQB 2XNAC 1H89A 2IHEA 1NU1D 4DR3Q 1H0TB 3TN2A 2E5LQ 2NUCA 4F7XA 4ZK9B 5APVA 1ILQA 2KCTA 3H0GG 2BASA 3AEAC 3E7KA 2QJPC 4LF6L 1KC8C 5AW0B 1VQ5A 3VP8A 1ENAA 1CA6A 2OWOA 3RZOH 1TU3F 4R4TA 4Y7NB 3OW7A 1K0RA 1EZVD 1HZ9A 3G3ZA 3IAOA 1JQYD 4UY8C 2F4VL 4RG1A 4Y28J 1GW3A 3C2PA 4PNYA 4XQJA 3L0OA 4BXLA 4HJGH 1IHZA 1U9RA 1OXVA 2RA4A 4C3IH 1C48A 3I55A 4FXDA 2Y0SB 4GDOA 4CJ1B 3I7FA 2ZXEB 4S3SA 5EBDA 1SQQK 4DAPA 4TKOB 4RAUC 3G6JB 2A6ED 1IBKQ 5CMDA 3TS0A 3VMYA 5BR8Q 4A3LG 1PFSA 1T9HA 1QUQA 3EA6A 5BN5A 3VR3A 3AFPA 4C3HH 3H1HE 5C4JB 3PH0A 5KAIE 4JI6Q 1A2UA 1OXSC 1SMYD 4A3FH 3S2HB 4EQOA 4BBRB 4IO9A 3NWSA 2Q8TA 1PGJA 5C4XB 4CBVA 2AUKA 1FZBA 1LACA 3HUSC 1WCMG 1S5BD 1J9OA 3FPPA 2B2VA 1BBXC 2R7ZB 3DEOA 1PP9J 1LTLA 1ICFB 1IBKL 3L70J 2N3SA 3E5SA 3WOEA 2FKWB 4DT0A 4OGQD 4G57A 3K5OA 1SAPA 5FO7B 2E42A 5CHXA 3J80E 1X56A 2JA8B 4ZLTF 5EQ0A 5DJTB 4LGDE 1SYFA 1WTOA 2K32A 1IBML 5JPNC 2KIKA 1HZBA 3PO2H 4OO1G 3L74E 1C0AA 2RCFA 2A06D 3Q5RA 3F1ZA 1TS3A 3AE4C 1HNZL 1M56D 5ELEA 1C9OA 1H9RA 4IPCA 1G2CA 1TY2A 1EQ7A 1WCMH 4OONA 4MHEA 4LFCL 1BR9A 1EYCA 5CV5A 3FWLA 3L74D 5IGBA 4R8IA 1STBA 2ZJPA 1L0NJ 1TIID 4L6TB 2WACA 1KYOI 4KI0A 1DM0B 1F2LA 5AW6B 2EY6A 1SFCB 1NTZD 5CCGC 3FKIG 1B2TA 2YKOA 1SMXA 3HTKB 1KILA 3TP5A 2PI2E 1B3QA 3L35A 4HCSA 5FLXc 5CBEE 2MHVA 3HKZB 4A3MB 1GZLA 2F0OA 2CHBD 3VMAA 4CDCC 5KNCA 1KZUB 4JPBW 1HNXL 3PF4A 5C0XJ 1GDTA 1VF7A 1YEZA 1SNPA 3IFDA 1VQFA 3J80i 4GKJQ 2IBZE 3W67A 1KN7A 1JOOA 4QIWE 3H1HD 4U3FG 5A2QL 2B63H 3SWYA 2VS1A 1SQVE 1Q82Q 1PV4A 4DR6Q 4ZKBB 5J39A 4CDEC 2JSOA 2K14A 3TS2A 5IYCH 3S16H 3J7YW 1TS5A 3EROA 3CWBG 3TNUB 2YIUB 1FOSE 1KTMA 1SYBA 2KB7P 1DIPA 1DJRD 1SJHD 1NYHA 1YHBA 5IT9c 1RQVA 1CKOA 2XNXA 3H3VI 4EIJA 1Q86Q 4V0BA 1B3AA 3FDTA 5ISRA 3T97A 2SNMA 2N1TB 3NENA 1N7SB 5M9OA 2WPSA 2WPQA 3M9BA 3MEFA 2WAQE 5M5XH 4IURA 4LWCA 4DKAC 1VQMA 1IFIA 4AYCA 3RZOB 1BO0A 1S9KE 5IP7H 3GTJB 1H9SB 4OO1I 5E4WC 4JBJA 4A3GB 3TMEA 4NPFX 3CC2P 3CD6P 2NZOA 4M3LA 4JI5L 1ENFA 1A02J 2M9VA 2ASBA 1FZEA 1SROA 3BG3A 3H25A 3Q1MA 4RHRA 2OYIA 3VR2A 4RGTA 5LL6S 4U673 3GTLH 2RQXA 1VQ9P 1KDAA 4ODGA 3Q0AA 3AEEC 4YXWH 1IW7D 3X3MA 1XMOL 3DWPA 3AE5C 4OIJA 4B86A 2J58A 1HR0W 1L2FA 1LT5D 4X3TA 5I6YA 3CCEP 1L0XB 1PH2A 1EZ6A 1IFDA 4KLKA 3TDQA 1LABA 1BCCG 4NB3A 3W68A 4GODA 3CMAP 2C9OA 1L0NK 2WPRA 5FLMG 2B39A 3M9HA 1BNZA 3GHGB 3W5OA 2O4XA 2KEEA 5M3FH 1USEA 2PGDA 2B2UA 1EU4A 1LTRD 1DONA 2FFDB 1U4MA 3I4LA 3V2NA 1ZW0A 3M0DA 3IRBA 3J7AF 1Y8OB 2R7DA 3JCUH 1ESFA 3CCUP 4JV5Q 3SE0A 5GROA 1PFBA 1JY2P 3H32A 2ZXPA 1D1IA 2WAQG 3I4NH 2VZAA 4IUVA 2JQOA 2HDMA 3H0GH 5GQOA 1M57D 1RH5B 3M06A 5C44H 1OW6A 3CQZH 3RN2A 3PO2G 3CPFA 4HCEA 4KJOA 4C7NB 3A0BE 1PV3A 1CZQA 2IX3A 1DOKA 2VW9A 1BE3E 2BCCD 3S1NH 4DAYB 3HE5B 3T51B 3CCVP 2NBFA 4H02A 1SS1A 2X6GA 1FS0E 1H9SA 3UDXA 2Y9YA 2M3EA 5APSA 4QMGA 3C9IA 2OYHA 1EUJA 4C56C 4X66Q 3E6ZX 2SPZA 2IBZD 3I90A 1E5WA 3L71D 3K58A 1E2WA 1K3BC 1CFMA 3HRZC 1RKNA 2K03A 1LTSD 4FXKC 3L75J 2WMMA 2XRSD 3MZ5A 4IQZA 3RMHA 2BCCE 1J1DB 2BH8A 3DWAA 2B2UC 4FF4A 4LNQA 2IX1A 3HKZE 1N32L 2A68D 3NHHA 2NVYH 2QE7H 3KQGA 1QNKA 2EE1A 2NZHA 1FDIA 1S1CX 1IYJB 3D0FA 4TT3H 1JCDA 4NW2A 2NVTB 2EY1A 1PPJE 4A3EB 1RQUA 3KZIE 1HHVA 1SQBE 5APXA 1IZ6A 2AQ2B 3O13A 3S16B 4RKLA 3Q24A 1WJJA 3A54A 4KY6A 5CV7A 3GQBA 1N73C 3CCMA 2WZ7A 3HEJA 4DV3L 3EQLC 1SQPK 1F77A 2V1CC 1D7MA 3MP7B 1PTOF 1KQSA 4QQBX 3AMUA 4A3FG 2IPKD 1G2TA 3UI2A 5CV4A 1KILB 4H0LC 4LFCQ 4KT0J 1LYLA 3MWYW 2IDBA 2EIFA 2OT2A 4J6HA 4GNXB 4A3MG 3NBHA 1VQ4A 2HG5D 1IC2A 4IPHA 3D70A 2B2TA 2OARA 5BVZA 3G4SP 1IBLL 4HIOA 1KB9D 4Q0FA 4X3KA 5EFWB 3BS1A 3TSSA 1XPOA 2E2IH 3KLSA 2H43A 1BCPB 1NTGA 3V05A 4L5TA 2KOGA 2SDFA 4JI1Q 3M4QA 1YHAA 1N73A 4XT1B 1XMQQ 5EJWA 4FF3A 4B3SQ 3HOXB 3KLWA 2JJLA 1VQ7P 2KUMA 4RCNA 3G6EP 1OO9B 3FMCA 1HXYD 1LTJB 3SWKA 1UEAB 5CJ4A 5CR3A 1KD1C 2B2TC 4NXNQ 2NN6H 3NELA 4A3DH 3E9HA 1NWQA 1N86A 2VQFQ 4DNTB 1LV9A 3EBEA 2JEBI 4ULLA 3U4VA 1URQD 1DXMA 3TK1A 1T5EA 1EY0A 1YIJA 1FDMA 2CW0C 1X22A 3U4ZA 3E3XA 1QWYA 3LW5H 5I9PA 3AU7A 5KGUA 1A0IA 3MGNA 1YVCA 3ZYYX 4JBKA 4LF7L 4KN4C 2E2HB 5C3WA 1XNQQ 2ZAEB 2LFNA 1YBKA 4WWIA 4KMUC 2O01N 2JP3A 2KJXA 1WCMB 3I2ZA 5C3EH 1CKNB 3H15A 2CH4A 2QG4A 1Q81C 1Y47A 3SXHA 3N4XA 2K5VA 1PRTC 1NAYA 2YIUC 2JA7B 1LTIC 5EPKA 2PQEA 1SFCC 3D4RA 5COYA 2IZ0A 3D6ZA 4AQYL 1S2EA 1K05A 3H1LG 2XTIA 2L5GB 1SQXJ 2ZYGA 2XRQD 2DUDA 1E1TA 1YNND 2AWNA 3V2PA 3N6RA 2DY7A 2WKCA 3CCEA 5HURA 3SVMA 5E7NA 3L70E 1ASYA 3H91A 3RK3C 5I2XA 1SE8A 2HHHL 1NUCA 3L73G 1SEBD 4P74A 2E75B 3OW2O 2K3RA 5ELDA 1R8EA 4DUYQ 3I5CA 4RGOS 1WTRA 1CA5A 1URQB 2PI2A 5CBAE 5E79E 3K5BA 2FMMA 3MAQA 3L75G 1JB7A 2Q2TA 2NPSC 3A2AA 4XA4A 3HP3A 2YTYA 2YO2A 3UDIA 3F2BA 2WV6D 4A93H 2KQ3A 3DWQA 1L0LJ 5D3DA 1EDLA 3TBIB 4IALA 1HJBA 1E2ZA 4BA1I 1I6HH 3UIAA 1QILA 3EVQA 2ICIA 1BE3D 2YTXA 4NMZA 1G1IA 2Q8RE 1PRTB 1ZOYC 1YZ6A 4AUWA 4L75A 1XMOQ 4DV1L 4DF7A 4A93B 1N34L 4D6TJ 1IBLQ 3CCJP 5AW2B 2KI7B 2LXKA 1VQDA 1RTNA 1TWCH 1VQGA 3G48A 2QIWA 3HTKA 5FO9B 3EIVA 3LNNA 2O2LD 2SEBD 1MSGA 3UE1A 4ZAIA 2JDIH 1X3FA 4RKBA 3J81c 5AW4B 4BY1H 5EGTA 1AW7A 3ULLA 5AJ3L 1JMBA 2WPVB 3HOVB 1FJKA 1N2DC 3QJYA 1PP9G 4K2KA 3GTQB 3HD7D 1T2KD 1WI5A 2DNEA 2HIVA 2PZUA 3WU2E 2OYIC 2SOBA 5G3LD 2WWWA 1Q7YQ 3VA7A 2P10A 3Q8DA 3J81j 5IIFA 4DV2Q 5C44B 1GHJA 5C4XG 1DOLA 1Y1VG 2JK8A 4RH6A 4I6MC 1X9NA 2N55A 1XNRQ 2XU6A 1PH1A 3MHBA 3AEBC 3HD7C 1VQCA 1H9KA 3K57A 3VR4A 1GUTA 1TU2B 1KILE 5M3FG 4RGNA 1TWHH 1QL1A 2D9UA 4WY4C 2MPMA 4R4IA 4NXNL 1AP0A 3FHWA 2K33A 4R4CA 1WTHA 3HD7A 1LWUB 3BRTB 4PMCA 1JM0A 1MUUA 2QEJC 1U57A 1IZNB 4DGZA 3K6OA 4DUZQ 5AW8B 4X66L 3PP5A 2R7FA 2ZTDA 2Z4HA 1AQTA 5LL6X 3A0HH 5DM73 2UU9L 4JYCA 4M1UB 1S5CD 1QVGO 1M1JC 3U1CA 1VQIA 1PVOA 3MXGA 2MP1A 3J80L 5K36H 1TR5A 3BZDB 3L73D 3SGIA 2ZXXA 3KF8A 4GOPC 1HUCA 5C5MA 1HR0L 3PIO3 3ABVC 3STBC 1N36L 1FDOA 1L4AA 5IYBH 2OYIB 3S1KA 4YWLA 3PO3G 2K5QA 4N9PA 1IFMA 1VS0A 4C3IG 1VL2A 4BWGB 4A3GH 1A6XA 2AEMA 1I4HA 4HIDA 3CX5D 1X79B 2E2JH 2K9YA 1HNZQ 4LF8L 4EX5A 2PO4A 3GO5A 4OGQC 4I1LA 1XTCC 2HUGA 3J80c 1JORA 2PQAB 4HSVA 1KILC 1W5CE 4H0LB 3I4NG 3S17H 2KLUA 4OXPA 3PRJA 3GTMB 3LX0A 4WY4B 3GTMH 3H1JE 4JOIC 3HE4B 3HOZH 1S5DD 1OVUA 3RK3D 3CPWO 1I50H 3CU7A 5IGCA 4JI0Q 1SQQE 1U0LA 1SLQA 2Z6BA 2PCFB 3TYYA 3AE7C 4GN4B 3CI9A 4CGYB 4HIMA 3NBHB 5H1SE 3KXDA 2NRGA 3U58A 1HQMC 4PJ0H 3G71A 1L0NE 1NOHA 1Z9FA 2B3GA 2R92B 2P67A 5AVUB 5KJ7C 2KCNA 3HOZB 4QCLA 4MN4C 2CH4W 1Q1EA 1PRTD 3CRKC 2K7VA 3GF7A 1NTZG 3M7GA 3M4YA 3I3CA 1PLFA 4CPGA 3AE3C 3L74J 1LLRD 3HRNA 4W7YA 1Y1VB 2RDGA 3D4WA 3MVVA 4KV6A 3RD4A 4IFDG 4B3ML 3X3NA 2K1AA 4DR5Q 1SNQA 3L2PA 1PXUA 3EFXD 1SQBD 1G8ZD 2QJYC 2VQEQ 2PW5A 1HGZA 3MA2B 4A3MH 1BSHA 5FLXL 1PGQA 4N78E 2OF1A 4J15A 1R9TB 3MZWB 4WBAA 1HFGA 1Q46A 3PUYA 1AZQA 3L73J 1FNVA 2IFNA 2IL8A 4K6LA 4DR7Q 1BCPC 4R4OA 2WSFH 2F0TA 3F2UA 4FVMA 4LAAA 2QM7A 2G3AA 3PHLA 3JAMi 2RN0A 3A8IE 3HOYG 1FAVA 3TZDA 1NO4A 3AE9C 2L1BA 4A3IB 1Z6HA 3QWOC 4U3FJ 2D2CC 1WD0A 1SQPG 1SQXE 2Q3EA 2GVAA 2B9BA 1RHZB 1ZR4A 4RCOA 3CF5A 4A3JG 4Z1MH 1SJED 1N34Q 3P8CE 1FE6A 3RLOA 1YHQP 5M5WH 4PD4I 4A3JB 5E4XA 2PFXA 3A7AB 2YXQB 4X65L 5KEEA 5TJHA 4AH6A 2QJPB 3ND9A 2JYOA 3BU2A 2B29A 1AFPA 1YJNP 2A45I 2HPCB 3AQQA 3EN2A 4YCWA 3A55A 1NH4A 1K9MC 4U7JA 1VQ7A 3PO3H 3WMM0 2O1JA 5H2FH 5B66H 3I4MG 2H5XA 3RL0g 4PV1C 1QJOA 1OTCA 5JAVA 2IYPA 3TZUA 2OCEA 2GUSA 4POFA 3JAME 4DOJA 2AEFA 4Z9CB 3L36A 2QM8A 1JR0D 4KHPL 1K73Q 4L73A 1ZV8A 1S3OA 1CSBA 5KLVE 4WORA 1SQQD 2EXDA 3K8AA 2F0HA 1LT9A 2K9JB 1FZGA 1Q86C 1R4PB 1D5XC 2KCCA 4XYOA 3BASA 3TGUJ 3BCCJ 3RK3B 4IUQA 3MTUE 1GD2E 3A8KE 4ME5A 2FJ2A 1ZR2A 4A3IH 4JBMA 2NN6I 4D6TG 3QB3A 3JAMc 3F2CA 2KHSA 4IUPA 3H1KE 3H32B 2K50A 1HJ0A 3I56A 5IOCA 2KXPB 5IWAL 1LT4D 4LF6Q 3RLNA 5A35A 4FF2A 1BCCJ 1LTSC 2R44A 3D6YA 2KZIA 1IYUA 2A74C 2XV5A 3S9WA 3SDZA 4IFDK 1NAFA 4L5RC 3VYUA 5AVZB 1EQTA 1KRTA 2H1EA 1K73C 1TY0A 5CV9A 1KYOH 2HIXA 4IL6H 3Q22A 1J5EL 3CCLP 3QH9A 2B63G 2K75A 1N32Q 4CDDC 3GMAA 3LIEA 1F9PA 5DAUA 5KYLA 2VB3X 3P20A 1O80A 1L0YB 1VQLP 2K52A 1VQ5P 4WJ4A 2Q6QA 2IX0A 5IWAQ 2LXJA 1HA5A 1DYQA 2J5UA 3DHQA 2MUYA 1WYDA 4RKUJ 2Z1CA 1JY2N 5DEHA 2FMCA 3CKIB 1G6PA 5TISE 1SYCA 1CI6A 4R9WA 5JEAJ 1PA6A 4M8AA 5KLIC 1FVIA 4YCVA 3J7AV 2O3JA 3W1GA 4LFBL 1WTXA 3H6PA 3M3YH 3GG2A 1WOCA 3CX5I 4DR1L 3J81i 5IP7G 3V2RA 4DR5L 4GKKL 4IOIH 1KQGB 3TGUE 3CHBD 1L4AD 4W80A 3NTNA 3PIPA 2WB1B 5B66E 3T16A 2GM4A 1YI2A 3CXHH 3H1HG 2K28A 4OWFA 3M0AA 2I1KA 4GKGA 2F52A 3W1BA 4RHSA 1KQFB 1DGSA 4DV3Q 2Z9HA 3UDGA 2Z6KA 2R32A 4A3JH 1X3EA 3CWBD 1IW7C 3B71A 5I6WA 4A3CH 2XKMA 1B70B 1EDJA 2KA7A 1K28A 2KOLA 3QWNA 2LY7A 1RHPA 2M8RA 2KNCA 4UB8H 1ZXTA 4GN5A 3NSWA 1LWUC 1CSQA 3GF3A 1HWTC 3CMAA 1XYIA 1SFCA 3S1RB 1TWFB 1BBUA 1NVOA 1L1OB 1K9MQ 4A76A 3I4MB 1MFZA 5IP9G 4XIGS 1IYVA 2EYHA 5M3MH 4IFDJ 3SHLA 2MO1A 4DN4M 1NR2A 1HH2P 3PGZA 3KF6B 1VQEA 1F9QA 3K5MA 3CCUA 1GJXA 4P75A 1B53A 4GOPB 1PYSB 4BBRH 4R4LA 2E5LL 4YCUA 4JI3Q 2XN9C 4IJLA 1LT1A 4UB8E 2F3VA 4DZOA 2R6GA 1Q8KA 2IX7C 2WSEJ 1VQKP 2I8DA 5AW7B 2XSCA 3NTIA 4U68A 4OX9L 3IR9A 4QB4A 4IOCA 3E9IA 2HLOA 2QEXP 2C5CA 4A3EG 2WB1G 5D14A 1NTZJ 2R93G 1VQ9A 2OGUA 1HFNA 1SQBG 1OFCX 2OTKE 2YV5A 1BQQT 1KNEA 3MXUA 2RMZA 1JTHB 5C4ZA 3M3YB 3NP8A 3W3AA 1H9JA 4BY1B 2EYMA 1S4XA 3C8VA 4XYQA 2LSSA 3IL8A 3CRLC 4I2LC 4DUZL 3HOUB 3OHXC 2LR2A 1GL2C 5FLMH 2ZM6L 3V6IA 1LT6D 1CKMA 1KFNA 1S4ZA 1PH8A 2R5DA 1TWAH 1ZRTD 5AVRB 4DAMA 2YXRB 3I8ZA 2FYUJ 5B5EH 2OXPA 3H09A 2E8GA 2D0PA 2A6HC 3IFMA 1XNRL 1CTMA 1E24A 2H4OA 4UAIA 1SBBB 5T1GA 1J2JB 2RHQB 4KKUA 1YJWP 1KTKA 1OMIA 4B9WA 2QRXA 3S2DH 2R61A 3A0HE 2A6HD 5DNFA 5IYDH 1YQ3C 5KRUA 4B08A 4JYAQ 4I7ZC 3TGUG 4OEMB 2OEOA 3R4YA 2YNYA 1RE4C 2F0MA 4IN3A 2WAQB 2ZJRA 1SFOH 3V4WA 5C39A 1KC8Q 1PFNA 4PD4E 4X3SA 4X62Q 3RK2D 1O78A 1E7ZA 3L4FA 2KS1B 3ER0A 2YTVA 3KBXA 2K6AA 2QGQA 1HCZA 2UXCL 3HOWG 3B5NC 1NTZK 4GT1A 2N78A 4K35A 3L75E 2HQLA 4EVOA 4A3GG 2B2YC 1FR3A 2SNSA 1VQNP 1UAPA 1JOCA 2HFED 1EZVG 4TQUS 1KXLA 3R2TA 1LUZA 1E22A 4KHZA 3GTOH 1XWEA 3N52A 1MI2A 4C3JG 4X6AH 1GHKA 4RJTA 1VQBA 4C3JH 2F0PA 2NWGA 2L11A 2BE5C 2UUCQ 3HOUG 3V4QA 1AJYA 3NTHA 4IFDH 1UIIA 5C4HA 1VMPA 1M1JB 4YWMA 4AYBB 2A6EC 3F8TA 1JEKA 3WU2H 3IFTA 1AV1A 1NNXA 3FRPB 3VN0A 2QW7A 1MSHA 1W3SA 1K8OA 2R93B 3L72D 1EL0A 1YITP 3L73E 1NTMJ 4JI8L 3CMEP 2QJKC 1ESRA 1PZID 5AVSB 5JEAG 4DK3C 1YQ4C 3KJOA 4JVZA 4JI1L 4I7ZB 2ZM6Q 1YJNA 3BCCG 1BUVT 1JMCA 4DU9A 2P2UA 3MFYA 2PPBC 4KY7A 3AE6C 1N8RC 4GOFA 3C1FA 3B5NA 1QOHA 2L9HA 4GLAC 4A75A 1Y1VH 3HOXH 1LT9B 2B8FA 1A3TA 1N33L 5I9OA 2BH2A 4CDFC 4K0KQ 1JY2O 3OJAB 2JXMB 2F0WA 3CW2C 3ULPA 1RF1B 1CI3M 4APVA 2QCPX 4I65A 4DV1Q 1MJEA 1WD1A 2IYOA 1IO4A 4FNFA 5AVTB 2F0IA 2FXMA 1EYAA 5GAGC 3M0DC 4HJ5A 1XNQL 2VUMB 5AW1B 1VMCA 4LF5L 3KDFB 4ASVA 2ENBA 1MJCA 1S72A 5ELNA 3HUSB 1CQFA 1EY5A 3NEMA 4O0AA 1S5FD 5KLVK 2Z4EA 1M8AA 2MO0A 1T8ZA 1PDQA 1MD2D 4DV4L 3L71G 1SQPD 1GU4A 1FGBD 2QJYB 2A45H 4UP9A 2NPSB 5J3BA 3CCQP 3K59A 4XFJA 4OL7A 2LS01 4DK0A 3SR1A 4ZRZA 1B1ZA 4H44D 2NVXB 3H1IE 3F2DA 1NTKG 1JCKB 1FC2C 4K5VA 2K05A 3RL0B 1BGYG 1UE6A 1SQPE 1SQXG 3BRVB 3IKJA 1DEBA 2L12A 1NTMD 5GTHH 5JVH3 1CZGA 1PFMA 4K8IA 1O7IA 1KAAA 1HH0A 4XTCS 4BY7G 1LTBD 2Z5IA 5FO8B 2B87A 2FXOA 2H8PD 4HB1A 1P16A 1VF5D 1QZHA 1L1OC 4GZYC 1L0LK 1W2BA 3EFGA 3L72E 3WOFA 5EKKA 5HGTA 3HOZG 1YBYA 4J1MA 1G6ZA 2NVQH 1JWUD 1Q90A 2NTSA 4IUNA 1KYOE 1RD9D 1KABA 3NE5B 2N1TD 4R4MA 2JA8H
chains in the Genus database with same CATH topology
2KBNA 1OWAA 1LTBC 1N7LA 2CPBA 3NMDA 5AW5B 4DV7Q 3LGJA 4BBSH 3P7KA 1NJIC 3S2HH 5LMNW 1YJWA 4P72A 5GAEC 3RL0C 4B3SL 1RL2A 2BA1A 2D0OA 3E1IA 1IJDB 5C4XH 4DV6Q 3ICEA 1ZN5A 2XGTA 4HYTB 1NMFA 4DV2L 4O9BA 4O2DA 3KF6A 2VRSA 3MXNB 4HJ7A 4Y7NH 3U1AA 3NFQA 2GN5A 4JYBA 3HOVH 1QZGA 1V9PA 1BBWA 5IYCG 1SQXK 5KJ7A 3RNUA 3VYIA 1N7SC 4IFFA 3TSIA 2UXBQ 1X65A 3CCQA 1M7LA 2CWPA 4PZ7A 4JOIA 2XZRA 3TRZA 3M9QA 3G6EA 5KJ7D 2W6AA 3GDEA 1C7YA 2CCZA 4HJAA 1IK9A 1RE4A 4A93G 1RF1A 2VY3A 1KILD 1L1OA 4LF9L 5LMUL 1LTAC 1HR0Q 3RK2C 4K0KL 4KHPQ 1SP4A 1LTGC 2Y0SE 3HKSA 4OX9Q 1GVPA 1Q82C 3STBD 4DPGA 4LUOA 1RF1C 4A3BH 4L5SA 1GKHA 1I5FA 2E2HH 2CWAA 2JA9A 1KFMA 1K83H 3PUZA 1JNMA 4DK6C 5APQA 1R9TH 1N73B 1ASZA 1V1QA 3GHGA 2PNHA 4AIMA 2UXCQ 4OWWB 1OXUA 1KRSA 1J1DC 4JI5Q 2JA7G 5CCGA 3HOXG 2ZFCA 4DR4L 4IFMA 1MZ9A 5C0XI 3KF8B 2UUAL 2AKWB 4GN3B 3PUVA 1JCCA 2K4KA 2QA4A 3K7UC 2WTYA 3OTOQ 2JA5G 3KYQA 4IOAA 2MJZA 3BZCA 1SQVK 4JI4L 1FZAA 1FL0A 1M90C 1XPUA 2ID0A 2UXDL 2KCMA 4NXMQ 1L0WA 1Z56A 3D31A 1IBMQ 1S9KD 1EWIA 4UPAA 1A8VA 3II6A 1UE5A 2R93H 4PZ8A 2W6BA 1JTHA 1JE5A 2WB1E 2IPPA 5BR8L 3ERSX 4OWTB 2NPSD 2YKPA 4JI3L 1QVGA 1A02F 2C9NY 3T1YL 5IYBG 4MNOA 4BY1G 2OQKA 1L4AC 4DV5Q 1XJVA 4ME3A 4ZKPA 3PV0A 1FZCA 4QGUA 1JUNA 3PUWA 4AYBG 2IT1A 5CMZA 3CCLA 4DR4Q 3J7ZC 3MIWA 1SFCD 1SQBK 3OA7A 3CC4A 2HYNA 4BY7H 1UE1A 2VL6A 2P1JA 4GKJL 1URQA 2VQFL 2OYHB 4RMFA 1GM5A 1URQC 3A5UA 3K80C 3AEVA 2UXBL 1HNWQ 1HNXQ 5AW3B 5CCHC 1CW5A 3OTOL 3HE5A 2CKZB 4JF7A 1LWUA 1VQKA 5AW9B 5GAHC 2CFMA 1HZCA 2KHJA 3GTJH 4DNIA 5IP9H 1NBWA 2KP8A 1GU5A 3O8ZA 1WRGA 1KHIA 1VQHA 3HOUH 3S15H 1MKHA 3RK2B 4LF7Q 4GLXA 3OW2A 2D62A 5EAYA 3VMXA 3KDPB 4JC0A 4JI2Q 5AVXB 1X9VA 1I3QH 3E0EA 3KYHC 2POHA 1PH5A 2AMCB 3S1RH 3S24A 3OAKA 4TVAB 4IJHA 1M1KC 4PZ6A 4YY3Q 4HJ8A 3OYYA 1JY3N 4LFAQ 3G4SA 2IFMA 3A5ZB 2H7HA 1RIPA 1G2CB 4Y99C 1EFWA 1K3RA 1PH7A 2F3IA 1HTLC 1YNXA 1JT8A 3AFQA 3CP0A 3RLFA 1G1JA 4QL5A 4GLVB 5C3EG 1IFNA 3H3VH 1HBWA 1X8YA 4DV0L 3JC66 2PAJA 3S14H 3EQ2A 5C4JH 4JI0L 3K0XA 5LMNL 1PH6A 5C0XG 4Y52H 5CCHA 3HKZG 1Y1WG 2WT7B 2R7ZH 2UUBL 3GHGC 2L15A 1YJ9A 1OXZA 1YITA 1LM0A 1T3UA 2I1JA 1FGUA 5KTBA 3S1QH 2MQHA 4A3KG 2QEXA 1IXRA 1HZAA 1I94Q 1WFQA 2WSEH 1NTKK 1FZFA 1FZCC 1EIYB 3NXSA 4BBSG 1X3GA 4LC1A 1VQNA 1CI6B 2OTJA 3T1YQ 1X6OA 1HNWL 3J7A5 5AVYB 2IY5B 2KYVA 1J1EC 4R4QA 5HGQA 1EQQA 4AYBE 1QVFA 4C7NA 2I0QA 4RESB 3N7NA 4A3DG 1PH3A 2ZTEA 1VQAA 2DGYA 1AQ5A 3UDFA 1A63A 1D8LA 4WY4D 4JI7L 2R92G 4C46A 4BXXH 4IFDI 3ULJA 1IL2A 2FYUK 2M3BA 4LFAL 4XE5B 1K8GA 2Q2HA 1TXYA 3CXCA 3HOYH 2C0WA 4NPSA 4WJ3M 1FU1A 1NU1K 1L4AB 1T2KC 4LF8Q 1QVCA 1LTJC 2KSJA 3PUXA 2O1KA 3PCOB 4LW1A 3V5BA 2PMZE 3GTKH 4DV6L 3HOVG 1RY3A 2N1TA 1TWFH 1GD7A 4JBWA 5GADC 3M4OH 5CCGD 2K5HA 4YY3L 3VDYA 3TNUA 2N9BA 3CMEA 5K36G 4OH8B 3GTGH 3B6YA 2HODB 1XTDA 4GNXA 5CJ0A 2NVXH 3U50C 2HT1A 2UXDQ 1MV8A 2Q3IA 4FDBA 1YTZT 4B3TL 2HPCA 4UP8A 1N33Q 1JO5A 2JA6H 3A7OA 2ATWA 4HH2A 4AQYQ 1IFJA 1I94L 1P8LA 2UUAQ 4C2MH 2VUMH 2GUVA 2E43A 3UE0A 4A3EH 5APWA 3B8EB 1PH4A 4X62L 4ALPA 3A74A 1UWVA 4JI7Q 3CC2A 4BBRG 3MD0A 2BA0A 5DLQE 1UEBA 3FP9A 4WY4A 1NHLA 3SWFA 1YHQA 4KHXA 1GL2A 1XPRA 3T1HL 1JJGA 2JE6I 2OQ0A 4UP7A 1N7SD 2CPSA 1E1OA 2OTLA 2J59M 2GVBA 1MIUA 2N8NA 3BATA 1Y14B 3S1MH 3K7AH 3V2QA 1RF0A 4IPDA 2UU9Q 4C7RA 3PF5A 2I5HA 4LF4L 2FYZA 3ZJYC 2ZTCA 2O01H 3CCRA 3RL0D 2WP8J 3KJPA 1HJPA 3TEHB 3P8CD 1PH9A 1RE3A 2P7JA 3TREA 2AHOB 5M5YH 4YHHQ 2JEEA 2KENA 2RHSB 1J1EB 2EQSA 1LTJA 1VQ6A 2WFWA 3HUSA 3KFUA 4X65Q 5CCHD 1LGHB 4N78D 2N1TC 5AVWB 4JCVE 1GW4A 1JY3P 2VQEL 2JA6G 4YHHL 1U5KA 4LF4Q 2YO3A 1SN8A 2FFDC 1VPCA 4JI6L 1KIXA 4EQ5A 2IHFA 1G51A 1FOSF 4GKKQ 1KQLA 4LUVA 3CCVA 3CAMA 3BZKA 1CSPA 4HJ9A 1PFIA 5IY0A 4R1JA 5APYA 2RF4A 3PIOA 2JA7H 2WT7A 3A0JA 4DR6L 1VQLA 1GTWA 4JI4Q 2YYZA 3CCJA 3P32A 1M1JA 1WT6A 4PG3A 4Y99B 2YKQA 2MNAA 1FJPA 2JA5H 5M3MG 1PHJA 3RN5A 3HE4A 4LFBQ 1X55A 1S40A 2W27A 5LMUQ 1JJCB 2C0XA 1D7QA 4P71A 4IPGA 1A62A 3HOWH 3WWVA 4B3RL 4DV5L 3L7ZC 2Q9IA 1VDFA 1Q7YC 1NY4A 1NKNA 1BVSA 2Q7CA 1NTMK 4QJFA 1NKZB 1AE3A 5HY6A 4GNXC 4JV5L 2R5BA 2WITA 1FBMA 1AFOA 2FFDA 2C9LY 2CQOA 3RR5A 1V43A 4A3BG 3VMZA 5APUA 1EYGA 2ZJQA 4MTNA 2NVTH 1GO3E 4DV7L 2Z6KC 1B8AA 1E3PA 5FJ8G 2Q2IA 2A8VA 3B5ND 4PMWA 2YU9H 2N49A 1OXTA 4N3YB 2OYHC 3A3YB 2AWOA 1NE3A 4DR1Q 1SLJA 1DX7A 3DLLA 4W7ZA 2LKMA 3CCSA 1RE3C 5JJIA 4B3TQ 3KOJA 4AQRD 1KL9A 4OWXB 4X64L 1Q12A 1VCIA 1JMMA 3VOPA 2I5MX 4JI8Q 3KDFA 1W2EA 5LMNQ 1VQ8A 4DR2Q 1PYBA 1J6QA 1GL2D 4OO1G 1B7YB 1ZLLA 4DR3L 4X64Q 1Z47A 3LIDA 3KPEA 4LLHA 3VTPC 3L37A 2R7ZG 4N6JA 3M7NA 4DR7L 1H8AA 4WB4A 3M4PA 4B3RQ 1NMGA 3AYHB 1VQOA 1HVVA 4QY7A 1G291 4B3MQ 1YTZI 3M91A 3CPWA 4A3IG 1OXXK 1K8AC 2YMYA 4JYAL 2JA8G 5ELOA 2Z5HA 5AVQB 2Y0SG 1KAWA 3CLQA 1FJGQ 2C35B 3K81C 3TQYA 4GIFA 4GS3A 2NN6G 1EIFA 3RZDH 1SR3A 4LF5Q 1J5EQ 3PSIA 1H95A 4ZKUA 5IE8A 1GK6A 3VP9A 1CKNA 2Q5UA 2MFIA 1Q1BA 3GTPH 4JG2A 1T3JA 2R92H 3PO2G 2JJQA 2K5NA 2JEAI 2R3CA 3DM3A 5FJ8H 4MZ9A 2FXQA 3I4OA 1BKBA 3P8MC 1VQPA 2PQAA 4POGA 4DR2L 1N9WA 1UE7A 1CUKA 1GK4A 1SRUA 2A45G 1Y1WH 1H88A 5AVVB 2NPSA 2ALYB 2KLVA 1N7SA 2VNUD 2UUBQ 2F4VQ 3CC7A 2UUCL 2A1AA 3A5TA 3HFZB 5JJKA 3M85A 5IYDG 3HD7B 3CL3D 4A3KH 1AH9A 2RCNA 2I5LX 2Q2UA 4YWKA 4BA2I 4DV0Q 3U59A 2KHIA 3I4MH 5BU8B 1GL2B 4NXML 1TWGH 3T1HQ 2XDJA 1FZCB 1FJGL 1RF0C 1XMQL 1HGVA 4A3LH 2ES2A 4P73A 3B5NB 4DV4Q 5AJ3Q 3MUDA 4A3CG 1VQJA 1JY3O 2HHHQ 4LF9Q 4HIKA 1N36Q 2WSCH 5C44G 4DUYL 1XTGB 1EQRA 2PP6A 1X54A 4A4IA 5APTA 2VUMG 2Z0SA 5BU5A 1JJ2A 3GTQH 3R2PA 1DH3A 1AE2A 4L5QA 2HODA 4LUZA 1LTTC 2A19A 3GD7A 4GOPA 4JI2L 1EOVA 3BJUA 4BXXG 1SVFA 3BVHA 1QL2A 3FKIH 1LT9C 1YYCA 4EOTA 1QUQB 1H89A 2IHEA 4DR3Q 2E5LQ 5APVA 3H0GG 2KCTA 2BASA 4LF6L 1KC8C 5AW0B 1VQ5A 3VP8A 3RZOH 2OWOA 4R4TA 1K0RA 1HZ9A 3G3ZA 4UY8C 2F4VL 4RG1A 1GW3A 3L0OA 3I55A 1OXVA 4C3IH 3I7FA 2ZXEB 1SQQK 1IBKQ 3TS0A 3VMYA 5BR8Q 4A3LG 1PFSA 1T9HA 1QUQA 3AFPA 4C3HH 4JI6Q 1OXSC 4A3FH 4IO9A 1FZBA 3HUSC 1WCMG 1LTLA 1IBKL 2N3SA 2FKWB 2E42A 5CHXA 1X56A 4LGDE 1IBML 1HZBA 3PO2H 1C0AA 3F1ZA 1HNZL 1C9OA 4IPCA 1G2CA 1WCMH 1EQ7A 4OONA 4LFCL 2ZJPA 4KI0A 5AW6B 1SFCB 5CCGC 3FKIG 2YKOA 1SMXA 3HTKB 1KILA 2PI2E 3L35A 5FLXc 1GZLA 1KZUB 1HNXL 3PF4A 5C0XJ 1GDTA 1YEZA 1VQFA 3J80i 4GKJQ 4QIWE 2B63H 3SWYA 2VS1A 1PV4A 4DR6Q 2K14A 3TS2A 5IYCH 3S16H 3TNUB 1FOSE 2KB7P 1YHBA 5IT9c 1CKOA 2XNXA 3H3VI 4EIJA 3T97A 2N1TB 3NENA 1N7SB 2WPSA 2WPQA 3M9BA 3MEFA 2WAQE 5M5XH 4LWCA 4DKAC 1VQMA 1IFIA 4AYCA 5IP7H 1S9KE 4OO1I 4JBJA 2NZOA 4M3LA 4JI5L 1A02J 2ASBA 1FZEA 1SROA 2OYIA 3GTLH 1XMOL 4B86A 2J58A 1HR0W 1L2FA 1PH2A 1IFDA 4KLKA 4NB3A 1L0NK 2WPRA 5FLMG 3M9HA 3GHGB 3W5OA 5M3FH 2FFDB 3V2NA 3M0DA 3IRBA 2R7DA 4JV5Q 5GROA 1JY2P 3H32A 2WAQG 3I4NH 2VZAA 2JQOA 3H0GH 5GQOA 5C44H 3M06A 3RN2A 3CQZH 3CPFA 4C7NB 1CZQA 2VW9A 3S1NH 4DAYB 3HE5B 4H02A 3UDXA 5APSA 3C9IA 2OYHA 1EUJA 4X66Q 1E5WA 1J1DB 2BH8A 1N32L 2IX1A 4LNQA 3HKZE 2NVYH 3KQGA 2NZHA 1IYJB 3D0FA 1JCDA 5APXA 1IZ6A 1WJJA 1N73C 3CCMA 2WZ7A 4DV3L 1SQPK 2V1CC 4QQBX 1KQSA 4A3FG 1KILB 4LFCQ 1LYLA 2EIFA 4A3MG 4GNXB 1VQ4A 2HG5D 1IC2A 4IPHA 2OARA 5BVZA 1IBLL 4HIOA 1XPOA 2E2IH 2H43A 1NTGA 4L5TA 2KOGA 4JI1Q 3M4QA 1YHAA 1N73A 1XMQQ 4B3SQ 3KLWA 2JJLA 1LTJB 5CJ4A 1KD1C 4A3DH 4NXNQ 3NELA 3E9HA 1NWQA 1N86A 2VQFQ 3EBEA 2JEBI 3U4VA 1URQD 3TK1A 1YIJA 1FDMA 3U4ZA 3LW5H 1A0IA 3MGNA 1YVCA 4JBKA 4LF7L 1XNQQ 3I2ZA 5C3EH 1CKNB 3H15A 1Q81C 3N4XA 2K5VA 1LTIC 1SFCC 4AQYL 2XTIA 2L5GB 2DUDA 1E1TA 2AWNA 3V2PA 3CCEA 1ASYA 5E7NA 3RK3C 1SE8A 2HHHL 4P74A 4DUYQ 3I5CA 1URQB 2PI2A 1JB7A 2Q2TA 2NPSC 3A2AA 4XA4A 3UDIA 2YTYA 2YO2A 3F2BA 4A93H 1HJBA 4BA1I 1I6HH 3UIAA 2YTXA 1G1IA 1YZ6A 4AUWA 1XMOQ 4DV1L 1N34L 1IBLQ 5AW2B 2LXKA 1VQDA 1TWCH 1VQGA 3G48A 3HTKA 3EIVA 3UE1A 1X3FA 3J81c 5AW4B 4BY1H 3ULLA 5AJ3L 1FJKA 1N2DC 3HD7D 1T2KD 1WI5A 2HIVA 2OYIC 2WWWA 3Q8DA 3J81j 4DV2Q 5C4XG 1Y1VG 2JK8A 1X9NA 1XNRQ 4I6MC 2XU6A 1PH1A 3HD7C 1VQCA 5M3FG 1TWHH 1QL1A 4WY4C 4R4IA 4NXNL 3FHWA 4R4CA 3HD7A 1LWUB 3BRTB 1MUUA 4DUZQ 5AW8B 4X66L 3PP5A