3M9BA

Crystal structure of the amino terminal coiled coil domain and the inter domain of the mycobacterium tuberculosis proteasomal atpase mpa
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
186
structure length
186
Chain Sequence
SARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQPPSGYGVLLATHDDDTVDVFTSGRKMRLTCSPNIDAASLKKGQTVRLNEALTVVEAGTFEAVGEISTLREILADGHRALVVGHADEERVVWLADPLIAEDLPDGLPEALNDDTRPRKLRPGDSLLVDTKAGYAFERIPLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding-induced folding of prokaryotic ubiquitin-like protein on the Mycobacterium proteasomal ATPase targets substrates for degradation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Chaperone
molecule keywords Proteasome-associated ATPase
total genus 31
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16450 Prot_ATP_ID_OB Proteasomal ATPase OB C-terminal domain
A PF17758 Prot_ATP_OB_N Proteasomal ATPase OB N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3m9bA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m9bA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m9bA02
2WPQA 1HZBA 3RLNA 3TEHB 5FLXc 3HOWG 4XE5B 3KDFB 4JI6Q 3G4SA 1HZAA 4QL5A 4LFAL 4JI5L 3VDYA 2NVTH 4KHZA 2YO3A 4HIMA 3K7UC 2WB1G 3H0GG 1C0AA 5APVA 1MJCA 5AW5B 4JOIC 4L5SA 1FAVA 3NTNA 3MXNB 3I4MH 4X65L 2Q2UA 5AVRB 1Y1VH 1CSBA 2YNYA 5AW1B 1SR3A 4OWWB 1FJGQ 3KFUA 4TVAB 3S1QH 3RNUA 5APXA 2KCTA 3UDXA 1J6QA 4A3FG 4B3ML 1GTWA 3GDEA 4JBWA 5IY0A 1VQHA 4IPCA 4Y7NH 1X54A 4BXXH 1I3QH 3G48A 4C3IH 3PUVA 2YTVA 2CKZB 2K5VA 1EYGA 4J15A 1VQCA 4PZ6A 4LFCQ 4LF4Q 5GAEC 3U4VA 1HNZL 3CPWA 1QZGA 2XTIA 5M3FG 4GKJL 4BBSG 1Q1BA 2HHHQ 1TXYA 3GTQH 4OO1G 1IBML 3J81j 1E24A 3HKSA 3M4QA 2C9NY 3TYYA 5LMNW 3A5ZB 2UXDQ 4RG1A 5AVZB 2ZJRA 1XNQQ 2IHEA 4DR6Q 1WFQA 1X3GA 1VQ7A 3JC66 4QIWE 4BBRG 4A75A 1QUQB 1E7ZA 1YVCA 3TREA 5C3EG 4B3TL 2XV5A 1GU5A 1WOCA 3J80i 2ZM6L 1CI6A 3K8AA 4P73A 1KQSA 2I0QA 2WAQG 4QY7A 3GTOH 2UXCL 2UUBQ 4O0AA 1HNWQ 3CXCA 3LIEA 2HT1A 3CD6A 3M91A 2R7ZH 3HKZG 4A3MH 4LF5Q 4DK6C 5AW9B 1PH3A 4K0KL 4QJFA 1BBUA 3Q8DA 1Z9FA 3AYHB 4IJHA 1L2FA 4DR1Q 1K8AC 2UXBQ 5JJLA 5JJIA 3RZDH 4LC1A 4X62L 2Y0SG 2Z6KA 1AE3A 3VMZA 1VQEA 1PFSA 1CUKA 1HJPA 3UDFA 4HJ7A 3VMYA 4IFDG 2QA4A 4BA2I 2JA6G 3I55A 1TWCH 1VQIA 1YNXA 4A3DH 5C4XG 1PV4A 4R4IA 1MIUA 4AQYQ 4JI0Q 5AW7B 3S24A 2BA0A 3LIDA 3M4PA 3JAMi 4A3JG 2K75A 1CKMA 4DV4Q 1VQ8A 2IPPA 1PH5A 1YHAA 1XNRQ 3M7NA 4HIKA 5M5XH 3M0AA 2VL6A 1VCIA 2JE6I 3T1YQ 2EIFA 2N3SA 4DKAC 4PZ7A 1K3RA 3ULLA 4DPGA 4GT1A 2Q3IA 1IBLQ 4NXMQ 4LF8Q 2UXBL 4PMWA 1Y1WG 3W1BA 3H15A 4JI2L 1YI2A 1JJ2A 3KJOA 3L2PA 2W6AA 1TWGH 3G6EA 2Q2HA 4HJAA 4LF4L 3S16H 3PCOB 1L0WA 3S2DH 4KI0A 4H02A 1NY4A 3GTJH 1N34Q 1BVSA 4YWKA 1AH9A 5APWA 4DAYB 2H5XA 5C4XH 2IT1A 2HQLA 1HNXL 4IOAA 3W5OA 4GLVB 3UE1A 1R9TH 4AIMA 4DR6L 1KL9A 2NZHA 4KHPQ 4JI7Q 1SRUA 4OO1I 2A19A 1QZHA 1IBLL 1K9MC 1LM0A 2IX0A 3KDFA 1EUJA 1ASZA 3PF4A 3BU2A 2E2IH 3E9IA 3PO2G 2D0OA 4GOPB 2R7ZG 1X8YA 4DZOA 1IBKQ 2UUCQ 2N9BA 4X65Q 1Q8KA 1VQBA 1YITA 2JK8A 4AYBE 1YYCA 4DR2L 1VQ5A 2VS1A 3PSIA 1KRSA 4PG3A 2LXJA 2B63G 2CWPA 2R7DA 2XGTA 1B8AA 3M06A 1OXXK 3HOYG 4RMFA 3HFZB 3B6YA 2VY3A 2E42A 4I6MC 3RN2A 4A3KG 4UY8C 5AVXB 4A3BH 1Q12A 2EQSA 4LW1A 1IBKL 5LMNQ 2VUMG 1MV8A 1Q1EA 1RL2A 2OQ0A 1J5EQ 1TWAH 5C0XG 4DUZQ 3T97A 1N36L 4APVA 5APYA 3A5UA 3U58A 1CI6B 1E3PA 4DV6L 1K0RA 2JA9A 1SE8A 1CSPA 4A76A 3T1HQ 3L0OA 3PF5A 4C7NA 3NEMA 1HR0W 1JJGA 4DV2Q 3HE4B 2JA8H 2R92H 3J81i 4A3FH 2PNHA 4IPGA 4DV7L 1PH9A 2E8GA 1A02F 4DR7Q 4JYAL 5C44G 5AW6B 4A3IH 5ELOA 1HWTC 2C35B 3U4ZA 5AJ3Q 3NXSA 1WCMH 3S1NH 5IT9c 2AWOA 1CKOA 2KENA 3GD7A 1V1QA 4R4CA 5LMNL 1YJNA 2YU9H 3S1MH 5C4JH 3ZJYC 4DV0Q 5K36G 4DV1L 3F2DA 3KLWA 3NELA 4LUOA 4IFDI 1GK6A 1E1OA 4UP7A 2Q5UA 5APQA 1XMQL 4OX9Q 1GM5A 2H7HA 1HBWA 2YV5A 4IOCA 1WJJA 1NE3A 5CMZA 3AFQA 2E43A 1VQGA 3G71A 3CCRA 4DUYQ 1XMOL 1XPRA 4A93G 5C44H 3HOVH 3HE4A 1D7QA 1Y14B 4DR2Q 1I5FA 2WPSA 1SFOH 4JYAQ 2MFIA 2UU9L 3TS0A 1PH7A 1VQ6A 2JA8G 4QQBX 4X66Q 3I4NG 2CQOA 1G291 3CC7A 1Q81C 3TNUB 1PA6A 1X65A 1VQKA 1QVFA 4POGA 4JI4Q 1LTLA 4JC0A 2VQEL 4JI2Q 3S15H 1A63A 3I4NH 1VQ9A 4ALPA 4B3TQ 2VUMH 3KF8B 1NBWA 1SROA 4L5RC 5AW0B 1JMCA 2ZFCA 4A3KH 5LMUQ 3HOVG 1KQLA 1YEZA 4DK3C 1X56A 1KRTA 4DR1L 4HIDA 3FKIH 4RESB 2Q2IA 4YY3Q 3OTOL 1HNXQ 1O7IA 2MO0A 1S9KE 2NN6G 4L5TA 5IWAL 3CCMA 3S17H 4DR4L 1V43A 2E2JH 3STBD 1N33Q 4JI3L 4GKKQ 2B63H 3P32A 4DV2L 4X62Q 5IP9G 1S72A 3V5BA 3MD0A 2FXQA 1B7YB 2E2HH 4JI4L 2R5DA 1GO3E 3HKZE 4GN3B 1K83H 1PH2A 3PO3H 2R5BA 4A3LH 3HOUG 1WCMG 5J3BA 4QGUA 1YBYA 4NB3A 4JI1L 4GOPA 4A3IG 1HR0Q 2OTLA 2WT7B 1XNRL 5JJKA 2JJLA 1Z47A 3KOJA 4YWLA 5GAGC 1OXUA 5IE8A 5C0XJ 4DV0L 1IBMQ 2R92G 4JI6L 4DV3Q 4A3EH 2RCNA 4HJ9A 1XMQQ 1EOVA 1HH2P 1KXLA 2WB1E 4NXML 3CPFA 5APUA 1SMXA 1T2KD 2BASA 4KHXA 2OTJA 4A3CH 1UEBA 1SP4A 2KHJA 2HIVA 3CP0A 5FLMH 3CAMA 2UU9Q 1GU4A 2R7FA 1X9NA 3B8EB 2IX1A 3ICEA 2K50A 4XTCS 1I94L 4X64L 2KHIA 4B3MQ 3SWFA 3L36A 5IP7H 2JEAI 1UE7A 4JBJA 3GTMH 1Y1WH 3GTGH 2F3IA 1NWQA 2MNAA 4GLAC 3F2CA 3M0DA 1OXZA 2VQFL 3RLFA 1IYJB 3CCUA 1Q82C 1GD7A 2JA5H 3VTPC 3KQGA 3EN2A 1IZ6A 4OWTB 1W2BA 4C7NB 3EBEA 1MUUA 4NPSA 4O2DA 3S2HH 3GTPH 4A3JH 5LMUL 1JB7A 4LUZA 1X6OA 4YCUA 4YHHL 3HOYH 4AUWA 1JJCB 3RLOA 2A8VA 3KJPA 4B3SQ 4A3DG 1SN8A 2PQAB 5IWAQ 1HZ9A 3NBHB 1VQOA 5EAYA 1A62A 3K81C 3S14H 2HIXA 2ZJQA 1VQFA 1YZ6A 4P75A 5AVSB 1X3FA 1K73C 4DAMA 2ZM6Q 4BY1H 1N32L 1JT8A 3M3YH 4A3MG 3K7AH 5IYCG 1C9OA 2NVYH 4JI8Q 1VQJA 3TNUA 4YCWA 4YHHQ 4DR3L 3A5TA 4JYBA 1M90C 3I7FA 1PYSB 5IYDH 1EWIA 4DNIA 3NENA 4GN4B 1YJ9A 1YJWA 1IL2A 3GTKH 3E0EA 2B29A 3KYHC 4C3JH 1NTGA 1PYBA 3ULPA 3H3VI 1E22A 1FGUA 1GKHA 2N8NA 4L5QA 4C2MH 5IP7G 4DV7Q 1L1OA 2RF4A 4B3RQ 4GLXA 1KIXA 5AW4B 3PUYA 3E9HA 2WFWA 3ULJA 4HJ5A 2DUDA 2YYZA 1CKNA 2VW9A 2CCZA 2F4VQ 5AW2B 1UE6A 4DV1Q 4GOPC 1FL0A 1NJIC 3NFQA 2JA6H 4DR7L 2Z0SA 3FHWA 3FP9A 1GK4A 1AE2A 4JI5Q 2UUAL 4I2LC 2B3GA 1N33L 4A3EG 1TWFH 4BXXG 4GKKL 1Q86C 1A8VA 5AVYB 4XIGS 3IR9A 1A02J 4BA1I 3OW2A 4IJLA 1PVOA 2ALYB 1G6PA 4DUYL 1XMOQ 3PUXA 3KF6B 3I4MG 2R6GA 2QM8A 4P74A 4UPAA 4X66L 3HOUH 4A3LG 3H0GH 1K8GA 3NMDA 3TRZA 4DUZL 2ZTEA 1HZCA 5C3EH 4BBRH 4GN5A 4OONA 4EQ5A 3TK1A 4OXPA 4GKGA 3UIAA 5HGQA 4DV5L 2NVXH 1VQDA 3HOWH 3GTLH 1D8LA 3K0XA 2C9LY 4EOTA 3RZOH 4HYTB 4C46A 3AFPA 2XU6A 1I6HH 3HE5B 2KCMA 1XPOA 1QVCA 1PH1A 4LUVA 2W27A 2MQHA 4B86A 3AQQA 3PUZA 5ELNA 2BA1A 2YTXA 4BY7H 2ATWA 2VZAA 1KAWA 3TS2A 4M3LA 2K4KA 1PHJA 4DR5Q 1MJEA 4LF9Q 3AEVA 4JI3Q 3I56A 3OAKA 4YY3L 1SLJA 4NXNQ 1L1OB 4AYBG 1OXTA 4POFA 3J80c 2D62A 4DR4Q 3CW2C 1EIFA 2VQFQ 1RIPA 3RR5A 2E5LQ 5APSA 3P7KA 3M4OH 4OX9L 1ASYA 1HR0L 4PZ8A 2F4VL 2Q7CA 1U5KA 2WTYA 2MO1A 3A74A 2NN6I 3CCQA 4LF7Q 3P8MC 4AQRD 3UDGA 4A93H 4MTNA 2JJQA 3L7ZC 2LSSA 4JV5Q 1HNWL 3A3YB 1YHBA 1XJVA 1VQ4A 3HTKA 1S40A 4JBKA 1P8LA 3CCJA 3CC4A 2F52A 3F1ZA 2CFMA 3CMEA 2VNUD 3L35A 4A4IA 1N8RC 1V9PA 3PGZA 1XPUA 3KF6A 3HOZH 1UE1A 3JAMc 2VRSA 3VYIA 2AMCB 3PIPA 1H89A 1MKHA 2RHQB 3J81c 2HHHL 2LXKA 1NMFA 1I94Q 2WWWA 4R1JA 3S1RH 2K14A 2N78A 2WAQE 3D0FA 3UE0A 4LF6L 4AH6A 2OWOA 4Y52H 1GZLA 5M3MG 2YO2A 1VQPA 2ZTCA 3BZKA 1PH6A 1H8AA 3PUWA 2KP8A 4JBMA 1EQQA 2R93H 2OQKA 2PMZE 2P2UA 1XTDA 4R4OA 4EX5A 3M85A 4ME3A 4JYCA 1N34L 2I5LX 2K5HA 5GQOA 4B3RL 2AHOB 1T9HA 3EIVA 1NAFA 4FDBA 3F2BA 1UWVA 5JEAJ 4A3BG 1FJGL 3M9HA 1GVPA 3LGJA 1FOSF 4UP9A 2XZRA 3WWVA 3MGNA 4C3HH 2JQOA 4HIOA 5APTA 1X55A 4NXNL 4B3SL 4LF6Q 4LNQA 3RN5A 4P72A 2GN5A 5BR8Q 2Q2TA 1N32Q 4X6AH 2P67A 2K52A 1DH3A 4JOIA 1OXVA 2CWAA 4IPHA 3I5CA 4LFCL 3UDIA 3A2AA 5IYBH 5FJ8G 4KLKA 5IYDG 2R32A 1HNZQ 3CCEA 1KD1C 1M1KC 4LFBL 4JI8L 1Q46A 4JI0L 4A3GG 1BBWA 3TQYA 4LF7L 1L1OC 2V1CC 1DGSA 2AWNA 3OTOQ 5IYCH 4AYCA 1QVGA 2YTYA 3H3VH 2JA7H 3PO2H 1MFZA 4BY1G 3HOXH 5M5WH 1CSQA 2DGYA 3I2ZA 2N49A 3HE5A 5E7NA 1VQAA 1EQRA 3V4QA 1FVIA 2JEBI 3K80C 5BR8L 3HOXG 4MZ9A 1VQMA 2AKWB 4IO9A 4GNXB 2PQAA 2UUBL 1H95A 3I4OA 3CCLA 1JNMA 1WI5A 2QM7A 2K5NA 3IRBA 2L15A 4A3GH 4IFDJ 1EFWA 4JI1Q 4IPDA 1N36Q 4GS3A 4DV3L 1LUZA 2D0PA 5GROA 3D31A 5AVWB 4BBSH 4K0KQ 5AVVB 3M9BA 1G51A 4DR5L 3PV0A 1N9WA 2JA5G 2GVAA 3F8TA 5DLQE 3T1HL 1T2KC 1Q7YC 4LWCA 2NZOA 2IY5B 2Y0SE 4DV6Q 4P71A 5AW8B 3BZCA 3V4WA 4UP8A 1UE5A 4AQYL 2PI2A 3CMAA 4OWXB 2A1AA 2UUCL 3KDPB 2WPRA 1VS0A 5FLMG 4GNXA 4X64Q 4A3CG 1OWAA 2QGQA 4YCVA 4HJ8A 1J2JB 1B70B 5AJ3L 4JV5L 1C7YA 1G2CB 4LF8L 2R3CA 1GD2E 4YWMA 3T1YL 2Z5IA 3MEFA 5C0XI 1P16A 1A0IA 2PI2E 3U50C 2I5HA 3GO5A 5M3MH 1CKNB 1LYLA 5GADC 2Z6KC 1OTCA 2JA7G 1PH8A 3SGIA 1BKBA 3CF5A 3CQZH 2KBNA 3BJUA 1I50H 4R4TA 1YHQA 4LF5L 1CZQA 1J5EL 3CC2A 3VMXA 1W3SA 1WYDA 4LF9L 1VQNA 3HOZG 3A7OA 5AVUB 1KC8C 3PO3G 2RHSB 4WJ3M 5IP9H 2WP8J 5FJ8H 2ZXEB 1FOSE 3W1GA 5IYBG 2VQEQ 1U0LA 2UUAQ 3A0JA 4JI7L 3L37A 1NMGA 2I5MX 2IHFA 2ID0A 1JE5A 5AVQB 1HUCA 3J7A5 3FKIG 3VN0A 2OCEA 1E1TA 2E5LL 1S3OA 1KHIA 3CCVA 4DR3Q 3DLLA 2BH2A 1OXSC 5AVTB 4DV4L 5M3FH 2NVQH 4GKJQ 5GAHC 1JUNA 4GNXC 2R93G 2UXDL 2ASBA 2ZTDA 4MNOA 2Z5HA 4TQUS 4LFAQ 2GVBA 3PIOA 2EXDA 2QEXA 1XNQL 3O8ZA 3DM3A 3CCSA 4DV5Q 1YIJA 5HY6A 4R4QA 3STBC 5AW3B 1IXRA 3J7ZC 4WJ4A 1HJBA 2ES2A 4LFBQ 1S9KD 1H88A 1IO4A 1X3EA 3OYYA 2ZJPA 1QUQA 1EIYB 5H1SE 5JEAG 1TWHH 4JCVE 4BY7G 4KHPL 3ER0A 2WT7A 2BH8A 1Y1VG 3ERSX 1PH4A 1VQLA 5M5YH 2UXCQ 1SLQA 4JG2A 2P7JA
chains in the Genus database with same CATH superfamily
5FLXc 2JP3A 4XE5B 1HZAA 4LFAL 2K88A 4UAIA 5C3XA 2YO3A 5KYLA 1L0NJ 1UIXA 4JOIC 3FVQA 2RCFA 3I4MH 1S72P 2OYHB 5AVRB 2F0LA 1CSBA 2YNYA 5AW1B 1SR3A 2NWGA 1FYCA 1FJGQ 3K7AB 4K5VA 3KPEA 2FYUK 2R61A 3TGUG 2KCTA 1J6QA 3E1RA 3UDXA 4A3FG 4B3ML 3J80E 2HUGA 2N1TD 3WUTA 2K1BA 4IPCA 4MHEA 1X54A 3A54A 1I3QH 5L37A 4C3IH 3PUVA 4G7OC 4QUCA 1ZMEC 1JQYD 4LFCQ 1TWCB 4RHRA 2HDLA 5M3FG 1IW7D 3HOVB 1JTHB 4OO1G 1L0NK 3M4QA 5LMNW 4C1NI 1XNQQ 1IFDA 2IHEA 4C3HB 4DR6Q 4C3JG 1B50A 4NPDA 1TIID 1WFQA 3JC66 4BBRG 4ZQ3A 2LMCB 2WQYC 3AEEC 1E7ZA 4PJ0H 5E1FA 3TREA 5C3EG 1JO5A 2ZM6L 1D6EC 4L74A 5HGTA 4QY7A 1OX3A 1SQVE 3H1HJ 2UXCL 1C8CA 4D6TD 3KK7A 3CXCA 2AXCA 4K0KL 1H9JA 4DK6C 1CI3M 2F0IA 3Q8DA 2W8ZA 2JDIH 4XQNA 4Y99B 3TGUJ 2JN4A 4R8NA 3Q5SA 1ICFB 1CUKA 1HJPA 1T3UA 1CFMA 1SYFA 2QA4A 2SDFA 3OIQA 2AEMA 1BE3J 1K05A 4JI0Q 5AW7B 2QJKC 4DV4Q 1L0LG 2IPPA 5M5XB 1QEXA 2D2CB 4KV6A 2HPCA 2RQXA 2EIFA 2N3SA 2PW7A 2UXBL 3ULLA 1IBLQ 4GT1A 4NXMQ 1Y9BA 3H15A 1YI2A 3I73A 1JCCA 1QX8A 2W6AA 3G6EA 4HJAA 3CXHH 4LF4L 3PCOB 1L0WA 2I07B 3G3ZA 4CJ0B 5KGUA 4H02A 2GM4A 1N34Q 2G8YA 1BVSA 3H1HE 4YWKA 1I50B 1S5LE 3C9IA 4KT0J 1HNXL 2ZYAA 2Z4IA 3IAYA 3UE1A 2F3VA 5CBEE 4ASVA 1VQMP 4IFDH 3E3XA 3VA7A 4OO1I 1IBLL 1FZCB 3JCUH 1SQQG 1LM0A 3L74J 2R92B 3BU2A 2AUKA 2O01J 4H44D 3U59A 1EIGA 2UUCQ 2N9BA 3H1KJ 1H9SA 4X65Q 3EFFK 1EY6A 2FYNB 2JP1A 1NU1D 2JK8A 1YYCA 2FJ2A 2QILA 5D14A 1USDA 2DY8A 5KLIC 1WD0A 4PG3A 1KORA 2FYNC 4XDXA 1NU1E 1SNOA 2FINB 1R4PB 1BUVT 3SEBA 4CDFC 5DJUB 2RH0A 2VY3A 1DCZA 4I6MC 3RN2A 1B3AA 3C8VA 5A35A 3ITKA 5AVXB 4R8IA 4A93B 4WRDA 3TGUD 1KYOH 4WVZA 1TS5A 2K04A 1J5EQ 5CC4A 5BN4A 5APYA 1CI6B 1E3PA 3H6MA 1EY8A 1ICWA 2JA9A 2F4IA 5JPMC 3NEMA 3TF5A 2B2VC 2F0KA 3L75J 4DV2Q 3HE4B 2R92H 1IFIA 5IIFA 4IPGA 1JOCA 2E8GA 5H2FH 4JYAL 5C44G 1NTMD 5ELOA 3U4ZA 2C35B 5JJZA 1UIIA 3NXSA 4YPCA 4JPZB 5IT9c 5LMNL 3X3NA 2ZJSE 1OO9B 1V1QA 5C4JH 3ZJYC 3Q23A 3S17B 2G3AA 5M1BA 4F7XA 3F2DA 1BOSA 1V8QA 3VYSA 4ILWA 1HUNA 3CCEP 1XMQL 4WY4D 1GOZA 5FKAC 1GM5A 1HBWA 4CDCC 2NN6H 1STEA 5LL6S 2VUMB 1NE3A 1VQGA 1N73B 3G71A 1BGYG 2FY8A 1D7QA 1NTKK 1I5FA 4JYAQ 3FXEA 4WJWA 2UU9L 1VQ6A 1L2PA 1WCMB 3I4NG 1AA0A 1MKMA 1AVYA 2PW5A 4D6TE 4Y7NB 2F0UA 5LHY1 1B44D 3M4YA 4JC0A 2HR3A 2A45H 2BOSA 3DHQA 3S15H 4Z9CB 1VQ9A 1STGA 2KSJA 1DD4A 2ZT9B 2IX3A 1Q8IA 1OZHA 4L5RC 3OOCA 3PTZA 5J1ZA 2ZFCA 2CH4A 3U1AA 2EXZA 4A3KH 1KQLA 4U7JA 2CW0D 1KRTA 5CR3A 4KD4A 3FKIH 5M5WB 1XTGB 4UHVA 1O7IA 2AEJA 1HNXQ 1SE3A 3CCUP 2YU9B 2I1KA 4H44B 2E2JH 3STBD 5CJ4A 2AEFA 3AB9A 3MVVA 4KD3A 4KKSA 2B63H 5IP9G 4CKCA 3K57A 3C46A 5K36H 4GN3B 3RGUA 1GO3E 2F0DA 2XNDH 1Y8NB 4A3FB 4W7YA 4EIJA 1JY2O 2IYOA 3BVGA 4GOPA 1TWHB 1HR0Q 3PP5A 1PIXA 3TSIA 1XWEA 3QG1A 3GTPB 5JJKA 4DV0L 1IBMQ 1LT5D 2AQ1B 3MZWB 3NUCA 4WWIA 2RCNA 3V2RA 1B53A 4PQXA 5C4HA 4HJ9A 4PJ0E 1AFPA 2WB1E 3CPFA 2EE1A 1IHZA 3R2IA 1UEBA 1P84D 2NPSD 2KHJA 1ZXGA 4L6TB 3A0HE 1X9NA 3B8EB 3BCCG 3K58A 2K50A 2IX1A 1ZN5A 3SWFA 5IP7H 4N8X1 1LT9A 1Y1WH 3GTGH 5ELFA 2MNAA 1JWSD 2IWHA 2VQFL 1M57D 3OHXC 2JA5H 3FWNA 1GD7A 4OGQD 4OWTB 2LKVA 2F0PA 3EBEA 2H4OA 4YCUA 3OA7A 2JSOA 2A8VA 1N2DC 4H44C 4B3SQ 2PQAB 3J81E 4OHJA 2FFDC 2QIWA 1YIJP 2O5IC 3I55P 2PFXA 1JMBA 2KS1B 1N32L 2F0JA 4QIWB 1L0LK 1BE3G 4A3MG 3TP5A 3H91A 2NVYH 4JI8Q 2I8DA 3M9QA 4DR3L 3A5TA 2F0GA 3R93A 5TISE 1JOKA 1EWIA 2JEEA 1VQNP 2HCIA 1YJ9A 3GTKH 2B29A 2G9HD 1TY2A 3ULPA 1FGUA 3EQ2A 3RL0C 2K5QA 2N8NA 4L5QA 4CPGA 1X22A 2FYUE 1L1OA 2Q1KA 2RF4A 4KY7A 3PUYA 1TVXA 2WFWA 5JPNC 1LWUA 1Z7TA 3ULJA 4HJ5A 1CKNA 3A7AB 1OW6A 2O01N 3CCVP 1FL0A 2KOLA 3NFQA 4UDUC 3I72A 3FP9A 1AE2A 2KCCA 3TP7A 1TWFH 5J39A 1Q86C 5AVYB 1M4VA 4BA1I 3R8BA 2POHA 1L0NE 3LNNA 3SHLA 2BCCJ 4CJ2C 3AEFC 1M1JC 3OW2A 1GUWA 1SFOB 3VR4A 3BCCJ 2R6GA 4O42A 4P74A 4UPAA 1AZQA 4RKLA 3NMDA 1KLGD 3TRZA 4DUZL 2BDNA 3CCJP 1HZCA 2A5HA 4UB6H 1WRGA 1BDOA 3TK1A 4GKGA 3HOWH 3GTLH 3M3YB 3U1CA 3QB3A 4K5XA 4L63B 2LR2A 1X3PA 1YI2P 4HYTB 1WTOA 2WMMA 1XPOA 4RKBA 1RCVD 3V96A 3AQQA 2PNRC 1NHLA 4B86A 2RSNA 2LY7A 4HH2A 3FPUB 1KAWA 1RQUA 1FBMA 4FXGC 4LF9Q 3RL0B 4JI3Q 2B8GA 3OAKA 4EQNA 4PD4H 1GL2C 1QVGO 5ELDA 5C5LA 3VR2A 1LTTC 1EC5A 2HG5D 1RF1A 1IJDB 2BEZF 1RIPA 2VQFQ 3P7KA 5KKZC 3I4NH 5E79H 1Z56A 3CRLC 4ZAIA 2WZ7A 4YXDC 1FZCC 1AFOA 1GUNA 1U5KA 4OELB 4LF7Q 4GOFA 3P8MC 1Y47A 1F2ZA 3MEHA 3E6ZX 3CMEP 4JV5Q 1G1JA 3J7AV 3P1HA 4MN3A 2K9YA 3KYQA 1VQ4A 3HTKA 1S40A 3CCQP 5KLVG 1NTZG 2RSOA 2F52A 1M1JB 4A4IA 3LX0A 3PGZA 5KLIB 4DAVA 1RF1B 1ZW0A 4PV1B 1MKHA 3TSSA 2IZ1A 4H13D 3C1EA 1I94Q 3BRVB 5JEAH 4R1JA 3A8JE 2EYMA 2K9JA 2JR8A 2WAQE 4LF6L 2O5JC 4Y52H 1GZLA 2YO2A 5CHXA 1PH6A 1H8AA 3QWOC 2XWBB 2KP8A 3SWKA 2PPBC 3W67A 1M56D 2OQKA 2PMZE 2R93H 1XTDA 2BCOA 4EX5A 4ME3A 2M0BA 3F5HA 5KNDA 2N1TC 1YITP 1FDIA 3S1QB 1I6HB 1VQ5P 3F2BA 5GTIH 1FJGL 3M9HA 4C3HH 4BRYA 1EYAA 1ZOYC 1HQRD 3RK3B 4LNQA 2YIUB 1M7LA 2E75C 2KXPB 2GN5A 2AXTH 5KEEA 1Y1WB 4X6AH 4JOIA 3TP6A 1N7SD 3A2AA 3N6RA 3L74E 5JVG3 4I1LA 2R32A 3CCEA 1KD1C 1M1KC 3S9WA 1RH5B 1BO0A 3AEDC 1H9SB 1W2EA 3OTOQ 3CHBD 5DEHA 5IYCH 3NQIA 3RK2C 4AYCA 2YTYA 2SNSA 5KTBA 2JA7H 1MFZA 4BY1G 2DGYA 5CCGC 1Y8AA 3I2ZA 3JAME 1AJYA 1TS2A 4MZ9A 2OYOA 2VB3X 4GNXB 1B1ZA 2UUBL 1AN8A 5DM63 1JC7A 3RL0D 2QM7A 5T1GA 3LW5J 3IRBA 4W7ZA 5M3FB 4IFDJ 1JE4A 4JI1Q 4XYQA 2KQ3A 4K0KQ 1VF5B 4DR5L 3M9BA 4L73A 1G51A 3ZYYX 4ZKUA 5CCHD 1T2KC 5HURA 4LWCA 1L0NG 3A55A 3TDQA 1OW7A 2Y0SE 4P71A 2F0FA 3D6WA 1PRTB 1SQBG 5C4ZA 1HJ0A 3L71J 1H0TA 1YNJD 4H0LC 2HYNA 3F2UA 2B2UA 1GL2A 4YCVA 1J2JB 1TWAB 4K5WA 1Q86Q 2LKMA 2YXRB 2EYFA 4LF8L 1JWUD 5M3MB 3T1YL 3WMM0 1PV3A 2FYUG 1A0IA 3AE6C 1BGYD 4DT0A 1CKNB 1I4QA 3G9RA 1LYLA 2I5HA 2Y9ZA 4KJMA 1OTCA 1K8AQ 2CQAA 1PH8A 3SGIA 1BKBA 3GHGB 3TN2A 3CF5A 2B8FA 3JSVC 1U4PA 4LF5L 1ZR2A 3VMXA 3EROA 2GUVA 1ZEQX 5KAFE 1ILQA 2QW7A 2IZ0A 2EYPA 1STNA 1U0LA 3HGBA 3K5BA 1G2CA 1AW7A 4C2MB 1JE5A 2KNCA 2D5DA 4LK1C 2OCEA 1BCCD 1CTMA 1MFTA 4DR3Q 3DLLA 2XVSA 5AVTB 2ZXOA 2C0WA 1FNUA 1PMRA 1SQBE 3VMAA 4PMBA 2E75D 5KIXA 1ZRTE 3H1JE 2F0NA 4GNXC 2EDGA 4OEMB 2UXDL 2ASBA 2ZTDA 4MNOA 4LFAQ 2GVBA 2EXDA 1QVFO 3O8ZA 1YIJA 5IGBA 1XYIA 1FU1A 1GJXA 3VR3A 3J7ZC 4DK0A 4LFBQ 3DEOA 2OTKE 2QEXP 3DUZA 2JO1A 2CVRA 2FHTA 1HGVA 1EXJA 2M5AA 1NH4A 1STYA 1TWHH 4JCVE 1Y1VG 3O13A 4B9XA 3E1IA 5M5YH 3CC2P 4YWMA 5CCGD 2QE7H 1CZGA 3RLNA 3HOWG 1USEA 4C3JB 2R3SA 3KDFB 4IURA 2OYHC 1STAA 4KHZA 2ZYDA 3K7UC 2WB1G 4Q0FA 5AW5B 1FAVA 1D2BA 1KV4A 1Y1VH 1CK1A 2DJGC 5A2QE 3KFUA 5APXA 4J6HA 2QJPB 4BS9A 1ZKOA 1NTMG 2R7ZB 3GDEA 1BGYJ 2WSSH 2WVRA 1VQHA 4Y7NH 3L74G 3PO2B 3D6ZA 1PPJG 1IC2A 2CKZB 1NTMJ 2K5VA 3KLSA 1R5LA 4J15A 1VQCA 3R3OA 1PPJD 4RGMA 3U4VA 1HNZL 1CQFA 2XTIA 4GKJL 1EY5A 3RK3E 1Q1BA 4JW0A 2HHHQ 1LNQA 2MJ8A 3HKSA 4EVOA 1S4XA 2OARA 3A5ZB 1KQSO 5AVZB 1DOKA 3RK2D 3H6PA 1JOOA 1B2TA 3DWAA 1K83B 1QUQB 5BVZA 3J80i 1SQXE 2B87B 4D6TG 1CI6A 3K8AA 3KF8A 4P73A 3SK4A 1LJ2A 2WAQG 1KQSA 1GUSA 2C5CA 1HNWQ 3DMUA 4OIKA 2FYUD 3CD6A 3M91A 2R7ZH 1PH3A 1T6AA 5D3IB 4DR1Q 1Z9FA 3J81L 1CHPD 2UXBQ 2JA6B 2Q8RE 1BGYE 4LC1A 4X62L 1AE3A 2K7VA 2QF7A 2V7QJ 4HJ7A 2LXCB 3VMYA 1JOQA 1D5XC 2X69A 4N8FA 5JOBA 4BA2I 2JA6G 1LTBC 5C4XG 1UEAB 1PFIA 2OXPA 1Q2NA 4AQYQ 4A3BB 1L4AA 3RMHA 2BE5C 3HOYG 2BA0A 4A3JG 2Y0CA 2QSIA 1PH5A 1YHAA 4HIKA 4GODA 2VL6A 1WT6A 2OGUA 4GDOA 2JE6I 2MUYA 1NTKE 1KLUD 3J7YW 1LTJB 1EWHA 1Y1WG 3W1BA 2PAJA 2QDBA 4JI2L 4RFBA 3AE8C 3K5OA 2A6HC 2JA5B 2KEDA 1SYBA 5IT9E 1F2MA 3GTJH 1NY4A 1BSNA 1L4AB 3L72J 4IOAA 3MXGA 2IBZD 4DR6L 5D3DA 2BDOA 2WINB 1IFMA 1N7SB 1NTKG 2K05A 3DWQA 2OYIA 3QR8A 1QZHA 3I91A 5BN5A 1STBA 4PNYA 3E9IA 3PO2G 2A73B 4FF1A 3S2HB 4DZOA 2B2VA 1QB5D 1HTLD 1YITA 1LT9C 1NNXA 4AYBE 2UWJE 3NXWA 4U68A 3H1JJ 2QEJC 1KB9D 1VQ5A 2A06G 1RF1C 3H0GB 2LXJA 1PP9E 3M06A 4N9TA 2L0CA 1ZXTA 4RMFA 2EY1A 2DW3A 1L0YB 2E42A 3G6EP 2X6LA 3AEGC 3VP9A 2WSFJ 1LABA 4A3KG 1WD1A 4UY8C 1Q12A 2EQSA 4A3BH 1CT1D 1IBKL 5LMNQ 3P8CE 4F88A 1Q1EA 1RL2A 2OQ0A 3AE3C 1TWAH 1HHVA 2A45G 4OGQB 3T97A 4APVA 4A3KB 3A5UA 3I90A 4DV6L 2OT2A 1K0RA 1N86A 2E74D 1CSPA 4A76A 2YIUC 3T1HQ 1WTRA 1HR0W 1JJGA 3O6QA 2JA8H 1W6KA 1N7SC 4DV7L 1PH9A 3PO3B 4O1NA 1YTZI 3WU2E 1D5ZC 3DXJC 4X3SA 3T56B 1WCMH 1CKOA 5C4XB 3S1MH 2E5TA 3CCMP 4KJNA 1PPJE 4HCEA 4LUOA 1BDCA 3CCRP 1SQQD 1NTME 2H7HA 2A69C 3NP8A 4IOCA 4DUYQ 1PGJA 2YKPA 2E43A 1XPRA 4A93G 4XT1B 5C44H 3HOVH 2CPSA 2FFDA 5KAIE 1W2BO 1Y14B 2WPSA 1SQPK 4U3FG 1F9QA 2JA8G 4QQBX 1T5XD 1K0SA 1F77A 2H89C 3MUDA 2PZUA 3CC7A 1Q81C 3TBIB 1QVFA 2EY2A 4POGA 3D71A 4IALA 2J59M 1LT9B 3DWPA 1SQXJ 5EPLA 4JI2Q 3CCLP 2W83C 1VQLP 1PP9G 3PHLA 1DEBA 1SROA 3M7GA 5E4XA 4A7PA 4FYDA 2YXQB 3BCCE 3SVMA 3PJSK 3EFXD 4U3FD 1A3VA 4HIDA 4RESB 2PCFB 4YY3Q 2ZXXA 3AEAC 4H0LD 5KKZB 3MHBA 3OTOL 1STHA 3NHHA 4L5TA 1U4LA 5IWAL 4DR4L 5ISRA 4JI3L 3TMEA 3P32A 2K9JB 1S72A 1N7LA 1J1EC 3MD0A 3V5BA 2FXQA 1H9KA 5CV9A 2PRRA 1LTSD 2KHSA 3HKZE 5G3LD 1GDTA 1WCMG 5J3BA 2KEEA 3L73E 1O7ZA 4NB3A 4JI1L 4A3IG 1XNRL 1IKMA 1Z47A 3KOJA 1RJTA 4YWLA 1OXUA 4JBZA 4DV3Q 4JI6L 4A3EH 1XMQQ 3HOXB 1EOVA 5CV5A 2QCPX 4NXML 1SJHD 1NTZD 5APUA 1SMXA 2A6EC 1LP1B 5IGFA 5J22A 4KHXA 2OTJA 5CBOA 1SP4A 3V6IA 1CQVA 1XXGA 1ZYRC 3CP0A 5DAUA 1H0TB 2XDJA 3CXHD 2MKVA 3V2PA 3A8KE 5IGEA 1RF0A 5C44B 3D3RA 2G9DA 1I94L 1EXIA 2KHIA 4X3KA 1BCCJ 2JEAI 2R44A 3OW7A 3CWBG 2F0MA 3CCUA 1Q82C 1PGQA 4RHSA 3RLFA 4N78D 3VTPC 1IZ6A 1W2BA 4C7NB 3HOZB 1IYVA 3OWEB 4NPSA 3GTPH 4A3JH 1X6OA 3MC0B 3HOYH 2YKQA 1VMCA 2K33A 2Z6BA 2V4HA 4JQ0D 2ZXPA 3BDLA 3KJPA 1SN8A 1NGMB 1LWUC 3NBHB 1KN7A 3EJIA 1VQOA 1A62A 4PV1D 3S14H 5EKLA 1EZ8A 2ZJQA 1JCKB 3D8GA 4H13B 1YZ6A 5TISH 5AVSB 3SWYA 1X3FA 4P75A 4DAYA 1MBYA 2EZVA 2N1TA 3L75E 2IJ0A 3M3YH 3HZXA 3HOWB 3G6JB 4JPBW 3TNUA 4EI2A 4NW2A 1URQC 1M1KQ 4JYBA 4YHHQ 4IFDK 1A2UA 4WFN3 3B5NC 4IUPA 2Q9IA 2FXMA 3NENA 4C3JH 1NTGA 1PYBA 1GKHA 1SYEA 3L9AX 5IP7G 3M0DC 1URQA 3PMFA 1X9VA 1MD2D 1P84I 2F4VQ 2VW9A 3BATA 3D4RA 5AW2B 5IGCA 4HKZH 3WOEA 4H0LB 3FHWA 4ZK9B 1GK4A 2UUAL 2B3GA 3KLSX 2L91A 1NU1G 1A8VA 5EQ0A 4C56C 3HG9A 3IR9A 1YNJC 1RF2D 3JAML 1Q82Q 2ZVOB 1CA6A 1LTAC 1PVOA 1G6PA 2FXOA 1I4GA 5AFWA 3PUXA 1VDZA 4X66L 3MTUE 2WITA 2L55A 1KNAA 2ZTEA 3HUSB 5HGQA 1M8OB 4EQ5A 4OXPA 3UIAA 1VQDA 1NUCA 2B88A 2M3BA 2VB2X 1PL5A 2PO4A 3RZOH 5CBNA 4C46A 1I6HH 5DM73 3VR6A 1BXTA 1QVCA 1PH1A 4LUVA 4WY4B 3I56P 3PUZA 3H1HG 2BA1A 2RDHA 5ELNA 4BBSB 2IL8A 3HD7A 1PHJA 1IW7C 3Q24A 3C2PA 2RN0A 1EU4A 4XQQA 1SLJA 3L73D 2A68D 4POFA 3J80c 2D62A 1EIFA 3HRZC 3RR5A 3AE1C 5APSA 2E5LQ 5CV4A 1EYDA 2E2DC 4HR7B 1VQ8P 1PP9D 3MP7B 2XNAC 3S16B 2K01A 2WTYA 1KILA 2NN6I 3UDGA 1MHWC 1S4ZA 4WY4A 5KAIH 1HNWL 4MTKA 1WTPA 1GHKA 2HQEA 2XNXA 3VOPA 2PZWA 3CCJA 1PFBA 2P1JA 1NCVA 3NPPA 2CFMA 4IOIH 1SQPD 3SR1A 4L8JA 3MFYA 1V9PA 4HEDA 3KF6A 3HOZH 1SFCD 4NMZA 1UE1A 1VPCA 1QL2A 5I2XA 3VYIA 4LJZC 1EIHA 2HODA 1VQPP 2WSCJ 2A45I 1S5DD 2KLVA 1ET9A 1SQVG 2QKIC 2N78A 2Y0DA 3L70D 3S4RA 1HFGA 1BCPC 5C4JB 1RY3A 5B5EE 1F9SA 4E6IA 1VQ9P 3PUWA 3SE0A 3GMAA 2Q8TA 2PP6A 1KYOI 3W68A 4JBMA 2A06E 1NTMK 3A8IE 2WSEJ 1N34L 4JYCA 2K5HA 3MFGA 3B5NA 2AHOB 4MIUA 2I1JA 1A2TA 2GUSA 1Q7YQ 3BYTB 2WSCH 3S1RB 2XZRA 2JQOA 1LP1A 4NXNL 3RN5A 2EYLA 3FGAD 1RD9D 5BR8Q 2Q2TA 1DH3A 1OXVA 2CWAA 2Y9YA 3I5CA 4IPHA 3L71G 3OIPA 1GW4A 4KLKA 5IYDG 1Q46A 2KIKA 3NTIA 4FVMA 4JI0L 4A3GG 1W6JA 3L70G 4DGZA 4EGVA 2V1CC 4FF4A 3IL8A 4A3IB 1NSNS 3H3VH 2CHBD 5C5MA 1VF7A 1URQD 1CSQA 4KK7A 4BRYB 2O1KA 1C48A 2N49A 3FMCA 5E7NA 1EQRA 3V4QA 1PP9J 2JEBI 5BR8L 1BCPB 1V1OA 1P84E 3RZDB 2AKWB 1OVUA 2Z4EA 3CCLA 2A69D 4Z1MH 1Y69U 1YJNP 2Z9HA 3D6CA 4IPDA 1TU3F 4DV3L 5E3FA 1SFCA 3D31A 4CKEA 2OYHA 1NYHA 2O2LD 1HH0A 3IKJA 3PV0A 1N9WA 1LTTD 5DLQE 3T1HL 3Q1MA 3RK3D 1X0TA 1M8AA 2P5ZX 4DV6Q 3USSA 3BZCA 3V4WA 4UP8A 5I6YA 5I2YA 1HQMC 1Y8PB 1S1CX 3CMAA 4V190 1JTHA 2A1AA 2MHVA 3KDPB 3MTSA 2CH4W 4B08A 3GP7A 4X64Q 2QGQA 2E76B 4ZNCA 1LTAD 1UNSA 3Q6SA 4JV5L 1C7YA 1VQKP 1SQXG 1ESFA 2R3CA 1DJRD 2L9HA 2EJFC 2X6GA 1K28A 1JY2N 1L4AD 5C0XI 5M3MH 2PI2E 3U50C 3AU7A 3R2TA 1OVVA 2H1EA 2Z6KC 2KYVA 2OF1A 2OTJP 3KXDA 4R4TA 1NU1K 1JR0D 4Y99C 1YJ9P 3ITPA 4IUTA 1J5EL 1EYCA 1VQNA 3R2PA 3PO3G 5AVUB 2RHSB 3E0JA 1DEEG 1XTCD 4IUNA 2NVTB 3AECC 2BEQD 1K8MA 1HTPA 1I4RA 2FKWB 2IHFA 2ID0A 5EGTA 1HUCA 1M90Q 2PYKA 5CCHA 3CCVA 2QVAA 4K3AA 5M5YB 5M3FH 2K03A 2J0TD 4Y28J 3H25A 1JUNA 4JK1C 4NKLA 4XQJA 2Z5HA 4K2LA 3PIOA 1NU1J 1XNQL 4NPFX 4DV5Q 3GLMA 3M4OB 1K04A 4R4QA 3STBC 1IXRA 2K1AA 1HJBA 1IO4A 5JVH3 2ZJPA 1QUQA 3FX0A 2E74B 1C4QA 4NPEA 2UXCQ 3BG3A 3L75G 4KHVA 4RGTA 1EEFD 3E0EA 3G7LA 2P7JA 3EQLC 2WPQA 3BYYB 1HZBA 1RKNA 2F0TA 4KY5A 4JI6Q 3VA5A 1L0LJ 5KRUA 4FXKC 3G4SA 4GIFA 4QL5A 1TY0A 4JI5L 1ZLLA 2NVTH 2Z4HA 1VL2A 4IUVA 4HIMA 1KDBA 5APVA 4L5SA 1SQVJ 1CA5A 2Q2UA 1KILE 4I7ZC 4OWWB 3S1QH 4TVAB 3RNUA 5KLVE 4QMGA 4JBWA 3QO2A 3BVZA 1J1DB 2ZAEB 3G48A 3QH9A 2O01H 1QL1A 2V4DA 3K5MA 4XA4A 4K6LA 1EYGA 3HD7D 4LF4Q 1RHZB 5GAEC 5GTHH 3WDNA 2W6JH 3RZOB 1LTGD 4OGQC 1S5LH 2NBFA 1SSOA 5FLXE 3GTQH 1IBML 2IBZI 4IL6E 2C9NY 3TYYA 4IQZA 2JXMB 4HMIA 1VQ7A 4QIWE 2L1BA 4D6TJ 4V0BA 4B3TL 1RQVA 2JKVA 1HF9A 3L70E 4W80A 1GU5A 1WOCA 4GOEA 1PGOA 1FZGA 1SJED 3L71E 4O0AA 3OWFA 3X3MA 3LIEA 2FBWC 3HKZG 4A3MH 4LF5Q 3H1IG 5AW9B 4QJFA 5T1IA 1K8AC 1SQXD 3RZDH 1EEID 2Y0SG 2Z6KA 3VMZA 1VQEA 4ZUIA 3BVMA 2F0SA 3UDFA 1S5FD 5ELEA 4F87A 1N73A 1LLRD 1VQIA 1YNXA 2ZXRA 1FC2C 3OMGA 2WIIB 1VQ8A 3M4PA 3LIDA 1FNWA 2K75A 2MP1A 1J1DC 3SK8A 1W5CE 1XNRQ 3M7NA 3W3AA 1FGBD 1SXTA 1TKWB 5G3LF 1WVLA 4DPGA 1LTIC 1N73C 1K3RA 2Q3IA 4PMWA 1QNKA 2A68C 3L2PA 3LW5H 2KJXA 1EQTA 3L73J 1F9PA 3GV3A 4TRDA 2SPZA 3O6QB 2M2LA 1AH9A 4DAYB 1O7YA 3L74D 2IT1A 1KB9I 2HQLA 4GLVB 1SQBJ 3LWUA 1R9TH 1KL9A 3HUSA 2NZHA 4KHPQ 4JI7Q 2A19A 4C7RA 1K9MC 2IX0A 3KDFA 1EUJA 4ZLTF 1ASZA 3PF4A 2B2TC 2D0OA 4GOPB 1X8YA 5JAVA 2N9YB 3PRJA 1IBKQ 1Q8KA 2WKDA 1VQBA 4H7BA 3JC22 4PV1C 2VXWA 4H13C 4BBRB 4DR2L 2VS1A 5CV6A 2WSFH 1KRSA 2RKSA 2XN9C 5FO8B 2O4XA 5B66E 2NTTA 2XGTA 2B63G 1FDOA 2L5TA 3B6YA 1QLED 4EQPA 3NE5B 3AE9C 3HEJA 1FJKA 2Z8LA 3RBXA 4N3YB 5CCHC 5C0XG 4DCKA 1SNCA 2GA4B 3RD4A 4CGYB 5M9OA 1PZID 3PQIA 1F2LA 2KI7B 3I4NB 3PF5A 3L0OA 4FNFA 3K5NA 1YQ4C 3J81i 3N4XA 4GZYC 1WTVA 1O78A 4ME5A 1A15A 4M1UB 3K5LA 4A3IH 1GW3A 2O3JA 4RJTA 3S1NH 3L75D 2KENA 4R4CA 1YJNA 1SYDA 1PZKD 1SNPA 5TSSA 3NELA 1PTOC 4IFDI 3MA2B 1GK6A 3G71P 2Q5UA 5KJ7D 4RWSC 5APQA 4OX9Q 1I4PA 1EZVD 2YV5A 1WJJA 1T8ZA 1B9NA 1XMOL 3AFQA 3H94A 2WPVB 3V2TA 1LTJC 4DXFA 3HE4A 4JVZA 1R4QB 1PH7A 2L5GB 1LTGC 1TQOA 1WTHA 2QJKB 1NO4A 2CQOA 1KQFB 1VQKA 1LTLA 4CHTB 1LTJA 2V7QH 1QE6A 3H1JD 3V05A 3DM1A 1OFCX 1A63A 3VR5A 3KF8B 1NBWA 4I7AA 3T53B 4G7ZC 5AW0B 2I46A 1JMCA 1L0ND 5LMUQ 3HOVG 4DK3C 3ABVC 1CHQD 1X56A 1KMIZ 3HP3A 4A3MB 2MO0A 1S9KE 1PGPA 1EZVE 2K32A 2FXPA 2RDGA 1RE4A 3CCMA 3S1MB 4IL6X 4UB8E 3I8ZA 4DV2L 2E2HH 4JI4L 3PLNA 2E2JB 1G8ZD 2R5DA 3PO3H 1G2SA 3EA6A 4KKUA 3RK2B 2R5BA 1IYUA 1GUTA 1PTOH 3HOUG 2JA8B 4LGDE 3CXHI 1YBYA 1Q90A 3DEPA 2OTLA 3HUSC 3KUPA 2JJLA 4IN3A 5C0XJ 4UB8H 1ZV8A 1SFCB 2NVYB 2R92G 1BF4A 5EFWB 1UAPA 3SDZA 2HPCB 4IL6H 2XRQD 1EWCA 1MI2A 1SFCC 1Q3LA 1KXLA 1HH2P 2EJGC 1KILD 4CJ1B 3S14B 3H32B 2E2IB 1T2KD 2BASA 2F1MA 2NVQB 1KB9E 1YHQP 3CX5H 2HIVA 5CYUA 3CAMA 2UU9Q 1L0XB 2R7FA 1DX7A 3ICEA 1EDIA 1BQQT 1XX8A 4S3SA 2HLOA 4X64L 3GTMH 4B3MQ 3L36A 4JBJA 2E74C 2NPSA 1NWQA 1H9MA 4DR7Q 4RAUC 4O9BA 3HD7B 4ID6A 3L73G 3KQGA 3EN2A 3UI2A 5CCGA 4XYOA 3S2HH 4O2DA 2KECA 1YNND 3SK5A 5IGDA 4LUZA 4YHHL 1JCDA 2WAQB 4AUWA 3VYTA 3RLOA 1WTXA 3I3CA 4A3DG 4MN4C 1I4HA 4N78E 1NAPA 5EBDA 5IWAQ 3K6OA 2JA7B 1J8IA 1SNMA 2Y0SB 4C3IB 3CCSP 3H1ID 1LTRD 5EAYA 1A3TA 1V1PB 1VQFA 1KFMA 1K73C 3L71D 4BY1H 3VP8A 1WTQA 2YMKA 4ZMDA 3K7AH 2RA4A 1QG7A 4J8QA 1C9OA 1DM0B 1FD7D 1ML0D 1U7JA 1PYSB 5IYDH 1P84H 2Z1CA 3CU7A 4DNIA 1B3QA 4U673 1YJWA 1Q90D 4U3FE 1IL2A 3KYHC 5EKIA 1R8EA 3H1JG 1E22A 1TT2A 1JY3P 1U4MA 3CX5E 3KBGA 1V1PA 3L72D 3V2QA 3FRPB 3QWNA 4OO1H 4B3RQ 4GLXA 1KIXA 1AVOA 3AE4C 2A74C 1HFNA 4FXDA 2YYZA 1U57A 1QCBD 4BWNA 5CMDA 4DV1Q 2JA6H 1NTKJ 2QRXA 2Z0SA 2JWAA 4C3IG 4I2LC 4BXXG 2NYZD 3BZDB 3BCCD 3CKIB 3Q5RA 3AEBC 4XIGS 1A02J 5TJHA 5DNFA 1D1IA 5EPKA 4BY7B 1RTNA 4IJLA 4DUYL 3KF6B 5FLXL 3I4MG 3R4YA 1DYQA 3HOYB 4A3LG 2MPMA 4R4LA 1K8GA 3C1FA 2RDFA 3CC4P 5C3EH 4IFMA 4BBRH 4GN5A 4OONA 5C3EB 1KQGB 2J4XA 3SK6A 4OIJA 2F0EA 1QWYA 1KILB 3MXUA 3T13A 3AFPA 1HTLC 2XU6A 3HRNA 2KCMA 5KLVD 5K5GB 3CQZB 3J80L 4RCNA 3AE7C 4BY7H 1KB9H 1VF5C 3TZDA 3GTKB 2LFNA 3QOJA 4M3LA 1FR3A 2K4KA 1MJEA 4RH6A 4YY3L 1L1OB 4AYBG 4DR4Q 1NOHA 1LTID 3CXHE 1O7LA 2FMMA 1JB3A 5CGKA 1YNNC 1ASYA 2MJZA 1U9RA 2OYIC 2QDLA 1HR0L 4PZ8A 2J58A 2Q7CA 3A74A 3KLRA 3EVQA 3CCQA 1HPCA 4AQRD 4MTNA 2LSSA 5COYA 2IDBA 2KS1A 3A3YB 1BDDA 4HB1A 2P58A 1XJVA 1AEXA 5E4WC 1B9MA 4K8IA 3F1ZA 3CMEA 2VNUD 3MWYW 1BBXC 3L35A 3PIP3 1MGSA 2KCNA 3B5NB 5BU5A 1N8RC 5ELCA 2QJYB 1CW5A 1XPUA 3P8CD 2VRSA 2AMCB 4LAAA 2B9BA 1H89A 4WBAA 3LWEA 1O80A 3J81c 1LTBD 2WWWA 3S1RH 4K6DA 5EBCA 2SOBA 2K14A 3P20A 4AH6A 3TP8A 2M00A 3W2DA 2ZTCA 3BZKA 4G57A 4AYBB 2IW3A 1EY9A 1NVOA 3H1LE 2F03A 1PYWD 3U9OA 2OEOA 1FZEA 4R4OA 2P2UA 1SYCA 3M85A 1HA6A 2KOGA 2B2YC 4K35A 2B39A 1DOLA 4OH8B 2P10A 1T9HA 3EIVA 2QA4P 3KBXA 1NTZK 1UWVA 5JEAJ 5I6WA 3GTJB 1LT1A 1FOSF 4UP9A 3ZDMA 3MGNA 4RCOA 3WWVA 3NBHA 5LL6X 2A06D 2LXBA 1X55A 2DN8A 4B3SL 4XFJA 4P72A 1N32Q 2P67A 2K52A 2JWDA 4KHPL 4LFCL 3UDIA 2SEBD 3NK9A 2KZJA 1ZR4A 1NJIQ 2D2CC 4KTAA 2CW0C 2B2UC 3S1KA 3TQYA 4LF7L 4RKUJ 4FO2A 1FZBA 1K73Q 1G1IA 1EOTA 3CX5I 3FKIB 5M5WH 4WY4C 3HE5A 2WV6D 1VQAA 3HOXG 2EYJA 1VQMA 1MZ9A 3WUUA 3NTHA 1GL2B 1WI5A 1SQPJ 1PTOB 2KZIA 1KDAA 5CV7A 3IN6A 1EFWA 1IL8A 3NWTA 2OQQA 5NUCA 1LUZA 2D0PA 1TS3A 4BBSH 5AVVB 3BDOA 4PMCA 3F8TA 1Q7YC 1DOMA 2J7ZA 2NZOA 2IY5B 2KVMA 3L70J 5AW8B 1ZYRD 4C1NK 4TT3H 4X3TA 2PI2A 5D65A 4K14A 2UUCL 1WTWA 3MXPA 1KAAA 3T4AC 4NDXA 4GNXA 4HJ8A 1SQQK 2OTLP 5AJ3L 3K59A 2M5AB 2FYZA 2Y0EA 1G2CB 1SQBK 1NKNA 4ODGA 2KNCB 1GD2E 2IX7C 4ASWA 2Z5IA 3MEFA 4KN7C 2WACA 3II6A 3GO5A 5BN3A 1PZQA 2JA7G 4A3DB 2NZ2A 5DJTB 1GHJA 2KBNA 3BJUA 3L4FA 1SQPE 1YHQA 2L12A 1CZQA 1VMPA 2W6BA 3A0BE 3SFEC 1RE3A 2RMZA 3A7OA 1W3SA 3URYA 2F0WA 4WJ3M 5IP9H 1KZUB 2ZXEB 2NVXB 3W1GA 2F3WA 3OMCA 5IYBG 2KUBA 2UUAQ 4JI7L 3L37A 1NR2A 3J7A5 3S15B 3EWKA 3FKIG 3A0BH 3VN0A 4C3HG 1KC8Q 3C3LA 1A6XA 3Q3DA 1KHIA 1X32A 2BH2A 1IK7A 2NVQH 1EQ7A 1YBKA 4GKJQ 2BCCD 4KY6A 5GAHC 3VYRA 3AE2C 2R93G 2XIWA 2RVLA 1BSHA 4TQUS 1AQTA 2QEXA 3DM3A 3OPOA 3CCSA 1K8OA 1PFNA 3S2DB 1SE4A 4EQOA 5AW3B 4WJ4A 2ES2A 2Q6QA 1S9KD 1H88A 1X3EA 1BNZA 2KK7A 3VYUA 5JEAG 2ITAA 4BY7G 3ER0A 3ERSX 1PH4A 2BCCG 2C9OA 1SLQA 4JG2A 3T97B 3F89A 4R9WA 2E2HB 1AV1A 1SYGA 3TEHB 1BCCG 4RO0A 1GMJA 1BE3D 2M3EA 3H1LJ 1EQVA 3GW6A 1S5ED 4JF7A 3VDYA 1PRTF 3H0GG 1MJCA 4ZKPA 2B2WA 2XRSD 4K8JA 3NTNA 3MXNB 4ULLA 4X65L 1SMYC 4EDFA 2A6ED 2PGDA 3FWLA 3D4DA 4FF2A 2B89A 1KD1Q 1PTOD 3KZIE 3GQBA 2NPSC 5EPJA 1GTWA 5B66H 5KJ7C 5IY0A 4HN7A 4BXXH 1GUGA 1DIPA 2ZT9D 1D7MA 2KLUA 2EOTA 2YTVA 1SAPA 1PXUA 4PD4D 4PZ6A 4QCLA 1G2TA 2G5DA 3CPWA 1QZGA 1EZVG 3CPWO 2D2CD 4PD4E 1TXYA 3J81j 1E24A 4HAEA 4QUFA 4ZKCB 4RGOS 2UXDQ 1KYOD 4RG1A 2ZJRA 1FZFA 5B5EH 1X3GA 4A75A 4CBVA 4KN4C 1YVCA 5EKKA 4DJGA 2XV5A 4L76A 3CD6P 2YKOA 2I0QA 1S3JA 1FJPA 3GTOH 1ENCA 2UUBQ 2C0XA 2IBZG 1KABA 3L72E 2HT1A 4A3GB 2KSEA 1CM9A 2DNEA 1BBUA 4DN4M 4FF3A 3AYHB 2M8RA 1L2FA 4IJHA 5JJLA 5JJIA 3HTKB 1RDPD 3B5ND 4U3FJ 3GHGC 1PFSA 1M1JA 4IFDG 4BY1B 1IK9A 3I55A 1TWCH 4A3DH 3OSOA 1PLFA 1EDJA 1MIUA 4R4IA 1PV4A 2LS01 3S24A 2F0HA 3MHVA 1BCPD 3JAMi 1CKMA 1PZJD 3RBZA 1OVRA 1VF5D 1E79H 1JWMD 3M0AA 5M5XH 1EU3A 3H1KG 1VCIA 1KILC 1QILA 1A3UA 4DKAC 1JY3O 3T1YQ 4PZ7A 1YTZT 4LF8Q 3Q2YA 4IZ8A 1JJ2A 3KJOA 1OW8A 3GF3A 3FXDA 1PRTD 1TWGH 2Q2HA 4BBSG 3S2DH 1Q81Q 3S16H 4CKBA 1DZ1A 2Q8IB 4KI0A 1ILPA 2JYOA 3HOUB 5APWA 2H5XA 5IT9L 5C4XH 2CK3H 1NTZE 3W5OA 1FS0E 4AIMA 4KJOA 1AQ5A 2XWJB 1RF0C 2HDMA 4Q5VA 3BVHA 4IFFA 1SRUA 2AQ3B 1MSHA 3SFDC 1SNDA 1RTOA 2R3ZA 2E2IH 4OWFA 5CORA 3GG2A 2NTSA 2R7ZG 1U7MA 2NRGA 5EJWA 3CWBJ 1T5EA 1RE4C 1ONLA 4LLHA 3PSIA 2ZT9C 2WB1B 2CWPA 2R7DA 5GTHE 3CMAP 1B8AA 3RL0g 1OXXK 1Z6HA 3HFZB 2N1TB 1GL2D 1HXYD 3MIWA 4ZYSA 1G6ZA 2F0OA 2ZVNB 2NB0A 1RHPA 2PQEA 4P2CB 1SEBD 4LW1A 1VQ6P 3NSWA 2VUMG 2E75B 1MV8A 3MUDC 1X3QA 4HTHA 4HSVA 4DUZQ 1N36L 1K9MQ 2AXTE 1SDFA 3U58A 3TZUA 2K37A 3EFGA 1SE8A 5KYIA 4C7NA 1EZVI 1E2ZA 2FFDB 1HGZA 4A3FH 2PNHA 3GTOB 1A02F 3GF7A 2HODB 1G91A 5AW6B 1E2WA 1HWTC 4HMJA 1KYOE 5AJ3Q 1HRJA 3D4WA 2AWOA 1EY7A 3GD7A 3QJYA 1SMYD 2XSCA 2YU9H 1FZCA 1SQQE 4DV0Q 5K36G 2KA7A 4DV1L 3KLWA 1FDMA 1E1OA 2N55A 4K2KA 4FP5D 4UP7A 1VQ4P 1HCZA 3T16A 4IUQA 4PD4I 5CMZA 5IGGA 1IKLA 3CCRA 1ESRA 1LT3D 1S5CD 4DR2Q 5A2QL 1SFOH 2MFIA 3TS0A 2K6AA 2QG4A 2ICIA 3S1NB 2PZTA 4X66Q 2EYHA 3SSUA 1G291 4KKTA 4N9PA 3V2NA 3TNUB 3I70A 1PA6A 1X65A 2R93B 3CRKC 2MGSA 4JI4Q 2NZ1D 3TDKA 1YQ3C 1EDLA 2VQEL 3RK3C 3CC7P 4M8AA 4OL7A 2NPSB 1TU2B 2HCCA 5KNCA 2BCCE 3WUVA 2B87A 4YXWH 5C0XH 4ALPA 4B3TQ 3OW2O 2VUMH 1BE3E 3IFMA 2NUCA 1PTOF 1HUMA 2IPKD 1N7SA 1YEZA 1L0LD 2OYIB 4DR1L 4YIJA 1LACA 2ZYGA 3D70A 2Q2IA 1C0AA 2NN6G 3S17H 3H32A 1V43A 4OVNF 1N33Q 4GKKQ 4QF4A 3A7LA 4X62Q 2N88A 1B7YB 1L4AC 2KUMA 1PH2A 1K83H 4A3LH 3FPPA 4QGUA 4N6JA 3Q5PA 2WT7B 5KAFH 1T3JA 5IE8A 1LV9A 5GAGC 1JORA 2QJYC 1QGKB 1TR5A 3NWSA 1AP0A 3U9SA 3ND8A 1IFPA 1ENFA 3T51B 4A3CH 2SNMA 3WOFA 5FLMH 1IZNB 1NAYA 2TSSA 3H1KE 4DXGA 1GU4A 5K5PA 1NTZJ 4ZUJA 4XTCS 2TMPA 1VQ7P 2DNCA 5CJ0A 3Q0AA 3H1KD 1UE7A 3RUZA 2F3IA 3F2CA 4GLAC 3KZIH 3M0DA 1OXZA 5FO7B 1B4OA 1IYJB 2EYOA 3GTGB 1MUUA 3IFDA 1DD3A 2Q3EA 4ZCKA 4R4MA 5LMUL 1JB7A 1NR4A 4DU9A 1JJCB 2IFNA 3CLQA 1H9RA 1HZ9A 4HJGH 3QIAA 1GUOA 1NKZB 3K81C 1PFMA 1URQB 2HIXA 2ENBA 1XTCC 1JT8A 2L4NA 4DAMA 2ZM6Q 3BS1A 1VQOP 2O1JA 4DFAA 5IYCG 2H43A 1WMKA 1VQJA 3H1LD 1PDQA 4YCWA 1IFJA 1F2YA 1ET6A 1HA5A 1LT6D 1M90C 3I7FA 3FEWX 3P75A 1I6VC 3ND9A 4GN4B 1JMMA 1S5BD 2PMZB 3H3VI 1X79B 4C2MH 4DV7Q 1SQBD 1F9RA 3A56A 5AW4B 3HD7C 5BU8B 3E9HA 1N8RQ 3K0YA 1HVVA 1R5SA 4L75A 5H2FE 2DUDA 2CCZA 3OJAB 4KMUC 1EY0A 1UE6A 1SQQJ 4GOPC 1NJIC 2E76D 3GTMB 5FO9B 4DR7L 4JI5Q 3H1HD 2A6HD 1N33L 4A3EG 4GKKL 3N7NA 3B71A 1CZWA 1MSGA 5C6AA 4DAPA 2XKMA 3BRTB 3MXNA 2ALYB 1XMOQ 4I65A 5ELBA 2QM8A 3HOUH 4TSSA 1DONA 1U4RA 5IOCA 3H0GH 5CBAE 3KHUA 1RODA 2AUJD 2AQ2B 3NTKA 4DV5L 2NVXH 4DA2A 1KDCA 1SE2A 1D8LA 2IBZE 3QOLA 3K0XA 2C9LY 4EOTA 3H1IJ 2E5YA 3HE5B 1GXDC 1ENAA 2W27A 2MQHA 3HKZB 2YTXA 5FOBB 2RKLA 1JICA 2ATWA 1I3QB 2K28A 2VZAA 3TS2A 3P7JA 5IODA 4NP5A 4DR5Q 3AEVA 3J7AF 3I56A 4ABNA 4NXNQ 1QNUA 1OXTA 4WB4A 3CW2C 1AZPA 3AMUA 1SQVD 1QOHA 4B9WA 3M4OH 4QB4A 4DK1A 4OX9L 4RGNA 2W90A 4HSPA 1JB0J 2F4VL 2DJFC 2MO1A 4DF7A 1EL0A 4A93H 2B2YA 2JJQA 3L7ZC 4G4KA 4X3UA 1YHBA 3MZ5A 1FNVA 3PH0A 4JBKA 3S9OA 2EY5A 1P8LA 1LGHB 3CC4A 3C1LA 2B63B 3WU2H 3IF4A 1NTKD 2DY7A 3H3VC 2WSEH 2HFED 3GHGA 1EZ6A 5I4DA 3JAMc 5KLVK 3H1IE 3PIPA 2RHQB 1LT4D 2HHHL 2LXKA 1NMFA 4TKOB 1BR9A 1EFID 2BE5D 3D0FA 1BCCE 3UE0A 1KTMA 2OWOA 1VQPA 5M3MG 3CWBD 3L3OC 3ONAB 4UB6E 3CI9A 1L0LE 1II3A 1QJOA 2WKCA 4CDEC 1EQQA 2J5UA 3D6YA 3BDCA 1ZRTD 2EVBA 1S5LX 2I5LX 1RE3C 5GQOA 4B3RL 4BXLA 4A3JB 4FDBA 1NAFA 4A3BG 4TLFA 2H88C 1GVPA 1EY4A 2GA1A 3LGJA 3CX5D 4HIOA 5KLVJ 5APTA 4LF6Q 4DNTB 1KTKA 1TWGB 2B2WC 2EY6A 5IYBH 1SQVK 5FJ8G 1HNZQ 3B4SA 5GTIE 4DOJA 4LFBL 4HCSA 4LMQD 4JI8L 1BCPF 1SS1A 2K3RA 1E2VA 4J1MA 1BBWA 3HS0C 1L1OC 1DXMA 1DGSA 5KJ7A 2AWNA 1JEKA 2FFKB 2K5DA 1QVGA 3PIO3 3NBIA 3I4LA 3PO2H 3SXHA 1SVFA 4BWGB 3HOXH 2D9UA 4A3EB 5C39A 5KNBA 1IFNA 2QJPC 1FVIA 3K80C 1SQPG 4ZRZA 4I7ZB 4IUUA 1Y1VB 1SBBB 2RBMA 4DNRB 1JY3N 4IO9A 2PQAA 1H95A 1I4XA 3I4OA 1LO5D 1JNMA 1D1KA 2K5NA 5FK9C 5CV8A 2L15A 4A3GH 2H8PD 2CPBA 1N36Q 4EYYQ 4GS3A 5GROA 5AVWB 1S2EA 2JA5G 2GVAA 1KFNA 3TGUE 5I9OA 2F0QA 2E76C 2M9VA 3JCUE 4WORA 3A0HH 1UE5A 3IAOA 3H1LG 4AQYL 3GTLB 4XXEA 4OWXB 1SQXK 3N52A 4RA8A 4CDDC 1VS0A 2WPRA 3L72G 5E79E 5FLMG 2B2TA 4A3CG 1E5WA 1OWAA 3CL3D 1JY2P 1B70B 1E0BA 4YTPC 2F0VA 1J1EB 4ZKBB 1PRTC 1LTSC 1P16A 1LWUB 5GADC 1TWFB 1D5MC 2KB7P 3GV6A 2IFMA 3CQZH 1I50H 3H09A 1YJWP 3CC2A 4LF9L 1WYDA 3HOZG 3I4MB 1KC8C 2FMCA 3Q22A 3BASA 3E5SA 2WP8J 1OIPA 5FJ8H 1FOSE 1ZP0C 4G7HC 2VQEQ 3A0JA 4XT3B 2I5MX 1NMGA 2EPBA 5AVQB 1TS4A 3ERQA 2E5LL 1FE6A 1E1TA 3AE5C 2K5WA 1S3OA 2YMYA 1OXSC 4DV4L 2EJMA 1DD2A 1SNQA 1EDKA 5L8RJ 1R9TB 3NQTA 1UUPA 3FDTA 3IFTA 5I9PA 4F8MA 5F2DA 2IYPA 1KNEA 1JM0A 3GTQB 5C3WA 3E7KA 1FZAA 5HY6A 2ICEC 2FYUJ 1K3BC 1VDFA 3OYYA 3CWBE 1EIYB 5H1SE 2WT7A 2BH8A 1OMIA 1VQLA 3MAQA 1J9OA 4QMAA 3G4SP 2HD3A 2L11A 1Y8OB
chains in the Genus database with same CATH topology
5FLXc 4XE5B 1HZAA 4LFAL 2YO3A 4JOIC 3I4MH 2OYHB 5AVRB 1CSBA 2YNYA 5AW1B 1SR3A 1FJGQ 3KPEA 2FYUK 4B3ML 2KCTA 3UDXA 1J6QA 4A3FG 2N1TD 4IPCA 1X54A 1I3QH 4C3IH 3PUVA 4LFCQ 5M3FG 1JTHB 4OO1G 1L0NK 3M4QA 5LMNW 1XNQQ 1IFDA 2IHEA 4DR6Q 1WFQA 3JC66 4BBRG 1E7ZA 3TREA 5C3EG 1JO5A 2ZM6L 4QY7A 2UXCL 3CXCA 4K0KL 4DK6C 3Q8DA 4Y99B 1CUKA 1HJPA 1T3UA 2QA4A 4JI0Q 5AW7B 4DV4Q 2IPPA 2HPCA 2EIFA 2N3SA 2UXBL 3ULLA 1IBLQ 4GT1A 4NXMQ 3H15A 1YI2A 1JCCA 2W6AA 3G6EA 4HJAA 4LF4L 3PCOB 1L0WA 3G3ZA 4H02A 2GM4A 1N34Q 1BVSA 4YWKA 3C9IA 1HNXL 3UE1A 4OO1I 1IBLL 1FZCB 1LM0A 3BU2A 3U59A 2UUCQ 2N9BA 4X65Q 2JK8A 1YYCA 4PG3A 2VY3A 4I6MC 3RN2A 5AVXB 1J5EQ 5APYA 1CI6B 1E3PA 2JA9A 3NEMA 4DV2Q 3HE4B 2R92H 1IFIA 4IPGA 1JOCA 2E8GA 4JYAL 5C44G 5ELOA 3U4ZA 2C35B 3NXSA 5IT9c 5LMNL 1V1QA 5C4JH 3ZJYC 3F2DA 1XMQL 4WY4D 1GM5A 1HBWA 1NE3A 1VQGA 1N73B 3G71A 1D7QA 1NTKK 1I5FA 4JYAQ 2UU9L 1VQ6A 3I4NG 4JC0A 2A45H 3S15H 1VQ9A 2KSJA 4L5RC 2ZFCA 3U1AA 4A3KH 1KQLA 1KRTA 3FKIH 1XTGB 1HNXQ 1O7IA 2I1KA 2E2JH 3STBD 5CJ4A 2B63H 5IP9G 4GN3B 1GO3E 4W7YA 4EIJA 1JY2O 4GOPA 1HR0Q 3PP5A 3TSIA 5JJKA 4DV0L 1IBMQ 2RCNA 3V2RA 4HJ9A 2WB1E 3CPFA 1UEBA 2NPSD 2KHJA 1X9NA 3B8EB 2IX1A 2K50A 1ZN5A 3SWFA 5IP7H 1LT9A 1Y1WH 3GTGH 2MNAA 2VQFL 2JA5H 1GD7A 4OWTB 3EBEA 4YCUA 3OA7A 2A8VA 1N2DC 4B3SQ 2PQAB 2FFDC 1N32L 1L0LK 4A3MG 2NVYH 4JI8Q 3M9QA 4DR3L 3A5TA 1EWIA 2JEEA 1YJ9A 3GTKH 2B29A 3ULPA 1FGUA 3EQ2A 3RL0C 2N8NA 4L5QA 1L1OA 2RF4A 3PUYA 2WFWA 1LWUA 3ULJA 4HJ5A 1CKNA 1FL0A 3NFQA 3FP9A 1AE2A 1TWFH 1Q86C 5AVYB 4BA1I 2POHA 1M1JC 3OW2A 2R6GA 4P74A 4UPAA 3NMDA 3TRZA 4DUZL 1HZCA 1WRGA 3TK1A 4GKGA 3HOWH 3GTLH 3U1CA 4HYTB 1XPOA 3AQQA 1NHLA 4B86A 4HH2A 1KAWA 1FBMA 4LF9Q 3RL0B 4JI3Q 3OAKA 1GL2C 1LTTC 2VQFQ 2HG5D 1RF1A 1IJDB 1RIPA 3P7KA 1Z56A 2WZ7A 1FZCC 1AFOA 1U5KA 4LF7Q 3P8MC 4JV5Q 1G1JA 3KYQA 1VQ4A 3HTKA 1S40A 2F52A 1M1JB 4A4IA 3PGZA 1RF1B 1MKHA 1I94Q 3BRVB 4R1JA 2WAQE 4LF6L 4Y52H 1GZLA 2YO2A 5CHXA 1PH6A 1H8AA 2KP8A 2R93H 2OQKA 2PMZE 1XTDA 4EX5A 4ME3A 2N1TC 3F2BA 1FJGL 3M9HA 4C3HH 3RK3B 4LNQA 1M7LA 2GN5A 4X6AH 4JOIA 1N7SD 3A2AA 4I1LA 2R32A 3CCEA 1KD1C 1M1KC 1W2EA 3OTOQ 5IYCH 3RK2C 4AYCA 2YTYA 5KTBA 2JA7H 1MFZA 4BY1G 2DGYA 5CCGC 3I2ZA 4MZ9A 4GNXB 2UUBL 3RL0D 2QM7A 3IRBA 4W7ZA 4IFDJ 4JI1Q 4K0KQ 4DR5L 3M9BA 1G51A 4ZKUA 5CCHD 1T2KC 4LWCA 2Y0SE 4P71A 2HYNA 4YCVA 1GL2A 1J2JB 2LKMA 4LF8L 3T1YL 3WMM0 1A0IA 2I5HA 1CKNB 1LYLA 1OTCA 1PH8A 3SGIA 1BKBA 3GHGB 3CF5A 4LF5L 1ZR2A 3VMXA 2GUVA 1U0LA 1G2CA 1JE5A 2OCEA 4DR3Q 3DLLA 5AVTB 2C0WA 4GNXC 2UXDL 2ASBA 2ZTDA 4MNOA 4LFAQ 2GVBA 2EXDA 3O8ZA 1YIJA 1FU1A 3J7ZC 4LFBQ 1HGVA 1TWHH 4JCVE 1NH4A 1Y1VG 3E1IA 5M5YH 4YWMA 5CCGD 3RLNA 3HOWG 3KDFB 2OYHC 4KHZA 3K7UC 2WB1G 5AW5B 1FAVA 1Y1VH 3KFUA 5APXA 3GDEA 1VQHA 4Y7NH 1IC2A 2CKZB 2K5VA 4J15A 1VQCA 3U4VA 1HNZL 2XTIA 4GKJL 1Q1BA 2HHHQ 3HKSA 3A5ZB 2OARA 5AVZB 3RK2D 3H6PA 1QUQB 5BVZA 3J80i 1KQSA 1CI6A 3K8AA 4P73A 2WAQG 1HNWQ 3CD6A 3M91A 2R7ZH 1PH3A 4DR1Q 1Z9FA 2UXBQ 4LC1A 4X62L 1AE3A 4HJ7A 3VMYA 4BA2I 2JA6G 1LTBC 5C4XG 1PFIA 4AQYQ 1L4AA 3HOYG 2BA0A 4A3JG 1PH5A 1YHAA 4HIKA 2VL6A 1WT6A 2JE6I 1LTJB 1Y1WG 3W1BA 2PAJA 4JI2L 3GTJH 1NY4A 1L4AB 4IOAA 4DR6L 1IFMA 1N7SB 2OYIA 1QZHA 3E9IA 3PO2G 4DZOA 1YITA 1LT9C 4AYBE 1VQ5A 1RF1C 2LXJA 3M06A 4RMFA 2E42A 3VP9A 4A3KG 4UY8C 4A3BH 1Q12A 2EQSA 1IBKL 5LMNQ 3P8CE 1Q1EA 1RL2A 2OQ0A 1TWAH 2A45G 3T97A 4APVA 3A5UA 4DV6L 1K0RA 1N86A 1CSPA 4A76A 3T1HQ 1JJGA 1HR0W 2JA8H 1N7SC 4DV7L 1PH9A 1YTZI 1WCMH 1CKOA 3S1MH 4LUOA 2H7HA 4IOCA 4DUYQ 2YKPA 2E43A 1XPRA 4A93G 5C44H 3HOVH 2CPSA 2FFDA 1Y14B 2WPSA 1SQPK 2JA8G 4QQBX 3CC7A 3MUDA 1Q81C 1QVFA 4POGA 2J59M 1LT9B 4JI2Q 1DEBA 1SROA 4HIDA 4RESB 4YY3Q 3OTOL 4L5TA 5IWAL 4DR4L 4JI3L 3P32A 1S72A 1N7LA 1J1EC 3MD0A 3V5BA 2FXQA 3HKZE 1GDTA 1WCMG 5J3BA 4NB3A 4JI1L 4A3IG 1XNRL 1Z47A 3KOJA 4YWLA 1OXUA 4JI6L 4DV3Q 4A3EH 1XMQQ 1EOVA 4NXML 5APUA 1SMXA 4KHXA 2OTJA 1SP4A 3CP0A 2XDJA 3V2PA 1RF0A 1I94L 2KHIA 2JEAI 3CCUA 1Q82C 3RLFA 4N78D 3VTPC 1IZ6A 1W2BA 4C7NB 4NPSA 3GTPH 4A3JH 1X6OA 3HOYH 2YKQA 3KJPA 1SN8A 1LWUC 3NBHB 1VQOA 1A62A 3S14H 2ZJQA 1YZ6A 4P75A 5AVSB 3SWYA 1X3FA 2N1TA 3M3YH 3TNUA 4YHHQ 1URQC 4JYBA 4IFDK 3B5NC 2Q9IA 2FXMA 3NENA 4C3JH 1NTGA 1PYBA 1GKHA 5IP7G 3M0DC 1URQA 1X9VA 2F4VQ 2VW9A 3BATA 5AW2B 3FHWA 1GK4A 2UUAL 2B3GA 1A8VA 3IR9A 1LTAC 1PVOA 1G6PA 3PUXA 4X66L 3MTUE 2WITA 2ZTEA 3HUSB 5HGQA 4EQ5A 4OXPA 3UIAA 1VQDA 2M3BA 3RZOH 4C46A 1I6HH 1QVCA 1PH1A 4LUVA 4WY4B 3PUZA 5ELNA 2BA1A 3HD7A 1PHJA 1SLJA 4POFA 3J80c 2D62A 1EIFA 3RR5A 2E5LQ 5APSA 2WTYA 1KILA 2NN6I 3UDGA 1HNWL 4WY4A 2XNXA 3VOPA 3CCJA 2P1JA 2CFMA 1V9PA 3KF6A 3HOZH 1SFCD 1UE1A 1VPCA 1QL2A 3VYIA 2HODA 2A45I 2KLVA 2N78A 1RY3A 3PUWA 2PP6A 4JBMA 1NTMK 1N34L 4JYCA 2K5HA 3B5NA 2AHOB 2I1JA 2GUSA 2WSCH 2XZRA 2JQOA 4NXNL 3RN5A 5BR8Q 2Q2TA 1DH3A 1OXVA 2CWAA 4IPHA 3I5CA 1GW4A 4KLKA 5IYDG 1Q46A 4JI0L 4A3GG 2V1CC 3H3VH 1URQD 1CSQA 2O1KA 2N49A 5E7NA 1EQRA 3V4QA 2JEBI 5BR8L 2AKWB 2Z4EA 3CCLA 4IPDA 4DV3L 1SFCA 3D31A 2OYHA 1HH0A 3PV0A 1N9WA 5DLQE 3T1HL 3RK3D 4DV6Q 3BZCA 3V4WA 4UP8A 3CMAA 1JTHA 2A1AA 3KDPB 4X64Q 2QGQA 4JV5L 1C7YA 2R3CA 1JY2N 1L4AD 5C0XI 5M3MH 2PI2E 3U50C 2Z6KC 2KYVA 4R4TA 1NU1K 4Y99C 1J5EL 1VQNA 3R2PA 3PO3G 5AVUB 2RHSB 2FKWB 2IHFA 2ID0A 1HUCA 5CCHA 3CCVA 5M3FH 1JUNA 2Z5HA 3PIOA 1XNQL 4DV5Q 4R4QA 3STBC 1IXRA 1HJBA 1IO4A 2ZJPA 1QUQA 2UXCQ 3E0EA 2P7JA 2WPQA 1HZBA 4JI6Q 3G4SA 4GIFA 4QL5A 4JI5L 1ZLLA 2NVTH 4HIMA 5APVA 4L5SA 2Q2UA 4OWWB 3S1QH 4TVAB 3RNUA 4JBWA 1J1DB 3G48A 2O01H 1QL1A 4XA4A 1EYGA 3HD7D 4LF4Q 5GAEC 3GTQH 1IBML 2C9NY 3TYYA 1VQ7A 4QIWE 4B3TL 4W80A 1GU5A 1WOCA 1FZGA 4O0AA 3LIEA 3HKZG 4A3MH 4LF5Q 5AW9B 4QJFA 1K8AC 3RZDH 2Y0SG 2Z6KA 3VMZA 1VQEA 3UDFA 1N73A 1VQIA 1YNXA 1VQ8A 3M4PA 3LIDA 2K75A 1J1DC 1XNRQ 3M7NA 4DPGA 1LTIC 1N73C 1K3RA 2Q3IA 4PMWA 3L2PA 3LW5H 1AH9A 4DAYB 2IT1A 2HQLA 4GLVB 1R9TH 1KL9A 3HUSA 2NZHA 4KHPQ 4JI7Q 2A19A 4C7RA 1K9MC 2IX0A 3KDFA 1EUJA 1ASZA 3PF4A 2D0OA 4GOPB 1X8YA 1IBKQ 1Q8KA 1VQBA 4DR2L 2VS1A 2WSFH 1KRSA 2B63G 2XGTA 3B6YA 1FJKA 4N3YB 5CCHC 5C0XG 3PF5A 3L0OA 3J81i 3N4XA 4A3IH 1GW3A 3S1NH 2KENA 4R4CA 1YJNA 3NELA 4IFDI 1GK6A 2Q5UA 5KJ7D 5APQA 4OX9Q 2YV5A 1WJJA 1T8ZA 1XMOL 3AFQA 1LTJC 3HE4A 1PH7A 2L5GB 1LTGC 1NO4A 2CQOA 1VQKA 1LTLA 1LTJA 1A63A 3KF8B 1NBWA 5AW0B 1JMCA 5LMUQ 3HOVG 4DK3C 1X56A 2MO0A 1S9KE 3CCMA 1RE4A 4DV2L 2E2HH 4JI4L 2R5DA 3PO3H 3RK2B 2R5BA 3HOUG 4LGDE 1YBYA 2OTLA 3HUSC 2JJLA 5C0XJ 1ZV8A 1SFCB 2R92G 2HPCB 1SFCC 1KXLA 1HH2P 1KILD 3H32B 1T2KD 2BASA 2HIVA 3CAMA 2UU9Q 2R7FA 1DX7A 3ICEA 2HLOA 4X64L 3GTMH 4B3MQ 3L36A 4JBJA 2NPSA 1NWQA 4DR7Q 4O9BA 3HD7B 3KQGA 3EN2A 5CCGA 3S2HH 4O2DA 4LUZA 4YHHL 1JCDA 4AUWA 3RLOA 4A3DG 4N78E 5IWAQ 5EAYA 1K73C 1KFMA 1VQFA 4BY1H 3VP8A 3K7AH 1C9OA 1PYSB 5IYDH 4DNIA 1YJWA 1IL2A 3KYHC 1E22A 1JY3P 3V2QA 4B3RQ 4GLXA 1KIXA 2YYZA 4DV1Q 2JA6H 2Z0SA 4I2LC 4BXXG 4XIGS 1A02J 4IJLA 4DUYL 3KF6B 3I4MG 4A3LG 1K8GA 5C3EH 4IFMA 4BBRH 4GN5A 4OONA 1KILB 3AFPA 1HTLC 2XU6A 3HRNA 2KCMA 4BY7H 4M3LA 2K4KA 1MJEA 4YY3L 1L1OB 4AYBG 4DR4Q 1NOHA 1ASYA 2MJZA 2OYIC 1HR0L 4PZ8A 2J58A 2Q7CA 3A74A 3CCQA 4AQRD 4MTNA 2LSSA 3A3YB 1XJVA 3F1ZA 3CMEA 2VNUD 3L35A 3B5NB 5BU5A 1N8RC 1CW5A 1XPUA 3P8CD 2VRSA 2AMCB 1H89A 4WBAA 3J81c 2WWWA 3S1RH 2K14A 4AH6A 2ZTCA 3BZKA 1FZEA 4R4OA 2P2UA 3M85A 2KOGA 4OH8B 1T9HA 3EIVA 1NTZK 1UWVA 5JEAJ 1FOSF 4UP9A 3WWVA 3MGNA 1X55A 4B3SL 4P72A 1N32Q 2P67A 2K52A 4KHPL 4LFCL 3UDIA 1ZR4A 3TQYA 4LF7L 1FZBA 1G1IA 5M5WH 4WY4C 3HE5A 1VQAA 3HOXG 1VQMA 1MZ9A 1GL2B 1WI5A 1EFWA 1LUZA 2D0PA 4BBSH 5AVVB 3F8TA 1Q7YC 2NZOA 2IY5B 5AW8B 2PI2A 2UUCL 4GNXA 4HJ8A 1SQQK 5AJ3L 2FYZA 1G2CB 1SQBK 1NKNA 1GD2E 2IX7C 2Z5IA 3MEFA 3II6A 3GO5A 2JA7G 2KBNA 3BJUA 3L4FA 1YHQA 1CZQA 1W3SA 2W6BA 1RE3A 3A7OA 4WJ3M 5IP9H 1KZUB 2ZXEB 3W1GA 5IYBG 2UUAQ 4JI7L 3L37A 3J7A5 3FKIG 3VN0A 1KHIA 2BH2A 2NVQH 1EQ7A 4GKJQ 5GAHC 2R93G 4TQUS 2QEXA 3DM3A 3CCSA 5AW3B 4WJ4A 2ES2A 1S9KD 1H88A 1X3EA 5JEAG 4BY7G 3ER0A 3ERSX 1PH4A 1SLQA 4JG2A 3TEHB 4JF7A