3M9BA

Crystal structure of the amino terminal coiled coil domain and the inter domain of the mycobacterium tuberculosis proteasomal atpase mpa
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
186
structure length
186
Chain Sequence
SARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQPPSGYGVLLATHDDDTVDVFTSGRKMRLTCSPNIDAASLKKGQTVRLNEALTVVEAGTFEAVGEISTLREILADGHRALVVGHADEERVVWLADPLIAEDLPDGLPEALNDDTRPRKLRPGDSLLVDTKAGYAFERIPLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding-induced folding of prokaryotic ubiquitin-like protein on the Mycobacterium proteasomal ATPase targets substrates for degradation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Chaperone
molecule keywords Proteasome-associated ATPase
total genus 31
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16450 Prot_ATP_ID_OB Proteasomal ATPase OB C-terminal domain
A PF17758 Prot_ATP_OB_N Proteasomal ATPase OB N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3m9bA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m9bA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m9bA02
1XNQL 1PYBA 4JBJA 5IYCG 3CC2A 2YV5A 1TWHH 2JJLA 1LTLA 2N3SA 4DR4Q 4NXNL 4IOAA 3ULPA 3I7FA 3L37A 4NXMQ 2Y0SE 1X8YA 2NVXH 4HJ5A 2A1AA 3CCLA 3FP9A 1WFQA 1KRTA 5GROA 4YCUA 4ALPA 4B3MQ 2C9NY 1Y1VG 1VQ9A 1HNZQ 1Q7YC 1K8GA 2K4KA 5IYDG 4GNXA 1VQ8A 3I2ZA 4JYAQ 1G291 1L1OA 1SROA 4BY1G 1HR0Q 1K3RA 2PQAA 5M5XH 4LF4Q 4JI0L 1J5EQ 1W3SA 4P75A 4JI4L 2F4VL 2JA9A 1KXLA 3KLWA 3CCVA 3A2AA 2R7FA 3F1ZA 4L5TA 3U4VA 1VQ4A 5AVRB 4YCWA 3A74A 5APVA 4A3MH 3HOWG 4A93G 1I6HH 5ELNA 3UE1A 1HNWQ 3IR9A 3I4NG 3VDYA 4AYCA 3I4MG 2OQ0A 2I5HA 3G6EA 3MXNB 2BH2A 4P72A 1AE2A 3KF6A 4JYAL 3M0AA 1V43A 4OX9L 4JG2A 4JI5L 1QUQB 1K0RA 3FKIG 4A3BG 2Z5HA 4JI2L 4DPGA 3T1HL 3PF4A 4DR5Q 3S1QH 3PIPA 2UXBQ 4X62L 3J81j 5DLQE 1H95A 3PCOB 4DR2Q 3CCJA 1XMQQ 4R4TA 4JYBA 1VQNA 2XZRA 1WJJA 4XE5B 2KCTA 5IY0A 2NZOA 4JI7L 3NXSA 3IRBA 3ER0A 2KBNA 1VQDA 1YI2A 4UP9A 3S14H 3L35A 2VQFQ 2XTIA 1JJ2A 4A3JH 3OAKA 3M91A 4A3FG 2E5LQ 2OTJA 1D7QA 1PH2A 4DR6Q 1W2BA 2P2UA 2WB1G 2MFIA 5E7NA 4A4IA 4DK3C 1YVCA 1VQIA 2CKZB 4L5QA 4LF7L 4C7NA 3J7A5 5GAHC 4IFDJ 3D0FA 4NB3A 1Q82C 1CI6A 2D0OA 4LWCA 2IX0A 3TYYA 5C44H 4GN4B 5AJ3L 3K7AH 4AIMA 2BASA 5M5YH 1N36L 5AJ3Q 1B8AA 1IBLQ 4B3SQ 2I0QA 4JI3Q 2UXDQ 4XIGS 1A63A 3NFQA 4YY3L 1D8LA 3KJOA 5BR8Q 1YJNA 4B3TQ 4DV3Q 2WTYA 2R3CA 1PV4A 3TS0A 4AYBG 4MZ9A 2UUCL 5AVTB 4O2DA 1E1TA 3K81C 4DV7Q 3P7KA 4B86A 3M9BA 2NVYH 2RHQB 3H0GH 2B3GA 1YEZA 3TQYA 1OTCA 1VQLA 4A3LG 2BH8A 2W6AA 3GO5A 4LUOA 5IYDH 1KHIA 3S2DH 5GADC 3JAMc 1Y1VH 1B70B 4RG1A 4KHPQ 1H8AA 4OO1I 3M4QA 1CKOA 2VL6A 3HKZG 2RHSB 1V1QA 4PZ6A 3RR5A 1NE3A 5J3BA 3NTNA 1MJCA 2D62A 3J81c 3L2PA 4DAYB 1HZCA 1K8AC 1WI5A 1RL2A 3F8TA 5C4XH 2UXBL 5AVQB 4X65L 3KJPA 2ZJRA 1NWQA 1L1OC 2E2HH 4GLXA 3EBEA 3SWFA 1K9MC 4QGUA 4C2MH 4JV5L 3CCEA 1XPRA 4TQUS 2E2JH 1I94L 2JK8A 2LXKA 2K14A 2ZM6Q 1R9TH 2YTXA 2JEAI 4OXPA 2WPSA 1IO4A 2E8GA 3OTOL 4LUZA 4A3GG 3TK1A 4HJ8A 4IPCA 1S72A 3FKIH 2JA5G 2QM8A 1OXTA 1YYCA 2C9LY 4YWLA 1RIPA 4RESB 5LMUL 3W1BA 3HKZE 2QEXA 4IJHA 2WT7A 3FHWA 4JI4Q 2KHIA 3VN0A 2QM7A 4P71A 4DAMA 3OW2A 1PH8A 1L1OB 5M3MH 3M9HA 1K83H 5M3FH 4LF4L 1G2CB 4UP8A 3H15A 3CF5A 4GNXB 1M1KC 2R93G 2HIXA 5M3FG 1GD7A 5AW5B 1HNZL 5APQA 1SE8A 3CW2C 3PIOA 1FJGQ 1E7ZA 3RZOH 2Q2TA 1I3QH 1OXXK 3UDFA 3NBHB 3AFPA 3HOXG 4WJ3M 1GZLA 4NXML 5IYBG 2NN6G 2VS1A 1YHQA 4NXNQ 4IFDI 4DV4Q 1PH1A 4BY1H 2R92H 3H3VH 2QA4A 2Q5UA 3PUYA 1PH5A 3STBD 1C7YA 4A3IG 3H3VI 2E2IH 1HNXQ 5AVWB 1GKHA 2XGTA 3D31A 5APYA 4OONA 1IBKQ 3DLLA 1NY4A 3HTKA 1IZ6A 1JJCB 5EAYA 5H1SE 3J81i 4DR3L 1ASZA 4X66L 1BBWA 4HJAA 2K75A 1VQCA 1CUKA 1L0WA 3GTMH 2H7HA 2I5LX 1X3GA 1KIXA 1HBWA 1NBWA 2OCEA 2VW9A 1UE7A 4LF5Q 4BXXH 4A3CH 2XV5A 1A02F 3T1YL 1X3FA 2ATWA 3HE4B 3KQGA 4I2LC 2B63G 5M5WH 2RCNA 1IYJB 1GK6A 5GAEC 3F2CA 3CD6A 3LIDA 3V4WA 3PO3G 3PO2H 1VCIA 4X65Q 4GKKL 3B6YA 3J7ZC 1UWVA 3PGZA 3CC7A 2YU9H 4DUZL 1VQ6A 2VNUD 4L5SA 3M7NA 5AW0B 1H88A 1YJ9A 1XMOL 2BA0A 3GTPH 2VRSA 3BJUA 4R4OA 2ALYB 4LUVA 3TREA 4LF8Q 1WYDA 1FOSE 4RMFA 4FDBA 1PA6A 4LW1A 5AW8B 3EN2A 4HIOA 4BY7G 4JOIA 3S2HH 4EX5A 1FVIA 4Y7NH 3CMEA 4HIMA 4QL5A 3RN2A 2B29A 4DV7L 2E43A 4LFCL 3GTQH 4DR7L 2R5DA 4C3HH 5IP7G 2UUCQ 1K73C 4YHHQ 1J2JB 1TXYA 1HR0W 4GKJL 2R7ZH 1PYSB 3ULLA 3UE0A 4GNXC 1N34L 2UXCQ 5JJKA 4JI3L 4B3SL 5IWAL 2V1CC 4JI8Q 1A0IA 1HWTC 3K8AA 2UXCL 3LGJA 4HIKA 2IHEA 4QJFA 2MNAA 1HH2P 4GKGA 1SMXA 5AVSB 1UE6A 2AWOA 2D0PA 4AYBE 4YHHL 1X3EA 2WT7B 3Q8DA 1GU4A 1Q86C 4JI6Q 1U0LA 4I6MC 3S1MH 4WJ4A 2FXQA 3AFQA 5AVZB 1OXUA 5IYBH 3CC4A 4PMWA 4DV6Q 1EYGA 2NVQH 5C4XG 1M90C 3JC66 2KHJA 3M4PA 4DV0Q 4JI7Q 1XMOQ 1HZBA 1XMQL 4BBSH 1SRUA 5HGQA 1PH7A 4P74A 4DR1Q 1HUCA 1YIJA 4DR2L 4DUZQ 3I4NH 4X62Q 3GTOH 2UUBQ 1P16A 1YBYA 4POFA 4POGA 4GKKQ 1VQJA 4JI2Q 4A3MG 3HOWH 4A93H 4IFDG 2ID0A 1A02J 3K7UC 5JEAG 4JI5Q 2IT1A 2PI2E 1VQMA 1NJIC 3PUXA 1ASYA 1FOSF 1EFWA 3HOUH 1T9HA 2LXJA 1GK4A 3M3YH 2CCZA 1NMFA 5IE8A 1SP4A 1E22A 1EQQA 3I56A 1CSBA 4AH6A 3NENA 5JJLA 3CPFA 2Q3IA 5AW9B 4DR7Q 2AKWB 3V5BA 2R7ZG 4LF6Q 1EIFA 2K50A 1U5KA 2UUAL 3GTLH 1H89A 3UDGA 1KL9A 2JA7H 1GVPA 2ZJPA 1AH9A 1IBKL 1GU5A 1GTWA 3KF8B 1I50H 4GN3B 4JBMA 2VUMH 4KHXA 2HHHL 1GM5A 2JE6I 1OXZA 2YO3A 2MQHA 1J5EL 2F4VQ 1SLJA 1JMCA 4UPAA 4JI0Q 2K52A 3W1GA 1YJWA 2IY5B 5C3EH 3F2DA 1LYLA 4L5RC 3GTGH 2Q2UA 5APWA 2VY3A 1VQHA 3KOJA 3G48A 4ME3A 4JI1L 3W5OA 4AUWA 1YITA 4BA2I 5CMZA 4H02A 4B3ML 1E1OA 1VQEA 1VQ5A 3F2BA 2PNHA 1BVSA 1CKNA 1CKNB 1FJGL 3MGNA 1SR3A 4R4IA 1YHBA 5AW7B 1UEBA 1QVFA 2JA8H 1E24A 5APUA 1Q1BA 4DR4L 2R92G 2VQEL 2NZHA 5APSA 4HYTB 4A3CG 4JYCA 1MFZA 4A3EG 1C0AA 2OWOA 2HHHQ 2VZAA 3P32A 4PZ8A 5LMUQ 1BBUA 2HT1A 1YNXA 1FL0A 2IHFA 1T2KD 2P7JA 1YHAA 4GN5A 4IOCA 4A75A 2UUAQ 4LF9Q 5GAGC 4YWKA 2WB1E 3A7OA 5AW3B 2WP8J 4R1JA 5AW2B 5JEAJ 2R93H 3HOYG 4DV1L 3OTOQ 1DH3A 3S17H 3U4ZA 3HOYH 1JJGA 1OXVA 1A62A 4JCVE 4X64Q 3JAMi 1KD1C 4BBRG 2ZM6L 2YO2A 3RNUA 2KP8A 4IJLA 1XPUA 2F52A 5AW1B 4R4QA 4JV5Q 1GD2E 5JJIA 3KF6B 3S15H 1HZAA 4A3DH 3CMAA 4A3JG 2W27A 2UUBL 1L2FA 3BZCA 3RLNA 3KYHC 2UU9Q 1PH9A 2ZJQA 5IT9c 2ZXEB 1VQBA 3ZJYC 2XU6A 2BA1A 5C0XI 1PFSA 3A5ZB 3RZDH 3RLOA 4AQYL 4DV0L 1QZGA 4JI6L 3CCQA 1Q8KA 1PH4A 4DV2Q 1KAWA 5IP9H 2Q7CA 1YZ6A 4QY7A 1MJEA 5LMNQ 1NMGA 2PQAB 2LSSA 3CP0A 3UDXA 3PSIA 1X55A 3TNUA 3PUVA 3PUWA 4APVA 2CWPA 4GOPA 1Y1WG 3VMXA 4C46A 2HIVA 1EOVA 4DV3L 1QZHA 3S16H 3GTKH 1JT8A 4A3KH 4B3TL 4YY3Q 3A5TA 4DV5Q 2VUMG 3I4OA 1SFOH 5AVYB 3NEMA 4NPSA 2UXDL 3O8ZA 1X65A 4JI8L 5C4JH 3B8EB 5IWAQ 2ES2A 4B3RQ 4DZOA 4B3RL 4A3LH 1EUJA 1O7IA 3S1RH 1PVOA 1N34Q 4GOPB 4GKJQ 5APXA 5AW4B 2EIFA 3HFZB 2N78A 4KLKA 4LF7Q 2Q2IA 3T97A 5FLXc 1FAVA 3VMYA 4P73A 1WOCA 4LFCQ 1N33L 2MO1A 1X6OA 3E9HA 4HIDA 3OYYA 3K80C 1KQLA 5LMNL 1IL2A 3M4OH 2WAQE 2GN5A 2ZTEA 3M0DA 2JA8G 2Z5IA 5C0XG 1KRSA 4LFBQ 3P8MC 2A8VA 1NTGA 3K0XA 4LF8L 3ULJA 1Y1WH 2ASBA 1SN8A 4EQ5A 2PMZE 2Z6KA 3NELA 2L15A 1KC8C 3G71A 3ICEA 1Q81C 2Q2HA 3EIVA 1XPOA 5IYCH 1S40A 1MUUA 2DGYA 2GVAA 3GDEA 4Y52H 2ZFCA 5IP9G 3HE4A 2JA6G 4OX9Q 1Z47A 1X56A 2EXDA 4GLAC 3VTPC 4OWWB 3T1YQ 2JA7G 3UIAA 4A76A 1XTDA 2N49A 1X9NA 2WFWA 1EWIA 4KHZA 4OWXB 5FJ8H 1TWGH 4X64L 4DV1Q 3V4QA 3VYIA 2YTVA 4A3DG 1G51A 2E42A 4X66Q 3S1NH 4KI0A 2K5VA 3NMDA 3CPWA 3KDFA 1WCMH 2OQKA 4C3IH 3PUZA 2H5XA 4BBRH 5HY6A 3AYHB 3J80i 3J80c 3GD7A 4K0KQ 2GVBA 1NAFA 5FLMH 2R7DA 5AW6B 1HR0L 2VQEQ 4MTNA 2K5NA 1MKHA 4DV4L 5FLMG 4BBSG 3CXCA 4HJ7A 4BY7H 5APTA 3RLFA 5K36G 1JE5A 2EQSA 3HOVH 2YNYA 4PG3A 4GT1A 2CFMA 1VQPA 4GS3A 4JI1Q 1KQSA 1N9WA 2JA5H 2JEBI 3HOZG 1VQFA 3DM3A 1TWCH 1S3OA 1XNQQ 4XTCS 4LNQA 3VMZA 3PO3H 3HE5A 3TNUB 2A19A 4DV6L 5FJ8G 4K0KL 3STBC 2WAQG 4GOPC 3M85A 2K5HA 3U58A 2QGQA 1IBMQ 1Q1EA 3PV0A 1CSQA 4LF6L 5C3EG 5C0XJ 3S24A 1N32L 3A3YB 4IPGA 4TVAB 3U50C 2ZTCA 5ELOA 3KDPB 4GLVB 2IX1A 1LUZA 4JOIC 1I94Q 1FGUA 3LIEA 1E3PA 5IP7H 4DUYQ 1DGSA 3CCRA 3UDIA 1OWAA 3HKSA 1GO3E 1VQAA 2Z0SA 1JB7A 4PZ7A 2RF4A 4A3IH 5LMNW 2YTYA 3HOZH 4QQBX 4C3JH 3E9IA 4O0AA 1Y14B 4DR1L 1MV8A 3H0GG 1EIYB 2N9BA 3CCUA 1J6QA 1BKBA 3RN5A 1V9PA 1VQOA 3CCSA 3HOUG 1JNMA 3WWVA 1VQGA 3HOXH 1Q12A 2R5BA 4HJ9A 1VQKA 4DK6C 2R6GA 4LFBL 4KHPL 3GTJH 2WPRA 2WWWA 3TRZA 3HE5B 4YCVA 1HNXL 4LFAL 2R32A 1XNRL 3PO2G 1XJVA 1A8VA 3ERSX 5GQOA 3M06A 2CWAA 1LM0A 4MNOA 1N33Q 2B63H 4OO1G 4UP7A 4BA1I 3TEHB 4A3KG 1TWAH 3BZKA 1PH3A 4BXXG 5BR8L 4AQRD 1S9KD 1WCMG 2DUDA 2CQOA 2F3IA 3PF5A 3TS2A 1C9OA 1IBLL 4LC1A 4R4CA 3KFUA 1N36Q 4A3FH 1HZ9A 3L7ZC 4IPHA 1CI6B 2KCMA 3I5CA 4DV5L 4A3GH 4M3LA 4C7NB 1OXSC 2C35B 1P8LA 3L36A 2YYZA 1VS0A 2WPQA 1S9KE 2ZTDA 3L0OA 3A5UA 1N8RC 3KDFB 2JA6H 3AEVA 1PH6A 4DR6L 4LFAQ 2E5LL 3A0JA 1XNRQ 1I5FA 1AE3A 2VQFL 4A3BH 4DV2L 1UE1A 3HOVG 4AQYQ 2KENA 2N8NA 1VQ7A 1CZQA 3CAMA 2HQLA 1JUNA 2JQOA 1T2KC 5AVUB 2AHOB 1SLQA 4JBKA 2NVTH 1CSPA 1QVCA 3AQQA 1HJPA 1Q46A 3CQZH 3I55A 2UU9L 3I4MH 5M3MG 4UY8C 1QVGA 4DR5L 5AVVB 4IO9A 3T1HQ 2I5MX 2Y0SG 1TWFH 1EQRA 3E0EA 3MEFA 2IPPA 2Z6KC 3SGIA 4DKAC 4EOTA 1QUQA 2OTLA 2P67A 1X54A 3BU2A 4DUYL 5AVXB 4LF5L 4OWTB 3CCMA 4JC0A 3G4SA 4A3EH 1CKMA 4YWMA 2AMCB 3MD0A 1B7YB 1HNWL 1G6PA 2AWNA 1N32Q 1IXRA 2MO0A 4LF9L 4J15A 5C44G 4DR3Q 1MIUA 1UE5A 1IBML 4X6AH 1Z9FA 4JBWA 4DNIA 1PHJA 4IPDA 1HJBA 2JJQA 2NN6I 4QIWE 2PI2A
chains in the Genus database with same CATH superfamily
1NTMD 2YKOA 3PH0A 1ZYRC 4N8X1 3L73G 4TSSA 5CCGD 1NAPA 3H1KD 2OXPA 4JVZA 4HJ5A 4NPDA 1RE3C 3MUDC 2H89C 2C9NY 5J22A 5IYDG 5CCHC 3I2ZA 5NUCA 3H1LE 1SROA 3S2HB 1DZ1A 1HR0Q 1CHQD 5M5XH 2PQAA 1GL2D 4JI0L 1EWHA 1Q86Q 4P75A 4ASVA 2HODB 4UHVA 4X3KA 4JBZA 4IUQA 2ZXOA 3IF4A 1V1PB 5IT9E 1K3BC 1KAAA 5T1GA 5APVA 5KLIC 2F0LA 1KB9E 2K7VA 1DM0B 3WOFA 3HOWG 2KLVA 3MC0B 1GW4A 5FK9C 1I6HH 5E3FA 3F5HA 1YQ4C 5KLIB 3GHGA 5KAIH 1LTTD 3HG9A 3I4LA 3VDYA 4IUNA 5LL6S 5EJWA 2QW7A 1STHA 3RZDB 1SYBA 3KF6A 4F88A 4JI5L 4H44C 3CCVP 2OTJP 2Z5HA 3VMAA 2BDOA 3FKIG 3T1HL 4DR5Q 1JM0A 4A3MB 4X62L 3L75D 2EJMA 5JJZA 3J81j 1GL2B 3VOPA 1F2YA 3MP7B 1ZEQX 5E4WC 1ZOYC 3U9SA 4JYBA 1U4PA 2XZRA 5M1BA 1WD1A 4JI7L 2NZOA 3NXSA 2JWDA 3ER0A 4EQOA 1VQDA 2Z4IA 3S14H 2PQEA 3HUSB 5CV5A 4YXWH 1AZQA 4L6TB 2TSSA 3SHLA 4CDDC 2WB1G 2LR2A 2W83C 3G6EP 3L74J 1JTHA 5CBEE 5GAHC 3D0FA 4NB3A 1ZRTD 1W6JA 2HUGA 2NVYB 2D0OA 4ZKBB 1FBMA 2BCCJ 2Q3EA 2Z4EA 3K5BA 2FJ2A 5C44H 5AJ3L 4HB1A 2BASA 2ZXPA 4LMQD 5AJ3Q 1B8AA 5IGEA 2UXDQ 3T13A 2FMCA 1D8LA 5BR8Q 1GUGA 4DNTB 2FXMA 1H9SA 3TS0A 1JMBA 4H44D 1PV4A 2OYHA 2UUCL 3S16B 4O2DA 1AP0A 1E1TA 4B86A 1OTCA 1VQLA 4BRYB 2WIIB 3H0GH 2B3GA 3TQYA 4DR7Q 3CD6P 3OPOA 2BH8A 2W6AA 1SNDA 1S5LX 3H1IJ 4IFMA 1KHIA 3OHXC 4LUOA 4A3IB 3S2DH 2XSCA 1BE3D 4KHPQ 4DCKA 2NVXB 4RHRA 1SQVE 2DNEA 2L12A 2EDGA 1HTPA 1U4LA 1V1QA 3J81c 1MJCA 2D62A 3DHQA 1HZCA 3FWLA 1TS2A 1SFCC 4X65L 3KJPA 2ZJRA 1L1OC 3S2DB 3SWFA 1NKZB 4QGUA 1L0NK 3PTZA 1R4QB 2RA4A 1XPRA 3A8JE 3I73A 1I94L 2K14A 1PRTC 1R9TH 2YTXA 1ZMEC 2KCNA 1YHQP 2WPSA 2E8GA 3OTOL 4A3GG 1GUNA 4FYDA 1LTGD 3OWFA 3FKIH 2JA5G 4TT3H 1JY2N 3MXGA 2E76C 1CZWA 1OXTA 1QNUA 4A3GB 1KLGD 1ESRA 2C9LY 3NQTA 1I50B 2QM7A 4DAMA 1KILE 3VP8A 1L1OB 1EY0A 1ZV8A 3M9HA 2F0UA 1G2CB 5L37A 4GNXB 1BO0A 3VR3A 5FO9B 5AW5B 1PTOH 5APQA 3QOLA 1SE3A 3CW2C 4NPFX 3D3RA 5I6YA 1WCMB 2B9BA 3NBHB 3HOXG 5EGTA 1GZLA 4ZK9B 2AQ2B 2KZJA 3CQZB 4DV4Q 1BCPF 2FINB 2B2VC 3TSIA 1D5ZC 1GOZA 5EBDA 1NTKE 1HNXQ 5AVWB 2XKMA 1GKHA 1B9NA 1FJKA 1LACA 1GXDC 4OONA 3RD4A 1Q90A 3HTKA 5JAVA 3G7LA 5TISH 1LTGC 4HJAA 1KB9I 3L75G 3Q3DA 2J59M 1L0WA 1CUKA 3W3AA 3GTMH 2H7HA 2K88A 1BCCG 3JAML 2XV5A 1SMYD 2AQ3B 2BCCE 3DM1A 3Q22A 1K8MA 1LTTC 1IYJB 1GK6A 3PO2H 1LTAD 3V4WA 2VB3X 3PO3G 2ZYAA 5CR3A 3PGZA 3CC7A 1VQ6A 2VNUD 3BVZA 3T16A 4O42A 5AW0B 1QB5D 1K05A 5KLVJ 1YJNP 2N55A 2ALYB 2A68D 4OIJA 2WKCA 3TP5A 1FOSE 5C3WA 1G1JA 3MTUE 2QJKC 1JMMA 2L9HA 4WRDA 1FVIA 3CMEA 2QJKB 4HIMA 4QL5A 1EZVG 2OARA 2E43A 4DV7L 5DAUA 3GTKB 3II6A 1TXYA 4GKJL 2IBZG 4QMGA 4E6IA 5JJKA 1STBA 1NOHA 5CCGC 4JI3L 5C6AA 4I7ZB 1M56D 2WZ7A 1LWUC 3K59A 2I46A 2RKLA 3QH9A 1FNVA 5AVSB 2FBWC 1X3EA 1PGOA 1N2DC 1Q86C 4CKEA 3VA5A 1LNQA 1N7SA 5IYBH 3CC4A 3HD7B 2EVBA 1EYGA 5C4XG 2EZVA 3JC66 3EFGA 2QCPX 2KHJA 2A45G 2CW0D 1LT9B 1B9MA 3ITKA 1SRUA 4DR1Q 1HUCA 1YIJA 3CI9A 4DUZQ 1ZP0C 3A8IE 1FZEA 3BYTB 1BGYE 1VF5C 5C0XH 1YBYA 2AQ1B 1IYUA 4IUVA 4POFA 4POGA 4A3MG 2JA7B 3A55A 2CPSA 1NJIC 1ASYA 1EFWA 1MD2D 1SFCA 1HGVA 1YTZI 4WY4A 2CCZA 1SNPA 1EQQA 2CPBA 3E5SA 3I56A 3NENA 3CPFA 3BCCD 3DUZA 2K04A 2V4DA 4V190 4CKCA 2FFKB 1H89A 3GV6A 1S5BD 4JBMA 1GU5A 2H4OA 3S1NB 2KI7B 2PNRC 3SVMA 1IK9A 1I6HB 2JE6I 2XWJB 3N4XA 3N7NA 1AN8A 4Y99C 3LWUA 2F4VQ 1KV4A 3NHHA 1YJWA 1TS3A 4UB8E 2D2CB 5C3EH 4L5RC 3A7LA 4JYAL 5KLVE 1VQHA 4ME3A 3W5OA 4CPGA 5CMZA 1FNUA 4B3ML 1E1OA 1VQ5A 2PNHA 1SQPE 1CKNB 4C56C 3H32A 1P84E 4R4IA 1SQVJ 4FF3A 4HYTB 1U57A 3RK3C 4K8JA 1JY2O 1TWCB 5LMUQ 1BBUA 2HDMA 3EFXD 2QJYB 1FL0A 5C4HA 4GN5A 4IOCA 4A75A 2EY1A 3KBXA 2M5AA 3C8VA 1FZCA 3ONAB 3L74D 3V2NA 3RK2C 5JEAJ 1AJYA 3S17H 3U4ZA 1M1JC 3H1HD 1OXVA 1EDIA 1ZN5A 3JAMi 1LV9A 1KD1C 4BBRG 2E74B 1XPUA 3GG2A 1GD2E 3S15H 1HZAA 1MFTA 4ASWA 2VXWA 4A3JG 2GUSA 2W27A 1H0TA 3CCQP 3GTPB 2IYPA 2K5DA 1ENFA 2XU6A 2BA1A 2F0NA 3MXNA 2N1TC 3U59A 1KTMA 3RLOA 1CFMA 1HTLD 2N1TB 3I4MB 3B71A 4YIJA 2A06E 2A6ED 1Y1VB 1MJEA 4DXGA 2WPVB 1NMGA 4R8IA 3PSIA 1ESFA 1X55A 3PUVA 3PUWA 1KXLA 1NTZD 4DV3L 1QZHA 1RY3A 2HD3A 4C3HB 1SQPJ 4YY3Q 1ZR4A 2VUMG 4DV5Q 3I4OA 3IFTA 5AVYB 3NEMA 5BN5A 2Z6BA 2ES2A 3QWNA 4B3RQ 4DZOA 5IOCA 3GW6A 3S1RH 1PVOA 4GOPB 4GKJQ 1TVXA 5AW4B 1RD9D 3HFZB 3T97A 1N73B 3MZWB 3IKJA 5J1ZA 1N33L 4MTKA 4A3KB 2MO1A 3K80C 3M4OH 1BGYD 2RCFA 4RGOS 2JA8G 1SEBD 3H1KJ 1IC2A 4IALA 1FC2C 2A8VA 3CX5H 1NTGA 2EY2A 1EOTA 4UB6H 2G9HD 4MIUA 2OT2A 1KC8C 1EIGA 1SN8A 5H2FH 2Z6KA 3JCUH 1A3VA 1A3UA 1HF9A 1F9SA 1I4XA 4ZKUA 4BY7B 2GVAA 3I91A 1STYA 3GDEA 4Y52H 5IP9G 1X56A 3VA7A 2I1KA 3C46A 3WOEA 2E75D 3JAME 1HUNA 4KHZA 1PGQA 1E2WA 2A6EC 4Q5VA 4X64L 1LWUB 4DV1Q 2JP1A 3AE6C 3IFMA 1G51A 2F3WA 1CHPD 2M5AB 1WCMH 2OQKA 5G3LF 1O80A 3AYHB 1SQVG 3K5OA 1MGSA 4DV4L 1MKHA 4RWSC 2NPSA 1QL1A 1LT9C 1IFPA 4PG3A 2ZXXA 3BG3A 4H0LC 1KQSA 4TKOB 1PV3A 4QB4A 3U1AA 1SBBB 3WMM0 2HCIA 1RHPA 2XIWA 5BN4A 1VQFA 1SJHD 3H1KE 4IL6E 3VMZA 1S5ED 1G1IA 4DF7A 2OYHC 1EYAA 5DJUB 2QGQA 2K1AA 4LF6L 1C48A 1I4GA 3GTQB 3TBIB 1LUZA 1X79B 1IFJA 1NTKD 4JOIC 1I94Q 3HOYB 4Q0FA 3SE0A 1FZCC 2NTSA 5IP7H 1FD7D 1I4HA 1GO3E 3H1LJ 1IHZA 2Z9HA 1VDZA 5D14A 4PZ7A 2RF4A 3KZIH 1SJED 4EI2A 2H88C 1NTMG 1A15A 4O0AA 1K73Q 3H0GG 1IFDA 5B66E 1J6QA 1NTZG 4N78E 2E76D 4DT0A 2OYOA 1GUOA 2DNCA 3CRLC 3NTIA 3VYTA 1VQGA 1Q12A 3L71D 2R5BA 2DJFC 4CDFC 4KHPL 1LLRD 2WPRA 3TN2A 5B5EH 2IDBA 5GQOA 1YNJC 3LWEA 3AMUA 4G57A 1NHLA 1PP9D 1USEA 3GF3A 4HKZH 4IZ8A 4UP7A 5C3XA 3KK7A 1E79H 5KAIE 1SFOB 3MAQA 5BR8L 4AQRD 5B5EE 2CQOA 4ODGA 2KUBA 1C4QA 1FJPA 4IPHA 3DWPA 2C35B 1N8RQ 1X3QA 4RKLA 1TIID 2PRRA 1EY6A 1TKWB 3OMGA 1BCCD 1HA6A 4Y28J 2R7ZB 4DXFA 2F0KA 3A5UA 1K04A 3V2QA 1ET6A 3D4RA 1M1JB 3AEVA 2GUVA 1BGYJ 2WV6D 4WB4A 1NR2A 3A0JA 3CRKC 2O1JA 4RKUJ 2DN8A 4HH2A 2DY8A 1UE1A 3HOVG 3SWYA 1S3JA 1CZQA 2FYUK 1KD1Q 2O01N 1SLQA 4OO1G 1QVCA 5LHY1 3I4MH 3FGAD 1HJPA 3GV3A 4WJWA 2FY8A 1EY8A 3BASA 5M3MG 4UY8C 3S1MB 4DR5L 2JKVA 1TY0A 2I5MX 1N7LA 4KY7A 3T1HQ 3MEFA 2Z6KC 1RE4A 1RF1C 4OWTB 3E3XA 1CKMA 1B7YB 4FXGC 4I65A 2D2CC 1AQTA 1TQOA 4J6HA 4J15A 4F8MA 3CCEP 1TU3F 3DXJC 4DNIA 2PO4A 1YITP 4B9WA 5GROA 1EDJA 3AU7A 1PYBA 4JBJA 1IJDB 2PFXA 4RCOA 4C1NK 1QX8A 5IYCG 4A3EB 3CC2A 1RQVA 2B88A 1STAA 1TWHH 3H91A 3DMUA 3L37A 2F0IA 2A1AA 1VMCA 1WTPA 1CM9A 2B87A 1Y1VG 2K4KA 1VQ8A 1G291 2F0HA 3HEJA 4LF4Q 3E1RA 5D65A 1ONLA 4J8QA 3V2PA 1S5LH 3KLWA 3CCVA 1ENAA 2R7FA 4L5TA 4EQNA 5J39A 4XXEA 5KEEA 2JA8B 4A93G 3PIP3 3W67A 2YKQA 1RF1B 5KIXA 3ICEA 3A8KE 2F1MA 3MXNB 2K33A 1AE2A 3Q23A 3M0AA 3PO2B 4M8AA 1PFMA 1QUQB 1K0RA 2F0DA 3KYQA 3HS0C 4JI2L 4DPGA 1HRJA 3S1QH 4IUTA 3LNNA 4I7AA 5DLQE 1N86A 5BVZA 1PP9E 2B2YC 4R4TA 1J8IA 3CCJP 4XE5B 1LT5D 3IRBA 3L73J 2KBNA 4GODA 4L73A 3L35A 4H7BA 2XTIA 1WTWA 4QIWB 3M91A 4A3FG 3BCCJ 2BE5C 2R92B 4OGQB 2MFIA 5E7NA 4A4IA 4DK3C 1YVCA 1VQIA 4L5QA 1ZXTA 2KZIA 4W7ZA 4EQPA 1Q90D 1NTMK 1B3QA 2EPBA 1O7ZA 3K7AH 5JPMC 1VQ4P 2OYIC 3FX0A 2WINB 4B3SQ 2IFNA 4XIGS 1A63A 3NFQA 5TJHA 3UI2A 4YY3L 3KJOA 3X3NA 1RF2D 2B8FA 4DV3Q 4AYBG 1S5FD 5AVTB 2D9UA 1AZPA 3K81C 2RHQB 5C4XB 1YEZA 2QJPC 3AE7C 1PXUA 1VQ9P 4FVMA 5CBOA 1JEKA 3M4QA 2YU9B 3CCLP 4CDEC 3OIPA 3I55P 4M1UB 3L2PA 3JCUE 3NTNA 3CXHH 2ZT9B 4DAYB 2LY7A 1A6XA 2K9JA 1HFGA 4W80A 3L9AX 2XDJA 5C4XH 2UXBL 5AVQB 5CYUA 3EBEA 4ZCKA 1JOKA 2MJZA 1N73C 3CU7A 4TQUS 1PFBA 2ICIA 4IUUA 2L91A 2WQYC 4DJGA 1KDAA 2JK8A 2WSEH 3AEAC 2KLUA 2LXKA 4PMCA 1URQB 2JEAI 4XDXA 1JORA 1B53A 3TK1A 1S72A 1RF1A 3H0GB 1JCDA 3EQLC 2KA7A 5D3IB 4CGYB 3FXEA 5CGKA 2D5DA 1HQRD 2RBMA 4RESB 1EDLA 3W1BA 3HKZE 5LMUL 4IJHA 2WT7A 2OYIB 2ZT9D 1XXGA 4B9XA 2R44A 4HJGH 2W6JH 1UIXA 1NH4A 4H0LB 5M3FH 3H15A 1SS1A 3Q5PA 1M1KC 2KOGA 2HIXA 5M3FG 1GD7A 4RO0A 1HNZL 1STEA 1JQYD 1SE8A 2Q2TA 3USSA 1PTOD 2ZXRA 4C3IG 1X32A 4WJ3M 1O78A 3CCSP 2NN6G 1YHQA 1SQBK 2P58A 4Y99B 4NXNQ 1PH1A 4BY1H 2R92H 4IFDI 2RVLA 3PUYA 1YNNC 1PH5A 3J80E 4RCNA 4A3IG 1C7YA 3D70A 4OIKA 2K01A 2NPSD 3TP6A 2O1KA 4H13B 3DLLA 5IODA 1NY4A 1JJCB 1ASZA 1BBWA 2Z4HA 5KJ7C 4LJZC 2K75A 5CV7A 1EWCA 1EL0A 3RK2B 3PQIA 4D6TE 5M3MB 2I5LX 1PZID 4IFDH 4LF5Q 4KKTA 1F9RA 1A02F 3ZYYX 3HE4B 1PTOB 1UIIA 5I9PA 1WVLA 3A0HH 3VR4A 5IGCA 4XQNA 5GAEC 3CD6A 1VCIA 2K37A 3CWBE 3TGUE 3B5NC 1HTLC 3B6YA 4X3SA 3J7ZC 2YU9H 5EPKA 4DUZL 1J1DB 1J1EB 1H88A 2I1JA 1JCKB 2VRSA 4R4OA 1ZRTE 1EXIA 1II3A 4RMFA 1QG7A 2CK3H 1EZ6A 2M00A 3S14B 1T6AA 2AEFA 3L75E 2PAJA 3HOZB 4LFCL 3AE3C 4C3HH 2H8PD 5DM73 3A54A 3FEWX 2R7ZH 4WWIA 5KJ7D 2HPCB 3QR8A 2RN0A 5E4XA 4KY6A 2A06D 4GNXC 1N34L 2KUMA 1N7SD 1A0IA 1HWTC 3LGJA 1SMYC 2NPSC 4H44B 5IGGA 1IZNB 2IHEA 4QJFA 2MNAA 4DAVA 2D0PA 4HIKA 2K5QA 4J1MA 2WT7B 2OYIA 3Q8DA 1I4QA 1U0LA 3FPPA 1BE3J 4I6MC 2IYOA 3S1MH 1KTKA 5AVZB 1AW7A 3H09A 2SOBA 3PMFA 1CZGA 3RMHA 3KLRA 2VUMB 1M90C 2F0SA 2KQ3A 2L1BA 3SEBA 3B5NB 4R4MA 3OJAB 2ENBA 4OEMB 2IX3A 1XMQL 3GTGB 4P74A 2LXBA 3BCCG 1HVVA 4C1NI 4DR2L 1URQA 1P16A 5FO7B 2A74C 3M7GA 4A93H 1RODA 2ID0A 1A02J 1O7YA 5JEAG 3AE5C 4IOIH 3PUXA 4HCEA 1NTKK 3H1LG 1SDFA 1SNMA 1GK4A 5EQ0A 1E22A 1L0LJ 1YJ9P 2K9JB 2Q3IA 5AW9B 2G9DA 1IL8A 1JOOA 2AKWB 4DAYA 1D6EC 5C5LA 3UDGA 1KL9A 3RK3B 1GVPA 4QCLA 1DEEG 2X6LA 4KHXA 2HHHL 2YXQB 4N3YB 4WY4D 2JP3A 2MQHA 1J5EL 2O01H 3QIAA 5DNFA 2QIWA 3F2DA 2MKVA 3VP9A 1NAYA 1LYLA 2CW0C 2RDHA 3BZDB 5APWA 2VY3A 1SYCA 2PZTA 3KOJA 1YITA 1KB9H 4AUWA 1CKNA 2WSFH 1YHBA 1UEBA 1KYOD 1QVFA 2JA8H 3S9OA 5APUA 2A69D 5D3DA 1Q1BA 4DR4L 2N88A 2R92G 2VQEL 1OZHA 2NZHA 1L0YB 2B63B 2K1BA 2XRSD 1FS0E 2FYUG 1NR4A 3P32A 2VZAA 2I07B 2HT1A 1SQPD 2P7JA 1STGA 3NK9A 2UUAQ 4K2KA 3H1JJ 2WB1E 1EXJA 5AW3B 4KMUC 2R93H 1GUWA 2RDGA 2DW3A 4IQZA 3OTOQ 3HOYG 1RE3A 3MUDA 4L76A 3HOYH 3P8CE 3I3CA 2K3RA 4AYBB 1YNJD 2ICEC 2F52A 1I4RA 2FHTA 2AXCA 4A3DH 3P1HA 3CMAA 1IYVA 2EYPA 3ND8A 2C0WA 3RLNA 3KYHC 1YNND 5JVH3 1PH9A 3U1CA 1ILPA 1QNKA 1VQBA 3ZJYC 1N7SC 1ZLLA 3GTOB 3BDCA 1LTJB 3ZDMA 3SK6A 3HD7C 4O9BA 5C5MA 3B5NA 4DV0L 4DV2Q 2XNXA 2Q7CA 1YZ6A 5M9OA 4DOJA 4QY7A 4A3DB 3HGBA 5A2QE 1SNOA 1TWFB 5LMNQ 5FLXE 1L0LD 2EXZA 3C3LA 2LKMA 4Z1MH 3N6RA 1Y47A 1JCCA 1SE2A 1BSNA 3VYUA 1Y1WG 3GTOH 2HIVA 1EOVA 3Q5RA 3GTKH 1X22A 3NBHA 2UXDL 1SFOH 4NPSA 2O01J 2BEZF 2HYNA 5K5GB 5IWAQ 2XNAC 1EUJA 1CW5A 1O7IA 3CL3D 1SQVD 1HQMC 5KRUA 3WUVA 2N78A 2SNSA 2HPCA 1CA5A 2Q2IA 2KXPB 3C1LA 2AUJD 1X6OA 3H1HJ 1IL2A 3OYYA 3BRVB 2GN5A 2Z5IA 2FMMA 3OA7A 5C0XG 4LFBQ 2K5WA 1S1CX 1NTZK 4LF8L 3OW2O 1YIJP 3SWKA 1DXMA 3NELA 3HRZC 3G71A 3MFYA 1DEBA 1ICWA 3EIVA 1S40A 3R4YA 1E2ZA 2JA6G 2EY6A 3TDKA 5EPLA 2D2CD 1SYGA 4A76A 1NU1K 1XTGB 2N49A 3HOUB 4OWXB 1J9OA 1KILD 4PV1D 1NTKG 3VYIA 1BQQT 2AEMA 1KFMA 4X66Q 2BE5D 1BCPB 2K5VA 3NMDA 5EBCA 1LTRD 1PFNA 3PUZA 2H5XA 3V96A 2E2JB 2OYHB 3GD7A 1SQQD 3AECC 4UB8H 1X3PA 2GVBA 4C3HG 5FLMH 1HR0L 2K5NA 3CXHE 2JWAA 4IURA 4KD4A 3CXCA 3L71G 2QDBA 3SK8A 1JE5A 2OQQA 2YNYA 1SQPG 4IL6H 2ZYGA 2CFMA 1VQPA 4GS3A 2P10A 5ELBA 4JI1Q 1EQVA 1N9WA 3HOZG 1JB0J 3VR2A 3CC7P 1VQ6P 2H43A 3D6WA 5JOBA 3PO3H 4XTCS 1BCPD 3E6ZX 3NWTA 4LNQA 2A19A 5FJ8G 3FKIB 3STBC 1HUMA 1USDA 5KAFH 2WAQG 4X3UA 1AVYA 3AEDC 1IBMQ 1Q1EA 1NUCA 1CSQA 3PV0A 1KDBA 1LTBC 5EKKA 3S17B 3BS1A 3Q1MA 3A3YB 5GTIE 1QE6A 2DJGC 2B2TC 3U50C 1GMJA 4OL7A 4MN3A 1S2EA 4ZAIA 4U3FD 5BU8B 1Y8OB 2E2IB 1FGUA 1E3PA 3AEFC 1CI3M 1BUVT 3A0BH 3SDZA 3CCRA 3MA2B 3HKSA 1VQAA 1RCVD 1CA6A 1K9MQ 1A3TA 4A3IH 2B2WC 2WAQB 5LMNW 2YTYA 1IK7A 4C3JH 3E9IA 1MV8A 1Q2NA 2N9BA 4DFAA 1BKBA 3SSUA 4YPCA 4IPDA 1VQOA 3CCMP 1JNMA 2FKWB 4KN4C 3HOXH 5I2XA 2A06G 4KKUA 4DK6C 4LFBL 1AFPA 3TP7A 3TRZA 2A5HA 3PO2G 1XJVA 3ERSX 3M06A 1GHKA 1LM0A 1H9RA 3GTMB 3TEHB 1TWAH 3BDLA 3H94A 4KKSA 4U673 5CMDA 5CV6A 2X69A 3WUUA 4GZYC 4P2CB 3D4DA 1IBLL 4LC1A 2NPSB 3L7ZC 1L0LE 4A3GH 1G2TA 3C1EA 4C7NB 1FZAA 1P8LA 3L36A 2YYZA 4BBRB 3H1JE 4ZUIA 2XN9C 4K6LA 4RGTA 2E75C 2WPQA 1S9KE 2ZTDA 3L0OA 5CCHD 1N8RC 1JC7A 1E0BA 3K5NA 4KV6A 1DYQA 5EPJA 1PH6A 1XNRQ 2E5LL 2M0BA 4A3BH 2GA1A 4DV2L 4NW2A 4PNYA 1M4VA 3CAMA 3L4FA 2HQLA 4RGNA 1PIXA 5AVUB 2NVTH 2X6GA 1CSPA 1LWUA 2VB2X 4PJ0H 1YTZT 2ZJSE 4WFN3 1W5CE 1QVGA 1B3AA 5AVVB 4G7ZC 4WBAA 1TWFH 3E0EA 1QUQA 1RTOA 2UWJE 1OW8A 4RFBA 4DUYL 3RBZA 3ND9A 1S72P 3CCMA 1NO4A 1VQOP 3G4SA 4YWMA 1L0NG 1G6PA 2AWNA 2MO0A 2F03A 3DWAA 2HLOA 4DR3Q 4JBWA 1M7LA 3CHBD 4A3CG 3H3VI 1SYFA 2MHVA 1N7SB 2PI2A 1EZVI 4DV6Q 1GUSA 3RUZA 3HRNA 1Y8AA 3L70D 1LTLA 2LS01 2N3SA 4DR4Q 1LT3D 4IOAA 2QEJC 1FZFA 4NXMQ 1Q7YQ 2F0QA 3I7FA 3H1ID 1X8YA 5IGDA 2NVXH 3CCLA 3FP9A 2Q9IA 1FDOA 2B87B 4ALPA 2YIUB 1R8EA 1LT1A 2Y0DA 1K8GA 1G2CA 4GNXA 3AB9A 3WDNA 3I56P 3IAYA 2WB1B 1K3RA 3VYRA 1S4ZA 3MHVA 1J5EQ 3B5ND 4JI4L 4X3TA 2JA9A 1JWUD 2BCCD 3A2AA 2J0TD 1XX8A 1KDCA 3F1ZA 2NZ1D 3QG1A 4YCWA 3A74A 4A3MH 1LTJA 5ELNA 3MIWA 3UE1A 1HNWQ 3ABVC 3IR9A 1D1KA 3KXDA 4AYCA 2I5HA 2BH2A 3HZXA 2J4XA 2R3ZA 1V43A 3HP3A 4ILWA 4JG2A 4OX9L 4A3BG 5KGUA 4OH8B 3FMCA 4NDXA 1H95A 3T4AC 4DR2Q 1H9JA 3L75J 1Z6HA 3CCJA 1XMQQ 4OWFA 2A69C 1WJJA 2KCTA 2IBZD 1LTIC 2V7QJ 1KNEA 1YI2A 2F4IA 4GOEA 4UP9A 2FYUE 4N6JA 2VQFQ 1M1JA 3TSSA 1JJ2A 3OAKA 1D7QA 3DWQA 5DEHA 1PH2A 4DR6Q 2G8YA 2KCCA 3SR1A 1RHZB 3KUPA 4BRYA 1S5DD 4IFDJ 4LF7L 4C7NA 2AEJA 1RE4C 4LWCA 2WITA 1LTAC 1DCZA 4GN4B 5M5YH 4AIMA 1N36L 2I0QA 1K0SA 1YJNA 4B3TQ 1JTHB 2KYVA 2L5GB 2P1JA 2R3CA 1WTVA 2Q8IB 3L70G 1Q81Q 5CC4A 3ERQA 5A2QL 1B44D 3P7KA 1B4OA 2NVYH 2JDIH 5DM63 4I1LA 5FLXL 1VQ8P 5FOBB 3I90A 3GO5A 1EY7A 1PRTB 5M5YB 3JAMc 1JO5A 2NZ2A 1B70B 1Y1VH 4RG1A 4UAIA 4XT3B 4OO1I 3HD7D 1CKOA 2VL6A 3HKZG 2RHSB 1LT6D 5J3BA 2B39A 4FF4A 1DD2A 4K5WA 1SFCB 4CJ2C 3CC2P 4KK7A 3WU2H 4K35A 1RL2A 1GL2A 1NWQA 4A7PA 3MXUA 2E2HH 1K9MC 1T8ZA 4NP5A 4JV5L 1PPJE 3OIQA 3QWOC 2E2JH 4PD4D 2ZM6Q 1SQQE 3F89A 3MVVA 4XFJA 1PRTD 3QJYA 4XQJA 4IPCA 4HJ8A 1KFNA 2WSSH 1YYCA 4YWLA 1JE4A 1WRGA 3HD7A 1MSHA 3FRPB 4JI4Q 2KHIA 3VN0A 4P71A 2V4HA 1PH8A 1EQTA 5M3MH 1K83H 1TWGB 2L11A 4MHEA 2HDLA 4UP8A 3VR6A 2R93G 2MJ8A 1SQBJ 4N9PA 3RZOH 4BS9A 1E7ZA 1ET9A 1KN7A 1I3QH 2E74C 1OW7A 3AFPA 2RMZA 5FO8B 5BU5A 4NXML 3A7AB 1KB9D 1IKMA 3L71J 3H3VH 2QA4A 3RL0D 4D6TD 2EYHA 3PIO3 3EROA 1OIPA 1B2TA 3KHUA 2E2IH 1DJRD 4KHVA 2XGTA 2IZ0A 3D31A 5APYA 2FYUJ 3GTJB 3NP8A 5GTHE 1IZ6A 5H1SE 5EAYA 4DR3L 5F2DA 3JC22 4KJMA 3H1LD 4ZYSA 1KQGB 4GOFA 1ZKOA 5A35A 1KIXA 4BXXH 1X3GA 1TWAB 1NBWA 2VW9A 1NTKJ 3N52A 1QEXA 4KD3A 4A3CH 3AE1C 2M3BA 4JF7A 3T1YL 2B63G 3KQGA 5M5WH 2E2DC 4LLHA 5DJTB 2J58A 3BATA 4GKKL 1VQLP 1NVOA 1DIPA 2FFDB 1UWVA 3S4RA 4ME5A 4L5SA 5HURA 3M7NA 4HR7B 2YKPA 4U3FG 1YJ9A 2JEEA 3M9QA 4FO2A 3BJUA 5T1IA 3F2UA 5JEAH 1WYDA 4FDBA 1NU1D 3E7KA 5AW8B 3EN2A 4DU9A 1E2VA 4JOIA 3S2HH 3CCRP 3RN2A 4Y7NH 2AXTH 2LXCB 1BBXC 3GTQH 3Q0AA 5IP7G 1DX7A 4YHHQ 1SNQA 1N73A 3GF7A 3H32B 3R2TA 1CQFA 3M4YA 2FYUD 2UXCQ 3SFDC 1HFNA 4B3SL 2QF7A 4PMBA 2V1CC 4JI8Q 1JR0D 2JYOA 3K8AA 4F7XA 4D6TJ 1OVRA 4Y7NB 1L0XB 2OF1A 3V6IA 4C3IB 2PW7A 4AYBE 1SMXA 1UE6A 2AWOA 4EDFA 1XTCC 3NTHA 2NVTB 4ZKPA 3P20A 1GU4A 2SPZA 2K03A 2NYZD 3K57A 4WJ4A 2PMZB 1DOKA 2FXQA 3AFQA 2QJPB 2JXMB 1WT6A 4PMWA 1JICA 2RDFA 4ZLTF 1EEID 2YIUC 5KLVK 2PCFB 3M4PA 1EFID 1XMOQ 1XYIA 4WY4B 4RH6A 5IIFA 2DY7A 4U7JA 2JA6B 2MUYA 2UUBQ 1SQBE 1VQJA 4JI2Q 3KPEA 1PLFA 4EVOA 3HOWH 3HOUH 1FOSF 2LXJA 3M3YH 5JJLA 4V0BA 2B2WA 1RJTA 3X3MA 3V5BA 2E5YA 4KY5A 3GTLH 1U5KA 1W6KA 4R4LA 2A6HC 2L55A 3ITPA 3SK5A 2ZJPA 3S1RB 2JA7H 1IBKL 2VUMH 2KB7P 1GTWA 3KF8B 1AH9A 1QOHA 4JPBW 2K32A 1OXZA 2YO3A 1FE6A 4UPAA 3VYSA 2K52A 3BCCE 1GDTA 2G5DA 4H13D 3GTGH 2IY5B 3G6JB 3CPWO 2SEBD 1R5LA 1H9SB 3C1FA 4JI1L 4H02A 5CJ4A 3KBGA 1XTCD 1KILC 1UUPA 1BVSA 4HSVA 2PGDA 3MGNA 1SR3A 2LFNA 2MGSA 1FJGL 3L74G 1E24A 2F0EA 2QKIC 1U7MA 1PP9G 3EQ2A 3H1HG 1IW7D 5APSA 5CHXA 1MFZA 1KNAA 2KEEA 2NWGA 4A3EG 1CQVA 1C0AA 2OWOA 4PZ8A 3MTSA 2KNCA 3U9OA 5GAGC 1R9TB 2WP8J 4JK1C 3MWYW 1D1IA 4R1JA 4PD4I 2KSEA 1KYOI 4GIFA 3K5MA 1JJGA 1A62A 2F3VA 1ENCA 1VQ7P 2W90A 2KP8A 1F77A 2O2LD 5H2FE 1W2BO 4IJLA 2Q8TA 2NBFA 4R4QA 1NU1G 5JJIA 2OEOA 2UUBL 1PZJD 3BZCA 1SQXE 2H1EA 4EIJA 1PTOF 3FVQA 5C0XI 1SQPK 1PFSA 2A6HD 3A5ZB 4K3AA 4JI6L 1D2BA 3CCQA 2E76B 1RQUA 3PJSK 1PH4A 1KAWA 1V1PA 3I4NH 4W7YA 3BRTB 1L2PA 3S15B 4YTPC 3T97B 2R93B 2LSSA 3P75A 3UDXA 1PDQA 1EIHA 4APVA 3R2IA 4GOPA 2CWPA 5LL6X 2R7ZG 1WTHA 3Q6SA 3S16H 1JT8A 3L71E 4A3KH 3RL0g 3O8ZA 1X65A 3NWSA 3FPUB 2A73B 5AFWA 4JI8L 3GTLB 1EY4A 4XYQA 4A3FB 5APXA 1VMPA 3H25A 3CCUP 1E5WA 2EIFA 4KLKA 4TRDA 3DEPA 2QG4A 1FAVA 3VMYA 3BVHA 1NCVA 1WOCA 4O1NA 3E9HA 1KQLA 5LMNL 2WAQE 3M0DA 1V8QA 1KRSA 3L70J 1X0TA 3ULJA 1WD0A 2OGUA 4EQ5A 3FDTA 2PMZE 2L15A 1S4XA 1BR9A 1YJWP 1JY3O 1ZXGA 2WMMA 1MSGA 2P5ZX 2Q2HA 5KNBA 5IYCH 1Q81C 1MUUA 2DGYA 1OMIA 2YXRB 2ZFCA 2BCOA 1VF7A 2PZWA 3HE4A 4LAAA 1SYDA 2PZUA 4CKBA 2EXDA 4GLAC 3VTPC 4DA2A 2PP6A 4L8JA 2F0PA 3T1YQ 4JQ0D 2G3AA 1EU3A 2WFWA 4OGQC 1K83B 1TWGH 2QILA 3Q5SA 1FZCB 1U7JA 3V4QA 1P84H 3HTKB 2YTVA 1RF0A 2E42A 3MZ5A 4A3DG 4KI0A 3GP7A 1AVOA 2B2VA 5KKZB 2MP1A 2K05A 3KDFA 1D5XC 4N8FA 4C3IH 5CORA 5CJ0A 5E79H 3S1KA 1PGJA 3S1QB 3D71A 1NAFA 4QF4A 2R7DA 5AW6B 2VQEQ 3L73E 4BBSG 4HJ7A 1DONA 2A45H 5APTA 5K36G 2EQSA 5COYA 3CWBG 4F87A 3CC4P 3LX0A 3V2TA 1PPJG 1IFIA 1SQXJ 1ICFB 3D8GA 4K5VA 3DM3A 5KLVD 1Y69U 1XNQQ 5KTBA 4NMZA 3HUSA 3O13A 5IGBA 3E0JA 1KLUD 2C9OA 2KJXA 2ZVNB 3M85A 1P84D 2K5HA 3R3OA 5C0XJ 1N32L 4IPGA 1PZKD 1SQXD 1JY2P 2IX1A 1T3UA 3LIEA 2HFED 2SNMA 1HPCA 2EJGC 2Y9ZA 1OWAA 2Z0SA 3I70A 3IAOA 4BXLA 1NYHA 1L0LG 2IX7C 1GL2C 4B08A 1M57D 3K6OA 5CCGA 1G91A 1I4PA 4K14A 1EIYB 4YXDC 3H6PA 4K2LA 4CJ0B 1V9PA 4C7RA 3RN5A 3HOUG 1J1EC 3W68A 5KJ7A 3BVMA 1PP9J 4NKLA 5K36H 4DK0A 2WWWA 3HE5B 4LFAL 3CWBD 1K28A 4U3FJ 1QL2A 1A8VA 4OO1H 3SK4A 1N33Q 4MNOA 2JN4A 1A2UA 3S9WA 3PP5A 5EKLA 5IGFA 1PH3A 1KMIZ 4RJTA 1S9KD 3PF5A 3TS2A 3G3ZA 2KIKA 2BCCG 3C9IA 3KFUA 1N36Q 1C8CA 1BE3G 2PYKA 2F0GA 4DV5L 4HAEA 3T56B 1EQ7A 1AFOA 2QJYC 5IT9L 3B4SA 1NSNS 3NQIA 4ZKCB 2GA4B 1D5MC 2JA6H 4DR6L 1F2ZA 1RDPD 4LFAQ 3HOWB 1HHVA 1VL2A 2VQFL 1BF4A 4RAUC 3QB3A 4KN7C 4HN7A 1PPJD 2Z1CA 1VQ7A 2QSIA 3NSWA 3L72E 1JUNA 3SFEC 2AHOB 4PD4H 1VF5B 4JBKA 3AQQA 1QLED 4WVZA 2FXOA 3OW2A 3SGIA 3SXHA 2IPPA 3BVGA 4HCSA 3CX5E 3PHLA 4EOTA 4CHTB 5CBNA 1PYWD 2BOSA 1KILB 3BU2A 3TZUA 4OVNF 4LF5L 1PTOC 3HKZB 4A3EH 1HNWL 3MD0A 2L0CA 1URQD 1HGZA 3GHGB 1N32Q 1IXRA 1FDIA 5C44G 2WSCJ 1D7MA 3URYA 1BSHA 2K6AA 1PHJA 1HJBA 2JJQA 2NN6I 4IFDG 1RF0C 1DD4A 3NE5B 1XNQL 1BOSA 2YV5A 3M4OB 1JY3N 2JJLA 4HTHA 4K8IA 1SQVK 4H0LD 4NXNL 4G7OC 3ULPA 1TT2A 2Y0SE 1BGYG 3DEOA 1SQBG 5TSSA 4N9TA 1DD3A 1WFQA 1FR3A 2EYFA 3RK3E 4YCUA 1KRTA 4B3MQ 1VQ9A 1MZ9A 1HNZQ 1Q7YC 4JYAQ 1L1OA 2CQAA 4BY1G 1EU4A 3L70E 1KZUB 1L0NE 5C4ZA 3H1JG 5KKZC 1SYEA 2F4VL 1W3SA 3KZIE 1VQMP 1JB3A 3RBXA 1F9QA 3A0HE 3V2RA 3U4VA 1VQ4A 1KYOE 1L4AA 5AVRB 4L63B 2A45I 4K6DA 3I4NG 1KC8Q 5L8RJ 3RK2D 3I4MG 2OQ0A 1L0LK 3G6EA 4N78D 4P72A 4QUFA 1CT1D 2MPMA 2WSCH 2RSOA 5M5WB 3PF4A 3H6MA 4C3JB 2LMCB 3PIPA 2UXBQ 1VDFA 1IFMA 1SQQG 1EZVD 1P84I 3PCOB 1NTMJ 4ID6A 3NUCA 1CK1A 4FXKC 1VQNA 2O4XA 5IY0A 1NTZJ 2RQXA 5I6WA 3D6CA 5HGTA 2EYMA 1QGKB 3AEGC 2Y0CA 2E75B 1LP1A 1K8AQ 4A3JH 2E5LQ 2OTJA 4RHSA 5CV8A 1W2BA 2P2UA 4R9WA 4XA4A 2CKZB 3J7A5 4EYYQ 3H1JD 5ISRA 1Q82C 1CI6A 2PPBC 2IX0A 3TYYA 2IBZI 3T53B 1HA5A 1TS4A 1QWYA 2FYNB 1IBLQ 4JI3Q 2GM4A 1VF5D 1LJ2A 2L4NA 3NXWA 2WTYA 1AV1A 4FF1A 4MZ9A 1UAPA 3L72D 4ZMDA 1QJOA 1LTSD 4DV7Q 5JVG3 3M9BA 4QMAA 4A3LG 1QVFO 3GLMA 3K7AB 5IYDH 1VPCA 3Q2YA 5GADC 4RA8A 4C2MB 1H8AA 1Q8IA 3LW5H 3CKIB 4IL6X 3NBIA 1U9RA 2F0WA 4PZ6A 3RR5A 4JI6Q 1NE3A 5KYIA 1BCCE 1K8AC 1WI5A 1RH5B 3F8TA 2QDLA 2J7ZA 4GLXA 3QO2A 4C2MH 2WACA 3CCEA 4WORA 1Q82Q 1YQ3C 1LT9A 2XVSA 2QVAA 3AEEC 2R3SA 4OXPA 1IO4A 4DN4M 2K9YA 4LUZA 2HQEA 2W6BA 1WTXA 3H1IG 2Y0EA 2QM8A 3IL8A 1ZR2A 1EDKA 1RIPA 2SDFA 3RK3D 4GDOA 4PD4E 4ZNCA 2A68C 1YBKA 3FHWA 2QEXA 1GW3A 1AEXA 1EEFD 4LF4L 3CF5A 1L0ND 1HH0A 2QEXP 1KABA 3R8BA 1G6ZA 2JSOA 2F0VA 3PIOA 1FJGQ 1IFNA 1W2EA 1OXXK 3UDFA 1JY3P 4G7HC 3OWEB 5IYBG 2VS1A 3L74E 2ITAA 3NPPA 3AE8C 2Q5UA 5CV4A 3STBD 2IWHA 5I9OA 2F0FA 4WY4C 4BWNA 2TMPA 3Q24A 1IBKQ 1X9VA 2Q8RE 1VQ5P 3J81i 4X66L 1T5EA 2XRQD 3J81L 4CDCC 3PRJA 1VQCA 5E79E 2R61A 1HBWA 3AE2C 2OCEA 1UE7A 3OSOA 1O7LA 1Y9BA 4G4KA 1X3FA 1PL5A 2ATWA 4I2LC 4PV1B 1AA0A 2FFDA 4XT1B 4DNRB 3TMEA 2RCNA 1WTRA 5E1FA 3F2CA 2E5TA 3LIDA 1EY5A 4X65Q 5CV9A 1TWHB 2F0TA 1XMOL 3GTPH 2BA0A 4KTAA 3TREA 4LUVA 4LF8Q 1ML0D 1AQ5A 1VQPP 2CH4W 2B2TA 4BWGB 1PA6A 1RKNA 4LW1A 4HIOA 4BY7G 1K8OA 2K28A 2KECA 3CWBJ 1T5XD 3MXPA 2B2UA 2L5TA 3KLSX 4EX5A 4DR7L 4QUCA 2B29A 2RKSA 5GTIH 2HODA 2R5DA 2BDNA 2KOLA 4DK1A 4MN4C 1K73C 1J2JB 2UUCQ 4R8NA 1EY9A 1ZYRD 1HR0W 2N9YB 1U4RA 4ZUJA 1PYSB 3ULLA 5CCHA 2C5CA 3UE0A 2O5IC 1J1DC 1SQQK 1L4AD 1KYOH 4LK1C 5IWAL 2N1TD 1YI2P 4HSPA 5C44B 2QRXA 2EY5A 2UXCL 2FYZA 1SFCD 1VQNP 3V05A 1HH2P 4GKGA 2RSNA 4YHHL 2ZAEB 4IFDK 3KF8A 1OXUA 1CTMA 5EKIA 2N1TA 2NVQH 4L74A 4DV0Q 3CLQA 3HUSC 4TLFA 3TF5A 3G71P 1EZ8A 2NRGA 2EOTA 5ELFA 4JI7Q 1HZBA 4BBSH 5HGQA 1PH7A 2F0OA 5C3EB 1H0TB 2WVRA 3MHBA 4BY1B 2JA5B 3H3VC 2E2HB 1SXTA 2ZYDA 1I6VC 1F9PA 1TU2B 3OMCA 5ELCA 4X62Q 3KLSA 1KORA 1KQFB 3CMEP 1NNXA 3W2DA 4A3JB 4GKKQ 3J81E 3K7UC 4JI5Q 2IT1A 2PI2E 1VQMA 4A3BB 4S3SA 1T9HA 1LTSC 2XNDH 1NMFA 1QCBD 5IE8A 1SP4A 4C3JG 2NB0A 1CSBA 4AH6A 5KNDA 3I4NB 4UDUC 1TS5A 1EIFA 2K50A 4LF6Q 2UUAL 3IFDA 3CX5D 1IKLA 3PLNA 1I50H 4GN3B 2IW3A 1GM5A 3L3OC 3AE9C 3O6QB 2FYNC 3MFGA 1OFCX 1SLJA 1JMCA 4JI0Q 3W1GA 1H9MA 2Q2UA 2EYOA 3G48A 4LGDE 4BA2I 1SNCA 2NUCA 4OGQD 3FWNA 3JSVC 1F2MA 1VQEA 4IUPA 2Z8LA 3F2BA 5KYLA 4Z9CB 3RZOB 1PMRA 2O5JC 2IFMA 5AW7B 1R5SA 2BEQD 4U68A 1OW6A 5B66H 3G4SP 1Z56A 2M8RA 3L73D 3O6QA 3J7YW 3MEHA 4JYCA 4KJNA 1LP1B 2WSFJ 3H1KG 3CMAP 2ZT9C 1IW7C 1KQSO 5ELEA 2M3EA 5ELDA 2JR8A 1FYCA 1YNXA 2HHHQ 1JOQA 2B2YA 1T2KD 1YHAA 2IHFA 5CBAE 4LF9Q 4KT0J 4YWKA 3A7OA 5AW2B 2RH0A 4ZQ3A 3D4WA 4DV1L 1DH3A 4L75A 2KS1A 5M5XB 4X64Q 4JCVE 5I4DA 2ZM6L 2YO2A 3RNUA 5TISE 1HCZA 1U4MA 2PW5A 4H13C 5EFWB 5AW1B 1LT4D 4JV5Q 1SAPA 1V1OA 4HMJA 3KF6B 2M9VA 3K58A 2YMYA 1B50A 1L2FA 1GHJA 2Y0SB 2UU9Q 2ZJQA 5IT9c 2ZXEB 2FFDC 1JOCA 3G9RA 3H1HE 3CX5I 4U3FE 1QVGO 1LTID 2NTTA 1MBYA 1Y8PB 1M8AA 1L4AB 1NTZE 3RZDH 4AQYL 4IFFA 1QZGA 1LTJC 3GQBA 1Q8KA 3WUTA 4PV1C 4FF2A 5IP9H 2B89A 1BDCA 3RGUA 3EJIA 1EZVE 3A0BE 2PQAB 3CP0A 1T3JA 3QOJA 3TNUA 3VR5A 1M1KQ 3VMXA 4C46A 2IBZE 1G2SA 3OW7A 1DOLA 1UNSA 2B2UC 2B8GA 4B3TL 3C2PA 3A5TA 1FGBD 4ABNA 1NU1E 3EVQA 1DOMA 1HJ0A 1S5LE 5C4JH 4B3RL 4A3LH 3B8EB 2EE1A 1N34Q 2I8DA 1GUTA 4LF7Q 1BDOA 5FLXc 2EYJA 1OVUA 1PGPA 4P73A 4XQQA 3OOCA 4LFCQ 1BNZA 4KJOA 4HIDA 3GMAA 1HXYD 2ZTEA 5C4JB 3BYYB 1A2TA 3P8MC 3K0XA 1QILA 2WKDA 1Y1WH 2ASBA 2AXTE 1MI2A 1OVVA 1KILA 3L72G 2W8ZA 1L4AC 1LGHB 1XPOA 1S5CD 1Z7TA 1EYCA 3BDOA 1NKNA 4ZRZA 2AUKA 5K5PA 4OX9Q 1Z47A 3TP8A 4OWWB 2Y9YA 2JA7G 3UIAA 1Y1WB 1SVFA 1XTDA 4OELB 2KS1B 4JPZB 1B1ZA 1SQXG 1EWIA 1JWSD 5FJ8H 1X9NA 5M3FB 1SE4A 3M3YB 1BCCJ 3J7AF 2F0MA 1FU1A 1Q3LA 3CXHD 2CHBD 2KEDA 2KNCB 2KK7A 3R2PA 5BN3A 1GJXA 2NN6H 3NTKA 3S1NH 3CPWA 4PJ0E 5KNCA 4JW0A 4BBRH 1LO5D 5FKAC 5HY6A 3J80i 3J80c 4K0KQ 2EJFC 4MTNA 5KLVG 5GTHH 3K0YA 3TZDA 5FLMG 1SQXK 4BY7H 2NVQB 1WTQA 3RLFA 4CBVA 3HOVH 2YMKA 3P7JA 4GT1A 3EFFK 1JWMD 2F0JA 2IJ0A 3A56A 2JA5H 2JEBI 3FXDA 1TWCH 1S3OA 2HG5D 3P8CD 4PQXA 4K0KL 3HE5A 3TNUB 4DV6L 3RL0C 1SSOA 3HOVB 1PFIA 3GHGC 1NGMB 4GOPC 1M90Q 3U58A 2POHA 1H9KA 2HCCA 1RTNA 3EA6A 5C3EG 3S24A 1WMKA 3TGUD 4TVAB 3TDQA 2KSJA 5G3LD 2ZTCA 5ELOA 2WSEJ 3KDPB 4GLVB 2HR3A 2O3JA 4DUYQ 1ILQA 1DGSA 2XWBB 1NU1J 3UDIA 4IN3A 1I3QB 1JB7A 4K5XA 2ZVOB 4RGMA 2CVRA 5KAFE 2IZ1A 3I72A 3HOZH 4QQBX 2QA4P 1PRTF 1SQQJ 3M0DC 1Y14B 4DR1L 3I8ZA 3CCUA 1OX3A 1F2LA 3CCSA 3D6ZA 1FNWA 3LW5J 2JO1A 3WWVA 4CJ1B 1UEAB 4HJ9A 3CXHI 2OTLP 2R6GA 1VQKA 2IL8A 3GTJH 1HNXL 4YCVA 1XNRL 2R32A 2CWAA 2QE7H 2B63H 4BBSB 4ULLA 4BA1I 4A3KG 2LKVA 2KVMA 1MKMA 3AEBC 4D6TG 1LABA 3BZKA 1L0NJ 3IN6A 3K5LA 4BXXG 2CH4A 1WCMG 3HOXB 2DUDA 2F3IA 2Q1KA 3RL0B 3J7AV 1G8ZD 3AE4C 1C9OA 4DGZA 4R4CA 4NPEA 4A3FH 1HZ9A 1CI6B 2KCMA 3I5CA 1URQC 1MHWC 4M3LA 4I7ZC 3T51B 3TGUG 1OXSC 1BCPC 1VS0A 1BXTA 5C39A 5JPNC 2EYLA 1PZQA 3R93A 1LTBD 3KDFB 1TY2A 1EC5A 1SQBD 3TGUJ 4FXDA 1FDMA 1OO9B 4A93B 1I5FA 1AE3A 1NJIQ 2OTKE 1M8OB 2V7QH 1EYDA 2IPKD 4HMIA 1TR5A 4AQYQ 1FZBA 2KENA 2N8NA 3EWKA 2FXPA 1T2KC 2JQOA 2KHSA 4EGVA 3I55A 3CQZH 2C0XA 1Q46A 1STNA 2UU9L 1XWEA 3PO3B 4IO9A 2M2LA 4UB6E 2Y0SG 1BE3E 1EQRA 1BDDA 1Y8NB 4DKAC 4RKBA 4FNFA 4HEDA 1VQKP 2OTLA 2P67A 1X54A 5AVXB 2E74D 1NTME 4JC0A 2AMCB 4DAPA 4XYOA 2Q6QA 3L72J 3D6YA 1WTOA 4OHJA 1ZW0A 1IBML 3H1IE 2J5UA 1MIUA 1UE5A 4FP5D 4LF9L 1Z9FA 4X6AH 3WU2E 3J80L 5I2YA 1FZGA 1R4PB 4QIWE 3E1IA
chains in the Genus database with same CATH topology
2YKOA 5CCGD 4HJ5A 1RE3C 2C9NY 5IYDG 5CCHC 3I2ZA 1SROA 1HR0Q 5M5XH 2PQAA 1GL2D 4JI0L 4P75A 2HODB 5APVA 3HOWG 1I6HH 2KLVA 1GW4A 3GHGA 3VDYA 3KF6A 4JI5L 3FKIG 2Z5HA 3T1HL 4DR5Q 4X62L 3J81j 1GL2B 3VOPA 4JYBA 2XZRA 4JI7L 2NZOA 3NXSA 3ER0A 1VQDA 3S14H 3HUSB 2WB1G 1JTHA 5GAHC 3D0FA 4NB3A 2D0OA 1FBMA 2Z4EA 5C44H 5AJ3L 2BASA 5AJ3Q 1B8AA 2UXDQ 1D8LA 5BR8Q 2FXMA 1PV4A 3TS0A 2UUCL 2OYHA 4O2DA 1E1TA 4B86A 1OTCA 1VQLA 3H0GH 4DR7Q 2B3GA 3TQYA 2BH8A 2W6AA 4LUOA 4IFMA 1KHIA 3S2DH 4KHPQ 1V1QA 3J81c 1MJCA 2D62A 1HZCA 1SFCC 4X65L 3KJPA 2ZJRA 1L1OC 3SWFA 1NKZB 4QGUA 1L0NK 1XPRA 1I94L 2K14A 1R9TH 2YTXA 2WPSA 2E8GA 3OTOL 4A3GG 3FKIH 2JA5G 1JY2N 1OXTA 2C9LY 2QM7A 4DAMA 3VP8A 1L1OB 1ZV8A 3M9HA 1G2CB 4GNXB 5AW5B 5APQA 3CW2C 3NBHB 3HOXG 1GZLA 4DV4Q 3TSIA 1HNXQ 5AVWB 2XKMA 1GKHA 1FJKA 4OONA 3HTKA 1LTGC 4HJAA 2J59M 1L0WA 1CUKA 3GTMH 2H7HA 2XV5A 1LTTC 1IYJB 1GK6A 3PO2H 3V4WA 3PO3G 3PGZA 3CC7A 1VQ6A 2VNUD 5AW0B 2ALYB 1FOSE 1G1JA 3MTUE 1JMMA 1FVIA 3CMEA 4HIMA 4QL5A 2OARA 2E43A 4DV7L 3II6A 1TXYA 4GKJL 5JJKA 4JI3L 1NOHA 5CCGC 2WZ7A 1LWUC 5AVSB 1X3EA 1N2DC 1Q86C 1N7SA 5IYBH 3CC4A 3HD7B 1EYGA 5C4XG 3JC66 3EFGA 2KHJA 2A45G 1LT9B 1SRUA 4DR1Q 1HUCA 1YIJA 3CI9A 4DUZQ 1FZEA 1YBYA 4POGA 4POFA 4A3MG 2CPSA 1NJIC 1ASYA 1EFWA 1SFCA 1HGVA 1YTZI 4WY4A 2CCZA 1EQQA 2CPBA 3I56A 3NENA 3CPFA 1H89A 4JBMA 1GU5A 1IK9A 2JE6I 3N4XA 3N7NA 2F4VQ 4Y99C 1YJWA 5C3EH 4L5RC 4JYAL 1VQHA 4ME3A 3W5OA 5CMZA 4B3ML 1E1OA 1VQ5A 2PNHA 1CKNB 3H32A 4R4IA 4HYTB 3RK3C 1JY2O 5LMUQ 1BBUA 1FL0A 4GN5A 4IOCA 4A75A 5JEAJ 1FZCA 3V2NA 3RK2C 3S17H 3U4ZA 1KD1C 1M1JC 1OXVA 3JAMi 1ZN5A 4BBRG 1XPUA 1GD2E 3S15H 1HZAA 4A3JG 2GUSA 2W27A 2XU6A 2BA1A 2N1TC 3U59A 3RLOA 2N1TB 1MJEA 1NMGA 3PSIA 1X55A 3PUVA 3PUWA 1KXLA 4DV3L 1QZHA 1RY3A 4YY3Q 1ZR4A 2VUMG 4DV5Q 3I4OA 5AVYB 3NEMA 2ES2A 4B3RQ 4DZOA 3S1RH 1PVOA 4GOPB 4GKJQ 5AW4B 3HFZB 3T97A 1N73B 1N33L 2MO1A 3K80C 3M4OH 2JA8G 1IC2A 2A8VA 1NTGA 1SN8A 2Z6KA 4ZKUA 2GVAA 3GDEA 4Y52H 5IP9G 1X56A 2I1KA 4KHZA 4X64L 1LWUB 4DV1Q 3IFMA 1G51A 1WCMH 2OQKA 3AYHB 4DV4L 1MKHA 2NPSA 1QL1A 1LT9C 4PG3A 1KQSA 3U1AA 3WMM0 1VQFA 3VMZA 1G1IA 2OYHC 2QGQA 4LF6L 1LUZA 1X79B 1IFJA 4JOIC 1I94Q 5IP7H 1FZCC 1GO3E 4PZ7A 2RF4A 4O0AA 3H0GG 1IFDA 1J6QA 4N78E 1VQGA 1Q12A 2R5BA 4KHPL 2WPRA 5GQOA 1NHLA 4UP7A 5BR8L 4AQRD 2CQOA 1FJPA 4IPHA 2C35B 3A5UA 3V2QA 1M1JB 3AEVA 2GUVA 4WB4A 3A0JA 2O1JA 4HH2A 1UE1A 3HOVG 3SWYA 1CZQA 2FYUK 1SLQA 4OO1G 1QVCA 3I4MH 1HJPA 3BASA 5M3MG 4UY8C 4DR5L 3T1HQ 2I5MX 1N7LA 3MEFA 2Z6KC 1RE4A 1RF1C 4OWTB 1CKMA 1B7YB 4J15A 4DNIA 5GROA 1PYBA 4JBJA 1IJDB 5IYCG 3CC2A 1TWHH 3L37A 2A1AA 1Y1VG 2K4KA 1VQ8A 1G291 4LF4Q 3V2PA 3KLWA 3CCVA 2R7FA 4L5TA 4A93G 2YKQA 1RF1B 3MXNB 1AE2A 3M0AA 1QUQB 1K0RA 3KYQA 4JI2L 4DPGA 3S1QH 5DLQE 1N86A 5BVZA 4R4TA 4XE5B 3IRBA 2KBNA 3L35A 2XTIA 3M91A 4A3FG 2MFIA 5E7NA 4A4IA 4DK3C 1YVCA 1VQIA 4L5QA 4W7ZA 1NTMK 3K7AH 2OYIC 4B3SQ 2IFNA 4XIGS 1A63A 3NFQA 4YY3L 3KJOA 4DV3Q 4AYBG 5AVTB 3K81C 2RHQB 1YEZA 3M4QA 3L2PA 3NTNA 4DAYB 4W80A 2XDJA 5C4XH 2UXBL 5AVQB 3EBEA 2MJZA 1N73C 4TQUS 2JK8A 2WSEH 2LXKA 1URQB 2JEAI 3TK1A 1S72A 1RF1A 1JCDA 4RESB 5LMUL 3W1BA 3HKZE 4IJHA 2WT7A 2OYIB 5M3FH 1NH4A 3H15A 1M1KC 2KOGA 2HIXA 5M3FG 1GD7A 1HNZL 1SE8A 2Q2TA 4WJ3M 2NN6G 1YHQA 1SQBK 4Y99B 4NXNQ 4IFDI 1PH1A 4BY1H 2R92H 3PUYA 1PH5A 1C7YA 4A3IG 2NPSD 2O1KA 3DLLA 1NY4A 1JJCB 1ASZA 1BBWA 5KJ7C 2K75A 3RK2B 2I5LX 4LF5Q 1A02F 3HE4B 5GAEC 3CD6A 1VCIA 3B5NC 1HTLC 3B6YA 3J7ZC 2YU9H 4DUZL 1J1DB 1J1EB 1H88A 2I1JA 2VRSA 4R4OA 4RMFA 2PAJA 4LFCL 4C3HH 2H8PD 2R7ZH 2HPCB 5KJ7D 4GNXC 1N34L 1N7SD 1A0IA 1HWTC 3LGJA 2NPSC 4HIKA 2IHEA 4QJFA 2MNAA 2D0PA 2WT7B 2OYIA 3Q8DA 1U0LA 4I6MC 3S1MH 5AVZB 1M90C 3B5NB 3OJAB 1XMQL 4P74A 1HVVA 4DR2L 1URQA 1P16A 4A93H 2ID0A 1A02J 5JEAG 3PUXA 1NTKK 1GK4A 1E22A 2Q3IA 5AW9B 2AKWB 3UDGA 1KL9A 3RK3B 1GVPA 4KHXA 2HHHL 4N3YB 4WY4D 1J5EL 2MQHA 2O01H 3F2DA 3VP9A 1LYLA 5APWA 2VY3A 3KOJA 1YITA 4AUWA 1CKNA 2WSFH 1YHBA 1UEBA 1QVFA 2JA8H 5APUA 1Q1BA 4DR4L 2R92G 2VQEL 2NZHA 2VZAA 3P32A 2HT1A 2P7JA 2UUAQ 2WB1E 5AW3B 2R93H 3HOYG 3OTOQ 1RE3A 3MUDA 3HOYH 3P8CE 2F52A 4A3DH 3CMAA 2C0WA 3RLNA 3KYHC 1PH9A 3U1CA 1VQBA 3ZJYC 1N7SC 1ZLLA 1LTJB 3HD7C 4O9BA 4DV0L 3B5NA 4DV2Q 2XNXA 2Q7CA 1YZ6A 4DOJA 4QY7A 5LMNQ 2LKMA 1JCCA 3GTOH 1Y1WG 2HIVA 1EOVA 3GTKH 2UXDL 1SFOH 4NPSA 2HYNA 5IWAQ 1EUJA 1CW5A 1O7IA 3CL3D 2N78A 2HPCA 2Q2IA 1X6OA 1IL2A 3OYYA 3BRVB 2GN5A 2Z5IA 3OA7A 5C0XG 4LFBQ 1NTZK 4LF8L 3NELA 3G71A 1DEBA 3EIVA 1S40A 2JA6G 4A76A 1NU1K 1XTGB 2N49A 4OWXB 1KILD 3VYIA 1KFMA 4X66Q 2K5VA 3NMDA 3PUZA 2H5XA 2OYHB 3GD7A 2GVBA 5FLMH 1HR0L 2K5NA 3CXCA 1JE5A 2YNYA 2CFMA 1VQPA 4GS3A 4JI1Q 1N9WA 3HOZG 2H43A 3PO3H 4XTCS 4LNQA 2A19A 5FJ8G 3STBC 2WAQG 1IBMQ 1Q1EA 3PV0A 1CSQA 1LTBC 3A3YB 3U50C 5BU8B 1FGUA 1E3PA 3CCRA 3HKSA 1VQAA 4A3IH 5LMNW 2YTYA 4C3JH 3E9IA 1MV8A 2N9BA 1BKBA 1VQOA 1JNMA 2FKWB 3HOXH 4LFBL 4DK6C 3TRZA 3PO2G 1XJVA 3ERSX 3M06A 1LM0A 3TEHB 1TWAH 1IBLL 4LC1A 2NPSB 3L7ZC 4A3GH 4C7NB 1FZAA 1P8LA 3L36A 2YYZA 2WPQA 1S9KE 2ZTDA 3L0OA 5CCHD 1N8RC 1PH6A 1XNRQ 2E5LL 4A3BH 4DV2L 3CAMA 3L4FA 2HQLA 2NVTH 5AVUB 1CSPA 1LWUA 1YTZT 1QVGA 5AVVB 4WBAA 1TWFH 3E0EA 1QUQA 4DUYL 3CCMA 1NO4A 3G4SA 4YWMA 1G6PA 2AWNA 2MO0A 2HLOA 4DR3Q 4JBWA 1M7LA 4A3CG 3H3VI 4DV6Q 1N7SB 2PI2A 3HRNA 1LTLA 2N3SA 4DR4Q 4IOAA 1FZFA 4NXMQ 3I7FA 2NVXH 1X8YA 3CCLA 3FP9A 2Q9IA 4ALPA 1K8GA 1G2CA 4GNXA 1K3RA 1J5EQ 3B5ND 4JI4L 2JA9A 3A2AA 3F1ZA 4YCWA 3A74A 4A3MH 1LTJA 5ELNA 3MIWA 3UE1A 1HNWQ 3IR9A 4AYCA 2I5HA 2BH2A 1V43A 4OX9L 4JG2A 4A3BG 4OH8B 1H95A 4DR2Q 3CCJA 1XMQQ 1WJJA 2KCTA 1LTIC 1YI2A 4UP9A 4N6JA 2VQFQ 1M1JA 1JJ2A 3OAKA 1D7QA 1PH2A 4DR6Q 4IFDJ 4LF7L 4C7NA 1RE4C 4LWCA 2WITA 1LTAC 4GN4B 5M5YH 4AIMA 1N36L 2I0QA 1YJNA 4B3TQ 1JTHB 2KYVA 2L5GB 2P1JA 2R3CA 3P7KA 2NVYH 4I1LA 3GO5A 3JAMc 1JO5A 1B70B 1Y1VH 4RG1A 4OO1I 3HD7D 1CKOA 2VL6A 3HKZG 2RHSB 5J3BA 1SFCB 1RL2A 1GL2A 1NWQA 2E2HH 1K9MC 1T8ZA 4JV5L 2E2JH 2ZM6Q 4HJ8A 4IPCA 1KFNA 1YYCA 4YWLA 1WRGA 3HD7A 4JI4Q 2KHIA 3VN0A 4P71A 1PH8A 5M3MH 1K83H 4UP8A 2R93G 3RZOH 1E7ZA 1I3QH 3AFPA 5BU5A 4NXML 3H3VH 2QA4A 3RL0D 2E2IH 2XGTA 3D31A 5APYA 4DR3L 1IZ6A 5H1SE 5EAYA 1KIXA 4BXXH 1X3GA 1NBWA 2VW9A 4A3CH 3T1YL 2M3BA 4JF7A 2B63G 3KQGA 5M5WH 4LLHA 2J58A 3BATA 4GKKL 2FFDB 1UWVA 4L5SA 3M7NA 2YKPA 1YJ9A 2JEEA 3M9QA 3BJUA 1WYDA 4FDBA 5AW8B 3EN2A 4JOIA 3S2HH 3RN2A 4Y7NH 3GTQH 5IP7G 1DX7A 4YHHQ 1N73A 3H32B 2UXCQ 4B3SL 2V1CC 4JI8Q 3K8AA 4AYBE 1SMXA 1UE6A 2AWOA 1XTCC 4ZKPA 1GU4A 4WJ4A 2FXQA 3AFQA 1WT6A 4PMWA 5KLVK 3M4PA 1XMOQ 4WY4B 2UUBQ 1VQJA 4JI2Q 3KPEA 3HOWH 3HOUH 1FOSF 2LXJA 3M3YH 5JJLA 3V5BA 3GTLH 1U5KA 2JA7H 2ZJPA 1AH9A 1IBKL 2VUMH 2KB7P 1GTWA 3KF8B 1OXZA 2YO3A 4UPAA 2K52A 1GDTA 2IY5B 3GTGH 4JI1L 4H02A 5CJ4A 1KILC 1BVSA 1FJGL 3MGNA 1SR3A 1E24A 3EQ2A 5APSA 5CHXA 1MFZA 4A3EG 1C0AA 2OWOA 4PZ8A 5GAGC 2WP8J 4R1JA 4GIFA 1JJGA 1A62A 2KP8A 4IJLA 4R4QA 5JJIA 2UUBL 3BZCA 4EIJA 5C0XI 1SQPK 1PFSA 3A5ZB 4JI6L 3CCQA 1PH4A 1KAWA 4W7YA 3BRTB 2LSSA 3UDXA 4APVA 2R7ZG 4GOPA 2CWPA 3S16H 1JT8A 4A3KH 3O8ZA 1X65A 4JI8L 5APXA 2EIFA 4KLKA 1E5WA 1FAVA 3VMYA 3BVHA 1WOCA 3E9HA 1KQLA 5LMNL 2WAQE 3M0DA 1KRSA 3ULJA 4EQ5A 2PMZE 2L15A 1KC8C 3ICEA 1JY3O 1Q81C 2Q2HA 5IYCH 1MUUA 2DGYA 2ZFCA 3HE4A 2EXDA 4GLAC 3VTPC 2PP6A 3T1YQ 2WFWA 1TWGH 1FZCB 3V4QA 3HTKB 2YTVA 4A3DG 1RF0A 2E42A 4KI0A 3KDFA 4C3IH 5CJ0A 1NAFA 2R7DA 5AW6B 2VQEQ 4BBSG 4HJ7A 2A45H 5APTA 5K36G 2EQSA 1IFIA 3DM3A 1XNQQ 5KTBA 3HUSA 3M85A 2K5HA 5C0XJ 1N32L 4IPGA 1JY2P 2IX1A 1T3UA 3LIEA 2HFED 1OWAA 2Z0SA 2IX7C 1GL2C 5CCGA 1EIYB 3H6PA 3RN5A 1V9PA 4C7RA 3HOUG 1J1EC 5KJ7A 2WWWA 3HE5B 4LFAL 1QL2A 1A8VA 1N33Q 4MNOA 3PP5A 1PH3A 1S9KD 3PF5A 3TS2A 3G3ZA 3C9IA 3KFUA 1N36Q 4DV5L 1EQ7A 1AFOA 2JA6H 4DR6L 4LFAQ 2VQFL 1VQ7A 1JUNA 2AHOB 4JBKA 3AQQA 3OW2A 3SGIA 2IPPA 4EOTA 3BU2A 1KILB 4LF5L 4A3EH 1HNWL 3MD0A 1URQD 1HGZA 3GHGB 1N32Q 1IXRA 5C44G 1PHJA 1HJBA 2JJQA 2NN6I 4IFDG 1RF0C 1XNQL 2YV5A 1JY3N 2JJLA 1SQVK 4NXNL 3ULPA 2Y0SE 1WFQA 1KRTA