3M9BA

Crystal structure of the amino terminal coiled coil domain and the inter domain of the mycobacterium tuberculosis proteasomal atpase mpa
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
186
structure length
186
Chain Sequence
SARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQPPSGYGVLLATHDDDTVDVFTSGRKMRLTCSPNIDAASLKKGQTVRLNEALTVVEAGTFEAVGEISTLREILADGHRALVVGHADEERVVWLADPLIAEDLPDGLPEALNDDTRPRKLRPGDSLLVDTKAGYAFERIPLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome-associated ATPase
publication title Binding-induced folding of prokaryotic ubiquitin-like protein on the Mycobacterium proteasomal ATPase targets substrates for degradation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Chaperone
total genus 31
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16450 Prot_ATP_ID_OB Proteasomal ATPase OB C-terminal domain
A PF17758 Prot_ATP_OB_N Proteasomal ATPase OB N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3m9bA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m9bA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m9bA02
2N9BA 2NN6G 1JE5A 1VQHA 4TQUS 3JC66 2NN6I 4LUZA 3P32A 3P8MC 4PZ6A 3PF5A 4X65Q 1KAWA 5APWA 3GTLH 3HOWH 4DV7L 2H7HA 1N9WA 3BU2A 3HE4B 2IPPA 1Q1EA 1HBWA 3AQQA 5IYBH 3A5TA 2R93G 4GS3A 5BR8Q 4A3GG 1B8AA 1L1OA 2YU9H 1KL9A 4JBKA 3STBC 1XMQL 3KF6B 1ASZA 1IZ6A 4BBRH 4X64Q 1Z9FA 1S40A 2H5XA 4HIOA 1XNRQ 2E2IH 3PV0A 1JJ2A 4GNXA 2UXBQ 2AHOB 1IBLL 2KP8A 4FDBA 5AW6B 3TS2A 1WI5A 4JI5Q 1UEBA 2JA6G 1T2KC 2BA1A 4IJHA 1NWQA 2CFMA 4LFAL 4GLAC 4Y52H 4PZ7A 5AVVB 3EIVA 5LMUQ 4NXNL 1FOSF 3M4QA 1CSPA 1G6PA 4LF8Q 4P73A 4DV0Q 1VQ5A 3G71A 5HGQA 4JV5Q 4GOPA 4MTNA 4IPDA 3U4ZA 2UUBQ 1XPRA 4A3DG 1XTDA 1E1OA 1G51A 5GAGC 3O8ZA 3ZJYC 5C4XH 2I5LX 3HOVH 2NZOA 4OWWB 2UXDL 1GZLA 3I5CA 4DUYQ 2Z6KA 2NVQH 2R32A 2RHSB 4UPAA 3KJPA 3T1HQ 2I0QA 4DR7L 1OXVA 1KD1C 4AIMA 3B8EB 3IR9A 1H88A 5GAHC 4M3LA 4UP9A 1TWFH 2R92G 5AW7B 2Q2IA 2MQHA 2VY3A 4DR4Q 3PO3H 5FJ8G 1B70B 1TWHH 4A3FH 1SN8A 1CKOA 4L5RC 1Q81C 2A8VA 2QM8A 3M4PA 3KDFA 4R4CA 5AW3B 2ZM6Q 2PNHA 4IOAA 1H89A 1VQ8A 1OXXK 1G291 4B3TQ 3KYHC 1SLJA 4LFBL 1YI2A 1YHBA 3HOZG 3KLWA 3CMAA 3PUVA 4DUZQ 2D0PA 1A63A 4UP7A 1W3SA 3UE1A 4BBSG 3JAMi 3HE4A 4C3HH 2C35B 4R4IA 5AJ3Q 2UXBL 2JA7G 5GQOA 1WCMG 5C4JH 2B63G 4LUOA 3RN5A 1FL0A 3I4MG 1XNQL 3NFQA 2Z5IA 2OTLA 4IPHA 3GDEA 2R93H 1K8GA 2JJLA 3DLLA 4A3GH 5LMUL 1QZHA 4NXMQ 1YJ9A 5AW4B 2YTVA 4LUVA 4LF8L 3F2BA 3KOJA 4JYAQ 2YV5A 4JI2Q 1J5EQ 3V4QA 1HR0Q 4DV4L 3J80i 2UUBL 3HOYH 3PUZA 2NVXH 1XMOQ 1SLQA 3S16H 4DV3Q 4LF9Q 2D62A 2FXQA 1OXSC 1PH4A 2JA6H 1YHQA 1QVFA 3HKSA 1V9PA 4DUYL 1U5KA 3VTPC 4YWKA 3BJUA 2K50A 3CCLA 4K0KL 4A3MG 1C0AA 3WWVA 3E9HA 3CCEA 2ZXEB 1XPUA 2F52A 3H3VI 1JNMA 2OWOA 2PI2E 4A3DH 1UE6A 2E2HH 1FJGQ 2VUMG 2WB1E 2HQLA 1YYCA 2MFIA 4KHZA 1L2FA 4IFDG 1P16A 4LC1A 2Y0SE 3A0JA 3M9HA 3NEMA 4IOCA 3RLOA 4B86A 3CAMA 5IYDG 1HNXQ 4AYCA 4IFDI 1T9HA 2ZTEA 2HIVA 4B3TL 3NTNA 4EX5A 5AVRB 3TQYA 2EXDA 3CF5A 4A3IG 5FLMG 4HYTB 1HZAA 4LF5Q 2I5HA 4A3BG 1VQ6A 2R92H 3BZKA 2KENA 2YTYA 5IYCH 4YY3Q 1W2BA 4APVA 3GD7A 3NXSA 3M91A 1GVPA 3ERSX 2JA9A 2VQEQ 2WTYA 1IBKQ 3S17H 2RHQB 3GTGH 3S14H 3L36A 5AJ3L 4MZ9A 4B3SL 5AVQB 2MNAA 1QVGA 4QJFA 5LMNQ 4GKJQ 1EWIA 5C0XJ 5APQA 3TK1A 1Y1WH 3J81j 2UUAL 5JJIA 3NELA 3HOZH 4BXXG 4NXML 4A3EH 1A02J 1PHJA 5AVUB 4JYBA 3J81c 4JYAL 1J5EL 1LUZA 4BBSH 4WJ3M 5GADC 3RNUA 1NMFA 1VS0A 1JJGA 5AVZB 3HE5B 1GD7A 4JG2A 3J80c 3KDPB 1S9KD 3VN0A 4LF9L 1WCMH 2WT7A 2XU6A 3GTOH 3VMZA 2JE6I 2B63H 1EQRA 1N36Q 3I4MH 4HIMA 1PH2A 5IP9G 3L7ZC 5JEAG 1IBMQ 2ZFCA 2ES2A 1VQCA 1EYGA 1GK6A 4XTCS 4LF4Q 4DV2Q 1FGUA 4EOTA 3T1YQ 1T2KD 2WFWA 2K52A 2QA4A 3TNUB 4JI1L 3EN2A 4YCVA 3OYYA 5K36G 4DKAC 1FJGL 4YHHQ 3HKZE 2VRSA 2HHHL 2P7JA 4OX9Q 1N8RC 1IL2A 4YCUA 1N34L 1OXUA 4LFCL 2C9NY 4JI3Q 3S1QH 4RMFA 4QL5A 4DV1Q 3ULPA 1HNXL 1CI6A 3ULLA 1FOSE 1GM5A 4YCWA 4JBWA 5M5XH 4A3MH 1HZCA 3OW2A 5M3FG 3CC7A 4A3KG 4PZ8A 4GN4B 4AQYL 4O2DA 4TVAB 1S3OA 3K81C 1I94Q 2VUMH 4YY3L 1A02F 4AUWA 4HJ8A 5JJKA 3TEHB 1H8AA 5IWAQ 1PH8A 2P67A 5AW9B 3CC4A 2R7DA 3KQGA 3UE0A 3A5ZB 3T97A 5IYDH 3M06A 2R5BA 2VZAA 5LMNL 1HNWQ 3MD0A 3HFZB 1Q46A 2UXCL 3RZDH 1TWAH 2XGTA 4A3IH 5FLMH 1VQPA 2Z0SA 4A3BH 2R7ZG 3K0XA 2K75A 3V4WA 4JI7L 3S15H 2GN5A 4DR5Q 3GTMH 1NMGA 3PUWA 1X56A 3GTKH 4O0AA 2PMZE 4DR2Q 3I2ZA 1QZGA 2ZJRA 2B29A 2CQOA 2P2UA 2JK8A 2K4KA 5AVXB 4BXXH 5C3EG 3FKIG 4XE5B 1OWAA 3HE5A 1VQGA 4JI6Q 1CKNA 2BH2A 3OTOL 3K7AH 2NVYH 2LSSA 1Q8KA 1RL2A 1FAVA 3M0DA 4OX9L 1CZQA 2VQFQ 3PCOB 4DV1L 2GVBA 1NY4A 4JC0A 3TNUA 1P8LA 4GLXA 3CXCA 3TRZA 4GKKQ 5AVTB 2KHIA 3PUXA 2E5LQ 3F2DA 1I94L 1PFSA 1K0RA 1MFZA 2N8NA 4DAMA 1HR0W 2HT1A 1YBYA 5IWAL 2JQOA 3DM3A 1ASYA 4X65L 4DV5Q 1L1OC 1IXRA 4KHPQ 4X6AH 4DK3C 1SROA 2UU9Q 1R9TH 2WWWA 3I7FA 2PI2A 1N33Q 1HNWL 5M3FH 1NE3A 3KFUA 4GNXC 3ICEA 5M5YH 4A3KH 5IT9c 4GN3B 5BR8L 1VQIA 1JB7A 3PO2G 1SMXA 3CCVA 5AW2B 1VQBA 1SP4A 4LF6Q 4A3CG 3LIDA 3H0GG 1Q12A 4UP8A 1VQLA 2WPRA 3I55A 4R4OA 4X64L 2ASBA 3PF4A 1VQNA 1XNRL 5AW0B 4Y7NH 3PGZA 4JI5L 4GOPC 2Q7CA 3UDFA 3CCMA 4C2MH 4H02A 1WYDA 5E7NA 5AVSB 4A75A 4GKGA 3PIOA 4DK6C 3OAKA 5M5WH 3KF6A 5C0XI 1MV8A 3UIAA 1HJBA 4DR1Q 3J81i 2R7ZH 2ZTDA 1N32Q 4DV0L 1KQSA 2Z6KC 5JJLA 4A93G 3KJOA 4JV5L 4OO1G 1K3RA 4B3RQ 1GTWA 3F1ZA 2ALYB 4P74A 4YWMA 4OO1I 1PH3A 1Q1BA 1H95A 4XIGS 2F3IA 3PUYA 1HUCA 2JEAI 5LMNW 2VQFL 4C7NB 1A0IA 1QUQB 3CD6A 3M85A 3T1HL 3IRBA 4JI0Q 5C3EH 3FKIH 3K8AA 3S1RH 2YYZA 2IX0A 4DR3Q 3L35A 4LF7Q 2E5LL 5DLQE 4X66Q 5IP7G 4DR4L 2WAQG 3GO5A 1MJCA 1NBWA 1Y14B 2WPSA 5C44G 4KHPL 2ZM6L 3L0OA 4X62Q 5AVYB 5GROA 4OWTB 3V5BA 5J3BA 1GK4A 4P75A 2L15A 2Q2TA 1Q82C 1CSBA 2KBNA 1EIFA 2XV5A 1X55A 4DUZL 1GKHA 1DGSA 2JA8G 1MJEA 3AEVA 5FJ8H 4C46A 2MO1A 1KRTA 4LF6L 1EUJA 1Y1VG 4JBJA 3A2AA 2IX1A 3Q8DA 3M4OH 1PH7A 2W6AA 3FHWA 1IYJB 2OTJA 3U4VA 4KHXA 1PH6A 1L1OB 1YJNA 1X9NA 2IY5B 1E24A 1VQJA 3CPFA 1X6OA 3RZOH 5APVA 1TWGH 4C3IH 3ER0A 3PO2H 1AE3A 3VDYA 3U50C 3A5UA 3ULJA 4GNXB 1C7YA 1RIPA 1UWVA 1TXYA 3HTKA 5AW5B 3H0GH 4JI2L 2E2JH 4POGA 2JA5G 1PH1A 1E7ZA 2Q2UA 1HNZQ 1HR0L 4JYCA 3GTPH 2CCZA 3LGJA 1V43A 2JA7H 2NVTH 1XMOL 4DV3L 3PIPA 1WOCA 4PG3A 3S24A 2YNYA 4POFA 2DGYA 4GOPB 5APUA 1HWTC 4YWLA 4UY8C 3RN2A 1VQEA 1YNXA 1OXZA 2AMCB 1OTCA 2KHJA 2NZHA 5HY6A 4KI0A 4QGUA 1G2CB 3J7ZC 1GU5A 1PH5A 4DR3L 1J6QA 2B3GA 1XPOA 1E3PA 4LF7L 1Q86C 4P71A 2K14A 4C7NA 1BVSA 3W1GA 3CC2A 2JJQA 1KHIA 4L5QA 4J15A 1PYBA 5APXA 3S1NH 3PO3G 3G48A 3H3VH 4X62L 2WP8J 3KF8B 2ZJQA 4IFDJ 3HOXG 1KIXA 4BY1G 4LF5L 1HH2P 4DR7Q 5APYA 4OONA 1EOVA 4I6MC 1UE1A 3A3YB 5ELOA 2CKZB 5IP7H 3M3YH 1O7IA 1VQDA 4B3MQ 1K83H 1BBUA 1QVCA 2VQEL 1IBKL 5H1SE 4JI8Q 5C44H 2V1CC 2BASA 4GKJL 1I6HH 3F8TA 1X3GA 2QEXA 3BZCA 1AH9A 4L5SA 4HJ9A 3HOUG 2R7FA 4JI4Q 2JA8H 2Q2HA 1J2JB 3TYYA 4DV6Q 3VMXA 1X3EA 4QY7A 1VQ4A 1FVIA 4LFBQ 3GTQH 1S9KE 3H15A 5M3MG 1Y1VH 1HNZL 4RESB 1D8LA 2F4VQ 4LWCA 2ZTCA 2HIXA 1X3FA 3D0FA 4C3JH 1K73C 3CCRA 2XTIA 1EFWA 1N36L 5FLXc 1NJIC 1MIUA 4LNQA 1IBML 3HOYG 4BY7G 1PYSB 4DZOA 1X54A 2QM7A 4OWXB 1XNQQ 4LF4L 4DV2L 1A62A 1YVCA 1JUNA 5JEAJ 3T1YL 3LIEA 2GVAA 2JA5H 1PA6A 4EQ5A 2OQ0A 2OQKA 3E0EA 1YZ6A 3CQZH 4R4TA 4YHHL 1OXTA 1LYLA 1CKMA 1B7YB 1VQ7A 2W27A 1HJPA 4GT1A 2LXKA 4DV4Q 5IP9H 2PQAB 3F2CA 4JI3L 3MGNA 2VL6A 4I2LC 4IPCA 1MUUA 1A8VA 3EBEA 3S1MH 3P7KA 3M9BA 4A76A 1SFOH 5EAYA 3A74A 1L0WA 3UDGA 2WB1G 4A3JG 1VQKA 4ME3A 5AW1B 4K0KQ 2Y0SG 4ALPA 2K5HA 2AWOA 4NB3A 4B3ML 3E9IA 4DAYB 4L5TA 1UE5A 4JI8L 5IYCG 3L37A 3U58A 1TWCH 3SGIA 2VW9A 2ATWA 3I4OA 2YO2A 1KC8C 2R3CA 5IE8A 3HOXH 4BY1H 3VMYA 4LW1A 1NAFA 1IO4A 1KRSA 2CWAA 1U0LA 4JI4L 3AFQA 1GD2E 1BKBA 1I50H 1Y1WG 1YIJA 4DV6L 4JOIA 4IJLA 3S2DH 4DR5L 2DUDA 4R4QA 4A3EG 2F4VL 2C9LY 2R5DA 1YJWA 3TREA 4DR2L 1AE2A 4AYBG 5C0XG 4P72A 4R1JA 1GU4A 4AH6A 3I4NG 2Q5UA 2VS1A 2N49A 2E8GA 1M1KC 1E1TA 3HOUH 4B3SQ 4A4IA 5AW8B 3B6YA 2N3SA 4GN5A 2UUCQ 3SWFA 1PVOA 4JI6L 2UUAQ 1PH9A 2E42A 2WT7B 5M3MH 3NMDA 5APSA 1JT8A 1C9OA 3TS0A 1VQMA 2A1AA 3CP0A 4OXPA 4DPGA 3UDXA 5ELNA 3W1BA 1DH3A 2E43A 1I3QH 4BY7H 1SRUA 4A3LG 3D31A 1X65A 2I5MX 2IHFA 3K7UC 1EQQA 2MO0A 4DR6Q 4GLVB 1YITA 2RF4A 3CMEA 3CCUA 2IT1A 3HKZG 4GKKL 4AQRD 4QIWE 3CCSA 4RG1A 2PQAA 2LXJA 1YEZA 5APTA 2ZJPA 1CI6B 2KCMA 1LM0A 2BH8A 3MEFA 3CCQA 1EIYB 4JI1Q 4DV5L 4PMWA 1CSQA 2AKWB 3A7OA 3NBHB 4KLKA 2CWPA 3S2HH 2UU9L 3I56A 3AYHB 3G4SA 2HHHQ 3MXNB 1N33L 4JOIC 3CPWA 5GAEC 4QQBX 1N34Q 2Q3IA 1D7QA 4LFCQ 1WFQA 3HOWG 2YTXA 4A3JH 4JCVE 2ID0A 3RLFA 5IYBG 2WPQA 2A19A 3RR5A 2N78A 4WJ4A 1NTGA 4AQYQ 1VQFA 1UE7A 1PV4A 3NENA 3AFPA 4BBRG 5IY0A 2AWNA 3K80C 3JAMc 4JBMA 1V1QA 4DV7Q 3G6EA 4DR1L 1K9MC 3M0AA 2K5NA 1S72A 2UUCL 1N32L 1M90C 4AYBE 2UXCQ 4A3CH 4HJAA 2R6GA 1XJVA 4DNIA 2EQSA 4B3RL 2IHEA 1BBWA 1JMCA 3GTJH 1XMQQ 4JI7Q 2Z5HA 1JJCB 4MNOA 5AVWB 1GO3E 3CW2C 1CUKA 1KQLA 3I4NH 4HIDA 4BA2I 1IBLQ 5C4XG 3W5OA 1WJJA 3HOVG 2VNUD 1CKNB 4HJ5A 3RLNA 1HZ9A 1I5FA 3VYIA 4JI0L 4HIKA 4NPSA 4LFAQ 3STBD 4A93H 2JEBI 4DR6L 2RCNA 4NXNQ 3L2PA 4IO9A 4HJ7A 5CMZA 4X66L 2EIFA 4BA1I 1VQAA 1QUQA 1VQOA 2BA0A 1E22A 2KCTA 1SE8A 3OTOQ 2K5VA 1VCIA 1Q7YC 1K8AC 3M7NA 3CCJA 1Z47A 4A3FG 2XZRA 2YO3A 1MKHA 1KXLA 4A3LH 3PSIA 2UXDQ 1X8YA 3J7A5 2WAQE 2QGQA 1SR3A 3FP9A 1HZBA 1VQ9A 4IPGA 1YHAA 2OCEA 3UDIA 3KDFB 2D0OA 1LTLA
chains in the Genus database with same CATH superfamily
2N9BA 4E6IA 2NN6G 1JE5A 2O5JC 3SWYA 1JE4A 1JCCA 4K6DA 2QJPC 1VQHA 4LAAA 2JWAA 2WB1B 2F03A 4H13D 1N8RQ 4TQUS 4A3JB 3KZIH 1YNJC 2KI7B 1WD0A 2F0KA 3JC66 1NTKJ 3FEWX 1SYDA 3CCQP 2WV6D 4XT1B 4A7PA 1L0YB 2NN6I 4LUZA 4N8FA 1LGHB 1U7JA 2JWDA 2WZ7A 3AE2C 3P32A 1OFCX 2Y0SB 1NTKE 1YQ3C 3P8MC 4PZ6A 1L4AB 3PF5A 4X65Q 2ZXRA 4H0LC 1EOTA 1KAWA 4C3HG 1TU3F 3H1HJ 1PPJD 3L70J 1BE3J 2W8ZA 3I56P 5APWA 1L0NG 1HPCA 2M2LA 5M9OA 3Q0AA 3GTLH 3K59A 3HOWH 1PGQA 4DV7L 3NQTA 2H7HA 3H1HE 1N9WA 2I8DA 3L70E 1BE3E 2F0EA 1Y8NB 4B08A 3BU2A 4OELB 3HE4B 2NZ2A 2A6HC 3BRVB 5ELEA 2IPPA 1E2ZA 2NTTA 1Q1EA 3OIPA 3B5NA 5CCGD 3PMFA 1RD9D 2RSNA 4RH6A 2SNMA 1WTXA 1HBWA 1U9RA 2JN4A 1M4VA 3AQQA 2F0MA 1YNND 5IYBH 2POHA 3Q23A 1A2UA 1K3BC 4EI2A 3A5TA 2E76D 1Y8AA 2KSEA 2R93G 4GDOA 1W2BO 4GS3A 5BR8Q 1EQ7A 4A3GG 1EY7A 2B2VA 1B8AA 3S14B 4JW0A 1L1OA 2YU9H 1JY2P 3CWBG 2IDBA 1S2EA 1KL9A 1RODA 1N7SD 1ICFB 2FHTA 4L74A 4J6HA 1F9PA 4JBKA 4RFBA 3MIWA 1DONA 3VR3A 1HHVA 2LR2A 3STBC 2I07B 1XMQL 1OVVA 5FKAC 1RQVA 3KF6B 5TJHA 1ILQA 1Y1WB 4H44B 2KZJA 1ASZA 1IZ6A 4BBRH 3T16A 4X64Q 1Z9FA 1BBXC 1S40A 2H5XA 1KORA 4HIOA 1XNRQ 2E2IH 3PV0A 1JJ2A 1H0TB 1QVGO 2F0TA 4GNXA 4B9XA 3HOZB 2UXBQ 2D2CD 2AHOB 2YIUC 4NPDA 1IBLL 2KP8A 4FDBA 1ET9A 4DAVA 1KFMA 5AW6B 3IAOA 3QIAA 3CX5I 4A3EB 3TS2A 5KKZB 1WI5A 1EU4A 4JI5Q 2KS1A 1UEBA 5KIXA 3R2TA 2JA6G 3GTJB 2E74C 1T2KC 4PMBA 3ONAB 2BA1A 2K04A 4IJHA 1D6EC 3DHQA 1SQQG 1NWQA 2KXPB 1S5CD 2CFMA 1JOCA 3G6EP 4LFAL 3S9OA 4GLAC 2MJZA 4BBSB 3I4NB 1SFCC 1H9RA 4Y52H 2RCFA 4Z9CB 4PZ7A 5AVVB 5C4HA 1IFPA 5IT9E 3CWBD 3LW5J 3EIVA 4Q5VA 2PO4A 5LMUQ 1EDLA 1FOSF 1Y8PB 4NXNL 1VMCA 1DD2A 4CGYB 4HMJA 1NTMK 3M4QA 5CCHD 1CSPA 1KAAA 1BDDA 4FXGC 3VR4A 5C3WA 4LF8Q 1G6PA 3CX5D 1LTRD 4CHTB 3GW6A 1OX3A 4P73A 4UB6E 1CW5A 2BOSA 4DV0Q 3JSVC 1VDFA 4RCNA 1VQ5A 2B63B 3G71A 5HGQA 2I1JA 2UWJE 4U3FG 1GHJA 2F0JA 4JV5Q 4GOPA 4MTNA 1RY3A 1MSHA 4IPDA 1OVUA 1EIHA 2PNRC 4KY5A 5DM63 3UI2A 5KAFE 2WPVB 2ZJSE 3U4ZA 2UUBQ 1XPRA 4A3DG 1XTDA 1SQVG 4N78E 1E1OA 1G51A 5AFWA 5GAGC 3O8ZA 3TGUG 1U57A 3ZJYC 2SDFA 5C4XH 2I5LX 2W6BA 3H32B 4RJTA 3L73G 1S1CX 4NW2A 1BSHA 3HOVH 4ZMDA 5KRUA 2FXPA 2EY6A 2KLUA 2EVBA 1BCCG 1X0TA 4G4KA 1GL2B 2NZOA 2LXCB 1SQXD 2OYHC 4OWWB 3PLNA 5KLVJ 1S5BD 2FXMA 2UXDL 3D4WA 1FS0E 4RAUC 1GZLA 3I5CA 5KAFH 4DUYQ 2Z6KA 4LMQD 1L0LJ 4RKUJ 1U4LA 1LTJB 5BN3A 2NVQH 2R32A 1L0LE 4XA4A 2RHSB 4UPAA 3KJPA 3T1HQ 2I0QA 1PTOH 2HQEA 2ENBA 4DR7L 1OXVA 3FX0A 2DY7A 3URYA 1KD1C 3OMGA 5CV4A 4U3FD 1KABA 4AIMA 3TSSA 4XXEA 3B8EB 3IR9A 1IFNA 5CYUA 2ZYDA 3M7GA 1H88A 2QF7A 3TDKA 5GAHC 1ZLLA 4M3LA 1JICA 4UP9A 1QNUA 1TWFH 2O01N 1EZ6A 3TGUD 2B2WA 5DEHA 3QH9A 2Q8RE 2EE1A 3FPUB 2R92G 3E5SA 1CA5A 3S1QB 5AW7B 2Q2IA 2NTSA 3HKZB 2MQHA 2X6GA 1NNXA 4UB8E 1VQOP 2VY3A 4ZCKA 4ZKBB 5IODA 4DR4Q 1EXIA 1RTNA 3D6YA 3PO3H 5FJ8G 1B70B 1TWHH 2J59M 1YNNC 3H6MA 4A3FH 3CC2P 1KMIZ 5EBDA 2E76C 2M5AA 1SQPG 1DOMA 2MJ8A 1SN8A 2FJ2A 5EBCA 5M5XB 1IYVA 4A3MB 4XT3B 5I6WA 1CKOA 3W2DA 4L5RC 1Q81C 2JSOA 1Q3LA 1VF5B 1NKZB 1VL2A 2A8VA 2QM8A 2FBWC 3KDFA 3M4PA 1TT2A 2P1JA 2A73B 1M1JB 2H43A 1B9NA 4R4CA 3PJSK 4IN3A 1RHPA 1EU3A 5AW3B 2ZM6Q 2PNHA 4QF4A 4IOAA 3H25A 1H89A 3QR8A 1VQ8A 3SFEC 1OXXK 1JCDA 1G291 4B3TQ 1H9JA 1QE6A 4KMUC 4Y99B 4K3AA 4TLFA 3W67A 3KYHC 2A5HA 1AZQA 4IL6E 4PNYA 2D2CC 1G8ZD 1SLJA 4HR7B 4LFBL 1STNA 1YI2A 2ZYGA 1YHBA 4NKLA 2HCCA 3HOZG 5G3LD 2NN6H 3KLWA 1B3AA 3TP8A 1LTTD 1ZEQX 2IWHA 3HP3A 3CMAA 3PUVA 4CJ0B 1RE3A 3BRTB 1BCPF 4DUZQ 3GTLB 3HOWB 1L0NE 1L4AA 2D0PA 1A63A 3SHLA 1O80A 1SQPD 2BEQD 1X9VA 3R2IA 4UP7A 3HZXA 4RHRA 1T8ZA 5ELFA 2ZXOA 3Q6SA 4LJZC 4K8JA 4KN7C 1W3SA 3ND9A 2IYPA 3UE1A 1RQUA 4BRYB 2AQ2B 4BBSG 3JAMi 2E5YA 2BE5D 1PXUA 3HE4A 3K5OA 2B2TC 3WDNA 4C3HH 4A3IB 1XWEA 3Q1MA 2C35B 4R4IA 5AJ3Q 2UXBL 1LTGD 1PTOF 2JA7G 4A3BB 5GQOA 4BWGB 3HTKB 1WTRA 1EZVE 1RF0A 1I4RA 2YU9B 1WCMG 1HFNA 1KDAA 5C4JH 2QEXP 1QX8A 3NTKA 3L75J 1KNAA 4LUOA 4ULLA 5J1ZA 2B63G 3MFYA 3RN5A 1FL0A 3I4MG 3S15B 2Q1KA 3C2PA 3FVQA 1XNQL 4ZNCA 1MGSA 1JM0A 2SPZA 3NFQA 3L75E 3IKJA 2Q3EA 4BBRB 4IZ8A 2Z5IA 1V1PB 2OTLA 4IPHA 2W6JH 3GDEA 4HEDA 2R93H 1K8GA 4PJ0H 2K7VA 2JJLA 5DNFA 3DLLA 4A3GH 5LMUL 1QZHA 4ZYSA 4NXMQ 1IJDB 1B50A 1SNCA 4GOFA 2SNSA 1YJ9A 5AW4B 2YTVA 4LUVA 3GTKB 4LF8L 2HODB 1BGYG 1TS3A 3F2BA 2KQ3A 4M1UB 1Y47A 1H0TA 4R8NA 3KOJA 2A45G 1M57D 2QJKC 4JYAQ 2YV5A 4JI2Q 2M00A 1J5EQ 1D7MA 3V4QA 2A74C 2IBZE 1Q90D 3TZUA 3RMHA 1HR0Q 4DV4L 1A2TA 3J80i 2UUBL 1NYHA 4R4MA 1URQB 2K5QA 4WBAA 3HOYH 1MFTA 1CM9A 2PMZB 3K5BA 2A45I 2O4XA 3E0JA 3PUZA 4PD4E 1XMOQ 1SLQA 2NVXH 3S16H 4DV3Q 4LF9Q 2D62A 4EVOA 3CL3D 1PRTC 2FXQA 1GDTA 1OXSC 1PH4A 2JA6H 2AUJD 2LFNA 2A6ED 1YHQA 1QVFA 3H1KD 4ASWA 3HKSA 1BSNA 1V9PA 2Y0CA 3GP7A 4DUYL 2B8GA 1ZXTA 1U5KA 3JCUE 3OW7A 3VTPC 2XWBB 1NTMG 3A7AB 1LT3D 1UNSA 4FF2A 1TS5A 2HYNA 2I1KA 4K2KA 1JORA 2E74B 4IURA 1BGYD 4YWKA 3N4XA 3BJUA 4I65A 1R5SA 5C4XB 1SQVE 4MN4C 2L5TA 2NVYB 5I4DA 1IHZA 1E0BA 1SJED 4Y28J 2K50A 2PQEA 3HOVB 4K6LA 3CCLA 5I2YA 4K0KL 3L73E 2K1AA 4A3MG 1C0AA 2SEBD 3J7YW 3WOFA 1FGBD 3E9HA 3HRZC 3WWVA 3CCEA 1MHWC 3H32A 1BCCE 4RGNA 3VYSA 2ZXEB 1VDZA 1XPUA 4L73A 5B66E 4CDCC 2F52A 2B9BA 3H3VI 1JNMA 3L74G 2OWOA 2OARA 1GL2A 2PI2E 2NVQB 4A3DH 1B4OA 1UE6A 2E2HH 2K6AA 1VQ5P 1EYCA 1FJGQ 2VUMG 5LL6X 3E3XA 1PTOB 3I73A 2WB1E 2HQLA 1XTGB 2RQXA 1G2SA 1LTJA 1YYCA 2MFIA 1SVFA 1I6VC 3AE4C 4KHZA 1L2FA 5JPMC 4OIKA 4IFDG 2O01J 4ILWA 1QWYA 1P16A 1LTTC 3OA7A 4LC1A 2Y0SE 3A0JA 3N6RA 1QG7A 3M9HA 3MXPA 3NEMA 4IOCA 1LABA 3RLOA 1GJXA 1OW6A 4B86A 4QUFA 4XQJA 3CAMA 2IFMA 4PV1D 4DNRB 5IYDG 1ET6A 1HNXQ 5CV6A 1LT6D 1GXDC 1TQOA 1CA6A 2O1JA 4AYCA 4IALA 2XRSD 4IFDI 4DAYA 3RUZA 4MTKA 1T9HA 2ZTEA 2HIVA 5CORA 1RDPD 4A3FB 2YMKA 5GTIE 4L63B 4B3TL 1IFMA 3NTNA 4H13B 2BE5C 1WMKA 4EX5A 5AVRB 3T97B 3TQYA 2F3VA 3FGAD 1VQKP 1EY0A 2EXDA 1W5CE 3CF5A 1SNPA 4A3IG 5FLMG 4HYTB 1HZAA 4LF5Q 2I5HA 1RF0C 2YXRB 3VMAA 2B2YA 1EDKA 1K05A 1USEA 4A3BG 1KYOI 3H1JD 1VQ6A 2R92H 3BZKA 1KN7A 2KENA 2YTYA 5IYCH 1SJHD 1N73C 4YY3Q 1W2BA 3LWUA 5GTIH 1SS1A 4APVA 3GD7A 5CJ0A 3NXSA 1M1JA 3P1HA 1QNKA 2NBFA 3M91A 1J8IA 2ICIA 1RH5B 1GVPA 4ZK9B 4JF7A 3ERSX 2JA9A 1PFIA 2VQEQ 1FZCB 2WTYA 1IBKQ 5M3FB 3S17H 2RHQB 3GTGH 2JP1A 5D3DA 2BDNA 2WKCA 5I2XA 5M5YB 1RKNA 2WSCJ 4IUQA 1BXTA 3S14H 1W6KA 3H1IG 3L36A 1DM0B 1O7LA 2E76B 5AJ3L 4MZ9A 1KYOD 5CMDA 4C3JG 1Q82Q 4B3SL 5AVQB 2MNAA 2EY5A 1QVGA 4QJFA 5LMNQ 1NU1K 2BDOA 1EWIA 4GKJQ 4KD3A 3BYTB 5C0XJ 5APQA 3TK1A 1GHKA 2A69D 2NUCA 2ZT9B 4X3SA 1Y1WH 1YNJD 1N7SB 1OW7A 4N6JA 3RL0D 3MEHA 1FZAA 2HFED 1ZR4A 1QCBD 3J81j 1SYGA 1HQMC 2UUAL 5JJIA 1ZW0A 3NELA 4C3HB 1SQXK 3AE9C 3HOZH 3BZDB 4Y7NB 2A06G 3P20A 4BXXG 5BN5A 5EKLA 4NXML 5GTHH 1GUOA 1A02J 4BRYA 2GA1A 4RGOS 2JP3A 4A3EH 1QJOA 1PHJA 4BWNA 1LWUC 2A6EC 1WRGA 5AVUB 2D2CB 2BEZF 2ZYAA 5CGKA 1YI2P 2AQ3B 3DEPA 1BDOA 5KYIA 1EYDA 2RH0A 1JB0J 3AEDC 4JYBA 4U7JA 1EY6A 3J81c 4HCSA 1ESFA 2NYZD 4JYAL 3CMAP 2A6HD 1SNQA 1J5EL 3KBXA 1LUZA 3MHBA 4DA2A 3H1ID 2QIWA 4BBSH 1EQVA 1S5LX 4WJ3M 1YJWP 5GADC 1PP9G 3RNUA 2D5DA 1NMFA 2R93B 1AP0A 1VS0A 1JJGA 2WIIB 5AVZB 1KILC 3HE5B 1GD7A 4JG2A 4KKUA 5CBOA 4DXFA 3J80c 1YBKA 1FNUA 2G5DA 1KTKA 3KDPB 1JMMA 4HJGH 1S9KD 1UIIA 3VN0A 1IYUA 1WCMH 2WT7A 3X3MA 4LF9L 2XU6A 3GTOH 3VMZA 2R7ZB 2JE6I 2B63H 1EQRA 3QWNA 5KJ7D 1N36Q 3E7KA 3I4MH 2Y0DA 4HIMA 1PH2A 5IP9G 1S5FD 2RA4A 3L7ZC 4HMIA 1X32A 5JEAG 4OHJA 2HODA 1HUMA 3D70A 4C7RA 1IBMQ 1RCVD 2RBMA 2ZFCA 2ES2A 1VQCA 4FYDA 2SOBA 1WVLA 2AEJA 2J4XA 1EYGA 1KQSO 4IUNA 5G3LF 1NAPA 1R4QB 3BVHA 2OYIC 1GK6A 2QJYC 5M1BA 2W90A 2NVXB 3S16B 1ICWA 2F0OA 2OTLP 4XTCS 1JWUD 3V2TA 4LF4Q 3SXHA 4KJMA 4DV2Q 4WY4A 4DN4M 5FO8B 1URQA 2IFNA 2JA6B 1FGUA 1LP1B 2NPSA 2A45H 4EOTA 1CFMA 3T1YQ 4X3TA 3H3VC 3Q5PA 4O42A 1PP9D 4PV1C 4FF3A 1T2KD 1WTWA 1VQMP 1YJ9P 3V2RA 3BCCG 1HFGA 2EJFC 4ME5A 4OEMB 2WFWA 3C46A 3G6JB 3H6PA 2K52A 2QA4A 2PCFB 2QVAA 3TNUB 4JI1L 3EN2A 3I91A 4OH8B 4YCVA 1UAPA 2F1MA 3OYYA 1YQ4C 5K36G 1NTME 3L9AX 4KJOA 4DKAC 5L37A 1FJGL 1IL8A 4YHHQ 3Q3DA 4IOIH 5BU8B 3HKZE 3V2QA 1KFNA 3Q24A 3F5HA 5BU5A 2VRSA 3HUSC 3OHXC 2P7JA 2HHHL 3FKIB 2YKPA 3L71J 5FLXE 5FO9B 4OX9Q 1NVOA 2Q9IA 1N8RC 1IL2A 1A3VA 5CR3A 4IUTA 1SQPK 4YCUA 1N34L 1OXUA 3L71E 4LFCL 2C9NY 4JI3Q 3S1QH 2LY7A 4RMFA 4A3DB 4QL5A 2HCIA 5KNBA 2CVRA 3L74E 4DV1Q 3KK7A 3ULPA 2C0XA 1YTZI 1CI6A 1HNXL 3ULLA 1FOSE 3J81L 1GM5A 1KLUD 4FVMA 1YITP 4YCWA 5TSSA 4JBWA 1JY3N 5M5XH 3CMEP 4A3MH 2K9YA 3CCUP 1HZCA 3OW2A 5M3FG 4XQQA 3CC7A 4GOEA 3Q2YA 1ZMEC 3ND8A 1ZRTD 4XQNA 2KUBA 4PZ8A 4A3KG 1Q86Q 1AW7A 4GN4B 5IGEA 1KLGD 3J80L 2K03A 4AQYL 4QUCA 3MXNA 3CCLP 3KXDA 4O2DA 4TVAB 3FWLA 3P8CD 1S3OA 1GUWA 3K81C 1STGA 3CCEP 1I94Q 2A69C 2VUMH 1SQBG 1CTMA 1STBA 1H9SA 5J39A 2HLOA 1I4XA 1A02F 4YY3L 5KLVD 1T6AA 4AUWA 4HJ8A 3RL0C 1CQFA 5JJKA 1Z6HA 2FKWB 5L8RJ 1MKMA 4LK1C 1H8AA 3TEHB 5IWAQ 4CKCA 4JK1C 1SYEA 2P67A 1PH8A 5AW9B 3H94A 4TSSA 1I4PA 3CC4A 3NBHA 5K5GB 2R7DA 2B39A 4Q0FA 1IK9A 3KQGA 4JVZA 3UE0A 4V190 3O6QB 1HQRD 1RF1C 1SE4A 2N9YB 3AEFC 3G4SP 3A5ZB 5NUCA 3OJAB 3T97A 4N8X1 3MZ5A 4L8JA 2R92B 5IYDH 5H2FH 3C3LA 1IK7A 3M06A 2R5BA 3TMEA 1DZ1A 2VZAA 1TS4A 4ZKUA 5HURA 4HB1A 3HD7A 2DN8A 1HXYD 3A8JE 3NK9A 5EPJA 5LMNL 3NPPA 1HNWQ 3MD0A 4JPZB 2CK3H 1Z7TA 3HFZB 1Q46A 3B5ND 1FZEA 2UXCL 1GUGA 1DYQA 3S17B 1GOZA 3GTGB 1GUSA 3RZDH 1TWAH 1D1KA 2XGTA 3QOJA 5FLMH 3MFGA 4A3IH 1VQPA 2Z0SA 3PHLA 2JXMB 3M4OB 1SQBD 1IC2A 1EY5A 4A3BH 1JY2O 2BCCG 4D6TJ 1FZCA 5KJ7C 3VYRA 1NR2A 2R7ZG 3K0XA 1UUPA 1PV3A 1FZFA 2K75A 4D6TE 3V4WA 4JI7L 1ZOYC 4ODGA 2GN5A 5DJUB 3S15H 1U4MA 2L5GB 2FFDB 3CXHI 3C8VA 4CJ1B 4TRDA 4DR5Q 3SE0A 5ELBA 1N73B 3GTMH 1LTAD 3SWKA 4W7YA 1NMGA 3RZOB 1NU1G 1N7SA 4QMAA 5A2QL 3PUWA 1ENFA 3DEOA 1X56A 1SYFA 3GTKH 4O0AA 4L6TB 2PMZE 3PO2B 4DR2Q 2EYMA 3I72A 2A06E 3F89A 5KNDA 3I2ZA 1QZGA 1SSOA 3T53B 2ZJRA 2B2UA 2B29A 3QOLA 4V0BA 1SQXG 3AEBC 1FDMA 1E2WA 2CQOA 4DU9A 3GHGB 3CXHD 2E2JB 2HR3A 2P2UA 3EROA 2JK8A 1MD2D 2BCCD 1ENCA 2HDMA 2K4KA 5AVXB 4P2CB 2OTKE 2KCNA 1HA6A 1ML0D 2M3EA 1GW4A 1S72P 2XNDH 4BXXH 2JA7B 3T51B 3W68A 2NVTB 1FJKA 4N3YB 2ZVOB 2LS01 2Z8LA 5C3EG 2EYOA 3K5NA 2N1TC 1WCMB 3FKIG 4XE5B 5KLIC 1OWAA 1EFID 3GTOB 3HE5A 1BOSA 3MUDA 1VQGA 3DWPA 4PQXA 3I4MB 4JI6Q 1CKNA 2BH2A 4W80A 1NU1D 4ZKCB 3OTOL 1AJYA 1KB9I 3A0HE 5CCHA 1MSGA 1DD3A 3KUPA 2KLVA 3K7AH 1LTSD 2NVYH 3L75D 3TP6A 2OGUA 1AVOA 4HAEA 2FYUK 2LSSA 3LWEA 5EGTA 1Q8KA 1RL2A 1EYAA 3GV3A 1FAVA 2VB3X 3TBIB 3M0DA 4OX9L 1O7YA 5EJWA 1CZQA 3E1RA 3A0HH 4IFDK 1EY4A 2VQFQ 3BVZA 3H1LG 3PCOB 4G57A 4GZYC 2WINB 3MAQA 2WITA 2EJMA 3MVVA 1KB9D 5KAIE 4DV1L 3T4AC 3A8IE 1XYIA 2GVBA 1NY4A 1P84I 2K37A 3TNUA 4JC0A 5IGBA 2XVSA 1LJ2A 1P8LA 1V1OA 2KEEA 2CH4A 1MI2A 2OQQA 4GLXA 4I7ZC 1PRTD 2J0TD 3CXCA 3TRZA 2KEDA 4GKKQ 5JAVA 3C9IA 5KAIH 2PPBC 4IQZA 4YIJA 1TU2B 3QG1A 5AVTB 5K36H 2KHIA 1L2PA 3PUXA 4O1NA 2EYHA 2E5LQ 3F2UA 3RK2B 1LT9A 3D8GA 1K0RA 1PFSA 3F2DA 1MFZA 2N8NA 1I94L 3B5NC 1PPJE 4DAMA 3AEAC 1HR0W 4PV1B 2HT1A 2QW7A 2HPCA 3ITPA 1YBYA 5IWAL 2QA4P 1NHLA 1NOHA 3SK5A 1P84D 3RK3D 3NWSA 2JQOA 4QMGA 3DM3A 3GMAA 1ASYA 3ZDMA 2RDGA 3H1LD 2B2VC 4NDXA 4X65L 1B53A 3CCJP 1J1DB 1X22A 3IN6A 4IUUA 4DV5Q 1L1OC 1JTHB 1JQYD 1IXRA 4YTPC 2K01A 4KHPQ 1JC7A 4X6AH 4DK3C 1PZJD 1SROA 1FDIA 2M0BA 2UU9Q 2KA7A 1R9TH 2WWWA 2VUMB 3I7FA 4W7ZA 2F0LA 1B3QA 1D5XC 2PI2A 1N33Q 2WQYC 3M3YB 3HGBA 4U673 1HNWL 3FMCA 1LTAC 1K83B 1VQ9P 5M3FH 1KDBA 1NE3A 3KFUA 3O13A 4TT3H 4GNXC 3ICEA 2M3BA 5M5YH 4A3KH 1KV4A 1L0NJ 2EOTA 5IT9c 1SYCA 4GN3B 5BR8L 1SE2A 1VQIA 5C44B 4FXKC 4C3IG 1JB7A 3GF3A 3PO2G 1SMXA 3CCVA 4G7HC 2WACA 2H8PD 3NTHA 4NPFX 3LX0A 5AW2B 1EEID 1VQBA 2H89C 3OOCA 4S3SA 1SP4A 4LF6Q 3KPEA 2K33A 3GV6A 3VP9A 1TS2A 4A3CG 3D4DA 3TF5A 3LIDA 3H0GG 1Q12A 4UP8A 5COYA 2WPRA 5CBEE 1VQLA 2QJPB 3I55A 1X3QA 4R4OA 4X64L 2ASBA 3PF4A 2R3ZA 3MZWB 5C4ZA 5CV7A 3R4YA 1VQNA 3RZDB 1TWAB 1XNRL 1QEXA 5AW0B 1NTZG 2EYPA 1SXTA 3RL0B 1JR0D 1DD4A 4EDFA 1KC8Q 5E3FA 3U9OA 3BATA 4PJ0E 4BXLA 4Y7NH 1WTQA 4G7OC 3CWBJ 2EDGA 2F0VA 1PFBA 2Z1CA 3PGZA 1DEBA 2IPKD 3WMM0 4JI5L 3MUDC 3CWBE 4H0LB 4GOPC 2MUYA 5IGCA 1PGPA 2Q7CA 3UDFA 3P75A 3CCMA 2WSFJ 1BO0A 3QO2A 4C2MH 2KHSA 4H02A 1WYDA 3CX5E 3GTQB 2V7QH 4CPGA 1LTSC 5E7NA 5AVSB 1Y1VB 3H1KG 4A75A 4GKGA 3PIOA 3GTMB 2HG5D 3OAKA 1HGVA 3CXHH 4DK6C 5M5WH 1HVVA 3KF6A 1X79B 5C0XI 3GG2A 1MV8A 2FFDA 3UIAA 1HJBA 5CC4A 4DR1Q 3J81i 4ZUJA 2OF1A 3L72G 4C3JB 2R7ZH 2ZTDA 4NMZA 1N32Q 4DV0L 3PIO3 1KQSA 2Z6KC 1JY3P 1SQQJ 5JJLA 2IYOA 4A93G 1JO5A 3CX5H 5CBNA 1HA5A 1SDFA 3KJOA 4JV5L 3VP8A 1SNDA 3MXUA 2WSFH 2DY8A 1NTZD 2PZWA 2K9JB 2F0SA 1SQQE 4OO1G 4HKZH 1K3RA 1SQXE 2I46A 4B3RQ 3LNNA 1GTWA 3F1ZA 2ALYB 3FRPB 3SK8A 3AE8C 4KTAA 1FNVA 5C5MA 5EKKA 1JCKB 1I4HA 1HTLC 1PFNA 4R8IA 3BS1A 1F9SA 3I70A 2QILA 4ASVA 4P74A 1M1KQ 2OEOA 4YWMA 4KKSA 3RL0g 4U3FJ 4OO1I 3V2PA 1PH3A 1Q1BA 5IT9L 2B2WC 1H95A 4XIGS 3VYUA 2YIUB 1STYA 2PZTA 1JOOA 1PZKD 1AQ5A 2F3IA 4U3FE 3PUYA 5KLVK 4CBVA 4JBZA 5J22A 1HUCA 4M8AA 2JEAI 1SQVJ 3JAME 2VQFL 4C7NB 5LMNW 1A0IA 2XDJA 3TGUJ 1QUQB 1L0LK 3VR5A 3CD6A 1LT9C 3M85A 3L73J 3L72D 4DFAA 3T1HL 3CQZB 3K7AB 4UAIA 3IRBA 3RK3C 3TGUE 1RHZB 4B9WA 5T1GA 1BCCJ 1KILD 3BVMA 4K35A 4WORA 4JI0Q 2RVLA 5C3EH 1SFCB 3FKIH 3K8AA 3S1RH 2YYZA 2IX0A 4EQOA 1QLED 3V6IA 1X3PA 1NUCA 1EZ8A 2RKSA 2QKIC 4WWIA 2F0WA 1H9KA 3J7AV 1TR5A 2FYUG 1JY2N 3L35A 2FFKB 4DR3Q 2GUSA 1UIXA 5KLIB 3G71P 4RO0A 3VOPA 2WMMA 3A8KE 3HG9A 2K5WA 4LF7Q 1W6JA 4HN7A 3H1JG 4NPEA 5DLQE 4C1NK 4RGTA 5IP7G 4X66Q 5E1FA 4DR4L 2Y0EA 2WAQG 3GO5A 1MJCA 1SQBK 1AZPA 4F8MA 2ZXPA 1N2DC 1MBYA 1ZV8A 1F77A 1NBWA 3MWYW 4IL6X 1Y14B 1R8EA 2WPSA 1Y8OB 1P84H 1RE3C 5IGFA 5C44G 1L4AC 3CRLC 1BQQT 3ERQA 2XNXA 1AFOA 4KHPL 2OYHB 2ZM6L 3L0OA 1WT6A 4X62Q 1G2TA 2H88C 1NR4A 1IZNB 1AEXA 4N9PA 3VR6A 2J58A 1PDQA 5AVYB 5GROA 1I4GA 1SQPJ 2KCCA 3V5BA 4OWTB 4QCLA 1KNEA 5J3BA 1GK4A 4P75A 2NRGA 2L15A 2KB7P 1BR9A 2Q2TA 1IFJA 1Q82C 1SQPE 3KHUA 1GMJA 3MTUE 2FYUD 3L3OC 1DEEG 4WVZA 1CSBA 2MKVA 3CRKC 1DIPA 1EQTA 3GQBA 5CJ4A 2KBNA 1FD7D 4BS9A 3S1KA 1EIFA 2XV5A 1X55A 4DUZL 1E5WA 1GKHA 3VA5A 1R9TB 3KYQA 1DGSA 2JA8G 1L0XB 1NTKG 4I7ZB 1NO4A 1VF5D 4YPCA 1MJEA 3AEVA 1JTHA 5FJ8H 1CZGA 2QCPX 4C46A 2MO1A 2K3RA 1KRTA 4LF6L 3Q5SA 1EUJA 3SEBA 2PW7A 1Y1VG 4DT0A 3A2AA 4JBJA 4K5XA 4FF1A 2IX1A 1K8OA 3H1HG 3L70G 3Q8DA 1BE3G 4H44C 3M4OH 4A3KB 3EJIA 1HRJA 1OW8A 1PH7A 4ABNA 2W6AA 1M7LA 3FHWA 1IYJB 2OTJA 3U4VA 4F87A 2Q6QA 5GTHE 3AMUA 1NKNA 1I50B 1EWCA 4KHXA 1PH6A 3AE3C 1L1OB 5KTBA 1YJNA 1X9NA 5BVZA 1PZQA 3S2DB 2IY5B 1E24A 3W3AA 2HD3A 1VQ8P 1F2MA 1VQJA 3CPFA 1X6OA 4DAPA 1LV9A 3ABVC 3RZOH 5APVA 2W83C 2VB2X 1TWGH 4C3IH 1NTKD 3WUUA 3ER0A 1EY8A 1PYWD 3NQIA 1AE3A 3KLRA 3VDYA 3PO2H 2ZXXA 3U50C 3V05A 5A2QE 3A5UA 4ZKPA 3ULJA 4GNXB 2AXTE 2WVRA 2HDLA 4ZAIA 1C7YA 4KK7A 1RIPA 1UWVA 1H9MA 1TXYA 4CKEA 3HTKA 3H1HD 5AW5B 3L70D 3R3OA 1BE3D 3H0GH 2E5TA 4C2MB 4JI2L 2E2JH 4POGA 3CCVP 3DMUA 2JA5G 1PH1A 1E7ZA 2Q2UA 1HGZA 1HNZQ 1HR0L 2F0NA 4LLHA 4JYCA 3GTPH 2CCZA 5CBAE 2PZUA 3LGJA 5M5WB 3K5LA 1V43A 1D5MC 2KZIA 2IL8A 5DAUA 3HOUB 1FYCA 3PQIA 1EXJA 2JA7H 1VQLP 4CDDC 3KLSA 1V1PA 5EQ0A 4WFN3 1BGYJ 3I55P 2AXTH 1JEKA 2NVTH 1XMOL 4DV3L 3PIPA 2BCOA 1WOCA 2F0DA 1BGYE 4PG3A 2G8YA 2KOLA 3S24A 1KZUB 2YNYA 3AE5C 1GL2C 3RBXA 1SEBD 4O9BA 4POFA 1K9MQ 2H4OA 3U1AA 1M8AA 2DGYA 1Q8IA 2F0FA 3PIP3 4EGVA 3OWEB 1CI3M 3R93A 4GOPB 5APUA 1M90Q 1HWTC 1SMYD 1LTJC 3IFMA 3CCMP 4C56C 4YWLA 1FBMA 2MHVA 2K9JA 3WOEA 4UY8C 4WB4A 4RWSC 1VQEA 3RN2A 1LTBD 1E79H 1YNXA 2F0IA 5F2DA 1S4ZA 1OXZA 2AMCB 3AE7C 2PYKA 1OTCA 2KHJA 2NZHA 4OIJA 2RN0A 4WY4D 5HY6A 3NWTA 3QJYA 4KI0A 2O1KA 3D71A 2NPSD 4DGZA 4QGUA 4IFFA 1G2CB 1NTMJ 2KNCB 3C1LA 2RDHA 1II3A 3J7ZC 1GU5A 2KIKA 1PH5A 4DR3L 1FZGA 4TKOB 1GUTA 1SBBB 3SVMA 1J6QA 3I90A 2YKQA 3DM1A 4BY7B 2B3GA 2QJKB 1XPOA 2WKDA 1JMBA 4L75A 1E3PA 4LF7L 3EFGA 3Q5RA 3C1EA 3NUCA 3ZYYX 1Q86C 4P71A 4U68A 2K14A 4C7NA 4OWFA 5C3EB 5KLVG 3S1RB 1BVSA 3AE1C 3D6CA 3KBGA 3CKIB 3W1GA 1L0LG 2N1TD 3T13A 3CC2A 1B2TA 2RKLA 1BCPD 2B2YC 2JJQA 3L74J 1N7LA 5B5EE 4KJNA 1KHIA 4L5QA 1SFCA 4J15A 1PYBA 1VF5C 1PRTB 5APXA 3S1NH 4YXWH 2F0GA 2LMCB 3PO3G 4R4LA 4XFJA 1QVFO 1ZXGA 2ITAA 1YHQP 1M1JC 1VF7A 3G48A 4HCEA 3G9RA 1CZWA 4X62L 2WP8J 1LT5D 3H3VH 3I3CA 1AV1A 2MP1A 2FY8A 4N78D 2XRQD 3H1JE 3KF8B 3MA2B 2ZJQA 4IFDJ 4UDUC 3EWKA 3HOXG 1KIXA 4BY1G 4L76A 4Y99C 5B5EH 1PTOD 2QEJC 3G7LA 4XYOA 1C4QA 4LF5L 1HH2P 4DR7Q 5APYA 3MTSA 4OONA 1XTCC 2M8RA 1EOVA 5ELDA 4I6MC 1UE1A 3A3YB 1HF9A 5ELOA 5H2FE 2CKZB 4KY6A 5IP7H 3M3YH 1EWHA 1O7IA 1Q7YQ 1L0LD 1KYOE 2OYHA 1K8AQ 1K83H 1BBUA 1VQDA 5D65A 5LL6S 4B3MQ 4IFDH 4C1NI 1QVCA 1S3JA 2VQEL 2CHBD 2L4NA 1IBKL 5H1SE 3H91A 4JI8Q 1ESRA 5C44H 2GA4B 5CHXA 3CPWO 1JWMD 2G9DA 3BDOA 1B44D 2F3WA 2YMYA 1NTZK 4I1LA 2V1CC 5KNCA 2BASA 4X3KA 1CK1A 4CKBA 1KYOH 4GKJL 1I6HH 3GLMA 4XYQA 3HD7D 1X3GA 3F8TA 4JPBW 4RKBA 5CV8A 5C6AA 4UHVA 1RJTA 2Y9YA 2QEXA 3BZCA 1Y69U 1AH9A 4L5SA 2YKOA 4HJ9A 1WTHA 4RCOA 3H1IJ 3EA6A 3HOUG 4OVNF 1LACA 2R7FA 4JI4Q 1XXGA 2H1EA 3H1IE 1PFMA 5CCGA 1FE6A 3L4FA 3PP5A 2AQ1B 2JA8H 2Q2HA 2P5ZX 1T5XD 1J2JB 3TYYA 4DV6Q 3VMXA 1FU1A 2CPSA 1X3EA 1R4PB 4QY7A 1VQ4A 2QDLA 1VQ6P 1EEFD 1FVIA 4LFBQ 3GTQH 1S9KE 3NBIA 3H09A 3H15A 1RF2D 1F9RA 1SMYC 5M3MG 1Y1VH 5IIFA 1G91A 2R3SA 1G6ZA 1EZVG 2OXPA 1HNZL 4RESB 3SK6A 1KTMA 1D8LA 2PP6A 1LTBC 1S5DD 1SNOA 2F4VQ 1STHA 4LWCA 2ZT9D 4GIFA 1TWGB 2ZTCA 4C3IB 2HIXA 1X3FA 4WY4C 4OGQD 3D0FA 4C3JH 1URQC 1K73C 3L75G 2NPSC 3WU2E 3CCRA 1A3TA 2XTIA 1EFWA 1KQFB 2JDIH 1EZVI 2WSSH 3GF7A 1AVYA 1K28A 1N36L 5IOCA 1EY9A 5FLXc 1NJIC 1L0ND 1QGKB 3H0GB 2OTJP 1PP9J 1MIUA 4LNQA 1IBML 3HOYG 3GTPB 2E75D 4BY7G 2PRRA 1QILA 1YJNP 1PP9E 3AFQA 1YTZT 1PYSB 2KUMA 3WU2H 4DZOA 3MC0B 1X54A 2QM7A 4OWXB 1HH0A 1XNQQ 1BCPC 4AYBB 2IBZG 4LF4L 4DV2L 3PRJA 2G9HD 1A62A 1YVCA 2YXQB 1JUNA 5JEAJ 3T1YL 1EZVD 4HH2A 1A3UA 3CI9A 3LIEA 2HUGA 2GVAA 1K73Q 1HCZA 1ENAA 1U4RA 2JA5H 2XKMA 1PA6A 1OIPA 1BDCA 1LWUB 2DNEA 4EQ5A 4PMCA 2B2TA 3WUVA 2KK7A 1D1IA 2OQKA 2OQ0A 2ICEC 3E0EA 1YZ6A 1AQTA 3CQZH 1NJIQ 4G7ZC 1K0SA 2IBZI 2Z9HA 4R4TA 4YHHL 1OXTA 3D3RA 1AN8A 1LYLA 5E79E 1B7YB 1CKMA 4KKTA 1PTOC 1VQ7A 3FPPA 2FYNC 2W27A 2L11A 4DOJA 1HJPA 4GT1A 4PD4I 1RTOA 1S4XA 2LXKA 2Z4HA 1KILB 1ZYRC 3SDZA 3AE6C 4DV4Q 4H7BA 5IP9H 2P58A 4A93B 3BCCJ 5JEAH 2PQAB 3DWAA 3AB9A 3I8ZA 3RGUA 5KYLA 4N9TA 3F2CA 3N7NA 1LP1A 3LW5H 3MGNA 3BCCE 2VL6A 3B4SA 5EPLA 4JI3L 3SR1A 1KQGB 4I2LC 2AUKA 1ZRTE 4UB6H 1S5ED 4DK1A 1DX7A 4IPCA 5E79H 3TP5A 2IBZD 1MUUA 1G2CA 1SQQD 2V4HA 2KNCA 2GM4A 2NB0A 4ZLTF 2O5IC 4K5VA 1A8VA 3EBEA 3S1MH 2KECA 2PAJA 3P7KA 3P8CE 1W2EA 1HTLD 2KJXA 1WTVA 3M9BA 4A76A 1SFOH 5CV9A 2P10A 5EAYA 3A74A 5KLVE 4PD4D 1DOKA 1L0WA 4H13C 3UDGA 1OZHA 2OYIB 2WB1G 2QJYB 3BVGA 5EFWB 3VYTA 4A3JG 1FJPA 1QB5D 1SNMA 2EJGC 2FXOA 1VQKA 4EYYQ 2FINB 3S1NB 3NXWA 4ME3A 3HD7C 1LLRD 5FK9C 5AW1B 4K0KQ 2DJGC 3BYYB 5FLXL 1T5EA 2Y0SG 3CHBD 1NH4A 4ALPA 2K5HA 2AXCA 3J7AF 1AFPA 3BG3A 1PZID 2AWOA 1F2ZA 3IFTA 4NB3A 2IZ1A 1NTKK 4B3ML 3E9IA 1SQVD 3CLQA 4DAYB 4L5TA 3KLSX 3P7JA 2F0UA 1V8QA 2VXWA 1UE5A 3AECC 2DJFC 3L73D 4JI8L 1GW3A 2K88A 2NZ1D 3KF8A 5JVH3 1FZCC 2EXZA 4R9WA 5IYCG 3L37A 3U58A 1B1ZA 2R44A 1BCCD 3HUSB 5CCGC 1SQBJ 1E2VA 2K32A 3Q22A 1TWCH 3SGIA 2JKVA 1I4QA 2VW9A 1ZP0C 2ATWA 3S4RA 3I4OA 5EPKA 1SQBE 2YO2A 3OSOA 2WAQB 4ZUIA 1KC8C 2KSJA 2R3CA 3HEJA 5IE8A 4DF7A 1EDJA 1KD1Q 3HOXH 1LTID 3NSWA 1NCVA 4BY1H 2RDFA 3VMYA 2ZT9C 2DW3A 4LW1A 2J5UA 1N7SC 1NAFA 2Z4IA 3IFDA 1IO4A 4UB8H 4OGQC 1KRSA 2CWAA 1JWSD 1OVRA 1J1EC 1U0LA 3EFXD 2KVMA 3CU7A 3OW2O 4JI4L 1TY0A 3CC7P 5ISRA 1L4AD 3A7LA 1PGOA 2QRXA 2B87B 1MZ9A 1GD2E 1BKBA 3O6QA 1I50H 2B2UC 2O3JA 3OWFA 2EY2A 3QB3A 4KD4A 1Y1WG 2CH4W 1I6HB 1YIJA 2N55A 4OL7A 2Z6BA 4DV6L 2XIWA 1K04A 1USDA 4JOIA 1CT1D 4IJLA 2V7QJ 1HTPA 2E75C 3S2DH 1RE4A 4DR5L 2JO1A 1NSNS 2DUDA 4R4QA 3BASA 1M56D 4A3EG 1Q81Q 2F4VL 1VPCA 2BCCJ 3SFDC 3CXHE 3DXJC 3OIQA 2C9LY 3OMCA 2R5DA 2KOGA 1YJWA 3CC4P 5HGTA 3TREA 1EIGA 5C5LA 4DR2L 1AE2A 4AYBG 2BCCE 5C0XG 2JA8B 3QWOC 4IL6H 2XNAC 3K58A 4P72A 4R1JA 1A6XA 1GU4A 1RF1B 3K57A 2RMZA 5D14A 4AH6A 3I4NG 2Q5UA 2VS1A 4ID6A 2N49A 5CCHC 2N88A 4K5WA 2E8GA 2L91A 1M1KC 1E1TA 4XDXA 1NU1J 2FMMA 3G3ZA 3USSA 3HOUH 2EYJA 4B3SQ 4HSPA 2OT2A 4H44D 1IW7D 4A4IA 2MPMA 4CDEC 3TSIA 5AW8B 4FP5D 1NU1E 3B6YA 1N73A 2N3SA 4GN5A 1LNQA 4EIJA 3M0DC 1DJRD 1TIID 2UUCQ 1VQPP 1JY3O 2IW3A 5DM73 2QG4A 1F2LA 2IX3A 1SQXJ 3SWFA 1PVOA 1CHQD 2UUAQ 4JI6L 3EVQA 2Q8TA 1PH9A 2E42A 2WT7B 4GKKL 2E2IB 5M3MH 5BN4A 3NMDA 2G3AA 2X69A 3BDCA 5APSA 1XX8A 1JT8A 1C9OA 3TS0A 1LO5D 3FXEA 4K14A 5E4XA 1VQMA 1OO9B 2B8FA 2A1AA 1VQ4P 3CP0A 3AEEC 3GHGA 4NP5A 3N52A 4OXPA 2QSIA 4DJGA 1D2BA 2WSEJ 2CPBA 2K28A 4DPGA 3UDXA 4J8QA 3E6ZX 5ELNA 1KB9E 1EC5A 1CHPD 3W1BA 1Q90A 4K2LA 3EFFK 1DH3A 1FDOA 1A15A 2LXBA 2B88A 2E43A 2JA5B 4WY4B 1K8MA 1C48A 4HSVA 3CCRP 1IKMA 1I3QH 1EL0A 2NPSB 2XWJB 1STEA 4BY7H 1T3JA 3D6ZA 1SRUA 3FWNA 2RSOA 4A3LG 3D31A 2EZVA 4RGMA 1X65A 2AEMA 2IX7C 2I5MX 3NHHA 1KB9H 2IHFA 2F0QA 1LWUA 3K7UC 3M4YA 2WSEH 1WTPA 3IL8A 1M8OB 4KHVA 1U4PA 1EQQA 2MO0A 3T56B 4DR6Q 4GLVB 2JEEA 3EQ2A 4ZQ3A 1YITA 2RF4A 3ITKA 3CMEA 1S5LE 3CCUA 2IT1A 3H1LJ 2CQAA 2XN9C 3HKZG 2F0PA 4AQRD 4QIWE 4ZRZA 5KEEA 1P84E 3RK3E 3CCSA 4PD4H 1GL2D 2N1TB 4RG1A 1T3UA 1UEAB 4MIUA 1BCPB 5T1IA 2L0CA 1KILA 3H1LE 1GUNA 2PQAA 2L9HA 2LXJA 4F88A 1LTIC 1DXMA 3J81E 1ZKOA 3JC22 1YEZA 5APTA 2JYOA 3S1MB 3L71G 5A35A 2ZJPA 1CI6B 3JCUH 3TDQA 1SFOB 2KCMA 1S5LH 1LM0A 2BH8A 3MEFA 3CCQA 4WJWA 1EIYB 2A68D 4JI1Q 1DOLA 2F4IA 4DV5L 1ONLA 5CV5A 4PMWA 5FOBB 1CSQA 2IJ0A 2AKWB 5JVG3 4FO2A 2V4DA 1VQ7P 4CJ2C 5I9OA 3J80E 2GUVA 3A7OA 3NBHB 2FYNB 4KLKA 2CWPA 3S2HH 1TKWB 4KT0J 2UU9L 3TP7A 3I56A 3VA7A 3AYHB 2Q8IB 3G4SA 2OYIA 2HHHQ 3MXNB 1N33L 4JOIC 3NTIA 3NP8A 1IFIA 3C1FA 1IFDA 4Z1MH 3CPWA 5B66H 1RE4C 5EKIA 1NTMD 4DCKA 4QB4A 5GAEC 4QQBX 1N34Q 2Q3IA 1H9SB 1FZBA 1TWFB 1D7QA 3HRNA 4LFCQ 3RK2D 1WFQA 2R61A 1QL1A 2J7ZA 3HOWG 2EYFA 2YTXA 2Y9ZA 4A3JH 1WD1A 4JCVE 1L0NK 2CW0D 2X6LA 1Z56A 2PFXA 1TWCB 4RA8A 3PO3B 2ID0A 3RLFA 1TWHB 2FYZA 3L71D 1R5LA 5IYBG 2WPQA 2A19A 3RR5A 1FC2C 1ILPA 1QOHA 2N78A 3L74D 4WJ4A 3HUSA 2O01H 1NAYA 1LTGC 1NTGA 2ZAEB 4AQYQ 2K05A 3HOXB 5C39A 1VQFA 3K0YA 4BY1B 2XSCA 3HD7B 4MN3A 3V2NA 2FFDC 1IW7C 1UE7A 2L12A 2O2LD 4CDFC 3B5NB 1PV4A 1PMRA 3NENA 2EY1A 3X3NA 4KN4C 2QE7H 4GODA 3AFPA 1C8CA 3A55A 5LHY1 4EQNA 4WRDA 1SYBA 1XTCD 4BBRG 5KKZC 2M9VA 5IY0A 1IKLA 2AWNA 3K80C 1WTOA 3IF4A 3MXGA 2B87A 3DWQA 3A54A 1QL2A 3AEGC 1NTZJ 1PRTF 3JAMc 4K8IA 4JBMA 1V1QA 3GHGC 2D9UA 1STAA 2EYLA 2FMCA 3G6EA 4DV7Q 1PGJA 4D6TG 1NTZE 4IFMA 4KY7A 5I9PA 1VMPA 4DR1L 3NE5B 1K9MC 4J1MA 4X3UA 1TY2A 3M0AA 3FDTA 4RKLA 1EDIA 1HJ0A 2K5NA 1JOQA 3SK4A 1S72A 2UUCL 1N32L 1D5ZC 1M90C 4AYBE 4OGQB 4A3CH 2UXCQ 1PL5A 1J1EB 1PLFA 4HJAA 3D6WA 2R6GA 2KS1B 3EQLC 1XJVA 4DNIA 1SQQK 3H1KJ 2EQSA 2KYVA 3K5MA 4B3RL 1KDCA 5D3IB 4LGDE 2WSCH 4H0LD 1JB3A 2IHEA 4IUPA 1N86A 5DJTB 1BBWA 1RF1A 1YIJP 1U7MA 3A0BE 3H1KE 2PW5A 3M9QA 4RHSA 5E4WC 5JPNC 1JMCA 3U1CA 3L72J 5C4JB 3GTJH 4DXGA 1XMQQ 4JI7Q 2E75B 2Z5HA 1ZR2A 2OYOA 1JJCB 2K1BA 4FXDA 1VQNP 5C0XH 4MNOA 1SE3A 5AVWB 2IZ0A 1GO3E 3L72E 2AEFA 2JR8A 3CW2C 1G1JA 1CUKA 2C5CA 3WUTA 1KQLA 5IGGA 1F2YA 3I4NH 1KILE 3AU7A 1HUNA 3U59A 2L1BA 4HIDA 5M3MB 4BA2I 4D6TD 1IBLQ 5C4XG 3A0BH 3W5OA 4A3GB 1AA0A 1WJJA 3HOVG 3HS0C 2VNUD 5TISE 1SQVK 1CKNB 3I4LA 3OPOA 3FXDA 1ZN5A 5KJ7A 4HJ5A 3D4RA 3RLNA 1HZ9A 1SAPA 1I5FA 3VYIA 4JI0L 4HIKA 4NPSA 2A68C 4LFAQ 1URQD 1PIXA 3STBD 4A93H 2ZVNB 2JEBI 4DR6L 2RCNA 5IGDA 2A06D 3TZDA 2MGSA 1JOKA 3V96A 1BNZA 4NXNQ 4OO1H 5I6YA 4F7XA 1I3QB 5TISH 4DK0A 3HOYB 3A56A 3L2PA 4IO9A 2B89A 4EQPA 4HJ7A 5CMZA 5ELCA 4I7AA 4X66L 1OMIA 2EIFA 2C9OA 2E2DC 4BA1I 1VQAA 1QUQA 4MHEA 1B9MA 3RK2C 2PGDA 3II6A 2BA0A 1VQOA 2TSSA 4YXDC 1DCZA 2E74D 1CQVA 3JAML 2LKMA 1E22A 2KCTA 1O78A 4JQ0D 1NGMB 1SE8A 3OTOQ 2K5VA 2Z4EA 2EPBA 1VCIA 4KV6A 2CW0C 3IAYA 2FYUJ 5JOBA 5KGUA 3R2PA 1Q7YC 2QDBA 1K8AC 5JJZA 1SFCD 3M7NA 3B71A 1J1DC 1Q2NA 1Z47A 1J9OA 3CCJA 3H1JJ 3K6OA 2FYUE 4A3FG 4HTHA 2XZRA 2YO3A 1MKHA 1KXLA 4A3LH 3PSIA 2E5LL 1LT4D 3VR2A 2UXDQ 2TMPA 1FR3A 2C0WA 3E1IA 2N1TA 2L55A 3R8BA 3CD6P 5FO7B 1X8YA 3J7A5 2WAQE 2QGQA 1LT9B 3MHVA 3BDLA 1SR3A 4DNTB 3FP9A 4QIWB 3RK3B 2HPCB 2K5DA 2M5AB 1HZBA 4IUVA 5K5PA 2E2HB 3MP7B 1PPJG 1ZYRD 3RBZA 1VQ9A 1G1IA 1FNWA 3DUZA 4FF4A 2LKVA 2DNCA 3PH0A 3S9WA 4IPGA 3S2HB 1YHAA 1LT1A 3RD4A 2NWGA 3KZIE 2OCEA 3UDIA 5C3XA 3KDFB 3SSUA 3U9SA 2D0OA 2F0HA 3PTZA 1Y9BA 1BUVT 1BF4A 1O7ZA 4FNFA 1TVXA 3BCCD 3TN2A 3CCSP 1F9QA 1LTLA
chains in the Genus database with same CATH topology
2N9BA 2NN6G 1JE5A 3SWYA 1JCCA 1VQHA 4TQUS 3JC66 2NN6I 4LUZA 1LGHB 2WZ7A 3P32A 3P8MC 4PZ6A 1L4AB 3PF5A 4X65Q 1KAWA 5APWA 3GTLH 3HOWH 4DV7L 2H7HA 1N9WA 3BU2A 3HE4B 3BRVB 2IPPA 1Q1EA 3B5NA 5CCGD 1HBWA 3AQQA 5IYBH 2POHA 3A5TA 2R93G 4GS3A 5BR8Q 1EQ7A 4A3GG 1B8AA 1L1OA 2YU9H 1JY2P 1KL9A 1N7SD 4JBKA 3MIWA 3STBC 1XMQL 3KF6B 1ASZA 1IZ6A 4BBRH 4X64Q 1Z9FA 1S40A 2H5XA 4HIOA 1XNRQ 2E2IH 3PV0A 1JJ2A 4GNXA 2UXBQ 2AHOB 1IBLL 2KP8A 4FDBA 1KFMA 5AW6B 3TS2A 1WI5A 4JI5Q 1UEBA 2JA6G 1T2KC 2BA1A 4IJHA 1NWQA 2CFMA 1JOCA 4LFAL 4GLAC 2MJZA 1SFCC 4Y52H 4PZ7A 5AVVB 3EIVA 5LMUQ 4NXNL 1FOSF 1NTMK 3M4QA 5CCHD 1CSPA 1G6PA 4LF8Q 4P73A 1CW5A 4DV0Q 1VDFA 1VQ5A 3G71A 5HGQA 2I1JA 4JV5Q 4GOPA 4MTNA 1RY3A 4IPDA 3U4ZA 2UUBQ 1XPRA 4A3DG 1XTDA 4N78E 1E1OA 1G51A 5GAGC 3O8ZA 3ZJYC 5C4XH 2I5LX 2W6BA 3H32B 3HOVH 1GL2B 2NZOA 4OWWB 2OYHC 2FXMA 2UXDL 1GZLA 3I5CA 4DUYQ 2Z6KA 1LTJB 2NVQH 2R32A 4XA4A 2RHSB 4UPAA 3KJPA 3T1HQ 2I0QA 4DR7L 1OXVA 1KD1C 4AIMA 3B8EB 3IR9A 1IFNA 1H88A 5GAHC 1ZLLA 4M3LA 4UP9A 1TWFH 2R92G 5AW7B 2Q2IA 2MQHA 2VY3A 4DR4Q 3PO3H 5FJ8G 1B70B 1TWHH 2J59M 4A3FH 1SN8A 1CKOA 4L5RC 1Q81C 1NKZB 2A8VA 2QM8A 3M4PA 3KDFA 2P1JA 1M1JB 2H43A 4R4CA 5AW3B 2ZM6Q 2PNHA 4IOAA 1H89A 1VQ8A 1OXXK 1JCDA 1G291 4B3TQ 4Y99B 3KYHC 1SLJA 4LFBL 1YI2A 1YHBA 3HOZG 3KLWA 3CMAA 3PUVA 1RE3A 3BRTB 4DUZQ 2D0PA 1L4AA 1A63A 1X9VA 4UP7A 1T8ZA 1W3SA 3UE1A 4BBSG 3JAMi 3HE4A 4C3HH 2C35B 4R4IA 5AJ3Q 2UXBL 2JA7G 5GQOA 3HTKB 1RF0A 1WCMG 5C4JH 2B63G 4LUOA 3RN5A 1FL0A 3I4MG 1XNQL 3NFQA 2Z5IA 2OTLA 4IPHA 3GDEA 2R93H 1K8GA 2JJLA 3DLLA 4A3GH 5LMUL 1QZHA 4NXMQ 1IJDB 1YJ9A 5AW4B 2YTVA 4LUVA 4LF8L 2HODB 3F2BA 3KOJA 2A45G 4JYAQ 2YV5A 4JI2Q 1J5EQ 3V4QA 1HR0Q 4DV4L 3J80i 2UUBL 1URQB 4WBAA 3HOYH 2A45I 3PUZA 2NVXH 1XMOQ 1SLQA 3S16H 4DV3Q 4LF9Q 2D62A 3CL3D 2FXQA 1GDTA 1OXSC 1PH4A 2JA6H 1YHQA 1QVFA 3HKSA 1V9PA 4DUYL 1U5KA 3VTPC 2HYNA 2I1KA 4YWKA 3N4XA 3BJUA 2K50A 3CCLA 4K0KL 4A3MG 1C0AA 3WWVA 3E9HA 3CCEA 3H32A 2ZXEB 1XPUA 2F52A 3H3VI 1JNMA 2OWOA 2OARA 1GL2A 2PI2E 4A3DH 1UE6A 2E2HH 1FJGQ 2VUMG 2WB1E 2HQLA 1XTGB 1LTJA 1YYCA 2MFIA 1SVFA 4KHZA 1L2FA 4IFDG 1P16A 1LTTC 3OA7A 4LC1A 2Y0SE 3A0JA 3M9HA 3NEMA 4IOCA 3RLOA 4B86A 3CAMA 2IFMA 5IYDG 1HNXQ 2O1JA 4AYCA 4IFDI 1T9HA 2ZTEA 2HIVA 4B3TL 1IFMA 3NTNA 4EX5A 5AVRB 3TQYA 2EXDA 3CF5A 4A3IG 5FLMG 4HYTB 1HZAA 4LF5Q 2I5HA 1RF0C 4A3BG 1VQ6A 2R92H 3BZKA 2KENA 2YTYA 5IYCH 4YY3Q 1N73C 1W2BA 4APVA 3GD7A 5CJ0A 3NXSA 1M1JA 3M91A 1GVPA 4JF7A 3ERSX 2JA9A 1PFIA 2VQEQ 1FZCB 2WTYA 1IBKQ 3S17H 2RHQB 3GTGH 3S14H 3L36A 5AJ3L 4MZ9A 4B3SL 5AVQB 2MNAA 1QVGA 4QJFA 5LMNQ 1NU1K 4GKJQ 1EWIA 5C0XJ 5APQA 3TK1A 1Y1WH 1N7SB 4N6JA 3RL0D 1FZAA 2HFED 1ZR4A 3J81j 2UUAL 5JJIA 3NELA 1SQXK 3HOZH 4BXXG 4NXML 4A3EH 1A02J 1PHJA 1LWUC 1WRGA 5AVUB 4JYBA 3J81c 4JYAL 1J5EL 1LUZA 4BBSH 4WJ3M 5GADC 3RNUA 1NMFA 1VS0A 1JJGA 5AVZB 1KILC 3HE5B 1GD7A 4JG2A 3J80c 3KDPB 1JMMA 1S9KD 3VN0A 4LF9L 1WCMH 2WT7A 2XU6A 3GTOH 3VMZA 2JE6I 2B63H 1EQRA 5KJ7D 1N36Q 3I4MH 4HIMA 1PH2A 5IP9G 3L7ZC 5JEAG 2HODA 4C7RA 1IBMQ 2ZFCA 2ES2A 1VQCA 1EYGA 3BVHA 2OYIC 1GK6A 4XTCS 4LF4Q 4DV2Q 4WY4A 1URQA 2IFNA 1FGUA 2NPSA 2A45H 4EOTA 3T1YQ 1T2KD 3V2RA 2WFWA 3H6PA 2QA4A 2K52A 3TNUB 4JI1L 3EN2A 4OH8B 4YCVA 3OYYA 5K36G 4DKAC 1FJGL 4YHHQ 5BU8B 3HKZE 3V2QA 1KFNA 5BU5A 2VRSA 3HUSC 2HHHL 2P7JA 2YKPA 4OX9Q 2Q9IA 1N8RC 1IL2A 1SQPK 4YCUA 1N34L 1OXUA 4LFCL 2C9NY 4JI3Q 3S1QH 4RMFA 4QL5A 4DV1Q 3ULPA 2C0XA 1YTZI 1CI6A 1HNXL 3ULLA 1FOSE 1GM5A 4YCWA 4JBWA 1JY3N 5M5XH 4A3MH 1HZCA 3OW2A 5M3FG 3CC7A 4A3KG 4PZ8A 4GN4B 4AQYL 4O2DA 4TVAB 3P8CD 1S3OA 3K81C 1I94Q 2VUMH 2HLOA 4YY3L 1A02F 4AUWA 4HJ8A 3RL0C 5JJKA 2FKWB 3TEHB 1H8AA 5IWAQ 1PH8A 2P67A 5AW9B 3CC4A 2R7DA 1IK9A 3KQGA 3UE0A 1RF1C 3A5ZB 3OJAB 3T97A 5IYDH 3M06A 2R5BA 2VZAA 4ZKUA 5LMNL 3HD7A 1HNWQ 3MD0A 3HFZB 1Q46A 3B5ND 1FZEA 2UXCL 3RZDH 1TWAH 2XGTA 4A3IH 5FLMH 1VQPA 2Z0SA 1IC2A 4A3BH 1JY2O 1FZCA 5KJ7C 2R7ZG 3K0XA 1FZFA 2K75A 3V4WA 4JI7L 3S15H 2GN5A 2L5GB 2FFDB 4DR5Q 1N73B 3GTMH 4W7YA 1NMGA 1N7SA 3PUWA 1X56A 3GTKH 4O0AA 2PMZE 4DR2Q 3I2ZA 1QZGA 2ZJRA 2B29A 1FDMA 2CQOA 3GHGB 2P2UA 2JK8A 2K4KA 5AVXB 1GW4A 4BXXH 1FJKA 4N3YB 5C3EG 2N1TC 3FKIG 4XE5B 1OWAA 3HE5A 3MUDA 1VQGA 4JI6Q 1CKNA 2BH2A 4W80A 3OTOL 5CCHA 2KLVA 3K7AH 2NVYH 2FYUK 2LSSA 1Q8KA 1RL2A 1FAVA 3M0DA 4OX9L 1CZQA 4IFDK 2VQFQ 3PCOB 2WITA 4DV1L 2GVBA 1NY4A 4JC0A 3TNUA 1P8LA 4GLXA 3CXCA 3TRZA 4GKKQ 3C9IA 5AVTB 2KHIA 3PUXA 2E5LQ 3F2DA 3RK2B 1LT9A 1I94L 1K0RA 1PFSA 1MFZA 2N8NA 3B5NC 4DAMA 1HR0W 2HT1A 2HPCA 1YBYA 5IWAL 1NHLA 1NOHA 3RK3D 2JQOA 3DM3A 1ASYA 4X65L 1J1DB 4DV5Q 1L1OC 1JTHB 1IXRA 4KHPQ 4X6AH 4DK3C 1SROA 2UU9Q 1R9TH 2WWWA 3I7FA 4W7ZA 2PI2A 1N33Q 1HNWL 1LTAC 5M3FH 1NE3A 3KFUA 4GNXC 3ICEA 2M3BA 5M5YH 4A3KH 5IT9c 4GN3B 5BR8L 1VQIA 1JB7A 3PO2G 1SMXA 3CCVA 2H8PD 5AW2B 1VQBA 1SP4A 4LF6Q 3KPEA 4A3CG 3VP9A 3LIDA 3H0GG 1Q12A 4UP8A 1VQLA 2WPRA 3I55A 4R4OA 4X64L 2ASBA 3PF4A 1VQNA 1XNRL 5AW0B 3RL0B 4Y7NH 3BATA 3PGZA 1DEBA 3WMM0 4JI5L 4GOPC 2Q7CA 3UDFA 3CCMA 4C2MH 4H02A 1WYDA 1LTSC 5E7NA 5AVSB 4A75A 4GKGA 3PIOA 2HG5D 1HGVA 3OAKA 5M5WH 4DK6C 3KF6A 1HVVA 1X79B 5C0XI 1MV8A 2FFDA 3UIAA 1HJBA 4DR1Q 3J81i 2R7ZH 2ZTDA 1N32Q 4DV0L 1KQSA 2Z6KC 1JY3P 5JJLA 4A93G 1JO5A 3KJOA 4JV5L 3VP8A 2WSFH 4OO1G 1K3RA 4B3RQ 1GTWA 3F1ZA 2ALYB 1HTLC 4P74A 4YWMA 4OO1I 3V2PA 1PH3A 1Q1BA 1H95A 4XIGS 1AQ5A 2F3IA 3PUYA 5KLVK 1HUCA 2JEAI 5LMNW 2VQFL 4C7NB 1A0IA 2XDJA 1QUQB 3CD6A 1L0LK 1LT9C 3M85A 3T1HL 3IRBA 3RK3C 1KILD 4JI0Q 5C3EH 1SFCB 3FKIH 3K8AA 3S1RH 2YYZA 2IX0A 4DR3Q 1JY2N 3L35A 2GUSA 3VOPA 4LF7Q 2E5LL 5DLQE 4X66Q 5IP7G 4DR4L 2WAQG 3GO5A 1MJCA 1SQBK 1N2DC 1ZV8A 1NBWA 1Y14B 2WPSA 1RE3C 5C44G 1L4AC 4KHPL 2XNXA 1AFOA 2OYHB 2ZM6L 3L0OA 1WT6A 4X62Q 2J58A 5AVYB 5GROA 4OWTB 3V5BA 5J3BA 1GK4A 4P75A 2L15A 2KB7P 2Q2TA 1IFJA 1Q82C 3MTUE 1CSBA 5CJ4A 2KBNA 1EIFA 2XV5A 1X55A 4DUZL 1E5WA 1GKHA 3KYQA 1DGSA 2JA8G 1NO4A 1MJEA 3AEVA 1JTHA 5FJ8H 4C46A 2MO1A 1KRTA 4LF6L 1EUJA 1Y1VG 4JBJA 3A2AA 2IX1A 3Q8DA 3M4OH 1PH7A 2W6AA 1M7LA 3FHWA 1IYJB 2OTJA 3U4VA 1NKNA 4KHXA 1PH6A 1L1OB 1YJNA 5KTBA 1X9NA 5BVZA 2IY5B 1E24A 1VQJA 3CPFA 1X6OA 3RZOH 5APVA 1TWGH 4C3IH 3ER0A 3PO2H 1AE3A 3VDYA 3U50C 3A5UA 4ZKPA 3ULJA 4GNXB 1C7YA 1RIPA 1UWVA 1TXYA 3HTKA 5AW5B 3H0GH 4JI2L 2E2JH 4POGA 2JA5G 1PH1A 1E7ZA 2Q2UA 1HGZA 1HNZQ 1HR0L 4LLHA 4JYCA 3GTPH 2CCZA 3LGJA 1V43A 2JA7H 2NVTH 1XMOL 4DV3L 3PIPA 1WOCA 4PG3A 3S24A 1KZUB 2YNYA 1GL2C 4O9BA 4POFA 3U1AA 2DGYA 4GOPB 5APUA 1HWTC 1LTJC 3IFMA 4YWLA 1FBMA 4UY8C 4WB4A 3RN2A 1VQEA 1YNXA 1OXZA 2AMCB 1OTCA 2KHJA 2NZHA 4WY4D 5HY6A 4KI0A 2O1KA 2NPSD 4QGUA 4IFFA 1G2CB 3J7ZC 1GU5A 1PH5A 4DR3L 1FZGA 1J6QA 2YKQA 2B3GA 1XPOA 1E3PA 4LF7L 3EFGA 1Q86C 4P71A 2K14A 4C7NA 1BVSA 3W1GA 2N1TD 3CC2A 2JJQA 1N7LA 1KHIA 4L5QA 1SFCA 4J15A 1PYBA 5APXA 3S1NH 3PO3G 3G48A 1M1JC 3H3VH 4X62L 2WP8J 4N78D 3KF8B 2ZJQA 4IFDJ 3HOXG 1KIXA 4BY1G 4Y99C 4LF5L 1HH2P 4DR7Q 5APYA 4OONA 1XTCC 2M8RA 1EOVA 4I6MC 1UE1A 3A3YB 5ELOA 2CKZB 5IP7H 3M3YH 1O7IA 1VQDA 2OYHA 1K83H 4B3MQ 1BBUA 1QVCA 2VQEL 1IBKL 5H1SE 4JI8Q 5C44H 5CHXA 2YMYA 1NTZK 4I1LA 2V1CC 2BASA 4GKJL 1I6HH 3HD7D 1X3GA 3F8TA 2QEXA 3BZCA 1AH9A 4L5SA 2YKOA 4HJ9A 3HOUG 2R7FA 4JI4Q 5CCGA 3L4FA 3PP5A 2JA8H 2Q2HA 4DV6Q 1J2JB 3TYYA 3VMXA 1FU1A 2CPSA 1X3EA 4QY7A 1VQ4A 1FVIA 4LFBQ 3GTQH 1S9KE 3H15A 5M3MG 1Y1VH 1HNZL 4RESB 1D8LA 2PP6A 1LTBC 2F4VQ 4LWCA 4GIFA 2ZTCA 2HIXA 1X3FA 4WY4C 3D0FA 4C3JH 1URQC 1K73C 3CCRA 2NPSC 2XTIA 1EFWA 1N36L 5FLXc 1NJIC 1MIUA 4LNQA 1IBML 3HOYG 4BY7G 1YTZT 1PYSB 4DZOA 1X54A 2QM7A 4OWXB 1HH0A 1XNQQ 4LF4L 4DV2L 1A62A 1YVCA 1JUNA 5JEAJ 3T1YL 4HH2A 3CI9A 3LIEA 2GVAA 2JA5H 2XKMA 1PA6A 1LWUB 4EQ5A 2OQ0A 2OQKA 3E0EA 1YZ6A 3CQZH 4R4TA 4YHHL 1OXTA 1LYLA 1CKMA 1B7YB 1VQ7A 2W27A 4DOJA 1HJPA 4GT1A 2LXKA 1KILB 4DV4Q 5IP9H 2PQAB 3F2CA 3N7NA 3LW5H 3MGNA 2VL6A 4JI3L 4I2LC 1DX7A 4IPCA 1MUUA 1G2CA 2GM4A 1A8VA 3EBEA 3S1MH 2PAJA 3P7KA 3P8CE 1W2EA 3M9BA 4A76A 1SFOH 5EAYA 3A74A 1L0WA 3UDGA 2OYIB 2WB1G 4A3JG