3M9BA

Crystal structure of the amino terminal coiled coil domain and the inter domain of the mycobacterium tuberculosis proteasomal atpase mpa
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
186
structure length
186
Chain Sequence
SARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQPPSGYGVLLATHDDDTVDVFTSGRKMRLTCSPNIDAASLKKGQTVRLNEALTVVEAGTFEAVGEISTLREILADGHRALVVGHADEERVVWLADPLIAEDLPDGLPEALNDDTRPRKLRPGDSLLVDTKAGYAFERIPLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome-associated ATPase
publication title Binding-induced folding of prokaryotic ubiquitin-like protein on the Mycobacterium proteasomal ATPase targets substrates for degradation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Chaperone
total genus 31
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16450 Prot_ATP_ID_OB Proteasomal ATPase OB C-terminal domain
A PF17758 Prot_ATP_OB_N Proteasomal ATPase OB N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3m9bA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m9bA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m9bA02
3M9BA 4YHHQ 3F1ZA 5AW6B 2AWNA 2EQSA 1ASYA 3B8EB 3FKIG 4OO1G 2AMCB 1T2KC 2UUBL 5IP9H 3OTOQ 4AH6A 3A2AA 4IPDA 1V43A 2MFIA 3PIPA 2PQAA 4LC1A 4DR6Q 1M90C 3J7ZC 5LMUL 4IFDG 3CD6A 3W1GA 3I5CA 4UY8C 4A75A 4JI2Q 2UUCL 1GK4A 1KL9A 4JV5Q 2JQOA 2KCTA 2ZTDA 3NMDA 1L1OC 1RIPA 4LFBL 1FOSF 4DR5L 4R4IA 4A3FG 5APUA 3P32A 2Y0SE 5C4XH 5GQOA 1HNWL 3J80i 4KHZA 3KF6A 4LFAL 2HT1A 4WJ3M 3STBC 4DR4L 3SWFA 1D7QA 1CUKA 1J2JB 1TWCH 3K7AH 2JA5G 2WB1E 1R9TH 4JOIC 4JI0Q 5AW9B 2VY3A 3S1QH 1PH6A 1AE2A 1GD7A 3H0GG 3TREA 2CQOA 5LMNL 1NAFA 4R4TA 3GTGH 1AH9A 4YWMA 4KI0A 1KC8C 3OAKA 3H3VI 2C9NY 1H88A 2D62A 1TWGH 1P8LA 1HUCA 4HJ5A 5M5WH 4A3BH 1W2BA 5C3EG 1VQ7A 1YI2A 1WYDA 2NZOA 4XIGS 2BASA 2ZTCA 2NVQH 3L0OA 3ICEA 3S17H 5APYA 4LF5L 1Q7YC 2E2IH 3M0DA 1WOCA 2E2HH 4BA1I 3F2DA 1U5KA 3V5BA 2UXCQ 1EFWA 2WT7A 2LSSA 4DUZQ 4JI3L 1RL2A 4IPCA 1PYBA 2I5MX 2LXKA 1Y1WG 3JAMc 1S9KE 2ATWA 1GKHA 4C46A 3GD7A 2H7HA 2I0QA 4BBRG 5IWAL 4B3TQ 1UE1A 3GTPH 4RG1A 3CCEA 2AHOB 1UE5A 2PI2E 1N8RC 4JC0A 2C9LY 4B3ML 4DV7L 1NY4A 2Q2IA 1FAVA 2JE6I 4DAMA 4GLXA 4DV0L 4HYTB 5AVYB 3G4SA 1AE3A 1E24A 2UXBQ 1X3FA 3OW2A 3M4QA 3HOUG 1QVGA 2R7DA 1FOSE 1H89A 3RZOH 2E8GA 1K9MC 1QZGA 1XPRA 1MUUA 3S16H 3KJPA 2R5BA 2P7JA 2V1CC 4P73A 1DGSA 5C0XG 4UP8A 5AVRB 4X64L 5C44G 1VQMA 3PUVA 1PH4A 1UE6A 1SRUA 1PH5A 3K80C 5AJ3Q 1LYLA 1CKNA 1HNZL 4DV4Q 2Q2TA 2K5VA 3KDPB 1A02J 1YITA 5HY6A 3H3VH 5H1SE 2IX1A 1VQAA 1YHBA 4GNXC 2VW9A 1VQ8A 2AWOA 5IYCH 3F8TA 1HJPA 1OXZA 1QVFA 2VS1A 3D31A 5AVTB 3KOJA 5C0XI 2ZJPA 1SLQA 5JEAJ 4HJ8A 2VQEQ 3MD0A 1WI5A 2K50A 2R6GA 2OTJA 1NE3A 1VQDA 2NN6I 3I2ZA 2Q3IA 4NXMQ 3A0JA 3BU2A 1JT8A 2OQ0A 2K52A 2MO1A 1KQLA 1EIYB 1CKOA 2N9BA 1DH3A 3V4WA 3L2PA 4KLKA 4BBSG 2HIXA 2BA1A 1N34Q 5C3EH 2B63H 5M3MG 1QZHA 5M5YH 5E7NA 1N36Q 1HNXL 3HOWG 5AVSB 1A63A 2HHHQ 2R92H 4OWXB 4JI4Q 1K73C 4JI8Q 5IY0A 1V9PA 2Y0SG 3CMAA 2UXBL 2OCEA 4P72A 2Z0SA 4YY3L 2NVYH 3PO2H 1L1OB 1I3QH 4AQRD 2H5XA 4DV6Q 5DLQE 4UP9A 1TWHH 4DUYL 3TS0A 3KLWA 2WB1G 3HE4B 2KP8A 2W6AA 1HR0L 3TRZA 5FLMG 1PH1A 4GOPA 1GU4A 1IZ6A 1SE8A 1C7YA 3JAMi 3NBHB 2YYZA 2NZHA 3CCSA 2Z6KA 3IRBA 4IOCA 3NENA 1X56A 4DKAC 3HOUH 4DV4L 4O2DA 1PA6A 4LF4L 3M7NA 2N49A 4C3HH 1K0RA 3KQGA 1A02F 4DV3Q 5APTA 1VQPA 4YCWA 3TNUB 3GTMH 4M3LA 2F4VQ 2PI2A 4DR1Q 2R7ZH 3W5OA 1IBLQ 2DGYA 3UDGA 4A3GH 3U58A 3M9HA 2EXDA 1FVIA 2IHEA 5CMZA 2UUAQ 4YWKA 4MTNA 4LUVA 1H95A 1OXXK 4JYAL 1A62A 3NFQA 4JI5Q 5AVUB 1I5FA 4NXML 3PGZA 4A4IA 4K0KL 4NXNQ 3VYIA 3KYHC 3A5UA 2Q2HA 4AUWA 2ASBA 1OXSC 3W1BA 3F2CA 1VQNA 1PV4A 1MFZA 1N36L 5IP7G 1QUQB 2HHHL 1CI6B 2IX0A 1Q86C 2JA8G 1VQ4A 1L2FA 5FLXc 3J81j 3RLOA 2YTXA 3CF5A 2A1AA 3TEHB 1WCMG 3KDFA 3VDYA 4A3JG 5IT9c 2KENA 4LF8Q 4GKJQ 3ER0A 2K75A 3E9IA 4LFCL 3T1YQ 1I94Q 4A76A 4JI6Q 1VQ5A 2JA7G 4QJFA 1XMOQ 4KHPQ 3CMEA 1BBWA 4OX9Q 3S1NH 1OWAA 2WWWA 4HIDA 4OWTB 2Q7CA 2Z5HA 4J15A 4QIWE 4JYBA 4JI7L 1MJEA 4B3SL 1GU5A 5APXA 2UXDL 2UU9Q 3I4NG 4A3DH 3HOZG 4LF7Q 3MEFA 4DZOA 1KD1C 4DV2Q 3PO3G 2RCNA 2F3IA 1Y1VG 2PNHA 4GNXB 4OO1I 2E5LL 4A93H 1JNMA 4UPAA 4R4QA 1C9OA 3I7FA 4DV3L 5C4JH 4C7NB 3UE1A 3A5TA 4DV1L 1YIJA 3I4MG 3AQQA 4A3IG 2F4VL 1XNQL 4DR1L 4IFDI 3T1HL 1YVCA 4DR7L 2MNAA 1X3GA 3GTQH 2WPRA 3CQZH 4DR2Q 3WWVA 5APSA 5EAYA 1PH7A 4JBMA 3P8MC 5IYBH 1PH8A 1KRTA 4JCVE 4B3RQ 4LF6Q 1SP4A 2RHSB 1VQHA 5APWA 2WFWA 1E1OA 3IR9A 4BXXH 3GTKH 1Z9FA 1YEZA 3CCMA 4AQYQ 4C2MH 2QGQA 5FJ8H 3S1MH 4HJ9A 1XTDA 5C0XJ 2WP8J 4JBKA 4R4OA 4X62L 3CC4A 3ULJA 3HOVH 1A0IA 1E22A 4DNIA 1O7IA 1I50H 4RMFA 3RZDH 3S14H 2ZM6Q 3L7ZC 4YHHL 2VUMH 4A3EG 2WPSA 2QEXA 5IYDG 4L5SA 2VL6A 1HH2P 4JI6L 4BY7G 5AVQB 4IO9A 3TYYA 4KHPL 2VRSA 2B3GA 3OTOL 1VQLA 1C0AA 2PQAB 4POGA 4DR6L 1YJWA 2YU9H 3CCRA 1JJCB 4ALPA 1I6HH 4LUZA 4GKKQ 1K8GA 4JI2L 4DR3Q 1OXVA 4JV5L 4GLAC 1VS0A 3A74A 1JB7A 1LTLA 3CAMA 3MXNB 5JJIA 2KHIA 3FKIH 3KF6B 4A3LG 1IO4A 4HIKA 2ES2A 2FXQA 2JJLA 1E7ZA 1EQQA 4C3IH 2CKZB 4A3KG 3E9HA 4JI0L 4GN4B 4IOAA 5AVWB 4OXPA 4OWWB 4A3MG 1WFQA 3HOXG 1MIUA 4JOIA 1G2CB 1Q8KA 1N33Q 3I4NH 2R32A 3P7KA 1KXLA 4A3FH 1G291 1KQSA 1NTGA 3CXCA 2D0PA 3K81C 4TQUS 3M4PA 5HGQA 4BY1G 1EYGA 2NVXH 2IPPA 1BVSA 2R7FA 2R93G 2OQKA 2D0OA 4DAYB 2JA5H 3BZCA 4PZ7A 4AYCA 4A3IH 4QY7A 5AW3B 3H0GH 3HOYG 1UWVA 1EUJA 2UXCL 3S2DH 2WT7B 1PVOA 1YYCA 1QVCA 5M3FG 1X8YA 4DUZL 1W3SA 2VZAA 2YO2A 1LUZA 5AW0B 4X6AH 3GTJH 3CCQA 4ME3A 1EWIA 3DLLA 1IBKQ 2ALYB 1Y14B 3ULPA 1HWTC 3CPWA 4B3TL 3M3YH 5BR8Q 2C35B 4DPGA 1MJCA 3PUXA 2JK8A 5IP9G 3RLFA 5GAGC 3CC7A 3OYYA 1YHQA 1M1KC 1ASZA 3A5ZB 1IXRA 4GKKL 3KF8B 3M06A 1YHAA 3M4OH 4DK3C 4GN5A 1Y1WH 4AYBE 1JUNA 2ZXEB 4L5QA 3FHWA 3M85A 2YNYA 2EIFA 4BBRH 3CCVA 4QL5A 2N78A 2N3SA 1VQ6A 2ZJRA 1HZBA 1UEBA 3LIEA 2UUBQ 5JEAG 2B29A 5GAHC 1NWQA 4AIMA 3LIDA 3B6YA 5AJ3L 3UE0A 3I4OA 1CSPA 1CKNB 1CZQA 2UUCQ 1X9NA 2A8VA 1FL0A 3NEMA 2JEAI 2GN5A 1D8LA 1N33L 3CPFA 4LFBQ 4DR5Q 1K8AC 4WJ4A 1JJGA 1E1TA 3S2HH 2N8NA 4A3BG 4GNXA 2CFMA 5C44H 2WPQA 4GN3B 4DK6C 4DR4Q 2PMZE 4HJ7A 2VQEL 3H15A 1KRSA 3PSIA 4BA2I 3PCOB 2IT1A 4IFDJ 2VQFQ 3GTOH 5M5XH 5LMNQ 1KAWA 1GK6A 4LNQA 3PUZA 4I6MC 3MGNA 1XMQQ 4Y7NH 4LWCA 3GDEA 4X65Q 1WJJA 5ELOA 5AW8B 1IYJB 4FDBA 4TVAB 1OXTA 3A7OA 1IBKL 3O8ZA 1TXYA 1N34L 1NBWA 1PFSA 1GM5A 3RLNA 1GTWA 4IJHA 4NB3A 3K7UC 2XU6A 5ELNA 3GO5A 4XTCS 1PH9A 4JI4L 2VNUD 4JI8L 4LF5Q 4GLVB 3HOYH 1GZLA 1SMXA 4NPSA 3ULLA 2RHQB 1Q82C 2XGTA 2Q2UA 1X65A 1NJIC 5APVA 1G6PA 3NELA 4JI3Q 3U4VA 2YO3A 2QM7A 4P75A 4H02A 4DV6L 4BBSH 1XNRQ 2W27A 1VQEA 4PMWA 3S24A 5M3MH 3U50C 5IWAQ 1XJVA 2R5DA 1VQIA 3HOWH 1EIFA 4LUOA 4GOPB 1IL2A 3G71A 4YWLA 3K0XA 3JC66 1E3PA 3LGJA 1HBWA 3DM3A 3CW2C 3SGIA 4B3MQ 4DV7Q 2BA0A 1XPUA 3FP9A 4PZ8A 4DV0Q 3ERSX 1HZ9A 3J81c 2QM8A 1GVPA 2JA6G 3CCUA 4I2LC 1B8AA 5AVXB 2MO0A 2WAQG 4YCUA 2A19A 4HJAA 1CSBA 3EBEA 5LMNW 5APQA 1G51A 2I5LX 1K3RA 4POFA 5GAEC 3EIVA 5IYCG 5FLMH 3EN2A 1IBLL 4X64Q 2K14A 1GO3E 5AVZB 3TS2A 2F52A 3D0FA 2E42A 4Y52H 4R1JA 1UE7A 2CWAA 1GD2E 2UUAL 3UIAA 2IY5B 2VQFL 3HKZE 1HNZQ 3CC2A 3KFUA 3HE5B 1PH3A 4GS3A 1KHIA 1XMQL 1JE5A 4A3CG 4JI5L 3KJOA 1L0WA 4QGUA 4IPHA 1FJGQ 2HQLA 4DV5Q 4X65L 3U4ZA 4EOTA 2P67A 4NXNL 2YTYA 1OXUA 1X6OA 1S40A 5AW1B 2B63G 3S15H 1V1QA 3K8AA 2K5NA 1NMFA 2Q5UA 2DUDA 2R92G 1VCIA 2Z5IA 1J5EQ 1YJNA 4AYBG 3KDFB 1K83H 4O0AA 4LF8L 2YV5A 4GKJL 2E2JH 1X54A 2KHJA 3T1YL 1I94L 5JJKA 2OWOA 3PO2G 4QQBX 3L37A 1B7YB 1B70B 3G48A 3G6EA 1JMCA 2IHFA 1S72A 1XMOL 1YZ6A 2JJQA 1IBMQ 1XNRL 4OX9L 5AW5B 2CWPA 1HNXQ 5IP7H 1YNXA 3L35A 1Q1EA 4YCVA 1EOVA 3RN5A 2WTYA 1SFOH 2JA8H 1PH2A 2UU9L 1WCMH 2K5HA 4A3JH 1T2KD 4MZ9A 3PV0A 1TWFH 4LF7L 2JA9A 4YY3Q 1L1OA 3PF5A 4DV2L 1YJ9A 2MQHA 2JA7H 3F2BA 3NTNA 3BJUA 1VQ9A 4DUYQ 4GOPC 4UP7A 1Q12A 3V4QA 1BBUA 3VN0A 3HE4A 2BH8A 1PHJA 1N32Q 1HR0Q 3VMYA 3UDIA 2R7ZG 2Z6KC 4X66Q 4HIOA 4PG3A 4A3GG 3UDXA 2I5HA 4DR2L 3STBD 3AYHB 3HOZH 4KHXA 2E43A 4P71A 4LF9Q 2JA6H 2NN6G 2XTIA 1S3OA 3PO3H 4B3RL 3PUYA 3UDFA 4LF6L 3RN2A 4P74A 1Y1VH 4LF4Q 1BKBA 1FJGL 4DV5L 1VQKA 2WAQE 4IJLA 1PYSB 2ZTEA 4MNOA 3TNUA 3I4MH 3J81i 4AQYL 1U0LA 3ZJYC 4OONA 4B86A 1XPOA 1NMGA 3BZKA 3E0EA 4L5TA 4L5RC 1J5EL 4JG2A 3VMXA 2ZM6L 4JYAQ 1SLJA 2RF4A 4A3CH 4XE5B 1VQGA 3T97A 4JI1Q 3A3YB 4K0KQ 2GVBA 5JJLA 2ZFCA 3PUWA 1MKHA 3I55A 2QA4A 1IBML 1SR3A 2OTLA 3CCJA 3TK1A 2R3CA 1TWAH 1QUQA 1T9HA 1YBYA 1CI6A 1EQRA 1HZCA 3J80c 2YTVA 1X3EA 4DR3L 4IPGA 1HR0W 1VQCA 1VQJA 2KBNA 3VTPC 4A3DG 4A3EH 3AFQA 5IYDH 4EX5A 4LFCQ 5C4XG 4BY7H 5AW7B 2GVAA 3HKSA 2ID0A 3PIOA 5AW4B 4EQ5A 1OTCA 1N9WA 4GKGA 4A93G 1SN8A 3HFZB 4JYCA 1KIXA 4C3JH 4RESB 1JJ2A 1N32L 3S1RH 3M0AA 5AW2B 5LMUQ 3HKZG 2P2UA 1VQFA 4JI7Q 3GTLH 4X66L 4B3SQ 2UXDQ 5K36G 1MV8A 1SROA 2AKWB 4APVA 1Q1BA 4LF9L 5IYBG 1HNWQ 1VQOA 2CCZA 1J6QA 2XV5A 3AEVA 4A3LH 2ZJQA 5J3BA 4LFAQ 1S9KD 2E5LQ 3RR5A 2LXJA 4BXXG 4C7NA 4A3KH 4DV1Q 3HTKA 3PF4A 1H8AA 5FJ8G 1XNQQ 2L15A 1VQBA 1HJBA 2HIVA 4A3MH 3T1HQ 4R4CA 4DR7Q 3HOXH 3TQYA 3L36A 4JBJA 4GT1A 4JBWA 2XZRA 3RNUA 3HOVG 3CCLA 5GADC 1X55A 3HE5A 2VUMG 1A8VA 3I56A 4BY1H 4PZ6A 4HIMA 3VMZA 2K4KA 2KCMA 2BH2A 4JI1L 1CKMA 2R93H 5IE8A 1Q81C 5BR8L 1FGUA 3AFPA 3CP0A 1CSQA 1Z47A 3Q8DA 5GROA 5AVVB 3M91A 4X62Q 1LM0A 3J7A5 2NVTH 2JEBI 5M3FH 1Q46A 1HZAA 4LW1A 1P16A 3NXSA
chains in the Genus database with same CATH superfamily
1IW7D 4RGOS 1E2ZA 3M9BA 5KAFE 1VDZA 1Y8AA 2O3JA 4YHHQ 3F1ZA 5T1IA 5AW6B 4IUNA 2OTJP 2A6EC 5JPNC 2XWBB 1L0LK 1LT5D 2QILA 1SE4A 2AWNA 2EJGC 2EQSA 4RGTA 2KCNA 4NMZA 3BDOA 1FDMA 4N8FA 1ASYA 4HH2A 3B8EB 2B2WC 3VMAA 3A56A 3FKIG 1OW6A 1LJ2A 4N9PA 5E1FA 4OO1G 2H88C 2AMCB 2K88A 2KSJA 4BXLA 5KTBA 1K73Q 1ZRTE 1T2KC 5T1GA 3SK6A 4RKLA 2UUBL 4KY7A 1PZID 5IP9H 1EQ7A 1FDIA 3DM1A 4AH6A 1R5LA 3OTOQ 3A2AA 2K05A 4IPDA 1V43A 4C3IG 1FZEA 2MFIA 3PIPA 2PQAA 2ZVOB 3A0BH 1FD7D 1CQVA 2BCCD 1F77A 4LC1A 1T6AA 1PTOH 1YNJD 1M90C 3FVQA 4DR6Q 2C5CA 1G91A 5B5EH 1GL2B 3SFEC 4NP5A 3S15B 3J7ZC 5JVG3 5G3LF 4B9WA 2HDMA 2JN4A 3A0HE 1UEAB 5LMUL 4IFDG 2M5AB 3VR3A 1QGKB 4K2LA 3W1GA 3CD6A 3I5CA 2YIUB 4UY8C 1SJED 4A75A 3HRNA 2DN8A 1EOTA 4I7ZC 1SFCB 4JI2Q 1JY2N 1GK4A 2UUCL 2IFNA 1KL9A 4JV5Q 4TSSA 3D8GA 1AEXA 2JQOA 4E6IA 1NU1J 2KCTA 2ZTDA 1GMJA 2A45I 3NMDA 2W6BA 2FKWB 1L1OC 1RIPA 2EY2A 1EZVG 2BDNA 4LFBL 2Z4EA 3IF4A 3WMM0 3SR1A 1STNA 1SYGA 4CJ0B 1FOSF 4DR5L 4R4IA 4J8QA 4A3FG 3PQIA 2NPSD 2YXRB 1K83B 5APUA 3P32A 3AECC 2Y0SE 3MXNA 3LWUA 4X3UA 5CV4A 5C4XH 3CMAP 3Q5PA 1TS2A 5GQOA 2MKVA 2Q8TA 1WT6A 1TU3F 1XTCC 3RD4A 3J80i 1HNWL 2E2JB 1V1PA 4KHZA 1BBXC 1X9VA 1LABA 3KF6A 1HCZA 1SAPA 1G2SA 1OW7A 4LFAL 3HUSC 3B71A 3TGUJ 2HT1A 1LTIC 4WJ3M 3B4SA 4HB1A 3STBC 4DR4L 1ZXGA 3SWFA 1D7QA 1CUKA 5CBNA 5JEAH 1J2JB 5JAVA 1LO5D 5CBOA 1ZKOA 1TWCH 3BCCE 3K7AH 4FF4A 2JA5G 2O1KA 2WB1E 1R9TH 4Q0FA 4JOIC 4JI0Q 5AW9B 1FGBD 4PD4E 2VY3A 3S1QH 1PH6A 4WY4C 1AE2A 1GD7A 2PQEA 3OWEB 5J1ZA 1FZAA 4YXDC 1B9NA 3H0GG 3HRZC 2E75D 3SK8A 4JPBW 5AFWA 3TREA 2CQOA 2NTTA 5LMNL 1NAFA 4R4TA 3GTGH 5C5LA 1AH9A 1G2CA 3VP9A 3PMFA 1PZJD 4YWMA 1SFOB 3OSOA 4RKBA 2JA8B 2AXCA 3V2NA 4KI0A 1KC8C 3OAKA 3H3VI 2C9NY 3E5SA 1DXMA 4PV1D 1D7MA 1WCMB 2OYHA 1DD2A 1H88A 2LKMA 2D62A 1TWGH 3CCSP 1KYOE 2IYPA 2A6HD 2Z4IA 3SHLA 4A3JB 5EPLA 3IL8A 1W6JA 4CKBA 1BSNA 4UB6H 1SQBE 1P8LA 3P7JA 1TWFB 1AN8A 1BE3E 1HUCA 4HJ5A 1ZYRD 1IFIA 2KXPB 5M5WH 4RH6A 4A3BH 3TSSA 1W2BA 2Y0CA 1PP9J 2QRXA 4HEDA 1NU1D 5C3EG 3B5NC 2FXMA 3WDNA 1CFMA 2JXMB 5FKAC 1VQ7A 1AZQA 1YI2A 4JK1C 3T13A 1WYDA 2NZOA 3TP7A 2JA7B 4XIGS 3J80L 3CXHD 1VDFA 5CHXA 4DAYA 3Q24A 2BASA 2OT2A 1FC2C 1O80A 2IJ0A 2ZTCA 2NVQH 1ILPA 1VQPP 5CYUA 3J7AF 3OJAB 2LFNA 3L0OA 1EDJA 3ICEA 3S17H 5APYA 1R4PB 3MUDA 4LF5L 2XWJB 1Q7YC 2E2IH 3M0DA 1LACA 1JICA 2ZXOA 1BNZA 2KNCA 3TP5A 1NTKJ 3F89A 4PMCA 1WOCA 4CDEC 1LT9A 2YXQB 3TGUD 4K5VA 2E2HH 1ICFB 4BA1I 3F2DA 1KQFB 3CX5H 1EQVA 1U5KA 3V5BA 2UXCQ 3QOLA 1EFWA 2WT7A 2L1BA 3O13A 3G3ZA 2AQ2B 3AEFC 1L0NE 2DNCA 4ASVA 2LSSA 1PZQA 5KLVE 4DUZQ 4JI3L 4DA2A 3FPUB 3GTJB 1RL2A 1SQXJ 1EWCA 4IPCA 1BDOA 4RA8A 3PP5A 2CPSA 1PYBA 2I5MX 2TSSA 1A3UA 2LXKA 1Y1WG 3JAMc 3HOZB 2PFXA 1S9KE 1RF0A 4X3TA 1S3JA 1X0TA 1SQPD 3AE9C 2EYJA 5A2QL 3TF5A 2ATWA 1GKHA 2JA6B 2NB0A 4C46A 3GD7A 5ELCA 2H7HA 3H1JJ 1RE4A 2I0QA 1TR5A 3PO3B 4BBRG 3R3OA 5IWAL 4B3TQ 1Y1VB 4N3YB 1UE1A 2HODB 3GTPH 4RG1A 3CCEA 2AHOB 1UE5A 1ZEQX 2PI2E 1CI3M 1LT6D 1N8RC 1Q86Q 1YQ4C 4JC0A 3KPEA 1PPJG 2C9LY 1UUPA 2Y9ZA 4IQZA 1KDAA 2A74C 2F0NA 2HR3A 3I4MB 1URQB 4B3ML 4DV7L 1NY4A 1PP9D 3Q0AA 2OXPA 2WSSH 2Q2IA 1AV1A 2JWAA 4DCKA 5LHY1 1FAVA 1ZV8A 2JE6I 3KK7A 1MHWC 4DAMA 4GLXA 1VQNP 4DV0L 4HYTB 5AVYB 3G4SA 1AE3A 1E24A 4RCOA 2UXBQ 1KTMA 1EYDA 1X3FA 3J80E 3KF8A 3OW2A 3ND8A 3M4QA 3QH9A 2E76D 4CGYB 3HOUG 1JM0A 2B2VC 3I70A 1SQBK 2EJFC 1QVGA 2R7DA 1N86A 1FOSE 1N7LA 5CCGD 2A45H 1VQ4P 2K5DA 2PW7A 1H89A 3CHBD 4XT1B 1R5SA 1NTKD 4DGZA 3RZOH 3FPPA 1SYEA 2E8GA 1STGA 3VA7A 4DN4M 1K9MC 2IX3A 1NUCA 2F0GA 1QZGA 1XPRA 1MUUA 3S16H 3KJPA 2R5BA 4N9TA 2P7JA 3T53B 2V1CC 2DW3A 3H1ID 4P73A 4N78D 1MI2A 1DGSA 2O01H 4XYQA 2RBMA 4CDDC 5C0XG 4UP8A 1U57A 1OVVA 3TDKA 2IW3A 5AVRB 4X64L 3PHLA 5C44G 4FF3A 1VQ5P 5E4WC 1JWMD 3QWNA 3VA5A 1VQMA 3PUVA 3KZIH 2KLVA 1ZN5A 1LV9A 5A2QE 1J1DB 1N7SA 2YIUC 1Q3LA 1SNQA 5CBEE 3MP7B 3CMEP 1LT1A 3L75G 1DX7A 1UE6A 3OMGA 1PH4A 1SFCC 2JKVA 4ZRZA 2F3VA 1BGYJ 2AUJD 1SRUA 1PH5A 2W8ZA 5KLVK 3K80C 1LYLA 5AJ3Q 1TWAB 4PV1B 3H1KG 3K5LA 1FYCA 5TISE 2LKVA 3U1AA 1CKNA 4EQNA 1HNZL 1KD1Q 4DV4Q 2WQYC 2Q2TA 2K5VA 3KDPB 1A02J 1YITA 4ZKPA 3H1LJ 2CVRA 4Y99B 5HY6A 2CPBA 2ZJSE 4QMAA 3H3VH 3E1RA 1LNQA 4BS9A 1D5XC 5H1SE 2RA4A 2IX1A 1VQAA 1EZVE 2QEJC 2ZYGA 3HP3A 3DEPA 3CRLC 3KUPA 2XDJA 4L76A 1YHBA 4GNXC 3D3RA 2VW9A 1GW3A 1VQ8A 1N73C 1SQVJ 4A3EB 2B88A 4NPEA 2AWOA 4DOJA 1K05A 5IYCH 3F8TA 5C3WA 1HJPA 3H1HG 4FO2A 1EDIA 1OXZA 3WOFA 1QVFA 1DONA 4WBAA 2VS1A 3CCUP 4BY7B 3D31A 5AVTB 2FYUG 1RF1B 4G7OC 3KOJA 3O6QA 5C0XI 2ZJPA 1BR9A 5IGGA 1RH5B 3R2PA 3IN6A 3L73J 3QOJA 5A35A 1X3PA 1SLQA 2K5WA 5JEAJ 2EYMA 4HJ8A 2QDBA 1SNDA 2VQEQ 3MD0A 5FLXL 1WTOA 1M4VA 1KABA 3MC0B 3SE0A 1LGHB 4GDOA 2NYZD 1SYFA 1WI5A 4C3JB 2K50A 4KKUA 1YIJP 1X3QA 2OYIB 3S1RB 2R6GA 1NHLA 2R3SA 2OTJA 1PFBA 2QF7A 3CWBE 1NE3A 5ELBA 1F9PA 3I3CA 1VQDA 2NN6I 3I2ZA 1JY3N 4UHVA 3GTLB 2Q3IA 4XQJA 4NXMQ 2ZYAA 1PFIA 3A0JA 1FZCC 5KJ7C 1BGYD 2D2CD 3G6JB 4O9BA 1PTOD 2H8PD 2IBZD 1PZKD 3QG1A 1L0XB 1EYAA 5KYIA 3BU2A 1JT8A 2BEQD 2OQ0A 4H7BA 1EY6A 2K52A 2MO1A 1KQLA 1EIYB 1CKOA 3I8ZA 1ESFA 1L4AA 3GMAA 2N9BA 2PZTA 1DH3A 3SSUA 3MHVA 4DAVA 3V4WA 3GW6A 1F9SA 3HGBA 3NTIA 4KLKA 3L2PA 3SK4A 4BBSG 2HIXA 3H6MA 2BA1A 1N34Q 5C3EH 2B63H 5M3MG 1QZHA 4BRYA 4CJ2C 5M5YH 5E7NA 5F2DA 4XQNA 1N36Q 2RDHA 5BU5A 3DWQA 1HNXL 3GF3A 1F9QA 3D70A 1E79H 1LT3D 3C3LA 3HOWG 1DZ1A 5AVSB 1ZW0A 3ZDMA 3HZXA 4LK1C 1A63A 2HHHQ 1S5LE 1IW7C 1MKMA 1SQVD 2P1JA 4K5XA 2AEJA 2KEEA 2R92H 1PIXA 4OWXB 2DY8A 3D4RA 1FNWA 4JI4Q 2E76B 1WMKA 3CCMP 4A3KB 1K73C 4JI8Q 1F2YA 3K5NA 3QB3A 4HMIA 5EBCA 5IY0A 1JY3O 1PFNA 2D9UA 2A06G 1V9PA 4A3MB 3L73D 3HOXB 2Y0SG 3CMAA 2UXBL 3EFXD 2Z4HA 1KDBA 2OCEA 4P72A 2Z0SA 5D3DA 2KK7A 1M57D 3CC4P 5C4ZA 4YY3L 3QO2A 2KOGA 1DD3A 4WVZA 2NVYH 1L1OB 1I3QH 2SOBA 3PO2H 3E1IA 5FLXE 1HTLD 4AQRD 2H5XA 1HFGA 2ZXPA 2NTSA 3KBGA 1NU1E 1YNJC 2K03A 4DV6Q 5EGTA 5DLQE 5IOCA 4UP9A 1TWHH 2OYOA 1EXIA 2HD3A 2MPMA 4DUYL 3TS0A 1JTHA 1QL1A 1D5ZC 3BCCG 1K3BC 4U3FJ 2IPKD 3KLWA 2WB1G 4BY1B 4G7ZC 2O01N 3T4AC 3HE4B 1PFMA 2QEXP 2KP8A 2W6AA 2XN9C 1HR0L 2J7ZA 3TRZA 2G5DA 5FLMG 2IBZI 1PH1A 2R93B 4GOPA 4ODGA 3ONAB 1EY0A 1GU4A 3TGUE 1IZ6A 5C5MA 1DCZA 1JWUD 1SE8A 1U4PA 1C7YA 2NPSC 2EY5A 3JAMi 1TS3A 2B2UA 5GTIE 3NBHB 3L74J 3JC22 4GOEA 1KILA 2YYZA 2NZHA 1K0SA 2ZAEB 1VQLP 4IFMA 1GL2A 3CCSA 3R4YA 2Z6KA 1CTMA 4MIUA 3IRBA 4IOCA 2DY7A 1USEA 3NENA 3AEBC 1YJWP 1X56A 2LXBA 2FJ2A 4DKAC 1K04A 2O5JC 3CCRP 1QX8A 2F0MA 2JP1A 3HOUH 1ILQA 1BE3G 1LWUA 4DV4L 2NVTB 1DOLA 1PTOF 5M3FB 4O2DA 4K6LA 3N7NA 4ZMDA 1PA6A 1KFMA 4YPCA 2J0TD 4LF4L 2N49A 3M7NA 2N1TA 1K0RA 4C3HH 1BDCA 3KQGA 1AQ5A 1Y69U 1A02F 1SDFA 5DJUB 3D71A 4DV3Q 1U7MA 1HXYD 5APTA 4WWIA 2E75C 3CX5D 2MJZA 1VQPA 4YCWA 1HFNA 2B87B 3TNUB 3AE7C 3GTMH 1J1DC 4M3LA 1UNSA 2F4VQ 4RHSA 5C0XH 2PI2A 4DR1Q 2R7ZH 2O01J 2B2TA 3W5OA 2SEBD 1IBLQ 2N1TD 2G3AA 4PV1C 1S1CX 5B66H 2A6HC 2DGYA 1NTZG 3UDGA 4A3GH 3U58A 3M9HA 1L0NG 1EU4A 1STHA 3L71D 5KLVG 2UWJE 2EXDA 4U3FD 3L75E 1FVIA 1IKLA 2WINB 1ZYRC 5DJTB 3RBXA 2N88A 2D2CB 5CMZA 2IHEA 3D4DA 2BCOA 3BS1A 4GZYC 1PTOB 3JAML 2UUAQ 2H89C 2V4HA 4TLFA 1DJRD 1TY0A 4YWKA 3HD7D 1NTKE 1S5FD 1RD9D 4IURA 4LUVA 1OXXK 2NN6H 1NU1K 3BVGA 4MTNA 2OYHC 2F4IA 4JYAL 2J4XA 2E2DC 1A62A 3NFQA 3H09A 4L8JA 5IIFA 4WB4A 4JI5Q 5AVUB 5CV6A 1EY9A 1SNOA 3L74D 1I5FA 4NXML 1BCCE 3MTUE 3T97B 3A7AB 1EFID 1CHPD 3GQBA 1II3A 4KJMA 3NTHA 3PGZA 4H13D 4N78E 4A4IA 4K0KL 4I1LA 1MBYA 1SQXE 4NXNQ 3ERQA 1Q8IA 1YNND 4WJWA 3L72J 3VYIA 3KYHC 3A5UA 2Q2HA 4AUWA 2HPCA 2ASBA 1OXSC 3NSWA 1BDDA 5C4XB 3W1BA 5GTHH 3R2TA 1IKMA 1L0YB 1FNUA 1UIXA 3H1JE 3F2CA 3A7LA 1VQNA 1PV4A 1MFZA 1SQQD 1N36L 2IYOA 3BVHA 5IP7G 2OYIC 1QUQB 1E5WA 4C56C 1CA5A 3E3XA 2HHHL 2QIWA 3BZDB 1CI6B 2IX0A 2HLOA 4XT3B 3VR2A 3RL0g 3ND9A 1Q86C 2C0XA 2JA8G 1M1JB 1VQ4A 1TWCB 3K7AB 1L2FA 1R9TB 2RVLA 5FLXc 3J81j 3RLOA 2YTXA 5EPKA 3CF5A 3S1QB 3FWNA 5KAFH 2A1AA 2CHBD 3FEWX 3TEHB 1EY4A 1WCMG 2AQ3B 3KDFA 4DU9A 3VDYA 1NTMJ 2W83C 4A3JG 3C8VA 1U7JA 5IT9c 2KENA 4LAAA 4LF8Q 1IZNB 4GKJQ 4EVOA 3GTGB 3GHGA 3H32A 1WTVA 3ER0A 3A8KE 3IAYA 1FNVA 2K75A 3E9IA 4LFCL 5I2XA 4R8IA 1SNMA 3T1YQ 1I94Q 4HMJA 4A76A 4JI6Q 3Q23A 3GG2A 4NKLA 4UB8H 3V2TA 4EQOA 1VQ5A 3JAME 3CL3D 3I4LA 1TWGB 4F8MA 2JA7G 1NO4A 2LY7A 1WTHA 2PNRC 4QJFA 4HCEA 1XMOQ 4KHPQ 1EL0A 5BN5A 3CCQP 3CMEA 2FFDB 3PTZA 1BBWA 1IC2A 1NCVA 1OWAA 3JSVC 2WWWA 4OX9Q 3OPOA 3S1NH 4HIDA 5M5WB 5EQ0A 1USDA 5TJHA 4A3BB 2E76C 4FXDA 3OHXC 4OWTB 4OGQD 1LTJB 1M1KQ 1I4RA 1B2TA 4IOIH 1KAAA 4XQQA 2XNDH 2ZT9D 5CCGC 2Q7CA 2Z5HA 4QF4A 4C7RA 3L72D 3LWEA 4J15A 3K6OA 1SVFA 4QIWE 1OIPA 4JYBA 4JI7L 1NTKK 1MJEA 4B3SL 3I55P 5EKKA 3KLSX 2NVQB 2F0WA 1URQA 2KQ3A 1GU5A 1KZUB 4R4MA 4XFJA 1NKZB 3S17B 2XVSA 1H9SB 5APXA 2UXDL 2UU9Q 3BVMA 2EY1A 2E2IB 1BGYE 3I4NG 3TDQA 4QCLA 1W2BO 3C1FA 3SEBA 1NOHA 4A3DH 5JVH3 2HUGA 2D5DA 2YKPA 4K2KA 5B5EE 3CC7P 2A06E 2E2HB 1SQXK 1YHQP 3OIQA 5ELFA 3HOZG 4LF7Q 1TKWB 4C1NK 3MEFA 2CK3H 2F0HA 1GUWA 2M8RA 2J59M 4WORA 3V6IA 4KJOA 4DZOA 4KN4C 1KD1C 1MSGA 3H1LE 4DV2Q 3PO3G 2RCNA 2F3IA 2IDBA 4J6HA 1Y1VG 1HF9A 2BCCG 2PNHA 4GNXB 4OO1I 3SDZA 4NPDA 4UAIA 1N73B 1SYBA 2E5LL 5I4DA 1JNMA 2WPVB 2IL8A 4NW2A 4A93H 2FYUK 1NTMD 4R4QA 1C9OA 4UPAA 3I7FA 4DV3L 3KLSA 5C4JH 1TU2B 2K9JA 2V7QH 4C7NB 3UE1A 3A5TA 4DV1L 3D6ZA 1YIJA 3CCVP 3I4MG 2WKCA 2XNAC 2PYKA 5CCHA 1H0TA 3HTKB 1Y47A 1LTSD 3AQQA 4L63B 5CORA 2DJGC 4A3IG 2F4VL 1XNQL 1AQTA 2B2YA 3IAOA 3GTPB 4DR1L 4IFDI 1VQ6P 1JY2O 1RE3A 3T1HL 1SQPJ 3CWBG 1I4HA 1YVCA 4DR7L 2MNAA 1X3GA 4FVMA 2RDFA 1EQTA 3L73E 3TBIB 2MUYA 3GTQH 1QCBD 5K36H 1EZ8A 1NAYA 1XTGB 1SBBB 2WPRA 3CQZH 1WTXA 1OVUA 1HA6A 1GUOA 4DR2Q 1K8AQ 1ZOYC 3VR5A 4H13B 1EZVI 3TP8A 3WWVA 5APSA 4JF7A 2KECA 2PZWA 3D6WA 2F0KA 5EAYA 2RH0A 2YMYA 3K57A 1PH7A 1ET6A 3MA2B 1S4XA 3P8MC 5IYBH 4JBMA 5FOBB 1PH8A 2KS1A 4K8IA 1KRTA 1FZCB 4JCVE 4O42A 4B3RQ 3H91A 4LF6Q 1EDKA 1SP4A 2RHSB 1B44D 1VQHA 1KB9D 5APWA 2WFWA 4KY5A 1YTZT 4HSVA 1E1OA 4Z9CB 2F0VA 1P84I 2LS01 1L0LJ 2OARA 3IR9A 4LJZC 3RZOB 3C9IA 2JEEA 5KEEA 4BXXH 3P8CD 1U4LA 3ITPA 1Z9FA 1YEZA 3GTKH 2KUBA 3QIAA 3CCMA 1RCVD 1IL8A 5C3XA 1SYDA 3WOEA 4AQYQ 1IYUA 1PGQA 4OVNF 4C2MH 3S16B 2QGQA 5FJ8H 1CHQD 4G7HC 3OW2O 1OO9B 3MVVA 4Y28J 2K01A 3S1MH 4HJ9A 2D2CC 1XTDA 5C0XJ 1QVGO 3PIP3 3GP7A 2K6AA 5COYA 1PTOC 1RQUA 2WP8J 3F5HA 2Z6BA 4ZKBB 3UI2A 4JBKA 4R4OA 4X62L 3M7GA 2TMPA 1NTZE 2F3WA 4F7XA 4QUCA 3CC4A 3ULJA 4K5WA 1KLUD 3HOVH 1A0IA 3H1IJ 1E22A 4DNIA 1O7IA 1EY5A 1FBMA 1I50H 4RMFA 1NU1G 3RZDH 1TQOA 3S14H 4L75A 4F87A 4GOFA 1KORA 2ZM6Q 3D6YA 4F88A 1H9KA 2K7VA 3LX0A 4GODA 3L7ZC 4YHHL 2VUMH 4ULLA 2B89A 4A3EG 2WPSA 4ZLTF 3CX5E 1IFJA 1NVOA 4U7JA 2QEXA 5IYDG 4L5SA 1FZGA 3W67A 3DWAA 4MN3A 3BG3A 4OGQB 3C2PA 2VL6A 4KK7A 1TS4A 1QL2A 3VR6A 2F03A 1HH2P 4JI6L 4BY7G 1M8AA 2ZT9B 5AVQB 1PV3A 2WAQB 1KNAA 1XX8A 3DWPA 2B8FA 3TGUG 2F0TA 1M8OB 3W2DA 1HHVA 4IO9A 3L70J 4TT3H 3TYYA 4KHPL 3EWKA 2NUCA 1T8ZA 2XIWA 2VRSA 2B3GA 3OTOL 4PQXA 4ID6A 2WMMA 5ELDA 3MEHA 1VQLA 2B2WA 1C0AA 1E2VA 1M1JC 4U3FE 2YKQA 1KB9I 2L9HA 2PQAB 5DAUA 5E3FA 1Q82Q 2M2LA 4C3JG 4POGA 4DR6L 4FNFA 3NQIA 1HTLC 1YJWA 2YU9H 2FBWC 4IUQA 3CCRA 1NJIQ 1JJCB 1L0LD 4ALPA 3SWYA 2NPSB 1I6HH 4LUZA 4GKKQ 4FXKC 1Z7TA 4DNRB 1K8GA 4RFBA 5FO9B 3W68A 4JI2L 3RGUA 2IFMA 4DR3Q 4KD3A 1OXVA 1LTGD 3Q6SA 4JV5L 3Q22A 1TS5A 3L74E 4GLAC 3BDLA 1V8QA 1QVFO 1VS0A 2L11A 3A74A 1SNPA 4KN7C 1I4QA 1JB7A 1LTLA 3CAMA 3MXNB 1HQMC 2EYFA 2BEZF 2O1JA 1ZR4A 2FFDC 2HDLA 1IFDA 4DJGA 1RJTA 2KHIA 4O1NA 5JJIA 5H2FE 1ZLLA 3KHUA 3FKIH 1PP9G 1V1PB 4OO1H 2KZIA 1LTJC 3KF6B 5D65A 4A3LG 1IO4A 2ICIA 4HIKA 2ES2A 2E75B 2FXQA 4CBVA 1U9RA 3URYA 2JJLA 1GW4A 3AE6C 1QWYA 1E7ZA 4MHEA 4RHRA 1JCDA 1EQQA 1YTZI 4C3IH 2CKZB 2NRGA 2Z1CA 1NTZK 4A3KG 3E9HA 1VF5D 1SMYD 1L0NK 1QG7A 3HUSA 5C3EB 3MAQA 4JI0L 4GN4B 2B63B 4IOAA 5M5YB 1EU3A 1KTKA 1MD2D 4R8NA 1JEKA 1F2MA 4IFDH 2WACA 2FYNB 5AVWB 4OXPA 1E0BA 2OGUA 4CPGA 1NTKG 3NXWA 4OWWB 1DEBA 2OF1A 2KA7A 2H43A 4NDXA 4A3MG 4OELB 3L70D 1WFQA 2KHSA 4QB4A 3HOXG 1MIUA 2WIIB 2X6GA 4JOIA 2R92B 2PP6A 1G2CB 3H1HD 1DM0B 3G71P 1U4RA 5D3IB 1N7SD 4WY4A 3P20A 1Q8KA 1BCCG 1FZBA 4K3AA 1EZ6A 1N33Q 3I4NH 4AYBB 2R32A 2OEOA 3P7KA 2EYPA 1SQXG 2Y0DA 1KXLA 3MXPA 3OIPA 4KHVA 4TRDA 1G291 4A3FH 2OYHB 1B1ZA 1KQSA 1NTGA 2GUVA 3CXCA 3Q3DA 2N1TC 4L74A 1JOKA 2D0PA 3L9AX 3K81C 3V96A 2L5TA 4TQUS 3M4PA 3VYUA 2O5IC 2JR8A 4OEMB 2JYOA 4PJ0H 5HGQA 4BY1G 1EYGA 3H1JG 1W5CE 2NVYB 2NVXH 3PH0A 1I3QB 3PO2B 2IPPA 1BVSA 2BCCE 1P84H 2AXTE 1QLED 2R7FA 3V05A 5J39A 2R93G 3C46A 4KY6A 2OQKA 1PGPA 2E5TA 2M3BA 3JCUH 4IUVA 3FGAD 2F0EA 3HD7C 3L72E 1TWHB 2D0OA 4DAYB 2JA5H 1LP1A 1WRGA 3BZCA 3NWTA 1ONLA 3R2IA 1KFNA 2V7QJ 3B5NA 4PZ7A 3MZWB 4AYCA 1LTBD 4A3IH 4QY7A 1PYWD 1PGOA 1VL2A 5AW3B 1QE6A 3H0GH 1DD4A 2RMZA 3HOYG 2A69D 4H13C 5IT9L 1UWVA 1ZRTD 1HUNA 1LT9B 3C1EA 1QNKA 1SJHD 1YNNC 1EUJA 2CW0D 2UXCL 1EC5A 1BOSA 1KQGB 3S2DH 4A7PA 2WT7B 1YYCA 1PRTD 1PVOA 4IUPA 5JJZA 1QVCA 5M3FG 4GIFA 1X8YA 1JB3A 4DUZL 1W3SA 2FYZA 4QUFA 4MTKA 2YKOA 3Q2YA 2VZAA 3MFGA 2YO2A 3NWSA 2F0QA 4C1NI 1LUZA 5AW0B 1STYA 1HJ0A 4X6AH 3GTJH 4D6TJ 1SNCA 1SQBJ 3CCQA 3MZ5A 4KD4A 5IODA 4ME3A 1EWIA 3DLLA 1IBKQ 2ALYB 1N2DC 3HOUB 3CC2P 1Y14B 3ULPA 1CK1A 4L6TB 1HWTC 3CPWA 4IL6E 3GV6A 5KRUA 4B3TL 1L2PA 3FDTA 4C3HB 3L4FA 2KCCA 5D14A 3M3YH 2KOLA 1IFMA 1ZXTA 2PMZB 5BR8Q 1S5LH 4MN4C 2C35B 4EYYQ 1C8CA 3U59A 1NR2A 4DPGA 1MJCA 1IK9A 5M1BA 3PUXA 4CDFC 1L4AD 2JK8A 2EYOA 3N6RA 5IP9G 4RKUJ 3BYYB 4H44D 1Y8PB 3RLFA 2L55A 4KKSA 1GHKA 1KB9H 2DNEA 3LNNA 5GAGC 3GTMB 3VYRA 2HCCA 1BGYG 1A3TA 4B08A 3CC7A 3OYYA 4HJGH 2R7ZB 1CZWA 1YHQA 1M1KC 1ASZA 5I9PA 1QB5D 3A5ZB 2I1JA 2QE7H 3I72A 1IXRA 1J1EB 1BF4A 2KUMA 4GKKL 3CKIB 5EKLA 1KLGD 4A3GB 2FFKB 3KF8B 4JBZA 1JQYD 3DHQA 2E74D 3H1LG 3M06A 3MFYA 2HYNA 1YHAA 3M4OH 4DK3C 3H3VC 4OGQC 1B3QA 1BXTA 5E79H 4GN5A 4AYBE 4YTPC 1JUNA 1Y1WH 2ZXEB 1YJNP 4L5QA 2ZT9C 1VMCA 3FHWA 3M85A 2ENBA 5IT9E 2NWGA 2B2VA 2YNYA 3CXHE 3E7KA 4EQPA 1WTQA 1SQVG 2EIFA 3L71J 2LR2A 4BBRH 5KYLA 3CCVA 4RO0A 3EQLC 2R44A 4WRDA 4QL5A 2M3EA 2N78A 2A73B 1VF5B 1STBA 2K3RA 5JOBA 4X3KA 2N3SA 1DIPA 3OOCA 1VQ6A 2EE1A 2ZJRA 3AE5C 5I2YA 1HZBA 4D6TD 1SQBD 1PXUA 1UEBA 3LIEA 2JDIH 2UUBQ 3G6EP 3II6A 3D4WA 1X79B 5KKZC 4ZCKA 2JP3A 3L73G 2GA4B 3IKJA 3WUTA 1S72P 4RGMA 5EKIA 5JEAG 2L91A 4S3SA 1N7SB 2B29A 5GAHC 1NWQA 1A2UA 4AIMA 3LIDA 3B6YA 2EXZA 3IFTA 5AJ3L 4ZKUA 4TKOB 3UE0A 3I4OA 3SFDC 1JWSD 2M5AA 1BCPD 3E0JA 1OVRA 1CSPA 2Z8LA 1CKNB 2GUSA 1SQPE 1SFCA 1CZQA 2UUCQ 1A2TA 1X9NA 2A8VA 1B50A 1FL0A 5CR3A 3NEMA 1R8EA 3TZUA 4IUTA 2JEAI 2GN5A 1ZP0C 1D8LA 3WU2H 1KILD 1N33L 1SQQJ 2K1BA 3CPFA 1LTSC 4LFBQ 1GL2D 1J9OA 3F2UA 4DR5Q 1LTTD 1CZGA 4RWSC 1K8AC 3AU7A 1WD0A 4QMGA 2F1MA 2RQXA 1FZFA 1RF2D 2QDLA 1G2TA 4N6JA 5IGCA 4WJ4A 1F2ZA 1JJGA 1E1TA 3S2HH 2N8NA 3EQ2A 1S2EA 1PLFA 2JWDA 5IGBA 3Q5RA 3VP8A 4PD4I 1NGMB 3DEOA 4H0LD 1K8MA 4A3BG 3K5BA 4FF2A 1PP9E 4DK0A 4GNXA 3AMUA 2CFMA 5C44H 2WPQA 3H94A 1YJ9P 3MIWA 3O6QB 4GN3B 4ZAIA 4DK6C 2FYNC 4DR4Q 2PMZE 4K8JA 1L0LE 4JW0A 1VQ9P 3I73A 4P2CB 3SXHA 5JPMC 4HJ7A 2VQEL 3S1NB 1H95A 3H15A 2P5ZX 1KRSA 2K28A 3PSIA 4BA2I 1PMRA 3PCOB 3U1CA 2IT1A 5KAIE 1JOOA 1XXGA 1KYOI 3FXDA 4IFDJ 2VQFQ 4XDXA 2C9OA 3GTOH 5M5XH 1KAWA 1Q90A 1A3VA 5LMNQ 1GK6A 3PUZA 2FXOA 4I6MC 4LNQA 1JORA 3MGNA 3RK3D 4I7AA 1XMQQ 4Y7NH 4LWCA 2HG5D 2HQEA 5B66E 5CJ4A 3GDEA 3KLRA 1MZ9A 5J22A 1M7LA 1PDQA 4X65Q 2QVAA 1WJJA 4ZKCB 3FMCA 3H1IE 5ELOA 2WSFH 1A15A 1TT2A 5AW8B 2X6LA 2QG4A 1OZHA 2AEMA 1IYJB 4A3DB 4IZ8A 4FDBA 5FO8B 1LT4D 3EJIA 2H4OA 3U9SA 4TVAB 3DUZA 3AE1C 3OA7A 3PIO3 5KJ7A 1OXTA 1L4AB 3A7OA 1IBKL 4JQ0D 4H44B 3AEDC 3O8ZA 4U3FG 1TXYA 1N34L 1BUVT 1NBWA 4BRYB 1A6XA 4RGNA 1Y8NB 1H9JA 4CHTB 1PFSA 3MUDC 3RLNA 1GM5A 4RAUC 3PJSK 1GTWA 4IJHA 1J8IA 4NB3A 3K7UC 3M0DC 1WVLA 2XU6A 4A93B 1VQKP 5ELNA 1LT9C 3GO5A 4XTCS 2KB7P 4OIJA 1CA6A 1PH9A 5C4JB 3L70E 4JI4L 2VNUD 2E74B 1Z6HA 1SQPK 2EOTA 1G1JA 1BCPF 2EDGA 3DMUA 4V0BA 4JI8L 4LF5Q 3L74G 2KZJA 4GLVB 5KIXA 4N8X1 2L4NA 3HOYH 1GZLA 1SMXA 3S9WA 3HKZB 4NPSA 3ULLA 2RHQB 3CWBJ 2R61A 1Q82C 4R4LA 2XGTA 2WV6D 1D1KA 1X65A 3I90A 4KJNA 1NJIC 2Q2UA 2RN0A 5EJWA 5APVA 2CQAA 1G6PA 3NELA 1RF0C 3GTQB 4J1MA 4W80A 4JI3Q 2AUKA 3U4VA 2Q3EA 5TSSA 2YO3A 2P10A 3V2QA 2QM7A 1R4QB 1RE4C 2A68D 2QW7A 3CQZB 4P75A 2RSNA 2A45G 4H02A 2FXPA 4W7ZA 2M9VA 1KMIZ 4DV6L 4DT0A 1PL5A 2G8YA 2ZYDA 3EVQA 4BBSH 5EBDA 1XNRQ 1CM9A 2W27A 2MHVA 1JTHB 1VQEA 4PMWA 1RODA 3S24A 5M3MH 1AJYA 3U50C 5IWAQ 1YQ3C 1XJVA 2HODA 2QJYB 2R5DA 3EFFK 4LLHA 3S1KA 1LTGC 1VQIA 1EZVD 3A0HH 3HOWH 1TVXA 1EIFA 4ME5A 2QJPB 1TIID 4LUOA 5CV7A 4GOPB 1BCPB 3Q5SA 3MXUA 4FXGC 1IL2A 4UB8E 1S5DD 4W7YA 3GTKB 4ASWA 3G71A 4YWLA 3K0XA 2HCIA 3JC66 1J1EC 1E3PA 3LGJA 1HBWA 2WKDA 3DM3A 3CW2C 3SGIA 2QA4P 1FR3A 4C2MB 2RSOA 4B3MQ 4DV7Q 3KXDA 1OMIA 2N9YB 5CV9A 4U673 4IL6X 2BA0A 2OTLP 3CCJP 1KILB 4DXFA 4K35A 1XPUA 3A0BE 3FP9A 3S1MB 1JB0J 2Q8RE 1P84D 4PZ8A 2IBZE 1DOKA 1IHZA 5CV5A 3ERSX 4DV0Q 2NPSA 1HZ9A 2VB2X 1S5LX 3J81c 2K37A 5CV8A 1X32A 2Y9YA 2LXCB 2H1EA 2QM8A 3MHBA 5CGKA 1GVPA 2JA6G 1VPCA 3CCUA 1LWUB 1DYQA 2SNSA 3HOVB 1URQD 5KNBA 4H0LB 4I2LC 1B8AA 5AVXB 1IJDB 1I50B 1VF5C 4IFFA 1SMYC 2MO0A 1OX3A 2N1TB 3RZDB 3ITKA 1Y9BA 2KVMA 2WAQG 3GLMA 4YCUA 3S14B 2A19A 2BOSA 4HJAA 3CWBD 3L72G 1CSBA 3EBEA 5LMNW 1UIIA 2KYVA 1SEBD 5APQA 2VUMB 1G51A 2I5LX 1K3RA 4POFA 1SQVE 3AB9A 5GAEC 3MXGA 1HA5A 3EIVA 4PD4H 1RTNA 5IYCG 5FLMH 1N7SC 3K59A 3KYQA 2F0OA 1MGSA 3EN2A 3HD7B 1IBLL 4X64Q 2K14A 2IX7C 1GO3E 5AVZB 3RK3B 4CDCC 1F2LA 3TS2A 1O7YA 2KI7B 2F52A 3D0FA 5KGUA 1RHZB 4Q5VA 1FJPA 4XXEA 2E42A 1RHPA 3EA6A 2POHA 3BATA 4R1JA 4Y52H 1FE6A 1KYOH 5CCHD 1UE7A 2CWAA 1GD2E 3M4YA 1EDLA 1ENFA 3ABVC 2Z9HA 2UUAL 2YU9B 3UIAA 3NPPA 1W2EA 1JE4A 2IY5B 2VQFL 3HKZE 2ZXRA 1HNZQ 1I6HB 3CC2A 5ISRA 3KFUA 1NTMG 3HE5B 3P1HA 1PH3A 3NQTA 4GS3A 1KHIA 2F0SA 1XMQL 3RL0D 1JE5A 4A3CG 3CRKC 4JI5L 3KJOA 5E4XA 1L0WA 4QGUA 4ZUIA 4IPHA 3TN2A 3NBIA 1FJGQ 3VOPA 2HQLA 4DV5Q 4X65L 1LTBC 3U4ZA 4EOTA 2P67A 4NXNL 2NZ2A 3NE5B 4EI2A 1EXJA 4KV6A 2A69C 2YTYA 1BO0A 1OXUA 4D6TE 5LL6X 1X6OA 2QKIC 4UB6E 2CW0C 2HPCB 1S40A 1UAPA 1ESRA 1TY2A 1DOMA 4HSPA 1I6VC 1HVVA 1PRTC 5AW1B 2M00A 5I6YA 1LTAD 5NUCA 1VQOP 3G9RA 3FKIB 1RF1A 1JY3P 1JR0D 2B63G 3S15H 1E2WA 1V1QA 1D2BA 2MP1A 3K8AA 1Y8OB 2K5NA 3RK2D 1EEFD 1NMFA 2K5QA 4ZYSA 2Q5UA 3X3MA 3FWLA 4C3IB 3L75J 2DUDA 4EGVA 2AQ1B 2R92G 1PGJA 1VCIA 2Z5IA 1V1OA 1J5EQ 3BDCA 4ZK9B 1KV4A 1STAA 3H1KJ 4OIKA 2OYIA 1YJNA 3H6PA 4AYBG 1KILE 2FMCA 3K58A 1BSHA 1U4MA 3LW5H 3KDFB 1K83H 2QCPX 5EFWB 4OL7A 1PPJD 1CQFA 4O0AA 1WTPA 4LF8L 2YV5A 4GKJL 3GF7A 1JMBA 3GHGB 3H32B 1AZPA 2E2JH 1L4AC 1BCCJ 2O4XA 1X54A 2BE5D 1SQVK 3USSA 1G8ZD 2KHJA 1C4QA 4H44C 1Q81Q 3A8IE 2RDGA 3T1YL 3PLNA 1B53A 1RTOA 1I94L 5JJKA 2OWOA 3I4NB 5C39A 2WSFJ 3L37A 1B7YB 3PO2G 4QQBX 1KN7A 1B70B 5KLIB 3CCLP 3G48A 3G6EA 1ENCA 4A3FB 2PGDA 1FU1A 4NPFX 3QWOC 1JMCA 2IHFA 2L0CA 3AEEC 1S72A 1G1IA 3IFMA 3I91A 1XMOL 1XYIA 2Y0EA 2B9BA 1YZ6A 2JJQA 1IBMQ 1S5BD 3H1HJ 2CH4A 1XNRL 4OX9L 2F0LA 5AW5B 1DEEG 1VMPA 3L71E 1EY7A 2MJ8A 3I56P 3ZYYX 2E74C 2FYUJ 2EYHA 2CWPA 2NVXB 1HNXQ 5IP7H 1YNXA 4KKTA 3L35A 3GV3A 1Q1EA 3FXEA 1JOCA 5KKZB 5ELEA 4YCVA 1EOVA 2A6ED 3P75A 3RN5A 1SQPG 2WTYA 3DXJC 1SFOH 2JA8H 2K1AA 1PH2A 3RK3E 1T3UA 1KQSO 2JA5B 1OFCX 4IN3A 1GUSA 3U9OA 1AVOA 3S4RA 4IUUA 3SWKA 5CCGA 1H9MA 4UDUC 4PNYA 4A3IB 2UU9L 1WCMH 5KNDA 2RCFA 3H0GB 2K5HA 4A3JH 5BVZA 1T2KD 2FINB 4MZ9A 2SDFA 1K28A 2EZVA 3CXHI 3PV0A 1TWFH 4LF7L 2JA9A 4L73A 1EIHA 3TSIA 3L75D 1SS1A 5H2FH 3S2DB 1LLRD 4EDFA 1L1OA 2MGSA 3RUZA 4YY3Q 4RCNA 3PF5A 1F9RA 2XRQD 4DV2L 3H1KD 1YJ9A 2QJYC 1JMMA 1O7LA 4IALA 2MQHA 2JA7H 3TZDA 3F2BA 1SQQE 4C3HG 3NTNA 4K6DA 3CI9A 2QJPC 1L0LG 1ZMEC 1C48A 2KEDA 3BJUA 4DUYQ 4GOPC 1BCPC 4UP7A 1VQ9A 1Q12A 3Q1MA 2G9DA 1NH4A 2JO1A 3V4QA 1BBUA 3R93A 3VN0A 2A5HA 3HEJA 3HE4A 1M90Q 2K9JB 2BH8A 1PHJA 1BCCD 5K5PA 4G4KA 3FX0A 5TISH 3FRPB 1N32Q 4Z1MH 1HR0Q 1SQXD 2B2UC 1H0TB 3VMYA 2GM4A 5DM63 4R9WA 2IZ0A 1KILC 3UDIA 3M3YB 2R7ZG 1GL2C 1FDOA 2Z6KC 2P58A 3V2RA 1AP0A 1LTTC 1QJOA 1I4GA 4X66Q 1GXDC 4HIOA 4PG3A 1ENAA 1CT1D 2L12A 3RL0B 1XTCD 3X3NA 3NBHA 3KZIE 4A3GG 3UDXA 3H1JD 1LWUC 5L37A 3H1IG 4OH8B 2FYUD 1ZR2A 2I5HA 3CU7A 5BN3A 4DR2L 4H0LC 1LTID 2F0IA 3STBD 3AYHB 3HOZH 4KHXA 3CPWO 2E43A 3AEAC 4WFN3 4P71A 4LF9Q 2JA6H 3J7YW 2NN6G 3CD6P 4HN7A 2KS1B 2XTIA 1S3OA 2FMMA 3PO3H 3V2PA 4B3RL 3PUYA 3UDFA 1HUMA 3RN2A 4LF6L 4P74A 1AFPA 1Y1VH 4WY4D 4LF4Q 2AXTH 3J7AV 1BKBA 3TP6A 3M4OB 1FJGL 2K04A 3AEGC 4DV5L 2X69A 1Y1WB 1VQKA 2WAQE 4IJLA 3OWFA 1AW7A 3RK2B 1PYSB 2J58A 2ZTEA 4HTHA 1STEA 2B2TC 1EY8A 2G9HD 3AE8C 2B87A 2XKMA 4MNOA 1GOZA 3BCCJ 1HGVA 2KLUA 3TNUA 2PO4A 3L70G 1GDTA 4CKCA 2ICEC 3J81i 3RK3C 4AQYL 1U0LA 2PAJA 1JCKB 4BBRB 3I4MH 4YIJA 2OTKE 1JCCA 2QJKB 1ML0D 4OONA 3ZJYC 2WZ7A 3SK5A 4B86A 1NSNS 3BASA 1XPOA 2KSEA 4PJ0E 2VB3X 3QR8A 1SSOA 1WTWA 2F0DA 2KNCB 1NMGA 2WSCH 4FP5D 2E5YA 1IYVA 3WUUA 1P84E 2Q1KA 2M0BA 1KC8Q 3BZKA 2WSEH 3E0EA 3JCUE 4L5TA 5DM73 5LL6S 2XSCA 2JSOA 3RBZA 2ZXXA 4L5RC 3B5ND 3RMHA 5I9OA 4CKEA 1EIGA 1J5EL 4JG2A 2QSIA 2EJMA 3EROA 3VYTA 2RKSA 4DNTB 3NTKA 2PRRA 1MSHA 1KNEA 2I8DA 3N4XA 3VMXA 2ZM6L 1OW8A 4JPZB 4JYAQ 1SLJA 2RF4A 1BE3J 1SQQK 1NTME 1SE3A 3VYSA 4A3CH 1IFNA 4XE5B 2IWHA 1HPCA 2K33A 4IL6H 1VQGA 3T16A 3T97A 4JI1Q 1JOQA 3A3YB 2Q6QA 5CJ0A 4YXWH 2ZVNB 4K0KQ 4DF7A 1QNUA 3WUVA 3SVMA 1G6ZA 1KDCA 2GVBA 1BQQT 5M9OA 5JJLA 2A06D 2ZFCA 3BRTB 3PUWA 1S4ZA 1H9RA 1MKHA 1QOHA 1SE2A 4DAPA 5HURA 4U68A 3I55A 2QA4A 5I6WA 4M1UB 1LTRD 2NZ1D 3PRJA 1IBML 1O78A 1SR3A 5C6AA 1Q7YQ 3H1LD 2R3ZA 3S2HB 2CH4W 4KT0J 2OTLA 3CCJA 2PW5A 3TK1A 1GHJA 1YBKA 2R3CA 2OQQA 1TWAH 3G7LA 4PMBA 3J81L 2IBZG 4RJTA 1NNXA 2PCFB 2A68C 4CJ1B 5C44B 1QUQA 1T3JA 1S5ED 1AA0A 1VQ7P 1IFPA 1T9HA 5IGEA 3AE4C 1YI2P 1NTZJ 3MWYW 1YBYA 3K0YA 1CI6A 1EQRA 1HZCA 1L0NJ 2KJXA 1RKNA 3J80c 3BCCD 5KLVJ 2YTVA 1M1JA 2J5UA 4IFDK 1X3EA 3T56B 3H25A 3KBXA 4PD4D 4DR3L 3IFDA 3GHGC 3A8JE 1RY3A 2BDOA 4IPGA 1HR0W 4XYOA 1KB9E 3HG9A 2W90A 4ZQ3A 1VQCA 1VQJA 2KBNA 3CXHH 3HS0C 5KLIC 3VTPC 4A3DG 3LW5J 4LGDE 4A3EH 3GTOB 5M5XB 3P8CE 3AFQA 4I7ZB 5IYDH 1IK7A 2EY6A 4EX5A 4Y7NB 5K5GB 1JO5A 2F0UA 4LFCQ 5C4XG 3K5MA 5HGTA 3W3AA 4BY7H 4JVZA 5DNFA 4DK1A 5AW7B 2GVAA 2LMCB 3HKSA 1JY2P 1NAPA 1KYOD 2ID0A 1N8RQ 2FHTA 4V190 2B8GA 4BWGB 3PIOA 5E79E 5AW4B 1MFTA 4EQ5A 1OTCA 1N9WA 2FFDA 4GKGA 3A54A 1BE3D 1SN8A 1T5EA 1SXTA 5C4HA 4A93G 5GTIH 3HFZB 4JYCA 4HR7B 3N52A 1LTJA 5IGFA 4C3JH 1KIXA 4ZNCA 2EPBA 4RESB 1JC7A 1JJ2A 2XRSD 1URQC 1RQVA 3HUSB 3AE3C 1XWEA 3S1RH 1N32L 3M0AA 5AW2B 5LMUQ 5DEHA 1PRTF 1QILA 3HKZG 3K5OA 3CCEP 2F0FA 2P2UA 3S9OA 1VQFA 4DXGA 4JI7Q 3GTLH 4X66L 4B3SQ 1PPJE 4FYDA 1D1IA 5FK9C 1NTMK 2AEFA 1H9SA 4KMUC 2YMKA 1HGZA 4WY4B 2UXDQ 5FO7B 2KIKA 5K36G 1HH0A 4X3SA 3HOYB 1NR4A 1MV8A 1K9MQ 1FS0E 2O2LD 3J81E 5KNCA 1I4PA 2F0JA 1SROA 1NTZD 2AKWB 3T51B 2XNXA 4D6TG 1SQBG 4APVA 3G4SP 1L0ND 1Q1BA 1GUTA 4LF9L 5KLVD 3E6ZX 3L3OC 1HQRD 5IYBG 1SFCD 1O7ZA 1HNWQ 1X22A 1VQOA 2VXWA 2PPBC 2CCZA 2RKLA 1J6QA 1K8OA 2XV5A 3AEVA 4A3LH 2WVRA 2B39A 2ZJQA 5J3BA 4LFAQ 4XA4A 1N73A 1W6KA 1S9KD 5CCHC 3WU2E 2E5LQ 1Z56A 3RR5A 1NKNA 2FY8A 2LXJA 3D6CA 1EYCA 2B2YC 1M56D 3CLQA 1B4OA 4BXXG 3NUCA 4BBSB 4C7NA 3R8BA 1RE3C 1HTPA 1PRTB 4A3KH 2WITA 3AE2C 3M9QA 4DV1Q 1Q2NA 1LP1B 2GA1A 2I46A 3C1LA 5M3MB 2ITAA 3B5NB 3HTKA 3RL0C 3PF4A 5KAIH 2DJFC 2NBFA 2EYLA 3QJYA 1H8AA 5FJ8G 3TMEA 1XNQQ 1D6EC 2L15A 1NYHA 1QEXA 3HOWB 1VQBA 3HD7A 1HJBA 2HIVA 4A3MH 3T1HQ 1AFOA 4R4CA 4DR7Q 4QIWB 3HOXH 3TQYA 4I65A 2N55A 2C0WA 3L36A 1FJKA 5CBAE 2IZ1A 4JBJA 4OWFA 4GT1A 1B3AA 5G3LD 4FF1A 1GUNA 1VQMP 2SPZA 1VF7A 3BYTB 4JBWA 2XZRA 5BN4A 3NP8A 3RNUA 2SNMA 3CCLA 3HOVG 4Y99C 5GADC 2F0PA 4BWNA 1GUGA 2HFED 4ILWA 1LTAC 2L5GB 3NHHA 3H1KE 1HRJA 1X55A 4B9XA 2Y0SB 1B9MA 3OMCA 1S5CD 3HE5A 3RK2C 1Q90D 3OW7A 1FZCA 1D5MC 1EWHA 5L8RJ 1A8VA 2VUMG 3I56A 4BY1H 4PZ6A 4HCSA 3L71G 4HIMA 5EPJA 1I4XA 3VMZA 1YITP 2K4KA 4EIJA 2KCMA 2Q8IB 2BH2A 4JI1L 2BCCJ 2QJKC 1CKMA 1WD1A 2V4DA 2R93H 5IE8A 1Q81C 5BR8L 1FGUA 4K14A 1AVYA 1RF1C 4G57A 2EVBA 3AFPA 3CP0A 4OHJA 1CSQA 1SYCA 1Z47A 1VQ8P 5IGDA 1WTRA 1T5XD 2WB1B 2I07B 5KJ7D 3Q8DA 3NK9A 3H1HE 3MTSA 1GJXA 3A55A 4ABNA 5CC4A 3BRVB 4HKZH 5GTHE 2BE5C 1CW5A 1RDPD 3BVZA 2FYUE 5AVVB 2PZUA 4KTAA 5GROA 3M91A 1ET9A 4LMQD 2WSCJ 1EEID 4X62Q 4ZUJA 1LM0A 3J7A5 3CX5I 3EFGA 2Q9IA 1ICWA 2JEBI 2K32A 5M3FH 2WSEJ 2NVTH 4HAEA 2I1KA 2K9YA 1Q46A 3VR4A 1HZAA 4LW1A 5CMDA 4DFAA 2W6JH 4M8AA 5BU8B 1P16A 3NXSA 1SQQG
chains in the Genus database with same CATH topology
3M9BA 4YHHQ 3F1ZA 5AW6B 1L0LK 2AWNA 2EQSA 1FDMA 1ASYA 4HH2A 3B8EB 3FKIG 4OO1G 2AMCB 2KSJA 5KTBA 1T2KC 2UUBL 5IP9H 1EQ7A 3OTOQ 4AH6A 3A2AA 4IPDA 1V43A 1FZEA 2MFIA 3PIPA 2PQAA 4LC1A 4DR6Q 1M90C 1GL2B 3J7ZC 5LMUL 4IFDG 3CD6A 3W1GA 3I5CA 4UY8C 4A75A 3HRNA 4JI2Q 1SFCB 1JY2N 1GK4A 2UUCL 2IFNA 1KL9A 4JV5Q 2JQOA 2KCTA 2ZTDA 2A45I 3NMDA 2W6BA 2FKWB 1L1OC 1RIPA 4LFBL 2Z4EA 3WMM0 1FOSF 4DR5L 4R4IA 4A3FG 2NPSD 5APUA 3P32A 2Y0SE 5C4XH 5GQOA 1WT6A 1XTCC 1HNWL 3J80i 4KHZA 1X9VA 3KF6A 4LFAL 3HUSC 2HT1A 1LTIC 4WJ3M 3STBC 4DR4L 3SWFA 1D7QA 1CUKA 1J2JB 1TWCH 3K7AH 2JA5G 2O1KA 2WB1E 1R9TH 4JOIC 4JI0Q 5AW9B 2VY3A 3S1QH 1PH6A 4WY4C 1AE2A 1GD7A 1FZAA 3H0GG 3TREA 2CQOA 5LMNL 1NAFA 4R4TA 3GTGH 1AH9A 1G2CA 3VP9A 4YWMA 3V2NA 4KI0A 1KC8C 3OAKA 3H3VI 2C9NY 2OYHA 1H88A 2LKMA 2D62A 1TWGH 1P8LA 1HUCA 4HJ5A 1IFIA 5M5WH 4A3BH 1W2BA 5C3EG 3B5NC 2FXMA 1VQ7A 1YI2A 1WYDA 2NZOA 4XIGS 1VDFA 5CHXA 2BASA 2ZTCA 2NVQH 3OJAB 3L0OA 3ICEA 3S17H 5APYA 3MUDA 4LF5L 1Q7YC 2E2IH 3M0DA 1WOCA 1LT9A 2E2HH 4BA1I 3F2DA 1U5KA 3V5BA 2UXCQ 1EFWA 2WT7A 3G3ZA 2LSSA 4DUZQ 4JI3L 1RL2A 4IPCA 3PP5A 2CPSA 1PYBA 2I5MX 2LXKA 1Y1WG 3JAMc 1S9KE 1RF0A 2ATWA 1GKHA 4C46A 3GD7A 2H7HA 1RE4A 2I0QA 4BBRG 5IWAL 4B3TQ 4N3YB 1UE1A 2HODB 3GTPH 4RG1A 3CCEA 2AHOB 1UE5A 2PI2E 1N8RC 4JC0A 3KPEA 2C9LY 1URQB 4B3ML 4DV7L 1NY4A 2Q2IA 1FAVA 1ZV8A 2JE6I 4DAMA 4GLXA 4DV0L 4HYTB 5AVYB 3G4SA 1AE3A 1E24A 2UXBQ 1X3FA 3OW2A 3M4QA 3HOUG 1SQBK 1QVGA 2R7DA 1N86A 1FOSE 1N7LA 5CCGD 2A45H 1H89A 3RZOH 2E8GA 1K9MC 1QZGA 1XPRA 1MUUA 3S16H 3KJPA 2R5BA 2P7JA 2V1CC 4P73A 4N78D 1DGSA 2O01H 5C0XG 4UP8A 5AVRB 4X64L 5C44G 1VQMA 3PUVA 2KLVA 1ZN5A 1J1DB 1N7SA 1PH4A 1DX7A 1UE6A 1SFCC 1SRUA 1PH5A 5KLVK 5AJ3Q 3K80C 1LYLA 3U1AA 1CKNA 1HNZL 4DV4Q 2Q2TA 2K5VA 3KDPB 1A02J 1YITA 4ZKPA 4Y99B 5HY6A 2CPBA 3H3VH 5H1SE 2IX1A 1VQAA 2XDJA 1YHBA 4GNXC 2VW9A 1VQ8A 1GW3A 1N73C 2AWOA 4DOJA 5IYCH 3F8TA 1HJPA 1OXZA 1QVFA 4WBAA 2VS1A 3D31A 5AVTB 1RF1B 3KOJA 5C0XI 2ZJPA 3R2PA 1SLQA 5JEAJ 4HJ8A 2VQEQ 3MD0A 1LGHB 1WI5A 2K50A 2OYIB 2R6GA 1NHLA 2OTJA 1NE3A 1VQDA 2NN6I 3I2ZA 1JY3N 2Q3IA 4NXMQ 1PFIA 3A0JA 1FZCC 5KJ7C 4O9BA 2H8PD 3BU2A 1JT8A 2OQ0A 2K52A 2MO1A 1KQLA 1EIYB 1CKOA 1L4AA 2N9BA 1DH3A 3V4WA 3L2PA 4KLKA 4BBSG 2HIXA 2BA1A 1N34Q 5C3EH 2B63H 5M3MG 1QZHA 5M5YH 5E7NA 1N36Q 1HNXL 5BU5A 3HOWG 5AVSB 1A63A 2HHHQ 2P1JA 2R92H 4OWXB 4JI4Q 1K73C 4JI8Q 5IY0A 1JY3O 1V9PA 2Y0SG 3CMAA 2UXBL 2OCEA 4P72A 2Z0SA 4YY3L 2KOGA 2NVYH 3PO2H 1L1OB 1I3QH 3E1IA 4AQRD 2H5XA 4DV6Q 5DLQE 4UP9A 1TWHH 4DUYL 3TS0A 1JTHA 1QL1A 3KLWA 2WB1G 3HE4B 2KP8A 2W6AA 1HR0L 3TRZA 5FLMG 1PH1A 4GOPA 1GU4A 1IZ6A 1SE8A 1C7YA 2NPSC 3JAMi 3NBHB 1KILA 2YYZA 2NZHA 4IFMA 1GL2A 3CCSA 2Z6KA 3IRBA 4IOCA 3NENA 1X56A 4DKAC 3HOUH 4DV4L 1LWUA 4O2DA 3N7NA 1PA6A 1KFMA 4LF4L 3M7NA 2N49A 2N1TA 1K0RA 4C3HH 3KQGA 1AQ5A 1A02F 4DV3Q 5APTA 2MJZA 1VQPA 4YCWA 3TNUB 3GTMH 1J1DC 4M3LA 2F4VQ 2PI2A 4DR1Q 2R7ZH 3W5OA 1IBLQ 2N1TD 2DGYA 3UDGA 4A3GH 3U58A 3M9HA 2EXDA 1FVIA 2IHEA 5CMZA 2UUAQ 4YWKA 3HD7D 4MTNA 4LUVA 1H95A 1OXXK 1NU1K 4JYAL 2OYHC 1A62A 3NFQA 4WB4A 4JI5Q 5AVUB 1I5FA 4NXML 3MTUE 3PGZA 4A4IA 4K0KL 4N78E 4I1LA 4NXNQ 3VYIA 3KYHC 3A5UA 2Q2HA 4AUWA 2HPCA 2ASBA 1OXSC 3W1BA 3F2CA 1VQNA 1PV4A 1MFZA 1N36L 3BVHA 5IP7G 2OYIC 1QUQB 1E5WA 2HHHL 1CI6B 2IX0A 2HLOA 1Q86C 2JA8G 2C0XA 1M1JB 1VQ4A 1L2FA 5FLXc 3J81j 3RLOA 2YTXA 3CF5A 2A1AA 3TEHB 1WCMG 3KDFA 3VDYA 4A3JG 5IT9c 2KENA 4LF8Q 4GKJQ 3GHGA 3H32A 3ER0A 2K75A 3E9IA 4LFCL 3T1YQ 1I94Q 4A76A 4JI6Q 1VQ5A 3CL3D 2JA7G 1NO4A 4QJFA 1XMOQ 4KHPQ 3CMEA 2FFDB 1BBWA 4OX9Q 1IC2A 3S1NH 1OWAA 2WWWA 4HIDA 4OWTB 1LTJB 5CCGC 2Q7CA 2Z5HA 4C7RA 4J15A 1SVFA 4QIWE 4JYBA 4JI7L 1NTKK 1MJEA 4B3SL 1URQA 1GU5A 1KZUB 1NKZB 5APXA 2UXDL 2UU9Q 3I4NG 4A3DH 1NOHA 2YKPA 1SQXK 3HOZG 4LF7Q 3MEFA 2M8RA 2J59M 4DZOA 1KD1C 4DV2Q 3PO3G 2RCNA 2F3IA 1Y1VG 2PNHA 4GNXB 4OO1I 1N73B 2E5LL 4A93H 1JNMA 2FYUK 4R4QA 4UPAA 1C9OA 3I7FA 4DV3L 5C4JH 4C7NB 3UE1A 3A5TA 4DV1L 1YIJA 3I4MG 5CCHA 3HTKB 3AQQA 4A3IG 2F4VL 1XNQL 4DR1L 4IFDI 1JY2O 1RE3A 3T1HL 1YVCA 4DR7L 2MNAA 1X3GA 3GTQH 1XTGB 2WPRA 3CQZH 4DR2Q 3WWVA 5APSA 4JF7A 5EAYA 2YMYA 1PH7A 4JBMA 5IYBH 3P8MC 1PH8A 1KRTA 1FZCB 4JCVE 4B3RQ 4LF6Q 1SP4A 2RHSB 1VQHA 5APWA 2WFWA 1YTZT 1E1OA 2OARA 3IR9A 3C9IA 2JEEA 4BXXH 3P8CD 3GTKH 1Z9FA 1YEZA 3CCMA 4AQYQ 4C2MH 2QGQA 5FJ8H 3S1MH 4HJ9A 1XTDA 5C0XJ 2WP8J 4JBKA 4R4OA 4X62L 3CC4A 3ULJA 3HOVH 1A0IA 1E22A 4DNIA 1O7IA 1FBMA 1I50H 4RMFA 3RZDH 3S14H 2ZM6Q 3L7ZC 4YHHL 2VUMH 4A3EG 2WPSA 1IFJA 2QEXA 5IYDG 4L5SA 1FZGA 2VL6A 1QL2A 1HH2P 4JI6L 4BY7G 5AVQB 4IO9A 3TYYA 4KHPL 1T8ZA 2VRSA 2B3GA 3OTOL 1VQLA 1C0AA 1M1JC 2YKQA 2PQAB 4POGA 4DR6L 1HTLC 1YJWA 2YU9H 3CCRA 1JJCB 4ALPA 3SWYA 2NPSB 1I6HH 4LUZA 4GKKQ 1K8GA 4JI2L 2IFMA 4DR3Q 1OXVA 4JV5L 4GLAC 1VS0A 3A74A 1JB7A 1LTLA 3CAMA 3MXNB 2O1JA 1ZR4A 2FFDC 5JJIA 1IFDA 2KHIA 1ZLLA 3FKIH 1LTJC 3KF6B 4A3LG 1IO4A 4HIKA 2ES2A 2FXQA 2JJLA 1GW4A 1E7ZA 1JCDA 1EQQA 1YTZI 4C3IH 2CKZB 1NTZK 4A3KG 3E9HA 1L0NK 3HUSA 4JI0L 4GN4B 4IOAA 5AVWB 4OXPA 4OWWB 1DEBA 2H43A 4A3MG 1WFQA 3HOXG 1MIUA 4JOIA 2PP6A 1G2CB 1N7SD 4WY4A 1Q8KA 1FZBA 1N33Q 3I4NH 2R32A 3P7KA 1KXLA 4A3FH 1G291 2OYHB 1KQSA 1NTGA 2GUVA 3CXCA 2N1TC 2D0PA 3K81C 4TQUS 3M4PA 5HGQA 4BY1G 1EYGA 2NVXH 2IPPA 1BVSA 2R7FA 2R93G 2OQKA 2M3BA 3HD7C 2D0OA 4DAYB 2JA5H 3BZCA 1WRGA 1KFNA 3B5NA 4PZ7A 4AYCA 4A3IH 4QY7A 5AW3B 3H0GH 3HOYG 1UWVA 1LT9B 1EUJA 2UXCL 3S2DH 2WT7B 1PVOA 1YYCA 1QVCA 5M3FG 4GIFA 1X8YA 4DUZL 1W3SA 2FYZA 2YKOA 2VZAA 2YO2A 1LUZA 5AW0B 4X6AH 3GTJH 3CCQA 4ME3A 1EWIA 3DLLA 1IBKQ 2ALYB 1N2DC 1Y14B 3ULPA 1HWTC 3CPWA 4B3TL 3L4FA 3M3YH 1IFMA 5BR8Q 2C35B 3U59A 4DPGA 1MJCA 1IK9A 3PUXA 1L4AD 2JK8A 5IP9G 3RLFA 5GAGC 3CC7A 3OYYA 1YHQA 1M1KC 1ASZA 3A5ZB 2I1JA 1IXRA 1J1EB 4GKKL 3KF8B 3M06A 2HYNA 1YHAA 3M4OH 4DK3C 4GN5A 1Y1WH 4AYBE 1JUNA 2ZXEB 4L5QA 3FHWA 3M85A 2YNYA 2EIFA 4BBRH 3CCVA 4QL5A 2N78A 2N3SA 1VQ6A 2ZJRA 1HZBA 1UEBA 3LIEA 2UUBQ 3II6A 1X79B 5JEAG 1N7SB 2B29A 5GAHC 1NWQA 4AIMA 3LIDA 3B6YA 5AJ3L 4ZKUA 3UE0A 3I4OA 1CSPA 1CKNB 2GUSA 1SFCA 1CZQA 2UUCQ 1X9NA 2A8VA 1FL0A 3NEMA 2JEAI 2GN5A 1D8LA 1N33L 1KILD 3CPFA 1LTSC 4LFBQ 1GL2D 4DR5Q 1K8AC 1FZFA 4N6JA 4WJ4A 1JJGA 1E1TA 3S2HH 2N8NA 3EQ2A 3VP8A 4A3BG 4GNXA 2CFMA 5C44H 2WPQA 3MIWA 4GN3B 4DK6C 4DR4Q 2PMZE 4HJ7A 2VQEL 3H15A 1KRSA 3PSIA 4BA2I 3PCOB 3U1CA 2IT1A 4IFDJ 2VQFQ 3GTOH 5M5XH 5LMNQ 1KAWA 1GK6A 3PUZA 4LNQA 4I6MC 3MGNA 3RK3D 1XMQQ 4Y7NH 4LWCA 2HG5D 5CJ4A 3GDEA 1MZ9A 1M7LA 4X65Q 1WJJA 5ELOA 2WSFH 5AW8B 1IYJB 4FDBA 4TVAB 3OA7A 5KJ7A 1OXTA 1L4AB 3A7OA 1IBKL 3O8ZA 1TXYA 1N34L 1NBWA 1PFSA 1GM5A 3RLNA 1GTWA 4IJHA 4NB3A 3K7UC 3M0DC 2XU6A 5ELNA 1LT9C 3GO5A 4XTCS 2KB7P 1PH9A 4JI4L 2VNUD 1SQPK 1G1JA 4JI8L 4LF5Q 4GLVB 3HOYH 1GZLA 1SMXA 4NPSA 3ULLA 2RHQB 1Q82C 2XGTA 2Q2UA 1X65A 1NJIC 5APVA 1G6PA 3NELA 1RF0C 4W80A 4JI3Q 3U4VA 2YO3A 3V2QA 2QM7A 1RE4C 4P75A 2A45G 4H02A 4W7ZA 4DV6L 4BBSH 1XNRQ 2W27A 1JTHB 1VQEA 4PMWA 3S24A 5M3MH 3U50C 5IWAQ 1XJVA 2HODA 2R5DA 4LLHA 1LTGC 1VQIA 3HOWH 1EIFA 4LUOA 4GOPB 1IL2A 4W7YA 3G71A 4YWLA 3K0XA 3JC66 1J1EC 1E3PA 3LGJA 1HBWA 3DM3A 3CW2C 3SGIA 4B3MQ 4DV7Q 2BA0A 1KILB 1XPUA 3FP9A 4PZ8A 4DV0Q 3ERSX 2NPSA 1HZ9A 3J81c 2QM8A 1GVPA 2JA6G 1VPCA 3CCUA 1LWUB 1URQD 4I2LC 1B8AA 5AVXB 1IJDB 4IFFA 2MO0A 2N1TB 2WAQG 4YCUA 2A19A 4HJAA 1CSBA 3EBEA 5LMNW 2KYVA 5APQA 1G51A 2I5LX 1K3RA 4POFA 5GAEC 3EIVA 5IYCG 5FLMH 1N7SC 3KYQA 3EN2A 3HD7B 1IBLL 4X64Q 2K14A 2IX7C 1GO3E 5AVZB 3RK3B 3TS2A 2F52A 3D0FA 1FJPA 2E42A 2POHA 3BATA 4R1JA 4Y52H 5CCHD 1UE7A 2CWAA 1GD2E 2UUAL 3UIAA 1W2EA 2IY5B 2VQFL 3HKZE 1HNZQ 3CC2A 3KFUA 3HE5B 1PH3A 4GS3A 1KHIA 1XMQL 3RL0D 1JE5A 4A3CG 4JI5L 3KJOA 1L0WA 4QGUA 4IPHA 1FJGQ 3VOPA 2HQLA 4DV5Q 4X65L 1LTBC 3U4ZA 4EOTA 2P67A 4NXNL 2YTYA 1OXUA 1X6OA 2HPCB 1S40A 1HVVA 5AW1B 1RF1A 1JY3P 2B63G 3S15H 1V1QA 3K8AA 2K5NA 3RK2D 1NMFA 2Q5UA 2DUDA 2R92G 1VCIA 2Z5IA 1J5EQ 2OYIA 1YJNA 3H6PA 4AYBG 3LW5H 3KDFB 1K83H 4O0AA 4LF8L 2YV5A 4GKJL 3GHGB 3H32B