3M9BA

Crystal structure of the amino terminal coiled coil domain and the inter domain of the mycobacterium tuberculosis proteasomal atpase mpa
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
186
structure length
186
Chain Sequence
SARDIHQLEARIDSLAARNSKLMETLKEARQQLLALREEVDRLGQPPSGYGVLLATHDDDTVDVFTSGRKMRLTCSPNIDAASLKKGQTVRLNEALTVVEAGTFEAVGEISTLREILADGHRALVVGHADEERVVWLADPLIAEDLPDGLPEALNDDTRPRKLRPGDSLLVDTKAGYAFERIPLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Proteasome-associated ATPase
publication title Binding-induced folding of prokaryotic ubiquitin-like protein on the Mycobacterium proteasomal ATPase targets substrates for degradation.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 31
structure length 186
sequence length 186
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16450 Prot_ATP_ID_OB Proteasomal ATPase OB C-terminal domain
A PF17758 Prot_ATP_OB_N Proteasomal ATPase OB N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3m9bA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m9bA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m9bA02
1PH8A 1MJCA 4A3JH 5AW8B 3CCRA 2XZRA 4HIKA 2WT7B 2VQFQ 3K81C 2XTIA 1X9NA 4YCUA 1E7ZA 2YYZA 1Q46A 4B3SL 2ZM6Q 4HJ7A 4OONA 1PV4A 3K0XA 1Y1VG 3CW2C 4B3TL 2R93G 2HHHQ 1B8AA 3CCLA 4A76A 1XNQL 2K50A 2HIVA 2R7ZG 1U5KA 1QZGA 4JI1L 1Z9FA 3D31A 2NVYH 3GDEA 2IX1A 5FLXc 1K8GA 2R7DA 2KENA 4A3BH 3KQGA 3F2DA 3W1BA 2R6GA 2ZTDA 4DR3Q 1UE7A 4UP9A 4LF7Q 4P75A 1PH3A 1S72A 1GU4A 4A3EH 2E8GA 2I5HA 1G51A 1P8LA 1XNRQ 1NJIC 2KCMA 1UEBA 5DLQE 3S2HH 3UDFA 3CMEA 3AEVA 3PUYA 3A7OA 3GTLH 1T2KC 5C44G 2N3SA 2WTYA 3IRBA 2I5MX 1T9HA 2GVBA 2VS1A 1TXYA 1CZQA 2W6AA 4BXXH 4GN5A 1UE5A 1YVCA 3T1HQ 3H15A 1Y1WG 3BJUA 2Z0SA 2IT1A 4WJ4A 4KI0A 5ELOA 3M0AA 5AVVB 2UUBQ 4YCVA 1OXZA 4X62L 2C9NY 4DR6L 2MFIA 3U4VA 1IZ6A 4R1JA 5C0XI 4AIMA 5FJ8G 1Q1BA 1VQJA 4JBJA 3I7FA 4YWKA 2JA5H 1TWAH 4LC1A 2VY3A 4JI8L 4A3MH 1VQ6A 1Q82C 1VQBA 3OTOL 2K52A 3K7UC 5AVRB 3UDGA 5AVXB 2VQEL 4LFAL 2LSSA 4XIGS 1PH4A 3Q8DA 2XV5A 3HOXH 2D0OA 3PSIA 4LF6Q 1JE5A 1J5EQ 1OXXK 1DH3A 2RCNA 1GU5A 1A8VA 2VZAA 4R4CA 4LF5L 5C3EH 1A02J 3ULJA 5C4XG 2VRSA 1XTDA 1EQRA 5AVQB 3TEHB 4DUYQ 4K0KQ 3M85A 2VNUD 1JT8A 4KHXA 2Q2IA 3HOUG 1VQ5A 4X65Q 1EIYB 1X3EA 3T1YL 1QVGA 1S40A 4PG3A 3KJOA 3GO5A 1HNZQ 1MIUA 3U4ZA 4I2LC 5AW0B 3RNUA 4R4OA 3JAMi 3WWVA 5IWAQ 2UU9Q 1AH9A 2N49A 4LF7L 2ALYB 2AKWB 4JI0Q 3CCJA 4L5RC 4AYBG 3NENA 3HTKA 4A3JG 2JQOA 2D62A 4PZ7A 1KQSA 1PH2A 3S1RH 1K9MC 3GTJH 1N8RC 5LMUL 2VUMH 2B3GA 1QVFA 2JEAI 1IO4A 4AYCA 4BBRG 1XPRA 3KFUA 4EOTA 3PGZA 3ULPA 5HY6A 2PMZE 4AYBE 4POGA 5J3BA 1PHJA 3HFZB 1SP4A 3BU2A 4BA1I 2ASBA 1EUJA 3KJPA 3BZKA 5JJKA 4DR7Q 1GKHA 3I4NH 2K75A 2UXCL 2AWOA 1X3FA 2UUBL 2WT7A 3PUXA 1VQLA 3PO3H 2WWWA 1S3OA 1X6OA 2E5LL 5EAYA 3VMZA 3SWFA 1YZ6A 3M3YH 2BASA 4A3BG 4BA2I 4LF4L 2QM7A 3M06A 1OWAA 3U50C 1SR3A 1WI5A 2UXBQ 3L37A 2H5XA 3RN5A 3I2ZA 3FKIG 4QL5A 1CKMA 3DLLA 3MEFA 3M0DA 2WPSA 2E2IH 2OQ0A 1YJNA 1MV8A 1NE3A 4X64Q 3GTPH 3S17H 1BBUA 4DV4L 2IPPA 1BBWA 3TYYA 1OXTA 4NXMQ 1X3GA 1Z47A 1OTCA 1NBWA 2CFMA 1WYDA 1B7YB 1N33L 3F1ZA 4BXXG 2JA7H 4LFCL 2HT1A 4X65L 4IFDG 4JI3Q 1RIPA 1VQGA 1ASYA 5M5XH 1HNXL 3EN2A 3CXCA 3PF5A 4GKKQ 2LXJA 4JYAL 2PI2E 4DR5Q 1FOSF 1KRTA 1DGSA 4IFDI 1H95A 1QVCA 1K0RA 5IYDH 4A3MG 2R5DA 3W1GA 4C2MH 4A93H 1L0WA 2F4VQ 2JA8G 4A3LG 2KP8A 1K73C 5APXA 3I4OA 2Q2TA 5AVUB 4NXNL 2W27A 1IBLQ 3HOYG 1YEZA 2GN5A 1VQEA 3HOXG 2L15A 5BR8L 3NEMA 2NVQH 1LTLA 3GTGH 3D0FA 2K14A 4A3FH 5C3EG 1VQ9A 2K5VA 4UP8A 2A8VA 3RLNA 4GS3A 1UE6A 1D7QA 4HJ8A 1CI6A 4DV1Q 3S1QH 4UP7A 3K80C 2Q7CA 1NAFA 3S2DH 1IXRA 3G48A 2Q3IA 4LF8Q 2MO1A 4MZ9A 2XGTA 2E42A 5AVSB 5GAEC 4EQ5A 4IJHA 1YIJA 5AVWB 2NVXH 4ME3A 2PQAB 4GKGA 2UXBL 1G2CB 2YV5A 4BY1H 4IPDA 4DV6L 3P32A 1EIFA 3AFQA 4X6AH 3V4WA 4M3LA 5M3FH 5AW5B 4HYTB 2JK8A 1FL0A 4B3RQ 4OX9L 4R4IA 3VN0A 4DV2Q 3STBC 4DR1Q 1HZAA 4MTNA 1X8YA 2R92G 3EIVA 1NTGA 4JI6Q 2VUMG 5H1SE 3GTMH 1SROA 1Q1EA 1TWFH 4A3DH 2UXDQ 2HIXA 4C7NB 3CMAA 1XMQL 4P72A 4RG1A 3A3YB 1AE2A 5M5WH 3EBEA 2OQKA 4A3CH 4B3ML 2ID0A 1A02F 4WJ3M 1YBYA 4YY3Q 4JI3L 1SE8A 3A0JA 4GKJL 1VQNA 2RF4A 1N36L 1KD1C 4DV7Q 2ZTCA 3KOJA 2WPRA 3PO3G 1HNWQ 2OTJA 2CWAA 4DV3Q 4P73A 1GK6A 2JJLA 4A3KG 1HJPA 3E9HA 1HZCA 3MD0A 5K36G 1C0AA 2ZFCA 4X66L 4P74A 4BY7H 2WP8J 2MQHA 2RHQB 4O0AA 1I6HH 5AJ3L 2ZJQA 2LXKA 1IBLL 2YTYA 1XMOL 1PVOA 2KCTA 3PUVA 3I4MG 5JEAG 1Q81C 1CUKA 1OXSC 2C35B 1R9TH 1B70B 4YCWA 1CKNB 3CCQA 3VDYA 1QUQB 1IBMQ 1FJGQ 3CP0A 4DR4L 1HR0L 3FHWA 1C9OA 2XU6A 3U58A 4IOCA 4JV5L 3S1MH 5C0XG 5AW6B 1I94L 4GN3B 2UUCQ 4DUZQ 3J80c 4C3IH 3HOZG 2WAQG 4JI7L 4DR2Q 4RESB 1NWQA 2IHEA 1WJJA 1WCMG 3A5TA 3M9BA 1BKBA 2K4KA 5LMNL 2P7JA 2OCEA 3L36A 3RN2A 3STBD 4QJFA 4DPGA 3AFPA 3CCUA 5IYCH 5IYBH 5M3MG 2R7FA 2WAQE 2ZJRA 3HOWH 3RLOA 4KHPQ 1CKOA 1EWIA 5IYDG 2IHFA 3HE5B 3CC2A 4JI2Q 2VQFL 4GOPB 3IR9A 3CCSA 2QA4A 1AE3A 1P16A 1CSPA 2EQSA 3KDFB 3H0GH 3CAMA 2ZM6L 2RHSB 5IP7H 3CCVA 4GNXB 1A63A 3HE4B 4LUZA 1I3QH 2A19A 4A75A 3L2PA 2HHHL 1EFWA 3B6YA 4I6MC 4LF9Q 4JI4Q 1GTWA 1EOVA 2YO2A 1QZHA 3M91A 2NN6G 2PNHA 1YI2A 1E24A 2N8NA 2Y0SG 2NN6I 4XE5B 4TQUS 1JMCA 2Q5UA 1N34Q 1UE1A 4DR3L 4DAMA 1E1OA 1N32Q 4KLKA 2BA1A 3TRZA 3A5ZB 1GK4A 2Y0SE 1XNRL 2NZHA 3NMDA 4C3JH 3KF6B 1KHIA 3A74A 2K5HA 1Q7YC 3DM3A 3LIDA 3TS0A 3L0OA 3RR5A 5M3FG 1EQQA 1UWVA 2WPQA 1G6PA 5CMZA 1VQIA 3JC66 1A62A 3PUWA 3UE0A 4JOIA 4QIWE 2MNAA 2R93H 3TREA 4AQYQ 3J81j 1A0IA 2Z6KA 3ER0A 2Z5IA 3TK1A 3OYYA 1YNXA 3V4QA 1E22A 3PF4A 3T1HL 3T97A 3KF8B 3UDXA 2PQAA 1MJEA 1IBKQ 2C9LY 4DV5Q 5GAHC 3CD6A 1HWTC 4A3CG 2P67A 4A3GH 3G4SA 3PIOA 3P8MC 1JJ2A 1KRSA 1SFOH 3MGNA 5IE8A 5APQA 4YHHQ 4OXPA 2QM8A 4DV0Q 2B29A 4A3EG 1FOSE 4LFBQ 2E43A 3J81c 1IL2A 4TVAB 2UUAQ 4C7NA 4BY7G 5JJIA 4R4TA 1WFQA 1L1OB 4LF6L 1KAWA 3GD7A 3UDIA 2ES2A 1Q86C 1LM0A 1YITA 1J5EL 4P71A 5JEAJ 4B3SQ 2JA9A 3PV0A 3CCEA 4JBMA 2EIFA 1YJWA 1ASZA 4B3TQ 1HJBA 5GADC 5C0XJ 4GLAC 4DAYB 4DUYL 4K0KL 4Y52H 4LF9L 3PO2H 1CSQA 1VQHA 4KHZA 2DGYA 2CWPA 1XNQQ 1KL9A 4JI1Q 3KLWA 4A3IH 2NVTH 1HNZL 1W2BA 3LGJA 2JA5G 1JB7A 3JAMc 5IWAL 2UU9L 3PIPA 5IYBG 1L2FA 4JI0L 2ZTEA 1N32L 1CKNA 1Y14B 1QUQA 3J7A5 2Q2UA 3G71A 3S16H 3GTOH 4POFA 1VQOA 1V43A 3TS2A 2WFWA 3CPWA 1V1QA 4EX5A 2JEBI 3FP9A 2F52A 1HZBA 3H0GG 1E1TA 1K83H 5IP7G 1VQMA 2QGQA 4PZ8A 5APYA 5IP9H 4IPHA 1GZLA 4GN4B 4B86A 3MXNB 1SLJA 2AWNA 1WOCA 2Z5HA 2ZXEB 4R4QA 4DR7L 4IPGA 1Q8KA 4JCVE 3HE5A 4GOPA 2JA6H 2KHIA 4X62Q 1SMXA 3L35A 4DR6Q 2HQLA 3KDFA 4GNXA 2H7HA 3GTKH 5AW3B 3ERSX 3HE4A 1VQPA 2KHJA 2Q2HA 3V5BA 4JI8Q 2I0QA 1M90C 1W3SA 1H88A 4DK6C 3OTOQ 1VQ8A 1JNMA 2CKZB 4Y7NH 3H3VH 5AW2B 1X65A 4LFAQ 2VQEQ 4IPCA 2JJQA 1X56A 3HOVH 4X64L 1S9KD 1HUCA 1OXUA 5APVA 4C3HH 3NBHB 4BBRH 4NXML 4OWWB 2CQOA 4OWXB 3ULLA 3GTQH 1JJGA 4LF5Q 3K8AA 1J2JB 4AH6A 1GM5A 4BBSH 1XPUA 4HJ5A 4L5SA 5AVYB 3KYHC 4XTCS 1SRUA 3I4NG 4APVA 1E3PA 3KF6A 1HH2P 5APUA 2R3CA 3M4QA 1PH1A 1VQKA 4GKKL 4JOIC 1CSBA 4A3GG 1YYCA 4DR5L 3T1YQ 1JUNA 3CPFA 5M5YH 2Z6KC 3E0EA 1KC8C 1NMGA 4DNIA 2IX0A 3OAKA 1OXVA 2F4VL 2YO3A 1D8LA 3FKIH 3S14H 4JI5Q 4AQRD 2N9BA 2R32A 5FLMH 4DK3C 1BVSA 4YWLA 5ELNA 1PH5A 3I55A 3CC4A 5LMUQ 1VQDA 2F3IA 3CC7A 1MKHA 4L5QA 3B8EB 3UE1A 3PO2G 4DV1L 2JA7G 4IFDJ 3W5OA 4LW1A 2KBNA 4LUOA 4LF8L 2B63H 1L1OA 2N78A 2UXCQ 2BA0A 4A3IG 2GVAA 3M7NA 4GT1A 5IY0A 2K5NA 4YWMA 1FAVA 2E5LQ 1C7YA 3TNUB 4HJAA 1PFSA 1TWHH 4JYCA 2OTLA 3RLFA 3L7ZC 4LF4Q 4QQBX 1MFZA 3CCMA 2YTVA 4A93G 1CI6B 1PH9A 1K8AC 4B3RL 2JA8H 1NMFA 4A3LH 3J7ZC 3J81i 4DV2L 2CCZA 3VTPC 3SGIA 1VQFA 2VW9A 4DR1L 3HOYH 4QY7A 1K3RA 4JI6L 3CQZH 1I50H 2AMCB 1X55A 1XJVA 3A2AA 2UXDL 3LIEA 2E2JH 4A3FG 4DV4Q 1VS0A 3I5CA 5IP9G 3AQQA 2WB1G 3OW2A 5GAGC 1N33Q 1PH7A 4ALPA 4OWTB 5C4JH 5AW4B 1S9KE 1G291 4YY3L 4LFCQ 3A5UA 4QGUA 1VQ7A 3G6EA 1VQ4A 3P7KA 4DV7L 1SN8A 1HNWL 2ATWA 2WB1E 2V1CC 2JA6G 4DKAC 4C46A 1PA6A 3PUZA 4DV3L 1HNXQ 1T2KD 1YHAA 4JYAQ 1HR0W 4JYBA 1VQAA 2DUDA 4BY1G 3O8ZA 5AVTB 4GLXA 3HKSA 2VL6A 4JC0A 2ZJPA 1PYSB 4JI5L 2OWOA 5AW9B 4NB3A 2NZOA 5GROA 4HIMA 4FDBA 5AW1B 3BZCA 4NXNQ 4GOPC 1PH6A 3RZOH 1SLQA 2YTXA 1XPOA 5LMNW 3HOVG 1Y1VH 2R92H 5BR8Q 1IBML 1PYBA 1FJGL 4GNXC 3S15H 2AHOB 2BH2A 1YHBA 3H3VI 3AYHB 4A3DG 1U0LA 2PI2A 1GO3E 3NFQA 2UUCL 4DUZL 3PCOB 2R7ZH 4BBSG 2JE6I 1N9WA 4DR2L 5APTA 3M9HA 2YNYA 5APSA 2YU9H 4UY8C 4LUVA 3NELA 2E2HH 3S24A 5APWA 3I56A 4JBKA 4KHPL 2EXDA 4A3KH 1H89A 1KQLA 1HZ9A 4JI2L 4DV6Q 4A4IA 1LYLA 1V9PA 3VMYA 5FLMG 1MUUA 4OX9Q 5C44H 4IO9A 5AVZB 1GVPA 4O2DA 1JJCB 1YJ9A 2R5BA 2QEXA 3I4MH 4JG2A 4LWCA 4JI4L 5GQOA 1IYJB 2FXQA 1FVIA 1Y1WH 5JJLA 1EYGA 1XMQQ 4AUWA 1O7IA 3HOZH 4OO1G 3M4PA 3KDPB 4LNQA 1KXLA 3NXSA 5E7NA 4B3MQ 1WCMH 5FJ8H 1N34L 4H02A 4GLVB 1GD2E 2B63G 4IOAA 5IYCG 4GKJQ 1NY4A 1KIXA 4OO1I 1N36Q 3HOWG 5M3MH 2P2UA 1M1KC 3M4OH 3VYIA 1HBWA 1TWCH 1GD7A 2BH8A 4PZ6A 4X66Q 3F8TA 2I5LX 4JBWA 1I5FA 4HJ9A 3ICEA 4NPSA 3F2CA 4L5TA 3TQYA 3UIAA 4RMFA 3CF5A 5AJ3Q 1L1OC 3HKZG 1XMOQ 3F2BA 2MO0A 4MNOA 2IY5B 3ZJYC 5C4XH 4AQYL 5AW7B 4PMWA 4J15A 4HIOA 1Q12A 4UPAA 4DR4Q 1HR0Q 1RL2A 3TNUA 4JV5Q 1J6QA 5IT9c 3K7AH 3HKZE 1I94Q 1IBKL 3J80i 3HOUH 4DV5L 1FGUA 3RZDH 4JI7Q 3VMXA 2A1AA 1H8AA 1VCIA 5LMNQ 3S1NH 1LUZA 2D0PA 4IJLA 4YHHL 1YHQA 1TWGH 4DV0L 1VQCA 4HIDA 4LFBL 3NTNA 1X54A 3E9IA 4DZOA 2UUAL 5HGQA
chains in the Genus database with same CATH superfamily
1PRTB 1MJCA 3MTSA 3B71A 1PH8A 4A3JH 1SDFA 5AW8B 1VQ7P 1SNPA 3CCRA 3L72D 3G6EP 1VQ4P 2XZRA 4HIKA 1CM9A 2WT7B 2VQFQ 5CV5A 3K81C 1SQBG 4KY5A 2XTIA 1X9NA 3HOWB 4YCUA 3I90A 1DZ1A 5CYUA 1E7ZA 2YYZA 5L8RJ 2KJXA 2PW5A 5DM73 1Q46A 4HH2A 3U9SA 1U7JA 4I7AA 4B3SL 1HHVA 1IK9A 1J9OA 2ZM6Q 4HJ7A 3OPOA 1NU1K 1SJHD 4OONA 4ZYSA 4MN4C 1PV4A 2A45H 3K0XA 1Y1VG 3CW2C 4J6HA 4B3TL 3TMEA 1N7SB 2R93G 1D5XC 3MXUA 2QE7H 3NK9A 3U9OA 1PTOH 1B3QA 4YXDC 1ENAA 1SQBE 2HHHQ 5TISH 1M8AA 2K3RA 3H0GB 1KILC 3BDCA 4H7BA 1B8AA 4PV1C 3CCLA 4A76A 1XNQL 2K50A 3NBIA 2QILA 2HIVA 2R7ZG 1ZW0A 4N78E 1LTAD 1SQQD 3H1JD 1SQVG 1I3QB 1LTSD 1U5KA 1V1PA 3E1RA 2HD3A 2A6HD 2KLVA 5C39A 2E75B 2KEEA 1QZGA 4JI1L 1Z9FA 3H1KG 5K5GB 2N88A 3D31A 2NVYH 3GDEA 4OHJA 3T16A 2KUMA 2WITA 2Z4EA 3EFXD 2Z9HA 2K04A 3R2TA 1LTTC 1D7MA 3IAOA 2IX1A 2N1TD 2WQYC 1R5LA 2CW0D 2R3ZA 1K3BC 1FNVA 3DWPA 5FLXc 1G2SA 2AXTH 1OO9B 2R7DA 1K8GA 2KENA 3H1ID 4A3BH 1AFPA 3KQGA 1DOLA 2EY2A 1NTMJ 3IFTA 1SQVE 3F2DA 3W1BA 2Y9YA 3EQLC 2R6GA 2VB2X 2ZTDA 4L6TB 4DR3Q 1Q90D 3H1KE 1EU3A 1UE7A 3H94A 5KLIB 4UP9A 4LF7Q 4HSPA 1LTGD 3QG1A 5K5PA 1JEKA 4P75A 3VR5A 1S72A 3TP7A 1GU4A 1PH3A 2NPSD 1JO5A 2M9VA 2XIWA 2R44A 4A3EH 4H0LD 2L9HA 2E8GA 1B2TA 2I5HA 1URQA 1G51A 1P8LA 3RD4A 3T51B 3RK2C 1XNRQ 1T5XD 1NJIC 1KNEA 2KCMA 1SQQK 1UEBA 2X6LA 5DLQE 5I2YA 3KF8A 5CBAE 3S2HH 3UDFA 3CMEA 2B87A 2W83C 3I56P 3JCUH 2IPKD 1K8OA 3SWKA 3AEVA 1WTWA 1DJRD 3WUUA 3PUYA 1RD9D 1NTZG 2MGSA 3FRPB 1WTRA 2MPMA 4RKLA 2R3SA 3A7OA 3GTLH 1FZCA 1U4MA 1KTMA 1T2KC 5C44G 3HRZC 4YXWH 1M56D 2N3SA 2E5YA 2ZXOA 4C3JB 2WTYA 5E79H 2QVAA 3IRBA 1GUGA 2I5MX 3HRNA 1T9HA 1PTOD 1E5WA 2GVBA 2FXPA 5D3IB 2VS1A 1HRJA 1RE3A 1LT4D 4Y28J 1EEID 1OVRA 1SNCA 1PP9D 1TXYA 1S3JA 3H1HJ 4OGQD 4DOJA 4KN4C 5KRUA 1CZQA 2W6AA 4RCOA 1NTZE 1IFIA 3AE7C 5C4HA 4BXXH 2AQ3B 3VYRA 4XQQA 4G57A 3BDLA 4GN5A 1HJ0A 1UE5A 1YVCA 1KDAA 2F0KA 2O1JA 3T1HQ 1B53A 3H15A 1Y1WG 1JCDA 3DM1A 1HUMA 3BJUA 2CK3H 2QEXP 2Q1KA 4IFDH 2Z0SA 3E6ZX 2IT1A 4WJ4A 1LTBD 4KI0A 4OEMB 5ELOA 2E76C 3AEDC 2LY7A 3M0AA 5AVVB 3KUPA 2UUBQ 4YCVA 1OXZA 4X62L 2C9NY 1W6KA 2MFIA 3U4VA 3LW5J 4DR6L 1IZ6A 4R1JA 1FGBD 1BSHA 1I4XA 5C0XI 2ZYAA 5A2QL 3B5NC 4AIMA 1CQVA 5FJ8G 4PJ0E 1Q1BA 1K8AQ 1VQJA 3I4NB 3A0HE 4JBJA 4ASVA 1XXGA 3I7FA 3V2QA 1EY7A 4QCLA 3EA6A 5KGUA 3LNNA 3BASA 5ELEA 4YWKA 1TWAH 2JA5H 1NGMB 4OIKA 1GL2A 3CX5E 4LC1A 2V7QH 1X3PA 2VY3A 5FO8B 1ONLA 1KORA 1RQUA 5EBDA 2EY5A 4JI8L 4A3MH 2K6AA 1VQ6A 1Q82C 3C9IA 4FVMA 1VQBA 3OMGA 1EDLA 5C6AA 4X3SA 4NPDA 3OTOL 2K52A 1GXDC 4A3GB 3K7UC 5AVRB 2MJ8A 3SXHA 3UDGA 3L70J 2RKLA 1I4GA 4XYOA 5AVXB 5IGGA 3FXEA 2VQEL 4LFAL 1A6XA 1S5ED 2LSSA 2ZYGA 1SFOB 1PDQA 4L63B 3SK6A 4XIGS 2Z4IA 3VMAA 2LS01 1BCCG 1PH4A 2O01H 3HUSC 2GA1A 2C5CA 5KJ7D 2XV5A 3Q8DA 2D0OA 3PSIA 3V05A 3HOXH 4LF6Q 1FDOA 2I8DA 3MHVA 2CH4A 3L72G 4ASWA 1STYA 3FPUB 3J80E 1JE5A 3HD7B 3ONAB 1VMPA 2Q8TA 1J5EQ 1OXXK 3K59A 2FYZA 4FYDA 1DH3A 1PV3A 2RCNA 2E2IB 1GU5A 3C8VA 1A8VA 2VZAA 1QGKB 4R4CA 3L74J 2MP1A 4LF5L 3AE3C 2I1KA 2M5AA 2WKDA 5C4JB 5C3EH 1A02J 3E3XA 2QKIC 2KUBA 3IN6A 3I8ZA 4UB8E 3ULJA 1ICFB 5C4XG 1EZ6A 2VRSA 1BCCE 5KNBA 1XTDA 2L5GB 1ENCA 2LFNA 2RCFA 1JOKA 1LT5D 2FY8A 1EQRA 5AVQB 3TEHB 3L72E 1HTLD 4DUYQ 4K0KQ 3M85A 2C9OA 2VXWA 1VMCA 4TRDA 2VNUD 1JT8A 1W5CE 1NKZB 3RK2D 2KHSA 3AMUA 4KHXA 1TR5A 2Q2IA 3QR8A 1VQ5A 3HOUG 4X65Q 1EWCA 2PPBC 4KKUA 3R2PA 3WU2H 4BWGB 3H1JG 1RF1B 3VP9A 1SFCA 4ZMDA 4CDEC 5D3DA 1EIYB 1QB5D 1R4QB 2BOSA 1ILQA 1X3EA 2XRQD 1D5MC 4U3FJ 3PO2B 1Q7YQ 3T1YL 1QVGA 2JA7B 3OMCA 1BGYD 2EYHA 4UHVA 1S40A 3A54A 4PG3A 3KJOA 3AE2C 3GO5A 4ME5A 2CQAA 1LTJC 3MZ5A 1HNZQ 1ET9A 1E2ZA 1H9SA 1MIUA 1OVUA 3U4ZA 5KKZB 4I2LC 2XVSA 5AW0B 2F0GA 3TDKA 2WPVB 3RNUA 2JSOA 2KZJA 4R4OA 3A0BE 3JAMi 1G6ZA 2OYOA 3H1IG 3RL0g 4UAIA 3WWVA 2N49A 4CKBA 5IWAQ 2UU9Q 4LF7L 4A3IB 1AH9A 2ALYB 1SQQE 3H1JE 1PMRA 2AKWB 4JI0Q 3K5OA 3URYA 3MXNA 3CCJA 4L5RC 2BDNA 2POHA 4IURA 3MAQA 2NVTB 5GTHH 2Q9IA 3BG3A 3K5LA 1NNXA 1ILPA 4AYBG 1IFDA 3NENA 3HTKA 4IFDK 3L73D 1HPCA 5BN5A 1SQBJ 3Q0AA 2B63B 1M1JB 2JQOA 4A3JG 2D62A 3TSIA 4PZ7A 1K73C 4RJTA 1KQSA 2W6BA 1PH2A 2ZXXA 2A73B 3S1RH 5CMDA 2KS1A 1YHQP 2HCIA 4RCNA 1UUPA 1K9MC 4C2MB 4XQJA 1ZXGA 2WINB 3GTJH 3H1IE 3J7YW 1N8RC 3CI9A 5LMUL 5EPKA 4EVOA 2VUMH 1K28A 2KNCA 4WWIA 4Y99B 4C1NK 2B3GA 1QVFA 3FXDA 1IO4A 2JEAI 4AYCA 4BBRG 3O6QA 1XPRA 2B2WC 4ODGA 3SVMA 4HMIA 4EOTA 3KFUA 3S16B 3PGZA 3ULPA 2KSEA 3AB9A 1KB9H 2A69C 5HY6A 2PMZE 3GTOB 4AYBE 3IF4A 1P84H 2FYNB 2A45G 4EI2A 4POGA 5EQ0A 1MI2A 3CCRP 4DNTB 4S3SA 5J3BA 3NXWA 1PHJA 3HFZB 1SP4A 3TP5A 3BU2A 4W7YA 1TU2B 2PZWA 3AE6C 1BCPF 4BA1I 2ASBA 3H32A 1EUJA 3KJPA 3L75G 2ICIA 2J58A 1K83B 1TT2A 5CV4A 2XN9C 3BZKA 1LT1A 2RDGA 5FKAC 1PP9G 4KKSA 5JJKA 2A45I 3H1KJ 1TVXA 4A3FB 2BDOA 4DR7Q 2NBFA 1LT9A 1UNSA 1GKHA 2KQ3A 2FKWB 3I4NH 3A8KE 4WBAA 1HTPA 2QJPB 3BVMA 2K75A 2W8ZA 4KJMA 2UXCL 4ZNCA 3M7GA 2WB1B 2AWOA 2WMMA 2SPZA 1X3FA 2PYKA 2UUBL 2IX3A 2WT7A 1OVVA 3ND8A 5IOCA 3PUXA 4QMGA 4MIUA 1VQLA 1BF4A 3PO3H 2YMYA 3AECC 2WWWA 3L75E 1S3OA 1X6OA 4N9TA 2E5LL 2QJKB 2YKQA 3I73A 3SK5A 2FINB 4UDUC 3L71J 3VMZA 5EAYA 3CCLP 3TZDA 5CORA 1JM0A 3OSOA 1O80A 5T1IA 1PP9E 3T53B 3SWFA 1YZ6A 3RK3D 2BASA 1FU1A 3FVQA 4IUPA 3SE0A 5CV6A 4F8MA 3M3YH 4LF4L 4BA2I 2PP6A 2QM7A 3M06A 1OWAA 1KLUD 5IT9L 1SQXG 2F0IA 3U50C 1SR3A 4IN3A 4YPCA 5K36H 1SYFA 1WI5A 2UXBQ 3L37A 4WY4B 2B2UA 2E74C 2H5XA 3RN5A 2FJ2A 1DONA 3I2ZA 3FKIG 5KAFH 2WACA 2QDBA 4QL5A 3D4RA 2JA6B 1I4HA 1FZBA 2G8YA 1CKMA 2OYIB 2EPBA 1FZAA 2HCCA 3MEFA 3DLLA 1AP0A 1OW7A 3M0DA 5IGFA 1JTHB 2WPSA 3V2TA 1EY5A 1ZV8A 2E2IH 1SNQA 2QRXA 4H13D 3GTKB 5A2QE 2AXTE 2OQ0A 1G2TA 1NTZJ 1YJNA 1Y8AA 1G1JA 1MV8A 1KNAA 1A3VA 2PO4A 1ML0D 1NE3A 1GUOA 3RL0C 1II3A 2B2TA 2SEBD 2JR8A 2ZXPA 4X64Q 1KB9D 4RGNA 3GTPH 2O1KA 1VF5D 1P84D 2K33A 2WSFH 1USEA 1S72P 1YNNC 2EJMA 1YTZT 2JN4A 1BBUA 3S17H 1GUNA 4DV4L 2IPPA 4OH8B 2WZ7A 1BBWA 2PMZB 4RGOS 3TYYA 4HJGH 1OXTA 1NTKD 4NXMQ 4JF7A 1X3GA 1VDFA 2A68D 1Z47A 2HG5D 3V2NA 4O42A 1OTCA 4B9XA 3CMEP 3HOVB 1NBWA 3I72A 2CFMA 1WYDA 5ELCA 4G7HC 3JCUE 2D2CB 3GTMB 1URQC 1B7YB 4XQNA 3C46A 4B9WA 1N33L 2OARA 4C3HB 3F1ZA 4BXXG 4TT3H 4RH6A 2JA7H 4BBRB 5M1BA 4A3DB 1F9PA 2EYLA 1TIID 4LFCL 3RGUA 5KIXA 3MFGA 2HT1A 4KY7A 4ZUJA 5E79E 3W2DA 4X65L 3J81E 1M1KQ 2ZAEB 1LWUB 2KI7B 4IFDG 4JI3Q 2F0EA 1RIPA 4BBSB 1VQGA 2OYHB 2AEFA 2B9BA 2G9HD 1ASYA 3BCCD 5M5XH 4RHRA 2L11A 4ABNA 3Q22A 3BS1A 1HNXL 3EN2A 4N8FA 1UIIA 3CXCA 1L0ND 3PRJA 3PF5A 5LHY1 4GKKQ 4NP5A 2LXJA 4JYAL 2PI2E 4DR5Q 1FOSF 1L4AD 5M9OA 1KRTA 1DGSA 1S1CX 1LTAC 3CKIB 1K8MA 1BGYG 4R4MA 4IFDI 1H95A 2C0WA 2ZJSE 3NTIA 5TSSA 1QVCA 1K0RA 2FYUJ 5IYDH 5KTBA 1QILA 4A3MG 1EL0A 5AFWA 2R5DA 3S4RA 5CCHA 5C3WA 5FO9B 3R8BA 2O4XA 3W1GA 4C2MH 4A93H 3A7AB 3NSWA 1L0WA 2F4VQ 2JA8G 3FWNA 1ZRTD 4A3LG 2CHBD 1KFNA 1SS1A 2JWAA 4C1NI 3MXPA 1BCCJ 2KP8A 3FWLA 5APXA 1KQFB 3B4SA 3I4OA 5AVUB 1FDIA 2N1TC 1HH0A 2W27A 4KK7A 4NXNL 2Q2TA 2NB0A 1IBLQ 5M5YB 3HOYG 2F0JA 4DT0A 1JCCA 1AQ5A 1YEZA 2GN5A 2ZT9D 1BGYE 3OJAB 5FLXL 4K14A 3L73G 1VQEA 2MHVA 5CBOA 4PMBA 3HOXG 4DN4M 2CVRA 2L15A 5BR8L 1VQ6P 4LGDE 3NEMA 2NVQH 1LTLA 3GTGH 3FKIB 2KLUA 1KDBA 1AZQA 4XXEA 1MSHA 1LTGC 1TY0A 4RKUJ 5KAIE 4X3KA 1QJOA 1U9RA 1RE4A 1JQYD 3D6CA 1IYVA 4X3UA 3D0FA 2K14A 3AE8C 4HAEA 4A3FH 3MA2B 5C3EG 3J7AV 1VQ9A 3FPPA 1KILB 1OFCX 2TSSA 2K7VA 2YKPA 2K28A 3E7KA 4DJGA 5I9OA 4PV1B 1MBYA 2K5VA 3L73E 1XTCD 1R9TB 4UP8A 3TN2A 2B2YA 2A8VA 2E74D 4GS3A 3RLNA 4KKTA 5GTIH 1UE6A 1LT3D 4IL6H 3Q23A 3JAME 4BS9A 4HJ8A 1D7QA 5EFWB 1CI6A 1C48A 2AEJA 4WJWA 1FR3A 1A2UA 4GOEA 4DV1Q 2IYOA 2J0TD 3S1QH 2WV6D 2BCCD 2Y0DA 3Q3DA 3CXHH 1S5BD 4KD4A 5EPJA 3S1MB 3MIWA 2HPCB 4UP7A 3K80C 1HCZA 2Q7CA 1NU1D 1NAFA 2RH0A 1PTOC 1IXRA 3S2DH 2HUGA 4O1NA 2LXCB 1FDMA 4IUVA 4F7XA 3R3OA 1AA0A 3G48A 2Q3IA 2Q6QA 4QF4A 4LF8Q 2MO1A 4MZ9A 2XGTA 1T5EA 4QB4A 2KECA 4HR7B 1NSNS 2E42A 1A3UA 5AVSB 1SQPK 1PZID 3G7LA 1MSGA 3VR4A 5GAEC 4EQ5A 3C1FA 4IJHA 1YNND 4WFN3 1UIXA 1YIJA 5AVWB 1V1OA 2NVXH 2H43A 1LACA 1BSNA 4CKEA 1XTGB 3PMFA 3T97B 1X3QA 4ME3A 2PQAB 4GKGA 1O7ZA 1EZ8A 3DEOA 2DJFC 3USSA 2UXBL 1L2PA 1G2CB 2Y0CA 2YV5A 1NAPA 1PFNA 4HTHA 1PRTF 3GP7A 3P32A 4IPDA 3A55A 5KYIA 1EIFA 4DV6L 1LTBC 3WU2E 2KVMA 3AFQA 4X6AH 1USDA 3V4WA 1GHKA 4XT1B 4M3LA 1V8QA 1CT1D 2ICEC 5M3FH 1NKNA 5AW5B 3HP3A 1URQD 4Z9CB 3WMM0 4HYTB 4ZRZA 5BN4A 2JK8A 4ID6A 1PGJA 1FL0A 4R8NA 2CPSA 5CR3A 2JEEA 3TZUA 4B3RQ 2H88C 4EQOA 2KB7P 2E2DC 3KK7A 1TWHB 4OX9L 3W67A 1BCPD 1MD2D 5KLVJ 1SFCC 3VN0A 4R4IA 1EC5A 1JWUD 2WKCA 4DV2Q 4GOFA 3FEWX 1KAAA 1DD2A 3STBC 4DR1Q 1HZAA 4MTNA 1X8YA 2EDGA 2OXPA 3NQTA 3U59A 2R92G 3BATA 3BRTB 1B4OA 1DIPA 3EIVA 3RK3E 5IIFA 1NTGA 4JI6Q 2VUMG 1RF1A 3MHBA 4G4KA 5H1SE 3GTMH 2JA8B 3CCJP 2H89C 1DOMA 1SROA 4NPFX 1Q1EA 5GTHE 2ZXRA 4KT0J 3M9QA 1TWFH 3N6RA 4A3DH 4C56C 4L75A 2UXDQ 4HCEA 2HLOA 2HIXA 3HOYB 4C7NB 3K57A 3HKZB 3IFMA 3L75J 3NP8A 1STEA 3CMAA 4NPEA 1ZMEC 1Z7TA 4U7JA 5HURA 1NTKG 3CHBD 1EY9A 1ZEQX 1XMQL 1TU3F 5KJ7C 4DK1A 3QB3A 1I50B 4P72A 4ZKCB 5B66H 3CXHD 2B2VC 2HQEA 4X3TA 5H2FH 4RG1A 1KC8Q 1KB9I 3A3YB 1AE2A 1JY2N 5NUCA 5M5WH 1N73A 1P84I 3EBEA 2OQKA 4A3CH 2E76B 1J1DB 1NUCA 2ID0A 4B3ML 2E2JB 1A02F 2J4XA 4WJ3M 1KB9E 1YBYA 1DYQA 3MEHA 4YY3Q 1P84E 4JI3L 1TS3A 1SE8A 3A0JA 4GKJL 3B5NB 1SYGA 2DN8A 3W68A 1H9JA 2RF4A 2IDBA 1VQNA 1NTKE 1N36L 1QOHA 1KD1C 1L0YB 2ZTCA 3KOJA 2WPRA 4DV7Q 3PO3G 3JSVC 1HNWQ 2X6GA 2OTJA 1HTLC 2J7ZA 1NCVA 2NTTA 4RGMA 2DJGC 2KIKA 2CWAA 1SQXJ 3TP8A 3WOEA 3BVZA 5LL6S 1AW7A 4DV3Q 4P73A 2KSJA 1GK6A 1GL2D 2JJLA 1S5LX 3QWOC 5COYA 2W6JH 4A3KG 1HJPA 1BDDA 1L0NG 3E9HA 1AVYA 1HZCA 1QNUA 3MD0A 5K36G 1C0AA 2ZFCA 3VA5A 4X66L 3HG9A 3CWBJ 2L0CA 4P74A 4BY7H 2WP8J 2MQHA 4NW2A 1YNJD 2LKVA 5CHXA 1M4VA 2K01A 1WRGA 3K5BA 1VQLP 1IW7D 2RHQB 1T3JA 4O0AA 3T4AC 2RVLA 2XDJA 4GZYC 2BEZF 2AUKA 3HUSB 1PRTC 3X3MA 1I6HH 3FX0A 5AJ3L 5IGCA 2ZJQA 2LXKA 3V2RA 2SDFA 1IBLL 4M1UB 3K0YA 3BCCE 5J22A 5EKKA 4CDCC 2YTYA 1XMOL 3KLSA 4K3AA 1PVOA 1L0NE 1FZGA 3D4WA 1JCKB 2KCTA 4NDXA 3PUVA 3SEBA 5JEAG 1Q81C 3I4MG 1CUKA 1JE4A 1OXSC 4EYYQ 1RY3A 2F0NA 2RQXA 2C35B 2GA4B 1R9TH 1B70B 4YCWA 1CKNB 3CCQA 3VDYA 1QUQB 1G8ZD 2D9UA 4GODA 1IBMQ 1FJGQ 3CP0A 4DR4L 1HR0L 2XNDH 3FHWA 4TLFA 4OIJA 1C9OA 2F1MA 2XU6A 4HMJA 4IOCA 3U58A 4JV5L 2B2UC 4CJ1B 1I4RA 3S1MH 1S5LH 1ZRTE 5CBNA 3A56A 5AW6B 5CV7A 5C0XG 3RZOB 3KYQA 1I94L 2F4IA 4GN3B 2UUCQ 1YJNP 4DUZQ 2HODB 1Y1VB 3J80c 1WTXA 4C3IH 1YJ9P 2R92B 2R93B 4TKOB 4MHEA 3M0DC 3TGUJ 4WY4A 3HOZG 2MJZA 2WAQG 4JI7L 5CBEE 5CCGA 1LLRD 4DR2Q 4YIJA 4RESB 1ZR4A 1NWQA 1RF0C 3H1LJ 4OO1H 3I91A 4IUTA 2IHEA 3I70A 4RGTA 2OYIA 1WJJA 1Q82Q 1WCMG 3A5TA 3M9BA 1BKBA 2K4KA 3I3CA 3C2PA 5LMNL 1JWSD 3QH9A 2ENBA 2P7JA 4IZ8A 1SFCD 2OCEA 4RWSC 3L36A 2R7ZB 2BCCG 1EIHA 1ZYRD 3RN2A 2H8PD 3F89A 1Y8OB 3STBD 1ZR2A 5EJWA 4H44D 3EJIA 4QJFA 4EGVA 3LW5H 1Y8NB 3DUZA 1NU1G 4DPGA 2H4OA 3AFPA 4FXKC 2OQQA 5IYCH 3CCUA 1NTMD 1SE2A 3C3LA 5IYBH 4Q0FA 2I1JA 1CI3M 2F0MA 3CRLC 5M3MG 2ZVOB 2R7FA 2WAQE 2ZJRA 4G7OC 1LJ2A 3HOWH 3RLOA 3Q24A 2OF1A 3L9AX 1HVVA 4KHPQ 1CKOA 1JOCA 3OWFA 4I65A 3AEBC 1EWIA 5IYDG 2IHFA 3N4XA 3HE5B 3SDZA 3CC2A 5KLIC 1FZEA 2BCCE 4JI2Q 4N3YB 1U4PA 2VQFL 2E2HB 4GOPB 3IR9A 1NU1E 3GG2A 3SK4A 3CCSA 2QA4A 1PLFA 3Q5RA 1AE3A 5DM63 2GUSA 1WMKA 1JY2P 1P16A 2Q8RE 3H09A 1CSPA 2EQSA 1AJYA 3OOCA 1TS5A 2F0VA 3KDFB 1DEEG 3H0GH 3CAMA 2ZM6L 1YQ3C 3RK3C 1F2MA 2RHSB 5IP7H 1U57A 3CCVA 1I6VC 4GNXB 4A3KB 1A63A 3HE4B 1DX7A 2N55A 2OGUA 1TQOA 4LUZA 1I3QH 1LWUA 2A19A 2DY7A 4A75A 1L0LJ 3L2PA 2J5UA 5DJTB 1NTMK 3OW7A 2HHHL 1EFWA 2BCOA 2I46A 3B6YA 2HDMA 3G9RA 1E0BA 2EOTA 1WTOA 4I6MC 4LF9Q 4JI4Q 1A3TA 2PFXA 2A5HA 1GTWA 1JMBA 3H1HD 5C44B 2F0FA 1D1IA 4H13C 5CCHC 1EOVA 3QIAA 2YO2A 3M91A 2NN6G 2F0PA 1QZHA 1KYOH 4D6TJ 2PNHA 3QJYA 4K5WA 3AU7A 1EY6A 4HB1A 1HUNA 2Y9ZA 4ZAIA 3K58A 1SQQG 2B39A 1YI2A 4NKLA 3RMHA 1E24A 2XKMA 1VF5C 2BE5C 3OW2O 2N8NA 1MGSA 2PGDA 3MVVA 3E1IA 2Y0SG 1PRTD 4ZUIA 3MWYW 2NN6I 4XE5B 4TQUS 3DWQA 2EYJA 3PH0A 4GDOA 1JMCA 2M3EA 1VQ9P 2A68C 2IFNA 2Q5UA 3AEAC 1B44D 3RBZA 3KZIH 4O9BA 1VDZA 1AVOA 1EQ7A 1Y1WB 3BZDB 1N34Q 3HEJA 4PQXA 3DXJC 1UE1A 4DR3L 2PCFB 4FF3A 1G1IA 3HOZB 5GTIE 1JOOA 2WAQB 2F3WA 5JAVA 4LLHA 3SSUA 2IZ0A 4DAMA 3CXHI 1E1OA 2CH4W 5FK9C 1N32Q 1SMYC 2X69A 2BA1A 4KLKA 1WVLA 3TRZA 2P5ZX 1QVGO 3A5ZB 2F0TA 3CXHE 1GK4A 1N8RQ 2Y0SE 2AQ2B 1JR0D 2B2YC 1XNRL 2RN0A 3N52A 1N7SD 1XYIA 2NZHA 3NMDA 4C3JH 3KF6B 3L70D 1KHIA 3A74A 3BVGA 2K5QA 2K5HA 1KILA 4CHTB 1Q7YC 3DM3A 3LIDA 2FBWC 3TS0A 3L0OA 2DNCA 3RR5A 2IWHA 5M3FG 1EQQA 2PQEA 1UWVA 1D2BA 2WPQA 3RBXA 1G6PA 3D71A 1R8EA 5CMZA 5ISRA 1VQIA 3M4OB 4BXLA 3RL0B 4IUNA 4QUCA 3JC66 3T13A 1A62A 1HFNA 1YIJP 1UAPA 3PUWA 4RA8A 1L4AC 3UE0A 3GMAA 1F2ZA 1JY3N 4KTAA 4B08A 1TWCB 2E75D 2HPCA 3D70A 1ESRA 4EQPA 2OEOA 4JOIA 4DGZA 1KQSO 3L74D 1HGZA 4QIWE 5KYLA 2MNAA 2R93H 3TREA 1BE3D 1T6AA 2KCCA 2IX7C 4AQYQ 3GHGB 3Q2YA 1DD4A 3J81j 1A0IA 3SK8A 2Z6KA 1KYOD 3ER0A 1SQVJ 2Z5IA 3TK1A 1NH4A 1WD1A 3NUCA 4IUQA 3OYYA 1QVFO 4FXGC 1YNXA 1EZVD 2EZVA 3V4QA 1KLGD 4K5VA 3ERQA 1E22A 3PF4A 3T1HL 1SYBA 2ZT9C 3T97A 3KF8B 3UDXA 2V4DA 2PQAA 5LL6X 1MJEA 1IBKQ 5C4XB 1G2CA 5EKLA 1Q8IA 2C9LY 4DV5Q 5GAHC 4DK0A 3CD6A 3LX0A 5D65A 1HWTC 5TISE 4A3CG 1S5CD 2P67A 5C4ZA 4A3GH 4U3FD 1ICWA 3G4SA 1X9VA 1EDKA 3NHHA 3PIOA 3P8MC 3K7AB 1JJ2A 3CMAP 1PZJD 1QNKA 1KRSA 1T3UA 4GIFA 1EQVA 3MGNA 1LO5D 1SFOH 3HOUB 5DAUA 1XTCC 1LTIC 1BQQT 4F87A 5IE8A 3RZDB 1CFMA 5APQA 2KCNA 1N7SA 5B66E 1RCVD 2EYPA 4YHHQ 4K35A 4Z1MH 1NOHA 4OXPA 1L0LK 2QM8A 3HZXA 2QJYC 4DV0Q 4TSSA 1O7LA 4IALA 2B29A 3VYUA 1FOSE 4A3EG 4LFBQ 2E43A 3J81c 1AQTA 1IL2A 3VYTA 1H0TB 2F0UA 5CCHD 1S4ZA 4TVAB 2UUAQ 4C7NA 2QCPX 1QL2A 4BY7G 1SQBD 5JJIA 3NQIA 1WFQA 2G5DA 1N73C 2N1TB 4R4TA 1VQNP 3D6YA 1L1OB 4LF6L 2K1BA 1KAWA 1TWGB 1IKMA 5ELDA 3GD7A 3UDIA 2ES2A 1SNDA 3PIO3 4EDFA 5J39A 2WSEJ 3FGAD 3Q6SA 1Q86C 2OTJP 1LM0A 3MC0B 2M0BA 2EYMA 1YITA 5CC4A 3GV3A 3NPPA 3QWNA 1J5EL 2BE5D 4LK1C 4KMUC 4P71A 1MFTA 5JEAJ 3BYTB 2TMPA 4Y7NB 1LGHB 4AYBB 4B3SQ 2JA9A 3PV0A 3CCEA 1ZLLA 2FFDB 1F77A 4PNYA 4A3JB 4LAAA 2NPSB 4RHSA 4JBMA 4E6IA 2NUCA 1QEXA 2M8RA 4H0LB 2EIFA 4QIWB 2LXBA 3KBGA 3B5NA 3GW6A 1YJWA 1ASZA 4B3TQ 4FF4A 1HJBA 5GADC 4JBZA 1LP1B 2HYNA 3EFGA 5C0XJ 1JB0J 4GLAC 4DAYB 4DUYL 4K0KL 4Y52H 4LF9L 1GW3A 1FJKA 1SMYD 2DNEA 1CSQA 3PO2H 1VQHA 2DW3A 1CK1A 1AN8A 1BCPC 3K5NA 4KHZA 2DGYA 3A0HH 3GTQB 5CGKA 2CWPA 4LMQD 1XNQQ 3MP7B 3H1KD 3H1HG 5E3FA 1AV1A 1SQBK 1KZUB 3CX5H 3OHXC 1FZCC 4KD3A 1KL9A 1H9RA 3T56B 1PTOB 3CCQP 5F2DA 1RH5B 1E2VA 2EY1A 4JI1Q 1X79B 1KABA 3KLWA 4A3IH 3FMCA 1NO4A 3AE5C 2O2LD 4JPZB 1SE3A 2QJPC 3HUSA 3OA7A 2NVTH 1RE3C 1HNZL 1DEBA 2WSCJ 3KLSX 1JY3P 1W2BA 1S5LE 4OGQB 3LGJA 3MTUE 3L71D 3OIPA 2AXCA 2JA5G 1JB7A 4CDFC 3H1HE 2EE1A 1J8IA 3JAMc 3HD7D 5KNDA 5IWAL 3PIPA 5IYBG 2UU9L 1L2FA 2NVYB 4JI0L 2ZTEA 3AEGC 4IL6X 1N32L 1D1KA 1CKNA 1Y14B 5IODA 1QUQA 4I7ZC 1HF9A 4KJNA 2PZUA 1IFPA 1MZ9A 3J7A5 3BVHA 1JY2O 2Q2UA 2F0WA 1SQVK 3VR2A 3G71A 4ZKUA 3J7AF 3S16H 4WY4C 1PGPA 3GTOH 4A3BB 2K5DA 4POFA 3L72J 3WUVA 3H91A 1VQOA 1V43A 3EQ2A 2LR2A 2XNXA 4ULLA 1J1EC 2IZ1A 2WFWA 2HODA 3CPWA 3TS2A 2B89A 2OYIC 3CCUP 5I6YA 1GOZA 1V1QA 4EX5A 5C3XA 3IFDA 2JEBI 3FP9A 3S14B 2F52A 1U7MA 4W80A 3TF5A 1SQPD 1HZBA 3H0GG 1E1TA 1K83H 1PPJD 4A3EB 5C5LA 1K0SA 1RF2D 1KN7A 1GL2C 5IP7G 3PIP3 1HA5A 1SYCA 1STAA 1VQMA 2QGQA 5CV8A 3CL3D 1PFMA 3CC2P 4PZ8A 4F88A 4ZK9B 1B50A 3K6OA 1CW5A 5APYA 4K8JA 3S2HB 3ZDMA 1SYEA 5IP9H 1RHZB 1YNJC 4IPHA 1GZLA 1LTID 3F2UA 4UB6H 3CCSP 3E5SA 1TS2A 4GN4B 2QA4P 1IW7C 3L74G 1OW6A 4B86A 3MXNB 1BDOA 3SHLA 3H3VC 1SLJA 5TJHA 3CLQA 1EY8A 2L5TA 4BY1H 1EDIA 3E0JA 3AE4C 3GTLB 2AWNA 4FF1A 4JVZA 1BE3G 1AEXA 1WOCA 2Z5HA 2ZXEB 4J8QA 4R4QA 4DR7L 3CX5D 1SQQJ 3H1JJ 3CCVP 2B8FA 1RKNA 4IPGA 3C1EA 1EY0A 4KN7C 1EZVG 1Q8KA 4JCVE 1R5SA 2EVBA 3HE5A 4OL7A 5JVG3 2EYFA 1BOSA 1EEFD 1NTZK 4HKZH 1CTMA 1EU4A 4BRYB 2KNCB 1S2EA 4GOPA 2EJFC 1F9RA 1GDTA 3L74E 2K5WA 2JA6H 2KHIA 4X62Q 3HD7A 1IFJA 1KYOI 1SMXA 3L35A 4DR6Q 2HQLA 1BE3E 3KDFA 4IFMA 1NR4A 3H1IJ 3UI2A 5KEEA 1EZVI 1KYOE 4GNXA 2H7HA 3GTKH 4U3FG 5AW3B 3ERSX 2HDLA 1N86A 4RAUC 1VQ5P 3NWSA 3HE4A 2FMCA 5J1ZA 1VQPA 2KHJA 1EZVE 2Q2HA 2JP3A 5I6WA 2O01N 3V5BA 2M2LA 3J80L 2FYUD 3RK2B 1YI2P 4HSVA 5BVZA 1RODA 4FNFA 4JI8Q 2I0QA 3MZWB 1M90C 1PYWD 2KXPB 1X22A 1JMMA 3S9WA 1W3SA 1IC2A 1BR9A 3MXGA 1H88A 4DK6C 3OTOQ 1VQ8A 1RTNA 1JNMA 1O78A 1R4PB 2CKZB 1EIGA 4Y7NH 3H3VH 1F2YA 1BCCD 5AW2B 2NZ2A 1X65A 4LFAQ 2DY8A 2VQEQ 1EXIA 2JA5B 1TWAB 1ZYRC 4IPCA 5JVH3 1Q2NA 3KZIE 1EOTA 3Q1MA 2XWBB 1FC2C 4H44C 4U3FE 2JJQA 2OT2A 3V6IA 4KHVA 5C5MA 2QSIA 3VR3A 1X56A 5IT9E 4A3MB 3HOVH 4X64L 2FXMA 2RSOA 2EYOA 1S9KD 3SFEC 1WT6A 1HUCA 1WD0A 2B8GA 2KOGA 1OXUA 2F03A 4JW0A 5APVA 4ZQ3A 4C3HH 3NBHB 3G3ZA 1IFNA 1VPCA 5CJ4A 4BBRH 4NXML 4OWWB 1LABA 2CQOA 2Z6BA 4MTKA 4EIJA 4OWXB 1H9MA 3ULLA 3GTQH 1JJGA 4LF5Q 2KEDA 3K8AA 1J2JB 2D5DA 4HEDA 4DA2A 4AH6A 3HOXB 1GM5A 4BBSH 1XPUA 1X32A 1PP9J 3CQZB 4OWFA 2FYUK 2HFED 1TKWB 2KA7A 4HJ5A 4L5SA 3S9OA 4RKBA 2F0QA 4WRDA 5AVYB 2KOLA 3TDQA 1KD1Q 4JK1C 5ELFA 1Z6HA 3KYHC 4XTCS 1SRUA 4FP5D 3I4NG 4APVA 4WY4D 1HQRD 1FNWA 5C3EB 1JORA 1AFOA 1E3PA 1U4RA 5CCGD 1M1JA 3KF6A 3QOLA 2P58A 1JWMD 1ZXTA 1HH2P 5FO7B 5APUA 1WTPA 1NJIQ 3VYSA 3AEFC 2R3CA 2Q3EA 3M4QA 5E4XA 1PH1A 4CKCA 1VQKA 4GKKL 4JOIC 1CSBA 4A3GG 1YYCA 1EDJA 3D6ZA 4DR5L 3T1YQ 1JUNA 3TBIB 4WORA 2F0HA 3BCCG 2BEQD 3CPFA 5ELBA 3GLMA 3IKJA 3ITPA 2JKVA 2YIUC 1Y8PB 5M5YH 1PL5A 3GF7A 2Z6KC 3E0EA 2J59M 1KC8C 1RJTA 1NMGA 3L71G 3H6MA 2K1AA 4DNIA 2P1JA 2IX0A 2MKVA 3OAKA 1XWEA 1OXVA 3P20A 3CD6P 2IJ0A 2MUYA 2F4VL 2YO3A 5DJUB 1D8LA 1LT9C 3FKIH 3GHGA 1GMJA 3KXDA 1Q81Q 4JI5Q 3S14H 4AQRD 2K9YA 2N9BA 2R32A 3G4SP 5JOBA 3MUDA 3WUTA 2RDFA 5EPLA 3C1LA 2XSCA 5FLMH 3P8CD 1K04A 2F0OA 4DK3C 1F2LA 1BVSA 4YWLA 5KLVD 2D2CD 3PTZA 4KJOA 5ELNA 1PH5A 1STGA 2F3VA 3L4FA 3RK3B 1RTOA 3I55A 4A7PA 1EXJA 2A06D 2SOBA 3CC4A 3L71E 3GQBA 1K05A 5KAFE 3HGBA 3RUZA 2C0XA 2PZTA 5LMUQ 1VQDA 2F3IA 3CC7A 1D6EC 1MKHA 1GW4A 1EY4A 1FZFA 3SR1A 1N7SC 1CZWA 1SQPG 2K32A 1KMIZ 1PPJG 1RDPD 3W3AA 1S4XA 4W7ZA 3S1RB 4L5QA 1ZN5A 2GUVA 2N9YB 3B8EB 2K9JB 5JPNC 3L75D 4H13B 3JC22 5FLXE 2Z8LA 1W2EA 5EKIA 3UE1A 5IGBA 3GTJB 1WTVA 2VUMB 3S15B 4I1LA 3DHQA 1STNA 1YITP 4K6DA 2FHTA 3PO2G 1ESFA 1YQ4C 4DV1L 2JA7G 4IFDJ 1Q3LA 3W5OA 4ZLTF 2XNAC 3CCEP 1VF5B 3OWEB 2B2TC 2E75C 4LW1A 1JTHA 1H0TA 1C8CA 1JY3O 1SQPE 2L12A 1OX3A 1PPJE 2KBNA 4Q5VA 2F0SA 3U1AA 4LUOA 5KLVK 1YJWP 4CPGA 2N1TA 5BU5A 4LF8L 1LTJB 1SJED 3NTKA 2B63H 1L1OA 2N78A 2UXCQ 1QWYA 1J1DC 2BA0A 4A3IG 1YBKA 2GVAA 1PFBA 3M7NA 4GT1A 1D5ZC 2QEJC 5IY0A 1FNUA 2K5NA 4YWMA 1BGYJ 4R4LA 1KV4A 1FAVA 2V7QJ 4QUFA 2E5LQ 1CA6A 3II6A 1C7YA 3TNUB 1SQXD 1Q90A 3H6PA 4HJAA 4PD4H 1PFSA 2YU9B 1TWHH 3CX5I 4JYCA 2OTLA 1I4PA 2FFDA 3RLFA 3L7ZC 2NPSA 4LF4Q 1KFMA 5IGEA 4QQBX 4R8IA 5L37A 1SAPA 4WVZA 4FO2A 1MFZA 3CCMA 2RSNA 2YTVA 5HGTA 4A93G 3CWBD 1PFIA 4FF2A 4DU9A 3PO3B 1LP1A 1CI6B 1PH9A 1K8AC 5KAIH 4B3RL 4DAYA 2FYUG 2JA8H 1NMFA 2NRGA 4A3LH 2O01J 3L73J 3J7ZC 3J81i 3EWKA 1KILD 3U1CA 1QL1A 4XYQA 4DV2L 2CCZA 2IBZD 3VTPC 4PV1D 4BWNA 3M3YB 4FXDA 2XWJB 1VQFA 4U68A 3SGIA 4ZKBB 2VW9A 4DR1L 5EGTA 1PGOA 3HOYH 4RO0A 4QY7A 1K3RA 1QCBD 2Z4HA 3NTHA 2F0DA 1L4AB 3NE5B 3P1HA 4JI6L 4J1MA 2K88A 2OYHA 2YXQB 3CQZH 3MFYA 1I50H 3D6WA 3WOFA 2PW7A 1IJDB 4CGYB 2AMCB 5BN3A 1X55A 2RDHA 2M00A 1LTTD 1XJVA 2FYUE 3A2AA 3G71P 3LIEA 2E2JH 4A3FG 2UXDL 4DV4Q 1SQXK 3J81L 1VS0A 1F9SA 1VQOP 1GUSA 1EYAA 1ZP0C 1BUVT 2UWJE 3I5CA 5IP9G 3GF3A 3AQQA 3ZYYX 1BE3J 1LNQA 2WB1G 3I4MB 5B5EH 2ZT9B 4XA4A 3GTPB 1MHWC 4DXFA 3FDTA 4OELB 5GAGC 2WSSH 2JP1A 1B9NA 4CBVA 3OW2A 3TGUD 1N33Q 1PH7A 3S17B 2UUAL 4OWTB 5C4JH 5AW4B 1JC7A 3H1LD 1S9KE 1G291 1O7YA 1IL8A 4YY3L 1VQMP 2LMCB 4K8IA 4LFCQ 4WB4A 3EVQA 2NZ1D 5JJZA 3V96A 1EYDA 1QE6A 1ENFA 3A5UA 5BU8B 4QGUA 3EFFK 2WIIB 1VQ7A 3G6EA 1VQ4A 3P7KA 4DV7L 1M7LA 1SN8A 1RE4C 2ATWA 4UB6E 2WB1E 1HNWL 3PJSK 2YKOA 1FJPA 1B1ZA 2V1CC 4LJZC 4PD4D 2ZYDA 4DKAC 2JA6G 4IL6E 4C46A 1W6JA 2A6EC 3D4DA 3Q5SA 1PA6A 3PUZA 4DV3L 2K03A 1NAYA 2E74B 2RKSA 1DXMA 4DAVA 1HNXQ 1GJXA 1K9MQ 1WCMB 1T2KD 1YHAA 4JYAQ 4JQ0D 1HR0W 2OTKE 2QJYB 1A15A 3P7JA 2L91A 3R2IA 3K5MA 4JYBA 1VQAA 3PQIA 1V1PB 2DUDA 4BY1G 3O8ZA 3G6JB 5AVTB 4ZKPA 1HFGA 3QOJA 4GLXA 1PXUA 3HKSA 1DM0B 5M5XB 2VL6A 4JC0A 2ZJPA 2K05A 1PYSB 4JI5L 5I2XA 2EJGC 5M3MB 1N73B 2OWOA 5AW9B 4NB3A 4N6JA 2NZOA 5GROA 4HIMA 1QX8A 3IL8A 4FDBA 5E4WC 2FXOA 1FBMA 5KJ7A 3DWAA 5AW1B 3A8JE 1U4LA 3BZCA 5G3LF 4L74A 2B2VA 2PNRC 4QMAA 2JYOA 4NXNQ 4GOPC 1PH6A 3RZOH 1F9QA 1VQPP 1SLQA 2YTXA 1XPOA 4OVNF 1FD7D 1SE4A 5LMNW 3HD7C 3KPEA 3HOVG 1Y1VH 1OW8A 5DEHA 2R92H 1FYCA 3AE1C 3OIQA 3JAML 5KLVG 3AE9C 3BYYB 5BR8Q 4A93B 2E76D 1IBML 1PYBA 1FJGL 4BRYA 1L0LD 4C3HG 4GNXC 2AHOB 2BH2A 1YHBA 3S15H 2A06G 3H3VI 3M4YA 1VQ8P 1QLED 2NWGA 1CQFA 3AYHB 1NTKJ 4A3DG 1U0LA 2PI2A 1GO3E 1URQB 3NFQA 1IFMA 3B5ND 1NHLA 4XFJA 4DFAA 1BXTA 2UUCL 4G7ZC 4DUZL 2I07B 2R61A 3PCOB 2R7ZH 3KBXA 4BBSG 2JE6I 1BCPB 1E2WA 2B87B 4D6TD 1GUTA 1NR2A 2IL8A 2NVQB 3GTGB 4IOIH 1N9WA 4DR2L 3P8CE 5APTA 5KLVE 1CZGA 4R9WA 5E1FA 4DXGA 3M9HA 2AEMA 2YNYA 4KY6A 3HS0C 1IKLA 4IQZA 2V4HA 1N2DC 1FZCB 5DNFA 2H1EA 1OZHA 2A06E 3ABVC 3O13A 1KQGB 5APSA 1ZOYC 1G91A 1WTHA 3SFDC 2YU9H 1RF1C 4UY8C 4LUVA 3N7NA 3NELA 5CV9A 1ZKOA 5I4DA 1GUWA 1NVOA 3BCCJ 4K5XA 2E2HH 1BO0A 3PHLA 4DAPA 3S24A 1CHPD 5APWA 3I56A 2GM4A 4RFBA 1L0NJ 4JBKA 3AEEC 5H2FE 1LT6D 3S1QB 3VOPA 1NTMG 2WVRA 5KKZC 1EQTA 2IW3A 4KHPL 2M3BA 2Y0SB 3NBHA 1X0TA 1Q86Q 2EXDA 4I7ZB 3CRKC 3S1NB 3IAYA 3S2DB 4A3KH 3ND9A 1B3AA 1MKMA 1KQLA 1H89A 1HZ9A 4JI2L 1TY2A 2ZVNB 2JDIH 1SNOA 1TS4A 3R93A 5JPMC 4DV6Q 2FFKB 4K2LA 3VR6A 3LWUA 1RQVA 1HQMC 1VQKP 4A4IA 1J1EB 1DCZA 1CHQD 1M1JC 1LYLA 4N78D 1V9PA 3CWBG 4N8X1 4KV6A 3EROA 2NVXB 4ZCKA 1NTME 3VMYA 5FLMG 1JB3A 4XDXA 1MUUA 4OX9Q 5C44H 4IO9A 4L73A 5AVZB 3V2PA 1GVPA 3GV6A 2P10A 1RF0A 1NYHA 2WSEH 2WSFJ 2PRRA 1STBA 2L4NA 1GL2B 4BY1B 2IBZG 1FS0E 1ET6A 4O2DA 1SQXE 3KHUA 4Y99C 1JJCB 2R5BA 4CJ2C 2QEXA 1YJ9A 4P2CB 3VA7A 1YTZI 1XX8A 5JEAH 3I4MH 2SNMA 5M3FB 2PAJA 1SQPJ 3BDOA 2HR3A 3Q5PA 3H25A 3S1KA 2KZIA 1E79H 2A6ED 4JG2A 4LWCA 4JI4L 2FYNC 1S5DD 3I4LA 2G3AA 3CWBE 5T1GA 1GHJA 5GQOA 4DNRB 1SQVD 3KLRA 4PJ0H 3VP8A 2RA4A 2NYZD 1HA6A 1KDCA 2IBZI 4HN7A 3DEPA 5C0XH 1IYJB 4M8AA 3GHGC 4C3IG 1KILE 2FXQA 1EFID 1N7LA 1FVIA 3I55P 4YTPC 1Y1WH 2IBZE 3A7LA 1BBXC 5JJLA 3CC4P 1SBBB 1EYGA 1BDCA 1XMQQ 4AUWA 3MUDC 1O7IA 1SYDA 3HOZH 2QW7A 3F5HA 1SXTA 1FE6A 4OO1G 2BCCJ 2A74C 1PTOF 3M4PA 3CC7P 3KDPB 4MN3A 4LNQA 1TWFB 1BNZA 1KXLA 3NXSA 3PLNA 1Y9BA 5CJ0A 1Z56A 1M8OB 5I9PA 5E7NA 3TGUG 1NU1J 4B3MQ 1WCMH 2L1BA 2M5AB 4V0BA 5FJ8H 5D14A 2VB3X 4ILWA 3H1LG 1N34L 4H02A 4GLVB 1K73Q 1GD2E 4HCSA 2B63G 4IOAA 5IYCG 4GKJQ 1LV9A 1NY4A 1KIXA 2QJKC 4N9PA 4OO1I 4XT3B 1N36Q 2WSCH 2JO1A 3HOWG 1SSOA 2JXMB 5M5WB 5M3MH 4K2KA 2O5IC 2P2UA 1M1KC 3M4OH 4C7RA 1HGVA 1WTQA 3VYIA 4IUUA 1C4QA 2QG4A 1M57D 1DD3A 1HBWA 2Q8IB 4CJ0B 3R4YA 1NTKK 2AUJD 3TGUE 2A69D 1W2BO 5CCGC 1TWCH 2O3JA 1GD7A 2L55A 3D8GA 1LTSC 4U673 2BH8A 4JPBW 2A6HC 4PZ6A 4UB8H 3H1LE 3NWTA 4X66Q 1PGQA 3F8TA 1HXYD 1CA5A 1SFCB 1PIXA 2K9JA 1QG7A 2I5LX 3L70G 3A8IE 1NTZD 3DMUA 1SNMA 3D3RA 4JBWA 1I5FA 4HJ9A 3ICEA 4NPSA 1STHA 3F2CA 4L5TA 2LKMA 4H44B 1VF7A 4PD4I 3TQYA 2YMKA 3SWYA 2IYPA 1B9MA 4DCKA 3QO2A 1AZPA 4IFFA 3UIAA 4RMFA 3CF5A 2QF7A 2K37A 2CW0C 5AJ3Q 4PD4E 1H9SB 1IZNB 1L1OC 2F0LA 2OTLP 4EQNA 5EBCA 2Y0EA 3HKZG 2B88A 1PZQA 1XMOQ 2KK7A 2QDLA 2XRSD 3F2BA 2MO0A 4MNOA 4BY7B 2FMMA 2IY5B 2AQ1B 3CCMP 3ZJYC 4PMCA 3CPWO 5C4XH 4V190 1IK7A 5AW7B 4PMWA 1LTJA 2JWDA 4AQYL 2O5JC 1IHZA 3L70E 4J15A 4HIOA 2EY6A 2FFDC 1LTRD 1Q12A 1RHPA 2EXZA 1I6HB 2Z1CA 2NPSC 2IFMA 1IYUA 1L0NK 4UPAA 4DR4Q 2G9DA 5A35A 1HR0Q 4DF7A 4H0LC 1JOQA 3HTKB 1EWHA 1L0LG 2KYVA 1RL2A 3TNUA 2YXRB 2ITAA 4JV5Q 1VL2A 1J6QA 5IT9c 3K7AH 2NN6H 3HKZE 2D2CC 1I94Q 1IBKL 2QIWA 4K6LA 2KS1B 2SNSA 1T8ZA 3J80i 1JICA 3HOUH 3A0BH 1I4QA 4DV5L 2RMZA 1A2TA 1FGUA 1OMIA 3RZDH 1H9KA 3TP6A 2RBMA 2W90A 2E5TA 4D6TG 3WDNA 4JI7Q 4L8JA 3L3OC 4CDDC 1DOKA 5KNCA 1Y47A 3VMXA 2A1AA 3O6QB 1H8AA 4A3BG 1VCIA 3CU7A 4L76A 3LWEA 1UEAB 1LWUC 1S5FD 3X3NA 1M90Q 2OYHC 1PZKD 1L0LE 5LMNQ 3S1NH 5IGDA 1SVFA 1LUZA 1EYCA 2D0PA 4NMZA 4C3IB 3BRVB 1KTKA 2B2WA 4IJLA 5G3LD 4YHHL 1L4AA 1OIPA 2YIUB 3RL0D 3H32B 5B5EE 1L0XB 1TWGH 5FOBB 1YHQA 2NTSA 2CPBA 1Y69U 4DV0L 1VQCA 4OGQC 4HIDA 3PP5A 4D6TE 4LFBL 3NTNA 1X54A 3E9IA 4DZOA 1LT9B 3TSSA 1SEBD 3P75A 4C3JG 3ITKA 4ALPA 5HGQA
chains in the Genus database with same CATH topology
1PH8A 1MJCA 4A3JH 5AW8B 3CCRA 2XZRA 4HIKA 2WT7B 2VQFQ 3K81C 2XTIA 1X9NA 4YCUA 1E7ZA 2YYZA 1Q46A 4HH2A 4B3SL 1IK9A 2ZM6Q 4HJ7A 1NU1K 4OONA 1PV4A 2A45H 3K0XA 1Y1VG 3CW2C 4B3TL 1N7SB 2R93G 2HHHQ 1KILC 1B8AA 3CCLA 4A76A 1XNQL 2K50A 2HIVA 2R7ZG 4N78E 1U5KA 2KLVA 1QZGA 4JI1L 1Z9FA 3D31A 2NVYH 3GDEA 2WITA 2Z4EA 1LTTC 2IX1A 2N1TD 5FLXc 1K8GA 2R7DA 2KENA 4A3BH 3KQGA 3F2DA 3W1BA 2R6GA 2ZTDA 4DR3Q 1UE7A 4UP9A 4LF7Q 4P75A 1PH3A 1S72A 1GU4A 2NPSD 1JO5A 4A3EH 2E8GA 2I5HA 1URQA 1G51A 1P8LA 3RK2C 1XNRQ 1NJIC 2KCMA 1SQQK 1UEBA 5DLQE 3S2HH 3UDFA 3CMEA 3AEVA 3PUYA 3A7OA 3GTLH 1FZCA 1T2KC 5C44G 2N3SA 2WTYA 3IRBA 2I5MX 3HRNA 1T9HA 2GVBA 1E5WA 2VS1A 1RE3A 1TXYA 4DOJA 1CZQA 2W6AA 1IFIA 4BXXH 4GN5A 1UE5A 1YVCA 2O1JA 3T1HQ 3H15A 1Y1WG 1JCDA 3BJUA 2Z0SA 2IT1A 4WJ4A 4KI0A 5ELOA 3M0AA 5AVVB 2UUBQ 4YCVA 1OXZA 4X62L 2C9NY 4DR6L 2MFIA 3U4VA 1IZ6A 4R1JA 5C0XI 3B5NC 4AIMA 5FJ8G 1Q1BA 1VQJA 4JBJA 3I7FA 3V2QA 3BASA 4YWKA 2JA5H 1TWAH 1GL2A 4LC1A 2VY3A 4JI8L 4A3MH 1VQ6A 1Q82C 3C9IA 1VQBA 3OTOL 2K52A 3K7UC 5AVRB 3UDGA 5AVXB 2VQEL 4LFAL 2LSSA 4XIGS 1PH4A 2O01H 3HUSC 5KJ7D 2XV5A 3Q8DA 2D0OA 3PSIA 3HOXH 4LF6Q 1JE5A 3HD7B 1J5EQ 1OXXK 2FYZA 1DH3A 2RCNA 1GU5A 1A8VA 2VZAA 4R4CA 4LF5L 2I1KA 5C3EH 1A02J 3ULJA 5C4XG 2VRSA 1XTDA 2L5GB 1EQRA 5AVQB 3TEHB 4DUYQ 4K0KQ 3M85A 2VNUD 1JT8A 1NKZB 3RK2D 4KHXA 2Q2IA 3HOUG 1VQ5A 4X65Q 3R2PA 1RF1B 3VP9A 1SFCA 1EIYB 1X3EA 3T1YL 1QVGA 1S40A 4PG3A 3KJOA 3GO5A 1LTJC 1HNZQ 1MIUA 3U4ZA 4I2LC 5AW0B 3RNUA 4R4OA 3JAMi 3WWVA 5IWAQ 2UU9Q 1AH9A 2N49A 4LF7L 2ALYB 2AKWB 4JI0Q 3CCJA 4L5RC 2POHA 2Q9IA 4AYBG 1IFDA 3NENA 3HTKA 4IFDK 1M1JB 2JQOA 4A3JG 2D62A 3TSIA 4PZ7A 1KQSA 2W6BA 1PH2A 3S1RH 1K9MC 3GTJH 1N8RC 3CI9A 5LMUL 2VUMH 4Y99B 2B3GA 1QVFA 1IO4A 2JEAI 4AYCA 4BBRG 1XPRA 4EOTA 3KFUA 3PGZA 3ULPA 5HY6A 2PMZE 4AYBE 2A45G 4POGA 5J3BA 1PHJA 3HFZB 1SP4A 3BU2A 4W7YA 4BA1I 2ASBA 3H32A 1EUJA 3KJPA 2J58A 3BZKA 5JJKA 2A45I 4DR7Q 1LT9A 1GKHA 3I4NH 2FKWB 4WBAA 2K75A 2UXCL 2AWOA 1X3FA 2UUBL 2WT7A 3PUXA 1VQLA 3PO3H 2YMYA 2WWWA 1S3OA 1X6OA 2E5LL 2YKQA 5EAYA 3VMZA 3SWFA 1YZ6A 3RK3D 2BASA 1FU1A 3M3YH 4A3BG 4BA2I 4LF4L 2PP6A 2QM7A 3M06A 1OWAA 3U50C 1SR3A 1WI5A 2UXBQ 3L37A 4WY4B 2H5XA 3RN5A 3I2ZA 3FKIG 4QL5A 1FZBA 1CKMA 2OYIB 3DLLA 1FZAA 3MEFA 3M0DA 1JTHB 2WPSA 2E2IH 1ZV8A 2OQ0A 1YJNA 1G1JA 1MV8A 1NE3A 3RL0C 4X64Q 3GTPH 2O1KA 2WSFH 1YTZT 3S17H 1BBUA 4DV4L 2IPPA 4OH8B 2WZ7A 1BBWA 3TYYA 1OXTA 4NXMQ 4JF7A 1X3GA 1VDFA 1Z47A 2HG5D 3V2NA 1OTCA 1NBWA 2CFMA 1WYDA 1B7YB 1URQC 1N33L 2OARA 3F1ZA 4BXXG 2JA7H 4LFCL 2HT1A 4X65L 1LWUB 4IFDG 4JI3Q 1RIPA 1VQGA 2OYHB 1ASYA 5M5XH 1HNXL 3EN2A 3CXCA 3PF5A 4GKKQ 2LXJA 4JYAL 2PI2E 4DR5Q 1FOSF 1L4AD 1KRTA 1DGSA 4IFDI 1LTAC 1H95A 2C0WA 1QVCA 1K0RA 5IYDH 5KTBA 4A3MG 2R5DA 5CCHA 3W1GA 4C2MH 4A93H 1L0WA 2F4VQ 2JA8G 4A3LG 1KFNA 2KP8A 1K73C 5APXA 3I4OA 2Q2TA 5AVUB 4NXNL 2N1TC 1HH0A 2W27A 1IBLQ 3HOYG 1JCCA 1AQ5A 1YEZA 2GN5A 3OJAB 1VQEA 3HOXG 2L15A 5BR8L 4LGDE 3NEMA 2NVQH 1LTLA 3GTGH 1LTGC 1RE4A 3D0FA 2K14A 4A3FH 5C3EG 1VQ9A 1KILB 2YKPA 2K5VA 4UP8A 2A8VA 3RLNA 4GS3A 1UE6A 1D7QA 4HJ8A 1CI6A 4DV1Q 3S1QH 3MIWA 2HPCB 4UP7A 3K80C 2Q7CA 1NAFA 3S2DH 1IXRA 1FDMA 3G48A 2Q3IA 4LF8Q 2MO1A 4MZ9A 2XGTA 2E42A 5AVSB 1SQPK 5GAEC 4EQ5A 4IJHA 1YIJA 5AVWB 2NVXH 2H43A 1XTGB 4ME3A 2PQAB 4GKGA 2UXBL 1G2CB 2YV5A 4BY1H 4IPDA 4DV6L 3P32A 1EIFA 1LTBC 3AFQA 4X6AH 3V4WA 4M3LA 5M3FH 1NKNA 5AW5B 1URQD 3WMM0 4HYTB 2JK8A 1FL0A 2CPSA 2JEEA 4B3RQ 2KB7P 4OX9L 4R4IA 1SFCC 3VN0A 4DV2Q 3STBC 4DR1Q 1HZAA 4MTNA 1X8YA 3U59A 2R92G 3BATA 3BRTB 3EIVA 1NTGA 4JI6Q 2VUMG 1RF1A 5H1SE 3GTMH 1SROA 1Q1EA 3M9QA 1TWFH 4A3DH 2UXDQ 2HLOA 2HIXA 4C7NB 3IFMA 3CMAA 1XMQL 5KJ7C 4P72A 4RG1A 3A3YB 1AE2A 1JY2N 5M5WH 1N73A 3EBEA 2OQKA 4A3CH 1J1DB 2ID0A 4B3ML 1A02F 4WJ3M 1YBYA 4YY3Q 4JI3L 1SE8A 3A0JA 4GKJL 3B5NB 1VQNA 2RF4A 1N36L 1KD1C 4DV7Q 2ZTCA 3KOJA 2WPRA 3PO3G 1HNWQ 2OTJA 1HTLC 2CWAA 4DV3Q 4P73A 2KSJA 1GK6A 1GL2D 2JJLA 4A3KG 1HJPA 3E9HA 1HZCA 3MD0A 5K36G 1C0AA 2ZFCA 4X66L 4P74A 4BY7H 2WP8J 2MQHA 5CHXA 1WRGA 2RHQB 1T3JA 4O0AA 2XDJA 3HUSB 1I6HH 5AJ3L 2ZJQA 2LXKA 3V2RA 1IBLL 2YTYA 1XMOL 1PVOA 1FZGA 2KCTA 3PUVA 3I4MG 5JEAG 1Q81C 1CUKA 1OXSC 1RY3A 2C35B 1R9TH 1B70B 4YCWA 1CKNB 3CCQA 3VDYA 1QUQB 1IBMQ 1FJGQ 3CP0A 4DR4L 1HR0L 3FHWA 1C9OA 2XU6A 3U58A 4IOCA 4JV5L 3S1MH 5C0XG 5AW6B 3KYQA 1I94L 4GN3B 2UUCQ 4DUZQ 2HODB 3J80c 4C3IH 3M0DC 4WY4A 3HOZG 2MJZA 2WAQG 4JI7L 5CCGA 4DR2Q 4RESB 1ZR4A 1NWQA 1RF0C 2IHEA 2OYIA 1WJJA 1WCMG 3A5TA 3M9BA 1BKBA 2K4KA 5LMNL 2P7JA 1SFCD 2OCEA 3L36A 3RN2A 2H8PD 3STBD 1ZR2A 4QJFA 3LW5H 4DPGA 3AFPA 3CCUA 5IYCH 5IYBH 2I1JA 5M3MG 2R7FA 2WAQE 2ZJRA 3HOWH 3RLOA 1HVVA 4KHPQ 1CKOA 1JOCA 1EWIA 5IYDG 2IHFA 3N4XA 3HE5B 3CC2A 1FZEA 4JI2Q 4N3YB 2VQFL 4GOPB 3IR9A 3CCSA 2QA4A 1AE3A 2GUSA 1JY2P 1P16A 1CSPA 2EQSA 3KDFB 3H0GH 3CAMA 2ZM6L 3RK3C 2RHSB 5IP7H 3CCVA 4GNXB 1A63A 3HE4B 1DX7A 4LUZA 1I3QH 1LWUA 2A19A 4A75A 3L2PA 1NTMK 2HHHL 1EFWA 3B6YA 4I6MC 4LF9Q 4JI4Q 1GTWA 5CCHC 1EOVA 2YO2A 3M91A 2NN6G 1QZHA 2PNHA 1YI2A 1E24A 2XKMA 2N8NA 3E1IA 2Y0SG 2NN6I 4XE5B 4TQUS 1JMCA 2IFNA 2Q5UA 4O9BA 1EQ7A 1N34Q 1UE1A 4DR3L 1G1IA 4LLHA 4DAMA 1E1OA 1N32Q 4KLKA 2BA1A 3TRZA 3A5ZB 1GK4A 2Y0SE 1XNRL 1N7SD 2NZHA 3NMDA 4C3JH 3KF6B 1KHIA 3A74A 2K5HA 1KILA 1Q7YC 3DM3A 3LIDA 3TS0A 3L0OA 3RR5A 5M3FG 1EQQA 1UWVA 2WPQA 1G6PA 5CMZA 1VQIA 3RL0B 3JC66 1A62A 3PUWA 1L4AC 3UE0A 1JY3N 2HPCA 4JOIA 1HGZA 4QIWE 2MNAA 2R93H 3TREA 2IX7C 4AQYQ 3GHGB 3J81j 1A0IA 2Z6KA 3ER0A 2Z5IA 3TK1A 1NH4A 3OYYA 1YNXA 3V4QA 1E22A 3PF4A 3T1HL 3T97A 3KF8B 3UDXA 2PQAA 1MJEA 1IBKQ 1G2CA 2C9LY 4DV5Q 5GAHC 3CD6A 1HWTC 4A3CG 2P67A 4A3GH 3G4SA 1X9VA 3PIOA 3P8MC 1JJ2A 1KRSA 1T3UA 4GIFA 1SFOH 3MGNA 5IE8A 1XTCC 1LTIC 5APQA 1N7SA 4YHHQ 1NOHA 4OXPA 1L0LK 2QM8A 4DV0Q 2B29A 4A3EG 1FOSE 4LFBQ 2E43A 3J81c 1IL2A 5CCHD 4TVAB 2UUAQ 4C7NA 4BY7G 1QL2A 5JJIA 4R4TA 1WFQA 1N73C 2N1TB 1L1OB 4LF6L 1KAWA 3GD7A 3UDIA 2ES2A 1Q86C 1LM0A 1YITA 1J5EL 4P71A 5JEAJ 1LGHB 4B3SQ 2JA9A 3PV0A 3CCEA 1ZLLA 2FFDB 2NPSB 4JBMA 2M8RA 2EIFA 1YJWA 3B5NA 1ASZA 4B3TQ 1HJBA 5GADC 2HYNA 3EFGA 5C0XJ 4GLAC 4DAYB 4DUYL 4K0KL 4Y52H 4LF9L 1GW3A 1FJKA 3PO2H 1CSQA 1VQHA 4KHZA 2DGYA 2CWPA 1XNQQ 1SQBK 1KZUB 1FZCC 1KL9A 4JI1Q 1X79B 3KLWA 4A3IH 1NO4A 3HUSA 3OA7A 2NVTH 1RE3C 1HNZL 1DEBA 1JY3P 1W2BA 3LGJA 3MTUE 2JA5G 1JB7A 3JAMc 3HD7D 5IWAL 2UU9L 3PIPA 5IYBG 1L2FA 4JI0L 2ZTEA 1N32L 1CKNA 1Y14B 1QUQA 3J7A5 1MZ9A 3BVHA 1JY2O 2Q2UA 1SQVK 3G71A 4ZKUA 3S16H 4WY4C 3GTOH 4POFA 1VQOA 1V43A 3EQ2A 2XNXA 1J1EC 3TS2A 2WFWA 2HODA 3CPWA 2OYIC 1V1QA 4EX5A 2JEBI 3FP9A 2F52A 4W80A 1HZBA 3H0GG 1E1TA 1K83H 1GL2C 5IP7G 1VQMA 2QGQA 3CL3D 4PZ8A 1CW5A 5APYA 5IP9H 4IPHA 1GZLA 4GN4B 4B86A 3MXNB 1SLJA 3CLQA 2AWNA 1WOCA 2Z5HA 2ZXEB 4R4QA 4DR7L 4IPGA 1Q8KA 4JCVE 3HE5A 1NTZK 4GOPA 1GDTA 2JA6H 2KHIA 4X62Q 3HD7A 1IFJA 1SMXA 3L35A 4DR6Q 2HQLA 3KDFA 4IFMA 4GNXA 2H7HA 3GTKH 5AW3B 3ERSX 1N86A 3HE4A 1VQPA 2KHJA 2Q2HA 3V5BA 3RK2B 5BVZA 4JI8Q 2I0QA 1M90C 1JMMA 1W3SA 1IC2A 1H88A 4DK6C 3OTOQ 1VQ8A 1JNMA 2CKZB 4Y7NH 3H3VH 5AW2B 1X65A 4LFAQ 2VQEQ 4IPCA 2JJQA 1X56A 3HOVH 4X64L 2FXMA 1S9KD 1WT6A 1HUCA 2KOGA 1OXUA 5APVA 4C3HH 3NBHB 3G3ZA 1IFNA 1VPCA 5CJ4A 4BBRH 4NXML 4OWWB 2CQOA 4OWXB 4EIJA 3ULLA 3GTQH 1JJGA 4LF5Q 3K8AA 1J2JB 4AH6A 1GM5A 4BBSH 1XPUA 2FYUK 2HFED 4HJ5A 4L5SA 5AVYB 3KYHC 4XTCS 1SRUA 3I4NG 4APVA 4WY4D 1AFOA 1E3PA 5CCGD 1M1JA 3KF6A 1HH2P 5APUA 2R3CA 3M4QA 1PH1A 1VQKA 4GKKL 4JOIC 1CSBA 4A3GG 1YYCA 4DR5L 3T1YQ 1JUNA 3CPFA 5M5YH 2Z6KC 3E0EA 2J59M 1KC8C 1NMGA 4DNIA 2P1JA 2IX0A 3OAKA 1OXVA 2F4VL 2YO3A 1D8LA 1LT9C 3FKIH 3GHGA 3S14H 4JI5Q 4AQRD 2N9BA 2R32A 3MUDA 5FLMH 3P8CD 4DK3C 1BVSA 4YWLA 5ELNA 1PH5A 3L4FA 3RK3B 3I55A 3CC4A 2C0XA 5LMUQ 1VQDA 2F3IA 3CC7A 1MKHA 1GW4A 1FZFA 1N7SC 4W7ZA 4L5QA 1ZN5A 2GUVA 3B8EB 3UE1A 1W2EA 4I1LA 3PO2G 4DV1L 2JA7G 4IFDJ 3W5OA 4LW1A 1JTHA 1JY3O 2KBNA 3U1AA 4LUOA 5KLVK 2N1TA 5BU5A 4LF8L 1LTJB 2B63H 1L1OA 2N78A 2UXCQ 2BA0A 1J1DC 4A3IG 2GVAA 3M7NA </