2K37A

Csma
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
59
structure length
59
Chain Sequence
MSGGGVFTDILAAAGRIFEVMVEGHWETVGMLFDSLGKGTMRINRNAYGSMGGGSLRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Chlorosome Protein A
publication title The three-dimensional structure of CsmA: A small antenna protein from the green sulfur bacterium Chlorobium tepidum.
pubmed doi rcsb
total genus 17
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2008-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.950 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces bacteriochlorophyll c-binding protein 2k37A00
2K37A
chains in the Genus database with same CATH superfamily
5KLVD 2FYZA 1L0NG 3G9RA 3H1LJ 3CX5E 3GHGA 3PH0A 3KDPB 5APVA 1QX8A 3AE4C 1EDKA 1IFIA 1HJ0A 1QL1A 1EC5A 2A45H 5APYA 3Q1MA 2BCCJ 3FGAD 1KQGB 3AE2C 1JMMA 3T97A 3Q2YA 2D2CD 3E7KA 1FBMA 3GF7A 3O8ZA 2QRXA 4XFJA 1Q81Q 4H44C 3V4WA 2K9YA 1K9MQ 3HE5A 2M5AA 5DJUB 3CWBJ 4IL6H 2BEQD 3CXHD 1NAFA 1DD4A 2YO3A 4KJMA 1KYOH 4OVNF 1RF1B 3KZIE 2D2CC 2IX7C 3H1JE 3KPEA 3L73G 2XDJA 4WY4B 3M9HA 1R5SA 2KS1B 4N6JA 4UB6H 2BCCD 3EFGA 1UIXA 3V5BA 2ZVNB 1S9KD 3SFDC 1HBWA 2O1KA 3L72D 2ZT9D 3O6QB 3USSA 1KB9D 3RL0D 1R5LA 3SWKA 1W2BO 1KQFB 1SQBK 3RK2B 3U1AA 2JO1A 4BRYB 3I5CA 2NPSB 2KSJA 2ZT9C 1YITP 4Y28J 2KZJA 5APQA 1KQLA 3H1HE 2OTJP 1NU1G 1M8OB 1W5CE 3M9BA 1HGVA 2M5AB 5AW3B 3LW5J 5APXA 2IPPA 1PGOA 4RKUJ 3BCCD 3CX5D 1KILC 2W90A 4NPDA 2YXRB 5AVTB 3H1JJ 1LJ2A 3AE6C 2KXPB 1SQBD 1GMJA 2WPSA 4U3FG 3K5BA 2Z4EA 4GIFA 1U7JA 2KLUA 1VDFA 3FWNA 3SFEC 3WUVA 1IFPA 4MN4C 4KHXA 1YJNP 2V7QJ 1HUCA 1LT1A 2ZXEB 5KJ7A 1ZR4A 1GK6A 1MUUA 1LWUB 2B88A 2E75B 1PL5A 2R3CA 3H1IJ 4PD4H 3R2PA 2GM4A 3H1JD 2E76B 2YMKA 3C8VA 2KNCA 3WU2H 1YBKA 2QA4P 4TLFA 2NZ2A 1GK4A 3HTKA 3H32A 2IBZI 3B5ND 1SFCA 2WMMA 2RN0A 1VQ9P 3NMDA 3RK3D 3H1KD 2Y9ZA 3V6IA 3GF3A 3LIEA 5KAFE 2XKMA 3AECC 2C9NY 3H1ID 2E74D 4PV1D 3VP9A 3B5NC 1OW7A 2KIKA 1URQD 2HODA 3RK3C 4K35A 1PV3A 2C0WA 2WSEJ 2FY8A 4H44B 1YJ9P 2PGDA 2WTYA 1UIIA 5AW5B 1YTZT 2E74C 1CSBA 1N73A 1SQXG 1EDLA 1URQC 5B66H 1FC2C 1RF0A 2G8YA 1GU5A 1AVOA 2DW3A 4WB4A 2J58A 1NU1K 1M57D 1BE3D 4I7ZC 1BSNA 1NTZK 1FE6A 1BDCA 1N8RQ 2WSSH 1PGPA 1U57A 4PD4E 3CLQA 2OYIA 2HPCB 2M8RA 3S1KA 2WPVB 3HTKB 1SQPE 1L2PA 3SWYA 3Q3DA 5KAIH 3KHUA 1P84E 1NO4A 1QEXA 1PFIA 2HG5D 3H25A 3CPWO 3F89A 1M1KQ 1T2KD 2YMYA 3D70A 3VMXA 1Y47A 2BASA 1FJPA 2IBZE 1AQ5A 1PPJE 1GL2B 1NWQA 1K04A 2H8PD 2H88C 1KZUB 2QVAA 1Q86Q 3HUSB 1LTJB 1T2KC 1KILB 4GOFA 3CXHH 2JKVA 1U7MA 2IFMA 1BCCE 1JEKA 1OFCX 2K9JA 5B66E 1SQVK 5AVUB 4WY4D 1NOHA 1JM0A 1FZBA 1MV8A 1EZVI 3AE3C 2JWDA 4YXDC 4JPZB 1KQSO 5AW8B 3P7KA 3C9IA 3CI9A 1RF1C 2B89A 1SQQG 1RE4A 1KB9H 3S4RA 1L0LE 1SQPJ 2AEJA 1LP1A 1N7LA 1N7SC 2QG4A 1NYHA 2FYUE 5M1BA 2OQQA 3RK2D 1NTKJ 3A2AA 4IOIH 5KKZC 3M0DC 5KLVE 3H1LG 2NPSD 2B87A 3L74E 3W67A 2WT7A 3FWLA 2L5GB 2XZRA 1SQVD 1ZMEC 4M3LA 2YIUC 1L4AC 1T3UA 3RK2C 4ASVA 5CCGA 2ZYAA 3VTPC 2QM8A 4LLHA 2FBWC 5AW0B 1H88A 1FDIA 5APUA 2L91A 3M9QA 1JY3N 2A06G 1DEBA 3CX5H 1NGMB 1P84D 2R44A 2P7JA 3SWFA 1ZLLA 1NTKD 1NTMK 3CWBG 1BCCJ 3CXHE 3UIAA 3BASA 1DEEG 3NTNA 1VQLP 2K1AA 3E1IA 2FFDA 2XV5A 3CMAP 1GU4A 2IBZD 3IF4A 2BCCE 1W2EA 2KSEA 3HE4B 2Q5UA 1L0LJ 1S9KE 1R8EA 1OVRA 3L72E 3AE9C 3LW5H 2FKWB 1PGQA 3PP5A 4DJGA 3VMAA 2JR8A 2FYUJ 2E75D 1H0TB 5KLVJ 2H43A 2MKVA 2H7HA 2E76D 1AV1A 3L74J 3CCLP 2I8DA 3M06A 1AA0A 3CCEP 1G1IA 2N1TA 2Q6QA 2OGUA 1JY2N 3H6PA 2AEFA 2E75C 3QWOC 2V7QH 3CCJP 3GW6A 1LNQA 2E76C 1KILE 2O1JA 2KUBA 2Y0CA 1RY3A 2IFNA 3PJSK 1NJIQ 2W6BA 2WPQA 2N9YB 1M7LA 2M0BA 2FYUD 1OXZA 3EFFK 3KYQA 4RJTA 3TNUA 4LGDE 2YO2A 1A02J 3BCCE 4L74A 3L74D 1IC2A 3H1JG 2G3AA 4H44D 3C1LA 2GA1A 2C9LY 1SQBE 1AFOA 3L71J 3AE8C 5CJ0A 1S2EA 1LTTC 2I1JA 2IZ1A 3L72J 2V4HA 1MFTA 1E79H 3TGUD 1ZR2A 4Y99B 5APWA 4GDOA 4AUWA 3P8MC 3OJAB 2CPSA 4JF7A 4NPFX 3S9OA 1KYOI 4OH8B 2WSEH 3R4YA 3G71P 5KJ7C 3L75D 4A7PA 1LTIC 5GTIH 3N4XA 1N7SB 4IL6X 1LGHB 3GG2A 2WSFJ 3L71D 1FZCB 3P32A 1J1DB 5KKZB 2A45G 2R5BA 1KTMA 3L35A 3H1HG 4L75A 2JP3A 1ZP0C 3SSUA 3RK3E 5AVSB 3G3ZA 3H1KE 1EZVD 1YJWP 3BCCJ 2YIUB 1L4AB 1QL2A 4N3YB 1T8ZA 3H1IE 3CCSP 3A0HE 3GHGB 1SFCC 4ZKPA 4ZNCA 1GL2D 1SQBJ 1OIPA 1M1JA 1USEA 1YHQP 3V2NA 1KILD 5AW2B 1NHLA 1RQUA 3T97B 3B4SA 5KAFH 1GL2C 5AVYB 2JEEA 4D6TJ 1A02F 3B8EB 1FZAA 3HUSC 3HE5B 1CW5A 1LTJC 2WVRA 2ZXXA 1BE3E 5BU8B 1L0NK 3RBXA 2ZVOB 1MZ9A 5CCHD 1NAYA 1GTWA 1SP4A 2HFED 2E5YA 4ZKUA 5CBNA 1GD2E 1KV4A 5GTIE 1NKZB 4C7RA 1S72P 4HH2A 5AW7B 2W6JH 4OGQB 4D6TD 5CCHC 3BRVB 4HJGH 3H1KJ 3D6ZA 1NH4A 3IFMA 5AVRB 2J59M 1FZFA 1CZQA 2QEXP 3QH9A 4H13B 2RH0A 3JCUH 2KB7P 5AW9B 3FXEA 4EDFA 1BGYD 4I1LA 1L0ND 2SPZA 1P84H 3L73J 3M0AA 3Q5RA 2FYNB 3VOPA 3IAOA 1G2CA 4N78E 2O01J 1HF9A 4TT3H 2YKPA 2P10A 1BE3J 4DT0A 2WZ7A 4EI2A 4W7YA 2P67A 2E43A 3G4SP 2J5UA 3BRTB 1PZQA 1WT6A 5C39A 3U1CA 3L73D 2BEZF 1SQPG 3N7NA 1JY3O 1KD1Q 2GUVA 1EDIA 3ABVC 3D6YA 5BVZA 1S5LX 4L76A 1PP9E 1ZXGA 4L73A 1K73Q 5AVVB 3VN0A 4RO0A 4BXLA 1NU1J 1M90Q 1SQVE 1VF5C 2IBZG 1PPJG 3JCUE 5CCGD 1NTZJ 5TJHA 5AW4B 2KNCB 1Z56A 2QJKB 2HR3A 2N9BA 1SVFA 2UWJE 3TF5A 3H32B 1DX7A 2FXOA 4UB8E 1KYOD 1FOSE 1SFCB 4U3FJ 3CL3D 5TISE 1IFNA 1SLQA 3GMAA 4I6MC 5CCGC 1NTKE 1BCCG 1NVOA 1SS1A 1FZGA 3L4FA 3IN6A 1E5WA 1LT9A 1NU1D 1JY2O 2P2UA 1H89A 4EOTA 2HODB 4C7NA 1OVVA 2FXPA 2QJPB 3MD0A 1RHZB 1NTZD 1AJYA 4DCKA 2LKMA 2PFXA 2M3EA 1L0LG 3CCRP 2Q7CA 1KORA 1N73B 5K5GB 4U3FD 2KOGA 4W80A 3AE1C 2FYUG 4N78D 2ZAEB 1PP9J 5KLVG 1HWTC 3L74G 3B5NA 4GKGA 4JYBA 4Y99C 1FS0E 1N7SD 4OWFA 4WWIA 1SQVJ 3MZWB 2OYIB 4ZMDA 4HYTB 1NKNA 1HH0A 1KB9I 3E1RA 4H0LC 3A0BE 1URQA 1SQXK 2PAJA 3CCMP 1FZCC 1L4AD 4EIJA 1J1DC 1PP9D 1LTBC 1VL2A 3MUDA 1Q2NA 2WSFH 4RESB 2WSCJ 3CC4P 1RE3A 3MHVA 1LTSC 5APSA 2ITAA 2KP8A 3GHGC 2BCCG 1JTHA 3CCQP 2VRSA 3CD6P 5B5EE 3L72G 2KZIA 3CX5I 3V2PA 3A7OA 3TGUE 1VQOP 2CK3H 2RKLA 2K9JB 2YXQB 1EXIA 1VQMP 1SQXD 3OA7A 1OMIA 3L75E 4Z1MH 1NTMJ 2OYHA 5AVQB 3CCUP 3MP7B 4KT0J 3VMYA 1KMIZ 3L71E 3U59A 3HRNA 4OGQD 3V2RA 1QVGO 1LP1B 2K88A 3G6EP 1OX3A 2E5TA 2K3RA 3RBZA 3FX0A 5AW6B 3OW2O 1EZVE 1VF5B 3BCCG 4H13D 2R3SA 4OGQC 2OTKE 4EYYQ 1JMBA 2B87B 2WT7B 1NTMD 1JNMA 1S4XA 1OWAA 1SQBG 2KYVA 4GODA 1RF1A 5GTHH 4H13C 1EDJA 4WY4A 1FOSF 1N2DC 2OARA 1RQVA 1SQQK 2KS1A 3PHLA 1OVUA 2XNDH 3TGUJ 4PJ0E 2ZFCA 1KC8Q 3HD7A 2RMZA 3A0HH 4WBAA 3M0DA 2Q1KA 3LIDA 2WPRA 3O6QA 4XE5B 2FYNC 1JY2P 3L75J 2E42A 1ZRTD 1J1EC 3PTZA 2A45I 2Y0EA 1S3JA 2FFDB 1AVYA 4WVZA 4YPCA 3L70J 2ZYDA 4BRYA 4DZOA 4C46A 3NXSA 2KLVA 2NPSA 3AEAC 1PIXA 1M56D 2C0XA 5KJ7D 2O01H 1ZN5A 4D6TE 2KI7B 3H1KG 1IJDB 1SQQD 1N86A 4XA4A 1JCDA 3H1IG 3I56P 3P8CD 1FZEA 2XNXA 4H0LB 3EQ2A 1BGYE 2N1TB 3L70D 1L0NE 4DOJA 3H1LD 1K8AQ 2IDBA 1EQ7A 1BDDA 2YNYA 1SFCD 5GTHE 3PRJA 2LR2A 1JOCA 1VQKP 1FJKA 2QJKC 3HD7B 3AE5C 3TNUB 1VQ4P 4GOEA 1BE3G 2QJYB 2AXCA 2A06D 1ZV8A 1LWUA 5KLIB 3CWBD 1GZLA 4GT1A 1ZW0A 3GLMA 2OTLP 2P58A 3L73E 1WRGA 3KXDA 2QJPC 3D71A 3RL0C 2I1KA 1IFMA 5H2FH 1JB0J 1ZOYC 5APTA 2Z5HA 1N73C 1T6AA 2LXCB 1EXJA 3AEEC 1RF0C 2R32A 2P1JA 3EWKA 1VQ6P 2B9BA 3AEBC 5AVZB 1BGYJ 3ITKA 1X79B 1L0NJ 1NTZG 4BWNA 4QMAA 4IL6E 2WITA 1X9VA 2MJZA 1KYOE 1XTCC 2OYIC 3FXDA 3BATA 2FXMA 4I2LC 1X22A 4K3AA 4YTPC 4U7JA 4PD4I 3AE7C 4UB6E 1D7MA 5KTBA 1NU1E 1VQPP 3M91A 3V4QA 2O01N 4JBZA 4IFDK 2W8ZA 3JSVC 4AYCA 5CMZA 1DD3A 1NTZE 5EFWB 3PLNA 1YI2P 1M1JB 3CC2P 4UB8H 3AEFC 5TISH 5AW1B 1P84I 1KFNA 1LT9C 1OW6A 3RGUA 4U3FE 3MIWA 5DJTB 2HPCA 4IFFA 1HGZA 1VQNP 1J1EB 1PP9G 2WSCH 4AQRD 3I55P 4LC1A 5H2FE 3MGNA 3H1HJ 2M3BA 1X8YA 2QIWA 1IZNB 1FAVA 3WUUA 1KFMA 1SQVG 2ZJSE 3L37A 2IYOA 3WUTA 2YKOA 5CBOA 3Q5PA 1K05A 1IFJA 3CMEP 3B71A 1GL2A 3VMZA 2QSIA 1VF5D 1HJBA 1VQ8P 3HUSA 1NTKG 1S5LH 1MKMA 1DIPA 1LTJA 1RE4C 1KILA 4B86A 4PV1C 3H1HD 4JYCA 3A3YB 2D2CB 5E79H 3WMM0 2YKQA 1TU3F 2NRGA 3A0BH 1AQTA 1YYCA 4ASWA 3MUDC 2LXBA 1HVVA 1RE3C 4JQ0D 3IR9A 2Y9YA 1H8AA 3Q5SA 5CCHA 3CC7P 1S1CX 1YTZI 1G2CB 2Z5IA 4R4LA 5L8RJ 3WU2E 1SQXE 1RH5B 1LTAC 1YQ4C 1OZHA 1X0TA 1NTMG 1DH3A 2Q3IA 2ZT9B 1USDA 5B5EH 3RL0B 1G1JA 2JWAA 1Y8AA 1FDMA 1QLED 1GW4A 2OYHC 2FFDC 1QVFO 3CXHI 2O3JA 4HKZH 2AEMA 2QM7A 4H0LD 3TSIA 2H89C 1S5LE 2XU6A 2N1TD 2Y0DA 2ZYGA 4IFMA 1NTME 5E79E 1HTLC 1CI6A 1Y9BA 1IFDA 3NFQA 2W6AA 2N1TC 2KK7A 1GDTA 1SQPK 3TGUG 3HD7D 3HE4A 1IK7A 1VQ7P 3ZDMA 4WY4C 5AVWB 1NTKK 1LTGC 1SQXJ 3TK1A 2WWWA 1WMKA 1QGKB 5BU5A 3L75G 3V2QA 2K37A 1LT9B 1H0TA 1ZRTE 3HD7C 2QE7H 3VYIA 3W68A 3F5HA 5KAIE 3BVHA 3L70G 2R5DA 2QJYC 3L71G 1FDOA 4C7NB 2AXTH 2IYPA 4PJ0H 1Q90D 3AEGC 1T3JA 5KLIC 1MFZA 4PD4D 3TDKA 3II6A 2CPBA 2HYNA 1YQ3C 1KN7A 1EZVG 3AEDC 1SQQE 2NPSC 1J2JB 1SQPD 3MTUE 4W7ZA 1FU1A 3KQGA 3P8CE 3B5NB 2Q3EA 3L70E 3RK3B 3VP8A 5AVXB 3H1LE 1JUNA 1JY3P 1CI6B 2E74B 4PV1B 1L0LK 1PPJD 1URQB 2POHA 5CJ4A 3RL0g 4R4MA 2JDIH 1VPCA 2FYUK 1JO5A 3A5TA 3JC22 2Q9IA 1JCCA 5KLVK 3L36A 1XTGB 4I7ZB 2A06E 1KB9E 1PGJA 3KZIH 1BSHA 3CWBE 4CPGA 1BCCD 2PRRA 1IK9A 1Q82Q 4O9BA 4HB1A 2GUSA 1JTHB 4NPEA 3TYYA 2W27A 2W83C 1N7SA 2AXTE 1LWUC 1OW8A 2WQYC 4D6TG 1FZCA 1M1JC 5CHXA 1SQQJ 1YIJP 1L0LD 3OAKA 1IO4A 3CCVP 2HLOA 2JJLA 2PP6A 1GW3A 2IZ0A 1Q7YQ 1VQ5P 2OYOA 2OYHB 1BGYG 4YXWH 1L4AA
chains in the Genus database with same CATH topology
2K37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K37 A; 
#chains in the Genus database with same CATH topology
 5KLV D;  2FYZ A;  1L0N G;  3G9R A;  3H1L J;  3CX5 E;  3GHG A;  3PH0 A;  3KDP B;  5APV A;  1QX8 A;  3AE4 C;  1EDK A;  1IFI A;  1HJ0 A;  1QL1 A;  1EC5 A;  2A45 H;  5APY A;  3Q1M A;  2BCC J;  3FGA D;  1KQG B;  3AE2 C;  1JMM A;  3T97 A;  3Q2Y A;  2D2C D;  3E7K A;  1FBM A;  3GF7 A;  3O8Z A;  2QRX A;  4XFJ A;  1Q81 Q;  4H44 C;  3V4W A;  2K9Y A;  1K9M Q;  3HE5 A;  2M5A A;  5DJU B;  3CWB J;  4IL6 H;  2BEQ D;  3CXH D;  1NAF A;  1DD4 A;  2YO3 A;  4KJM A;  1KYO H;  4OVN F;  1RF1 B;  3KZI E;  2D2C C;  2IX7 C;  3H1J E;  3KPE A;  3L73 G;  2XDJ A;  4WY4 B;  3M9H A;  1R5S A;  2KS1 B;  4N6J A;  4UB6 H;  2BCC D;  3EFG A;  1UIX A;  3V5B A;  2ZVN B;  1S9K D;  3SFD C;  1HBW A;  2O1K A;  3L72 D;  2ZT9 D;  3O6Q B;  3USS A;  1KB9 D;  3RL0 D;  1R5L A;  3SWK A;  1W2B O;  1KQF B;  1SQB K;  3RK2 B;  3U1A A;  2JO1 A;  4BRY B;  3I5C A;  2NPS B;  2KSJ A;  2ZT9 C;  1YIT P;  4Y28 J;  2KZJ A;  5APQ A;  1KQL A;  3H1H E;  2OTJ P;  1NU1 G;  1M8O B;  1W5C E;  3M9B A;  1HGV A;  2M5A B;  5AW3 B;  3LW5 J;  5APX A;  2IPP A;  1PGO A;  4RKU J;  3BCC D;  3CX5 D;  1KIL C;  2W90 A;  4NPD A;  2YXR B;  5AVT B;  3H1J J;  1LJ2 A;  3AE6 C;  2KXP B;  1SQB D;  1GMJ A;  2WPS A;  4U3F G;  3K5B A;  2Z4E A;  4GIF A;  1U7J A;  2KLU A;  1VDF A;  3FWN A;  3SFE C;  3WUV A;  1IFP A;  4MN4 C;  4KHX A;  1YJN P;  2V7Q J;  1HUC A;  1LT1 A;  2ZXE B;  5KJ7 A;  1ZR4 A;  1GK6 A;  1MUU A;  1LWU B;  2B88 A;  2E75 B;  1PL5 A;  2R3C A;  3H1I J;  4PD4 H;  3R2P A;  2GM4 A;  3H1J D;  2E76 B;  2YMK A;  3C8V A;  2KNC A;  3WU2 H;  1YBK A;  2QA4 P;  4TLF A;  2NZ2 A;  1GK4 A;  3HTK A;  3H32 A;  2IBZ I;  3B5N D;  1SFC A;  2WMM A;  2RN0 A;  1VQ9 P;  3NMD A;  3RK3 D;  3H1K D;  2Y9Z A;  3V6I A;  3GF3 A;  3LIE A;  5KAF E;  2XKM A;  3AEC C;  2C9N Y;  3H1I D;  2E74 D;  4PV1 D;  3VP9 A;  3B5N C;  1OW7 A;  2KIK A;  1URQ D;  2HOD A;  3RK3 C;  4K35 A;  1PV3 A;  2C0W A;  2WSE J;  2FY8 A;  4H44 B;  1YJ9 P;  2PGD A;  2WTY A;  1UII A;  5AW5 B;  1YTZ T;  2E74 C;  1CSB A;  1N73 A;  1SQX G;  1EDL A;  1URQ C;  5B66 H;  1FC2 C;  1RF0 A;  2G8Y A;  1GU5 A;  1AVO A;  2DW3 A;  4WB4 A;  2J58 A;  1NU1 K;  1M57 D;  1BE3 D;  4I7Z C;  1BSN A;  1NTZ K;  1FE6 A;  1BDC A;  1N8R Q;  2WSS H;  1PGP A;  1U57 A;  4PD4 E;  3CLQ A;  2OYI A;  2HPC B;  2M8R A;  3S1K A;  2WPV B;  3HTK B;  1SQP E;  1L2P A;  3SWY A;  3Q3D A;  5KAI H;  3KHU A;  1P84 E;  1NO4 A;  1QEX A;  1PFI A;  2HG5 D;  3H25 A;  3CPW O;  3F89 A;  1M1K Q;  1T2K D;  2YMY A;  3D70 A;  3VMX A;  1Y47 A;  2BAS A;  1FJP A;  2IBZ E;  1AQ5 A;  1PPJ E;  1GL2 B;  1NWQ A;  1K04 A;  2H8P D;  2H88 C;  1KZU B;  2QVA A;  1Q86 Q;  3HUS B;  1LTJ B;  1T2K C;  1KIL B;  4GOF A;  3CXH H;  2JKV A;  1U7M A;  2IFM A;  1BCC E;  1JEK A;  1OFC X;  2K9J A;  5B66 E;  1SQV K;  5AVU B;  4WY4 D;  1NOH A;  1JM0 A;  1FZB A;  1MV8 A;  1EZV I;  3AE3 C;  2JWD A;  4YXD C;  4JPZ B;  1KQS O;  5AW8 B;  3P7K A;  3C9I A;  3CI9 A;  1RF1 C;  2B89 A;  1SQQ G;  1RE4 A;  1KB9 H;  3S4R A;  1L0L E;  1SQP J;  2AEJ A;  1LP1 A;  1N7L A;  1N7S C;  2QG4 A;  1NYH A;  2FYU E;  5M1B A;  2OQQ A;  3RK2 D;  1NTK J;  3A2A A;  4IOI H;  5KKZ C;  3M0D C;  5KLV E;  3H1L G;  2NPS D;  2B87 A;  3L74 E;  3W67 A;  2WT7 A;  3FWL A;  2L5G B;  2XZR A;  1SQV D;  1ZME C;  4M3L A;  2YIU C;  1L4A C;  1T3U A;  3RK2 C;  4ASV A;  5CCG A;  2ZYA A;  3VTP C;  2QM8 A;  4LLH A;  2FBW C;  5AW0 B;  1H88 A;  1FDI A;  5APU A;  2L91 A;  3M9Q A;  1JY3 N;  2A06 G;  1DEB A;  3CX5 H;  1NGM B;  1P84 D;  2R44 A;  2P7J A;  3SWF A;  1ZLL A;  1NTK D;  1NTM K;  3CWB G;  1BCC J;  3CXH E;  3UIA A;  3BAS A;  1DEE G;  3NTN A;  1VQL P;  2K1A A;  3E1I A;  2FFD A;  2XV5 A;  3CMA P;  1GU4 A;  2IBZ D;  3IF4 A;  2BCC E;  1W2E A;  2KSE A;  3HE4 B;  2Q5U A;  1L0L J;  1S9K E;  1R8E A;  1OVR A;  3L72 E;  3AE9 C;  3LW5 H;  2FKW B;  1PGQ A;  3PP5 A;  4DJG A;  3VMA A;  2JR8 A;  2FYU J;  2E75 D;  1H0T B;  5KLV J;  2H43 A;  2MKV A;  2H7H A;  2E76 D;  1AV1 A;  3L74 J;  3CCL P;  2I8D A;  3M06 A;  1AA0 A;  3CCE P;  1G1I A;  2N1T A;  2Q6Q A;  2OGU A;  1JY2 N;  3H6P A;  2AEF A;  2E75 C;  3QWO C;  2V7Q H;  3CCJ P;  3GW6 A;  1LNQ A;  2E76 C;  1KIL E;  2O1J A;  2KUB A;  2Y0C A;  1RY3 A;  2IFN A;  3PJS K;  1NJI Q;  2W6B A;  2WPQ A;  2N9Y B;  1M7L A;  2M0B A;  2FYU D;  1OXZ A;  3EFF K;  3KYQ A;  4RJT A;  3TNU A;  4LGD E;  2YO2 A;  1A02 J;  3BCC E;  4L74 A;  3L74 D;  1IC2 A;  3H1J G;  2G3A A;  4H44 D;  3C1L A;  2GA1 A;  2C9L Y;  1SQB E;  1AFO A;  3L71 J;  3AE8 C;  5CJ0 A;  1S2E A;  1LTT C;  2I1J A;  2IZ1 A;  3L72 J;  2V4H A;  1MFT A;  1E79 H;  3TGU D;  1ZR2 A;  4Y99 B;  5APW A;  4GDO A;  4AUW A;  3P8M C;  3OJA B;  2CPS A;  4JF7 A;  4NPF X;  3S9O A;  1KYO I;  4OH8 B;  2WSE H;  3R4Y A;  3G71 P;  5KJ7 C;  3L75 D;  4A7P A;  1LTI C;  5GTI H;  3N4X A;  1N7S B;  4IL6 X;  1LGH B;  3GG2 A;  2WSF J;  3L71 D;  1FZC B;  3P32 A;  1J1D B;  5KKZ B;  2A45 G;  2R5B A;  1KTM A;  3L35 A;  3H1H G;  4L75 A;  2JP3 A;  1ZP0 C;  3SSU A;  3RK3 E;  5AVS B;  3G3Z A;  3H1K E;  1EZV D;  1YJW P;  3BCC J;  2YIU B;  1L4A B;  1QL2 A;  4N3Y B;  1T8Z A;  3H1I E;  3CCS P;  3A0H E;  3GHG B;  1SFC C;  4ZKP A;  4ZNC A;  1GL2 D;  1SQB J;  1OIP A;  1M1J A;  1USE A;  1YHQ P;  3V2N A;  1KIL D;  5AW2 B;  1NHL A;  1RQU A;  3T97 B;  3B4S A;  5KAF H;  1GL2 C;  5AVY B;  2JEE A;  4D6T J;  1A02 F;  3B8E B;  1FZA A;  3HUS C;  3HE5 B;  1CW5 A;  1LTJ C;  2WVR A;  2ZXX A;  1BE3 E;  5BU8 B;  1L0N K;  3RBX A;  2ZVO B;  1MZ9 A;  5CCH D;  1NAY A;  1GTW A;  1SP4 A;  2HFE D;  2E5Y A;  4ZKU A;  5CBN A;  1GD2 E;  1KV4 A;  5GTI E;  1NKZ B;  4C7R A;  1S72 P;  4HH2 A;  5AW7 B;  2W6J H;  4OGQ B;  4D6T D;  5CCH C;  3BRV B;  4HJG H;  3H1K J;  3D6Z A;  1NH4 A;  3IFM A;  5AVR B;  2J59 M;  1FZF A;  1CZQ A;  2QEX P;  3QH9 A;  4H13 B;  2RH0 A;  3JCU H;  2KB7 P;  5AW9 B;  3FXE A;  4EDF A;  1BGY D;  4I1L A;  1L0N D;  2SPZ A;  1P84 H;  3L73 J;  3M0A A;  3Q5R A;  2FYN B;  3VOP A;  3IAO A;  1G2C A;  4N78 E;  2O01 J;  1HF9 A;  4TT3 H;  2YKP A;  2P10 A;  1BE3 J;  4DT0 A;  2WZ7 A;  4EI2 A;  4W7Y A;  2P67 A;  2E43 A;  3G4S P;  2J5U A;  3BRT B;  1PZQ A;  1WT6 A;  5C39 A;  3U1C A;  3L73 D;  2BEZ F;  1SQP G;  3N7N A;  1JY3 O;  1KD1 Q;  2GUV A;  1EDI A;  3ABV C;  3D6Y A;  5BVZ A;  1S5L X;  4L76 A;  1PP9 E;  1ZXG A;  4L73 A;  1K73 Q;  5AVV B;  3VN0 A;  4RO0 A;  4BXL A;  1NU1 J;  1M90 Q;  1SQV E;  1VF5 C;  2IBZ G;  1PPJ G;  3JCU E;  5CCG D;  1NTZ J;  5TJH A;  5AW4 B;  2KNC B;  1Z56 A;  2QJK B;  2HR3 A;  2N9B A;  1SVF A;  2UWJ E;  3TF5 A;  3H32 B;  1DX7 A;  2FXO A;  4UB8 E;  1KYO D;  1FOS E;  1SFC B;  4U3F J;  3CL3 D;  5TIS E;  1IFN A;  1SLQ A;  3GMA A;  4I6M C;  5CCG C;  1NTK E;  1BCC G;  1NVO A;  1SS1 A;  1FZG A;  3L4F A;  3IN6 A;  1E5W A;  1LT9 A;  1NU1 D;  1JY2 O;  2P2U A;  1H89 A;  4EOT A;  2HOD B;  4C7N A;  1OVV A;  2FXP A;  2QJP B;  3MD0 A;  1RHZ B;  1NTZ D;  1AJY A;  4DCK A;  2LKM A;  2PFX A;  2M3E A;  1L0L G;  3CCR P;  2Q7C A;  1KOR A;  1N73 B;  5K5G B;  4U3F D;  2KOG A;  4W80 A;  3AE1 C;  2FYU G;  4N78 D;  2ZAE B;  1PP9 J;  5KLV G;  1HWT C;  3L74 G;  3B5N A;  4GKG A;  4JYB A;  4Y99 C;  1FS0 E;  1N7S D;  4OWF A;  4WWI A;  1SQV J;  3MZW B;  2OYI B;  4ZMD A;  4HYT B;  1NKN A;  1HH0 A;  1KB9 I;  3E1R A;  4H0L C;  3A0B E;  1URQ A;  1SQX K;  2PAJ A;  3CCM P;  1FZC C;  1L4A D;  4EIJ A;  1J1D C;  1PP9 D;  1LTB C;  1VL2 A;  3MUD A;  1Q2N A;  2WSF H;  4RES B;  2WSC J;  3CC4 P;  1RE3 A;  3MHV A;  1LTS C;  5APS A;  2ITA A;  2KP8 A;  3GHG C;  2BCC G;  1JTH A;  3CCQ P;  2VRS A;  3CD6 P;  5B5E E;  3L72 G;  2KZI A;  3CX5 I;  3V2P A;  3A7O A;  3TGU E;  1VQO P;  2CK3 H;  2RKL A;  2K9J B;  2YXQ B;  1EXI A;  1VQM P;  1SQX D;  3OA7 A;  1OMI A;  3L75 E;  4Z1M H;  1NTM J;  2OYH A;  5AVQ B;  3CCU P;  3MP7 B;  4KT0 J;  3VMY A;  1KMI Z;  3L71 E;  3U59 A;  3HRN A;  4OGQ D;  3V2R A;  1QVG O;  1LP1 B;  2K88 A;  3G6E P;  1OX3 A;  2E5T A;  2K3R A;  3RBZ A;  3FX0 A;  5AW6 B;  3OW2 O;  1EZV E;  1VF5 B;  3BCC G;  4H13 D;  2R3S A;  4OGQ C;  2OTK E;  4EYY Q;  1JMB A;  2B87 B;  2WT7 B;  1NTM D;  1JNM A;  1S4X A;  1OWA A;  1SQB G;  2KYV A;  4GOD A;  1RF1 A;  5GTH H;  4H13 C;  1EDJ A;  4WY4 A;  1FOS F;  1N2D C;  2OAR A;  1RQV A;  1SQQ K;  2KS1 A;  3PHL A;  1OVU A;  2XND H;  3TGU J;  4PJ0 E;  2ZFC A;  1KC8 Q;  3HD7 A;  2RMZ A;  3A0H H;  4WBA A;  3M0D A;  2Q1K A;  3LID A;  2WPR A;  3O6Q A;  4XE5 B;  2FYN C;  1JY2 P;  3L75 J;  2E42 A;  1ZRT D;  1J1E C;  3PTZ A;  2A45 I;  2Y0E A;  1S3J A;  2FFD B;  1AVY A;  4WVZ A;  4YPC A;  3L70 J;  2ZYD A;  4BRY A;  4DZO A;  4C46 A;  3NXS A;  2KLV A;  2NPS A;  3AEA C;  1PIX A;  1M56 D;  2C0X A;  5KJ7 D;  2O01 H;  1ZN5 A;  4D6T E;  2KI7 B;  3H1K G;  1IJD B;  1SQQ D;  1N86 A;  4XA4 A;  1JCD A;  3H1I G;  3I56 P;  3P8C D;  1FZE A;  2XNX A;  4H0L B;  3EQ2 A;  1BGY E;  2N1T B;  3L70 D;  1L0N E;  4DOJ A;  3H1L D;  1K8A Q;  2IDB A;  1EQ7 A;  1BDD A;  2YNY A;  1SFC D;  5GTH E;  3PRJ A;  2LR2 A;  1JOC A;  1VQK P;  1FJK A;  2QJK C;  3HD7 B;  3AE5 C;  3TNU B;  1VQ4 P;  4GOE A;  1BE3 G;  2QJY B;  2AXC A;  2A06 D;  1ZV8 A;  1LWU A;  5KLI B;  3CWB D;  1GZL A;  4GT1 A;  1ZW0 A;  3GLM A;  2OTL P;  2P58 A;  3L73 E;  1WRG A;  3KXD A;  2QJP C;  3D71 A;  3RL0 C;  2I1K A;  1IFM A;  5H2F H;  1JB0 J;  1ZOY C;  5APT A;  2Z5H A;  1N73 C;  1T6A A;  2LXC B;  1EXJ A;  3AEE C;  1RF0 C;  2R32 A;  2P1J A;  3EWK A;  1VQ6 P;  2B9B A;  3AEB C;  5AVZ B;  1BGY J;  3ITK A;  1X79 B;  1L0N J;  1NTZ G;  4BWN A;  4QMA A;  4IL6 E;  2WIT A;  1X9V A;  2MJZ A;  1KYO E;  1XTC C;  2OYI C;  3FXD A;  3BAT A;  2FXM A;  4I2L C;  1X22 A;  4K3A A;  4YTP C;  4U7J A;  4PD4 I;  3AE7 C;  4UB6 E;  1D7M A;  5KTB A;  1NU1 E;  1VQP P;  3M91 A;  3V4Q A;  2O01 N;  4JBZ A;  4IFD K;  2W8Z A;  3JSV C;  4AYC A;  5CMZ A;  1DD3 A;  1NTZ E;  5EFW B;  3PLN A;  1YI2 P;  1M1J B;  3CC2 P;  4UB8 H;  3AEF C;  5TIS H;  5AW1 B;  1P84 I;  1KFN A;  1LT9 C;  1OW6 A;  3RGU A;  4U3F E;  3MIW A;  5DJT B;  2HPC A;  4IFF A;  1HGZ A;  1VQN P;  1J1E B;  1PP9 G;  2WSC H;  4AQR D;  3I55 P;  4LC1 A;  5H2F E;  3MGN A;  3H1H J;  2M3B A;  1X8Y A;  2QIW A;  1IZN B;  1FAV A;  3WUU A;  1KFM A;  1SQV G;  2ZJS E;  3L37 A;  2IYO A;  3WUT A;  2YKO A;  5CBO A;  3Q5P A;  1K05 A;  1IFJ A;  3CME P;  3B71 A;  1GL2 A;  3VMZ A;  2QSI A;  1VF5 D;  1HJB A;  1VQ8 P;  3HUS A;  1NTK G;  1S5L H;  1MKM A;  1DIP A;  1LTJ A;  1RE4 C;  1KIL A;  4B86 A;  4PV1 C;  3H1H D;  4JYC A;  3A3Y B;  2D2C B;  5E79 H;  3WMM 0;  2YKQ A;  1TU3 F;  2NRG A;  3A0B H;  1AQT A;  1YYC A;  4ASW A;  3MUD C;  2LXB A;  1HVV A;  1RE3 C;  4JQ0 D;  3IR9 A;  2Y9Y A;  1H8A A;  3Q5S A;  5CCH A;  3CC7 P;  1S1C X;  1YTZ I;  1G2C B;  2Z5I A;  4R4L A;  5L8R J;  3WU2 E;  1SQX E;  1RH5 B;  1LTA C;  1YQ4 C;  1OZH A;  1X0T A;  1NTM G;  1DH3 A;  2Q3I A;  2ZT9 B;  1USD A;  5B5E H;  3RL0 B;  1G1J A;  2JWA A;  1Y8A A;  1FDM A;  1QLE D;  1GW4 A;  2OYH C;  2FFD C;  1QVF O;  3CXH I;  2O3J A;  4HKZ H;  2AEM A;  2QM7 A;  4H0L D;  3TSI A;  2H89 C;  1S5L E;  2XU6 A;  2N1T D;  2Y0D A;  2ZYG A;  4IFM A;  1NTM E;  5E79 E;  1HTL C;  1CI6 A;  1Y9B A;  1IFD A;  3NFQ A;  2W6A A;  2N1T C;  2KK7 A;  1GDT A;  1SQP K;  3TGU G;  3HD7 D;  3HE4 A;  1IK7 A;  1VQ7 P;  3ZDM A;  4WY4 C;  5AVW B;  1NTK K;  1LTG C;  1SQX J;  3TK1 A;  2WWW A;  1WMK A;  1QGK B;  5BU5 A;  3L75 G;  3V2Q A;  2K37 A;  1LT9 B;  1H0T A;  1ZRT E;  3HD7 C;  2QE7 H;  3VYI A;  3W68 A;  3F5H A;  5KAI E;  3BVH A;  3L70 G;  2R5D A;  2QJY C;  3L71 G;  1FDO A;  4C7N B;  2AXT H;  2IYP A;  4PJ0 H;  1Q90 D;  3AEG C;  1T3J A;  5KLI C;  1MFZ A;  4PD4 D;  3TDK A;  3II6 A;  2CPB A;  2HYN A;  1YQ3 C;  1KN7 A;  1EZV G;  3AED C;  1SQQ E;  2NPS C;  1J2J B;  1SQP D;  3MTU E;  4W7Z A;  1FU1 A;  3KQG A;  3P8C E;  3B5N B;  2Q3E A;  3L70 E;  3RK3 B;  3VP8 A;  5AVX B;  3H1L E;  1JUN A;  1JY3 P;  1CI6 B;  2E74 B;  4PV1 B;  1L0L K;  1PPJ D;  1URQ B;  2POH A;  5CJ4 A;  3RL0 g;  4R4M A;  2JDI H;  1VPC A;  2FYU K;  1JO5 A;  3A5T A;  3JC2 2;  2Q9I A;  1JCC A;  5KLV K;  3L36 A;  1XTG B;  4I7Z B;  2A06 E;  1KB9 E;  1PGJ A;  3KZI H;  1BSH A;  3CWB E;  4CPG A;  1BCC D;  2PRR A;  1IK9 A;  1Q82 Q;  4O9B A;  4HB1 A;  2GUS A;  1JTH B;  4NPE A;  3TYY A;  2W27 A;  2W83 C;  1N7S A;  2AXT E;  1LWU C;  1OW8 A;  2WQY C;  4D6T G;  1FZC A;  1M1J C;  5CHX A;  1SQQ J;  1YIJ P;  1L0L D;  3OAK A;  1IO4 A;  3CCV P;  2HLO A;  2JJL A;  2PP6 A;  1GW3 A;  2IZ0 A;  1Q7Y Q;  1VQ5 P;  2OYO A;  2OYH B;  1BGY G;  4YXW H;  1L4A A; 
#chains in the Genus database with same CATH homology
 2K37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...