2K37A

Csma
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
59
structure length
59
Chain Sequence
MSGGGVFTDILAAAGRIFEVMVEGHWETVGMLFDSLGKGTMRINRNAYGSMGGGSLRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chlorosome Protein A
publication title The three-dimensional structure of CsmA: A small antenna protein from the green sulfur bacterium Chlorobium tepidum.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 17
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2008-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.950 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces bacteriochlorophyll c-binding protein 2k37A00
2K37A
chains in the Genus database with same CATH superfamily
3A7OA 2GUSA 1HWTC 1BGYE 3FXEA 4KJMA 4ZMDA 2B87B 3PJSK 3HD7D 1SQBE 1NH4A 2QJYB 1AQTA 1S72P 5DJTB 4U3FE 2N1TA 1YJWP 2W6BA 2HR3A 1M8OB 4NPFX 1YHQP 5APTA 1Y47A 1HH0A 4H44D 3MP7B 3P8CD 2KP8A 2K1AA 3D6ZA 2KSEA 2K3RA 5AVRB 1KILE 2E74B 2YO2A 1KN7A 2B87A 2WSCH 1KQLA 4GKGA 5KLVE 5AW1B 2ZT9C 1SQPJ 2QRXA 1KV4A 4HKZH 1SQXE 3TYYA 2YXRB 2GA1A 5AW4B 3CPWO 2G3AA 2H88C 3L71G 3MUDC 3RL0C 3L75J 2ZXEB 2IBZE 4WY4D 3TF5A 2M3EA 3CCQP 5KLIC 1IFPA 2NPSB 1VQMP 5AW2B 1YTZT 4ZKUA 4Y99B 3F5HA 3P8MC 4XA4A 2RKLA 1D7MA 2ZYDA 2WPRA 3L70J 4YXWH 3CLQA 4UB8E 2Q6QA 4N78D 3JSVC 2XV5A 2ZVNB 2E43A 1VQKP 5L8RJ 2BASA 4L74A 2L91A 1BCCD 1RE3A 1P84I 2ZYGA 1FDOA 3AE3C 3OW2O 5B5EH 2IYPA 5GTIH 3AEGC 1R8EA 4BXLA 1S9KD 1JOCA 2W6AA 5CCHC 2NPSA 1RF1B 2E5TA 1R5LA 2KZIA 3GW6A 4R4MA 3GF7A 1YITP 3OA7A 4MN4C 3WU2H 2R32A 1OW8A 2OTKE 2Q9IA 3HUSB 4EIJA 2FBWC 3VN0A 2Y9YA 3EQ2A 4IL6H 4JBZA 3D70A 1EDJA 1SQPG 1VQ5P 1GTWA 3BRVB 2W8ZA 4L73A 4KHXA 5APSA 2OTJP 2HLOA 2H7HA 2QE7H 1JMMA 4Z1MH 3CXHH 1SQVE 3L75G 3IFMA 1RF1A 3SWYA 4ZKPA 1LTAC 1BE3D 4C7NB 1NKNA 1ZW0A 1X8YA 1Q86Q 2QA4P 3VTPC 3HUSA 1BCCE 3L70G 1VF5D 2E75D 3G9RA 1T8ZA 1NTKK 2OYIC 1Q90D 2IFNA 2AXTE 3LIEA 2OTLP 1S9KE 1NWQA 2K9YA 4JQ0D 1AV1A 2Y0EA 2CPSA 3M91A 1YJ9P 2CK3H 1L0LJ 3V2PA 5TISH 4WWIA 1L4AB 4LC1A 3RK2D 4C7NA 3CWBJ 4M3LA 1LWUC 2LXBA 4R4LA 4I7ZB 1FZEA 3RBZA 1EZVG 3L37A 3E1RA 3Q3DA 2P58A 4D6TD 1ZV8A 2KB7P 1M7LA 1R5SA 5H2FH 1OW7A 1SQQD 2QEXP 1NAFA 2ZJSE 3BCCJ 1M1JB 3A0HH 1FJKA 1J1EB 1L4AA 1PGJA 5KAFH 1FBMA 1NU1D 2FYUK 5AVQB 3AEBC 1M57D 4WY4C 1NKZB 2QVAA 2FYNB 4JPZB 1YBKA 1FOSF 4NPEA 1M90Q 1S5LX 1LJ2A 1A02J 4HH2A 3H1LJ 5APQA 1VL2A 5CBOA 3O8ZA 2R5DA 1S2EA 1M1JA 1X9VA 1ZMEC 1N7SC 2KOGA 1KB9H 3PLNA 1FS0E 1L0LG 3L36A 1QEXA 2SPZA 3CWBG 2WPSA 3AE4C 2QJPC 1NYHA 2KLUA 5AW6B 2YIUB 1FZCC 2Y9ZA 2LKMA 1YQ3C 3AE5C 1NVOA 1SQQE 3W67A 1K04A 5AVUB 1HJ0A 3KDPB 3B8EB 3H1HE 3TK1A 3L72J 1NU1E 2ZT9D 3GF3A 3TGUJ 3BCCG 3VMAA 3M0DA 1AFOA 2OARA 2R5BA 3A0BH 2IZ0A 1KQFB 3RL0D 1SQXK 2QJKB 3H32B 3L71D 2Z4EA 2YMYA 1JY3O 1PP9J 1RH5B 1S4XA 1HJBA 4IFMA 2ZFCA 2J59M 4XE5B 2VRSA 1U7MA 1Y9BA 2PAJA 5CCGA 1CI6B 3VYIA 1AVOA 1EDIA 3H1LG 1DEBA 3Q2YA 3H1IE 1KFNA 1RF0C 5B66E 1OWAA 2KUBA 2QIWA 3NMDA 3KZIH 1HGVA 2XDJA 2V7QJ 1CW5A 3CXHD 3H32A 1M56D 1JTHA 5KAIE 5CCHD 1H89A 1J1DC 1EXIA 5AVSB 2IX7C 4KT0J 3USSA 4BRYB 1NTKJ 3LW5J 3HD7B 2BCCJ 5BVZA 3VP8A 4OWFA 1CI6A 3WUVA 2OQQA 4PJ0E 3H1KJ 1GZLA 3L72G 3TGUG 3N4XA 1SQPD 1IFMA 1JEKA 3RL0g 1GDTA 5E79H 3S4RA 1W2BO 1FDIA 1X0TA 1NTME 4H44B 2WTYA 1RHZB 1Y8AA 4XFJA 2OYIA 1FJPA 3HTKB 3M9BA 1LTBC 2OGUA 1T6AA 2WSFJ 3CXHI 3A5TA 3L75D 4BRYA 1SQVK 3RK3C 2E76C 3HD7A 1PP9G 1ZR4A 4WB4A 4GODA 1GMJA 2WITA 1URQD 2DW3A 3MZWB 1FU1A 2YKOA 4DJGA 4JYCA 1GW3A 3L70D 1L0NE 1L2PA 2PFXA 3B4SA 4W7ZA 4IL6X 2C9NY 5AVWB 1YYCA 1N8RQ 2FYUJ 1DH3A 4PD4H 1GL2B 3CX5H 3AEDC 3HTKA 2ITAA 2WT7B 1IFJA 2WPVB 4I6MC 4RESB 4IFDK 3ABVC 1LT9B 2KYVA 3JCUH 2JWDA 1T2KD 3KPEA 4HJGH 2HFED 1NTKG 3T97B 2A06E 1OVUA 4TT3H 3RBXA 2BCCG 1GU4A 2JO1A 3B5NC 3I55P 1EZVD 2H89C 3WUUA 4ASVA 4C46A 3R4YA 3H1KG 1SQPE 3M0AA 3HRNA 3VMYA 5TISE 4WY4A 3L73E 3C9IA 1IC2A 1G1JA 4RKUJ 1EDLA 1GL2A 1P84D 2O1JA 2WT7A 2N9YB 4H13D 1LT9A 3S1KA 1G1IA 3GMAA 2KIKA 2V7QH 4UB6H 3SFEC 3T97A 1AJYA 1BSNA 4YPCA 3C1LA 3L70E 3L74J 3G71P 2I1KA 2D2CC 2XNXA 1YTZI 1QLED 3LW5H 2WZ7A 1VQ4P 1OMIA 1GU5A 4OGQB 2JJLA 1EZVI 2Z5HA 4N6JA 1BDDA 1NOHA 3PP5A 1KYOH 1SQXJ 3QH9A 1IZNB 1N7SD 2FYUG 1VQPP 4CPGA 2KNCB 3AECC 3ITKA 1KB9I 2R44A 1L0LD 1ZRTD 3NTNA 3P8CE 3AE1C 3Q1MA 1VQNP 1MFZA 3GHGB 2FXOA 1VF5B 2E75B 3CWBD 2WSFH 2P10A 3CC7P 4LGDE 2NZ2A 5EFWB 2E74D 4EDFA 1NGMB 2XNDH 2KSJA 2M5AB 1P84E 1NO4A 2I1JA 3BASA 1NJIQ 3PRJA 1HGZA 5AW9B 3V5BA 2NRGA 5KJ7C 3RK2B 3SWFA 2KNCA 4EI2A 2FFDC 1KC8Q 4GOFA 3AEFC 5GTHH 3BCCD 1BSHA 3GHGA 2R3CA 1OX3A 5APXA 1DEEG 3CMEP 1H8AA 5K5GB 3L74G 1TU3F 3AEEC 4GDOA 2WSSH 4N78E 2M5AA 1KILC 4DT0A 3CCSP 3S9OA 2YKPA 1QL2A 1RE4C 2AEJA 1URQC 3WMM0 2OYHB 3KHUA 3V2NA 1LNQA 3H1LD 1ZRTE 1SQXG 3RGUA 2L5GB 3CWBE 1JMBA 1SQVJ 2IBZG 2YNYA 2FY8A 5APYA 2WVRA 4AUWA 2UWJE 1KFMA 1Q81Q 4C7RA 5KTBA 1FAVA 1DX7A 5KKZC 5CJ4A 1LTJC 1T2KC 3CL3D 1J2JB 1VQ6P 2OYHA 3ZDMA 3VOPA 1LT1A 2C0XA 1JCDA 1IK9A 1JUNA 2A45H 3FGAD 3L72D 4PD4D 3TGUD 4IOIH 3HE5B 2KLVA 1BE3E 2AXCA 1S5LE 3V4WA 2O01J 2N1TC 1NTMK 4H13C 4PV1C 2J58A 3W68A 3CI9A 3RK3D 1NTZK 2E76D 1LTSC 4AYCA 3G3ZA 2LR2A 1K73Q 1PP9D 2ZT9B 3H1LE 1SVFA 2YMKA 4UB8H 1KZUB 1H0TB 1S3JA 3RL0B 3H1JJ 3TNUB 1L0NK 2BEQD 3HE5A 1JY2P 5KLIB 2QJYC 3UIAA 1SQVG 4PD4I 3CX5I 1OFCX 1SQBK 2QM7A 1RY3A 1S1CX 2MKVA 1GW4A 1Q7YQ 4D6TE 4JF7A 3Q5SA 3B5ND 1NTKD 3H6PA 2BCCD 3L72E 4IFFA 2P2UA 3CC2P 1YJNP 3K5BA 2E74C 1H0TA 3MUDA 3H1KD 3TNUA 1KYOD 1NHLA 3GG2A 1GK4A 1OIPA 3RK3E 5KLVK 5AVZB 4I2LC 2RN0A 2Q3EA 1RE3C 5CJ0A 5APUA 2HYNA 3KQGA 2LXCB 3PTZA 2FKWB 3IAOA 2RMZA 1JTHB 4RJTA 2IFMA 2D2CD 2NPSC 1HBWA 1HVVA 2Y0DA 5APWA 4Y99C 2OYOA 3V4QA 3H1HJ 2PGDA 3EFGA 2AXTH 1IK7A 2YO3A 5CCHA 1LP1B 2KS1B 3H1JG 3CCRP 2V4HA 1KYOI 1OVVA 2WSEH 2FXPA 2FYUD 3OAKA 1SFCD 1DD4A 4DOJA 5AVVB 2Q7CA 3CC4P 4WVZA 1DD3A 5TJHA 2O01H 4W80A 5M1BA 3II6A 1FZBA 2OYIB 1RF1C 3H1KE 1YI2P 2CPBA 5AW5B 1PPJG 1LTGC 3E1IA 3TDKA 2H8PD 1FE6A 1MFTA 3Q5PA 5CBNA 5CCGD 3H1IJ 1LP1A 2KS1A 4K35A 3HUSC 1ZXGA 1FZFA 5KJ7D 2BEZF 4ASWA 2JWAA 5B5EE 5GTIE 3G6EP 3SSUA 1LWUB 2M3BA 3EWKA 3KXDA 1WRGA 1GK6A 4H0LD 3L71E 2I8DA 1PIXA 1SP4A 2O01N 1PZQA 4HYTB 2C0WA 1KD1Q 4L76A 1H88A 3WU2E 1EC5A 2HPCB 3L74D 1MV8A 3H25A 1EDKA 4IL6E 1KILD 3CCVP 3H1HG 4GIFA 2K9JB 2IDBA 1AVYA 1LWUA 1CSBA 1NTMJ 2W6JH 3CXHE 1G2CB 1X79B 1SQXD 4WY4B 3V2QA 1NTZJ 4AQRD 1FZGA 1EQ7A 2IBZD 3PHLA 3CCUP 1L4AC 3AE9C 2B88A 2HPCA 1VQ7P 2JP3A 4I7ZC 2M8RA 2E5YA 2IZ1A 2PRRA 1BGYJ 1L0NJ 1N7SB 3CCLP 3H1IG 2K9JA 1OZHA 5AVXB 2P7JA 3HE4B 2WMMA 1SQBJ 5AVTB 1G2CA 1N2DC 2A45I 2QJPB 4U3FJ 3MHVA 3BRTB 1FZCB 2P67A 3L75E 1M1JC 1ZLLA 1X22A 1KB9D 4JYBA 3L74E 1J1EC 1LTIC 1W2EA 2N1TD 3U1CA 4PV1D 2IBZI 2ZXXA 5C39A 4EOTA 3MGNA 2K37A 1HF9A 3V2RA 3TSIA 1YIJP 5H2FE 1N7SA 2FYNC 1A02F 1JY2O 1IO4A 2B89A 1IJDB 2XZRA 1UIIA 2HG5D 1JO5A 3HE4A 1KQGB 1IFIA 1Z56A 3L73J 3A2AA 1WT6A 5KLVJ 2C9LY 1VQOP 3P7KA 3A0HE 1ZOYC 3U1AA 5KAFE 5B66H 1NTMG 3G4SP 1FZCA 1GL2D 3BVHA 1MZ9A 1NTZG 4DCKA 1SLQA 2Y0CA 1SQVD 3M0DC 1RQUA 5KAIH 1SFCC 2GUVA 1JY3P 1EZVE 4NPDA 4TLFA 3VP9A 1M1KQ 2KZJA 1OXZA 2YIUC 1E79H 1BGYG 1L0NG 4PJ0H 1U7JA 2JDIH 1T3JA 3QWOC 1Q82Q 3GLMA 1KB9E 1SQQK 1SQBG 5CCGC 1J1DB 2ZAEB 1SS1A 4K3AA 1PGQA 1OW6A 4U3FG 1E5WA 3V6IA 3FX0A 2QSIA 3FXDA 3E7KA 1NU1K 3CCEP 4H0LC 1JY2N 3PH0A 2KXPB 2W83C 2ZVOB 2A06G 2QJKC 3F89A 1AQ5A 1RF0A 2Q3IA 2NPSD 3D6YA 1JB0J 3BATA 4OGQD 3U59A 3WUTA 1UIXA 3L73G 5KLVG 2R3SA 2A45G 3A0BE 2Q5UA 3H1JD 1L0LE 3RK3B 2WQYC 2E76B 4L75A 2QG4A 2J5UA 5BU8B 2JEEA 5CHXA 3R2PA 1CZQA 4QMAA 5APVA 4W7YA 2N9BA 3FWNA 3M9HA 2XKMA 1ZP0C 3OJAB 3M06A 1VQLP 1N73C 4N3YB 3HD7C 1BCCJ 4WBAA 2O1KA 1PPJD 2JKVA 1XTCC 3CD6P 3VMZA 2FXMA 1N7LA 1AA0A 5AW7B 3KZIE 1PL5A 3CCMP 3BCCE 1NAYA 1OVRA 3O6QB 1RQVA 4YTPC 2WSEJ 2QM8A 1K05A 2AEFA 3CX5D 1GD2E 3B5NB 1FC2C 4H44C 5CMZA 1QGKB 4BWNA 1K9MQ 3NXSA 3L35A 3I5CA 2POHA 2RH0A 1YQ4C 2P1JA 4EYYQ 1JCCA 3H1JE 1K8AQ 3M9QA 1DIPA 2O3JA 2WWWA 2H43A 5E79E 3H1HD 1PFIA 1VPCA 3O6QA 1VQ8P 4LLHA 3MTUE 3NFQA 5AW0B 1BE3J 3SWKA 3B5NA 2GM4A 3EFFK 1GL2C 3IN6A 2D2CB 2HODB 3N7NA 4GOEA 2Z5IA 1L4AD 1LTTC 1PPJE 1KQSO 1LT9C 1FDMA 3JC22 3MIWA 4OH8B 3AEAC 1BCCG 1LGHB 1P84H 5AVYB 1Q2NA 4PD4E 3TGUE 3CX5E 1SFCB 3AE8C 3H1ID 3D71A 1W5CE 4O9BA 1JNMA 1SQPK 3CMAP 1VDFA 1T3UA 3KYQA 3JCUE 3IF4A 2HODA 4HB1A 2W90A 4RO0A 2YKQA 4D6TJ 1ZN5A 1IFNA 4U7JA 2AEMA 1PP9E 2K88A 2ZYAA 2M0BA 1PGOA 3IR9A 3A3YB 1SQQJ 3Q5RA 1USEA 1IFDA 2FFDB 3B71A 4H0LB 1SFCA 1PGPA 4OGQC 1NU1J 1MUUA 3AE7C 2E42A 1MKMA 5DJUB 1BE3G 1NTMD 4UB6E 4GT1A 2KK7A 4A7PA 3C8VA 1NTZD 1N86A 1KILB 1HUCA 1NTKE 2WSCJ 1URQB 2BCCE 4Y28J 5KJ7A 3GHGC 1VF5C 3MD0A 2E75C 1KORA 2FFDA 1BDCA 4ZNCA 3LIDA 2W27A 1KYOE 2MJZA 1JM0A 2XU6A 3AE2C 3SFDC 1BGYD 1L0ND 5BU5A 3P32A 3CCJP 2IPPA 2JR8A 4YXDC 2IYOA 1SQBD 2Q1KA 1USDA 3RK2C 1U57A 5AW3B 5KKZB 3L4FA 1N73B 1LTJB 4U3FD 1KILA 1QL1A 1S5LH 4D6TG 1XTGB 1RE4A 2FYZA 1URQA 4B86A 2A06D 2WPQA 2KI7B 4I1LA 1SQQG 1JY3N 1QVFO 2B9BA 3I56P 1VQ9P 1WMKA 4DZOA 3FWLA 5GTHE 3L73D 1NTZE 5KLVD 1QX8A 1FZAA 2G8YA 2YXQB 1NU1G 2N1TB 2FYUE 1HTLC 2OYHC 4H13B 1ZR2A 4PV1B 1PV3A 3L71J 1QVGO 1N73A 1LTJA 1KMIZ 3AE6C 1EXJA 1L0LK 4OVNF 2PP6A 5AW8B 1KTMA 3VMXA 1FOSE
chains in the Genus database with same CATH topology
2K37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K37 A; 
#chains in the Genus database with same CATH topology
 3A7O A;  2GUS A;  1HWT C;  1BGY E;  3FXE A;  4KJM A;  4ZMD A;  2B87 B;  3PJS K;  3HD7 D;  1SQB E;  1NH4 A;  2QJY B;  1AQT A;  1S72 P;  5DJT B;  4U3F E;  2N1T A;  1YJW P;  2W6B A;  2HR3 A;  1M8O B;  4NPF X;  1YHQ P;  5APT A;  1Y47 A;  1HH0 A;  4H44 D;  3MP7 B;  3P8C D;  2KP8 A;  2K1A A;  3D6Z A;  2KSE A;  2K3R A;  5AVR B;  1KIL E;  2E74 B;  2YO2 A;  1KN7 A;  2B87 A;  2WSC H;  1KQL A;  4GKG A;  5KLV E;  5AW1 B;  2ZT9 C;  1SQP J;  2QRX A;  1KV4 A;  4HKZ H;  1SQX E;  3TYY A;  2YXR B;  2GA1 A;  5AW4 B;  3CPW O;  2G3A A;  2H88 C;  3L71 G;  3MUD C;  3RL0 C;  3L75 J;  2ZXE B;  2IBZ E;  4WY4 D;  3TF5 A;  2M3E A;  3CCQ P;  5KLI C;  1IFP A;  2NPS B;  1VQM P;  5AW2 B;  1YTZ T;  4ZKU A;  4Y99 B;  3F5H A;  3P8M C;  4XA4 A;  2RKL A;  1D7M A;  2ZYD A;  2WPR A;  3L70 J;  4YXW H;  3CLQ A;  4UB8 E;  2Q6Q A;  4N78 D;  3JSV C;  2XV5 A;  2ZVN B;  2E43 A;  1VQK P;  5L8R J;  2BAS A;  4L74 A;  2L91 A;  1BCC D;  1RE3 A;  1P84 I;  2ZYG A;  1FDO A;  3AE3 C;  3OW2 O;  5B5E H;  2IYP A;  5GTI H;  3AEG C;  1R8E A;  4BXL A;  1S9K D;  1JOC A;  2W6A A;  5CCH C;  2NPS A;  1RF1 B;  2E5T A;  1R5L A;  2KZI A;  3GW6 A;  4R4M A;  3GF7 A;  1YIT P;  3OA7 A;  4MN4 C;  3WU2 H;  2R32 A;  1OW8 A;  2OTK E;  2Q9I A;  3HUS B;  4EIJ A;  2FBW C;  3VN0 A;  2Y9Y A;  3EQ2 A;  4IL6 H;  4JBZ A;  3D70 A;  1EDJ A;  1SQP G;  1VQ5 P;  1GTW A;  3BRV B;  2W8Z A;  4L73 A;  4KHX A;  5APS A;  2OTJ P;  2HLO A;  2H7H A;  2QE7 H;  1JMM A;  4Z1M H;  3CXH H;  1SQV E;  3L75 G;  3IFM A;  1RF1 A;  3SWY A;  4ZKP A;  1LTA C;  1BE3 D;  4C7N B;  1NKN A;  1ZW0 A;  1X8Y A;  1Q86 Q;  2QA4 P;  3VTP C;  3HUS A;  1BCC E;  3L70 G;  1VF5 D;  2E75 D;  3G9R A;  1T8Z A;  1NTK K;  2OYI C;  1Q90 D;  2IFN A;  2AXT E;  3LIE A;  2OTL P;  1S9K E;  1NWQ A;  2K9Y A;  4JQ0 D;  1AV1 A;  2Y0E A;  2CPS A;  3M91 A;  1YJ9 P;  2CK3 H;  1L0L J;  3V2P A;  5TIS H;  4WWI A;  1L4A B;  4LC1 A;  3RK2 D;  4C7N A;  3CWB J;  4M3L A;  1LWU C;  2LXB A;  4R4L A;  4I7Z B;  1FZE A;  3RBZ A;  1EZV G;  3L37 A;  3E1R A;  3Q3D A;  2P58 A;  4D6T D;  1ZV8 A;  2KB7 P;  1M7L A;  1R5S A;  5H2F H;  1OW7 A;  1SQQ D;  2QEX P;  1NAF A;  2ZJS E;  3BCC J;  1M1J B;  3A0H H;  1FJK A;  1J1E B;  1L4A A;  1PGJ A;  5KAF H;  1FBM A;  1NU1 D;  2FYU K;  5AVQ B;  3AEB C;  1M57 D;  4WY4 C;  1NKZ B;  2QVA A;  2FYN B;  4JPZ B;  1YBK A;  1FOS F;  4NPE A;  1M90 Q;  1S5L X;  1LJ2 A;  1A02 J;  4HH2 A;  3H1L J;  5APQ A;  1VL2 A;  5CBO A;  3O8Z A;  2R5D A;  1S2E A;  1M1J A;  1X9V A;  1ZME C;  1N7S C;  2KOG A;  1KB9 H;  3PLN A;  1FS0 E;  1L0L G;  3L36 A;  1QEX A;  2SPZ A;  3CWB G;  2WPS A;  3AE4 C;  2QJP C;  1NYH A;  2KLU A;  5AW6 B;  2YIU B;  1FZC C;  2Y9Z A;  2LKM A;  1YQ3 C;  3AE5 C;  1NVO A;  1SQQ E;  3W67 A;  1K04 A;  5AVU B;  1HJ0 A;  3KDP B;  3B8E B;  3H1H E;  3TK1 A;  3L72 J;  1NU1 E;  2ZT9 D;  3GF3 A;  3TGU J;  3BCC G;  3VMA A;  3M0D A;  1AFO A;  2OAR A;  2R5B A;  3A0B H;  2IZ0 A;  1KQF B;  3RL0 D;  1SQX K;  2QJK B;  3H32 B;  3L71 D;  2Z4E A;  2YMY A;  1JY3 O;  1PP9 J;  1RH5 B;  1S4X A;  1HJB A;  4IFM A;  2ZFC A;  2J59 M;  4XE5 B;  2VRS A;  1U7M A;  1Y9B A;  2PAJ A;  5CCG A;  1CI6 B;  3VYI A;  1AVO A;  1EDI A;  3H1L G;  1DEB A;  3Q2Y A;  3H1I E;  1KFN A;  1RF0 C;  5B66 E;  1OWA A;  2KUB A;  2QIW A;  3NMD A;  3KZI H;  1HGV A;  2XDJ A;  2V7Q J;  1CW5 A;  3CXH D;  3H32 A;  1M56 D;  1JTH A;  5KAI E;  5CCH D;  1H89 A;  1J1D C;  1EXI A;  5AVS B;  2IX7 C;  4KT0 J;  3USS A;  4BRY B;  1NTK J;  3LW5 J;  3HD7 B;  2BCC J;  5BVZ A;  3VP8 A;  4OWF A;  1CI6 A;  3WUV A;  2OQQ A;  4PJ0 E;  3H1K J;  1GZL A;  3L72 G;  3TGU G;  3N4X A;  1SQP D;  1IFM A;  1JEK A;  3RL0 g;  1GDT A;  5E79 H;  3S4R A;  1W2B O;  1FDI A;  1X0T A;  1NTM E;  4H44 B;  2WTY A;  1RHZ B;  1Y8A A;  4XFJ A;  2OYI A;  1FJP A;  3HTK B;  3M9B A;  1LTB C;  2OGU A;  1T6A A;  2WSF J;  3CXH I;  3A5T A;  3L75 D;  4BRY A;  1SQV K;  3RK3 C;  2E76 C;  3HD7 A;  1PP9 G;  1ZR4 A;  4WB4 A;  4GOD A;  1GMJ A;  2WIT A;  1URQ D;  2DW3 A;  3MZW B;  1FU1 A;  2YKO A;  4DJG A;  4JYC A;  1GW3 A;  3L70 D;  1L0N E;  1L2P A;  2PFX A;  3B4S A;  4W7Z A;  4IL6 X;  2C9N Y;  5AVW B;  1YYC A;  1N8R Q;  2FYU J;  1DH3 A;  4PD4 H;  1GL2 B;  3CX5 H;  3AED C;  3HTK A;  2ITA A;  2WT7 B;  1IFJ A;  2WPV B;  4I6M C;  4RES B;  4IFD K;  3ABV C;  1LT9 B;  2KYV A;  3JCU H;  2JWD A;  1T2K D;  3KPE A;  4HJG H;  2HFE D;  1NTK G;  3T97 B;  2A06 E;  1OVU A;  4TT3 H;  3RBX A;  2BCC G;  1GU4 A;  2JO1 A;  3B5N C;  3I55 P;  1EZV D;  2H89 C;  3WUU A;  4ASV A;  4C46 A;  3R4Y A;  3H1K G;  1SQP E;  3M0A A;  3HRN A;  3VMY A;  5TIS E;  4WY4 A;  3L73 E;  3C9I A;  1IC2 A;  1G1J A;  4RKU J;  1EDL A;  1GL2 A;  1P84 D;  2O1J A;  2WT7 A;  2N9Y B;  4H13 D;  1LT9 A;  3S1K A;  1G1I A;  3GMA A;  2KIK A;  2V7Q H;  4UB6 H;  3SFE C;  3T97 A;  1AJY A;  1BSN A;  4YPC A;  3C1L A;  3L70 E;  3L74 J;  3G71 P;  2I1K A;  2D2C C;  2XNX A;  1YTZ I;  1QLE D;  3LW5 H;  2WZ7 A;  1VQ4 P;  1OMI A;  1GU5 A;  4OGQ B;  2JJL A;  1EZV I;  2Z5H A;  4N6J A;  1BDD A;  1NOH A;  3PP5 A;  1KYO H;  1SQX J;  3QH9 A;  1IZN B;  1N7S D;  2FYU G;  1VQP P;  4CPG A;  2KNC B;  3AEC C;  3ITK A;  1KB9 I;  2R44 A;  1L0L D;  1ZRT D;  3NTN A;  3P8C E;  3AE1 C;  3Q1M A;  1VQN P;  1MFZ A;  3GHG B;  2FXO A;  1VF5 B;  2E75 B;  3CWB D;  2WSF H;  2P10 A;  3CC7 P;  4LGD E;  2NZ2 A;  5EFW B;  2E74 D;  4EDF A;  1NGM B;  2XND H;  2KSJ A;  2M5A B;  1P84 E;  1NO4 A;  2I1J A;  3BAS A;  1NJI Q;  3PRJ A;  1HGZ A;  5AW9 B;  3V5B A;  2NRG A;  5KJ7 C;  3RK2 B;  3SWF A;  2KNC A;  4EI2 A;  2FFD C;  1KC8 Q;  4GOF A;  3AEF C;  5GTH H;  3BCC D;  1BSH A;  3GHG A;  2R3C A;  1OX3 A;  5APX A;  1DEE G;  3CME P;  1H8A A;  5K5G B;  3L74 G;  1TU3 F;  3AEE C;  4GDO A;  2WSS H;  4N78 E;  2M5A A;  1KIL C;  4DT0 A;  3CCS P;  3S9O A;  2YKP A;  1QL2 A;  1RE4 C;  2AEJ A;  1URQ C;  3WMM 0;  2OYH B;  3KHU A;  3V2N A;  1LNQ A;  3H1L D;  1ZRT E;  1SQX G;  3RGU A;  2L5G B;  3CWB E;  1JMB A;  1SQV J;  2IBZ G;  2YNY A;  2FY8 A;  5APY A;  2WVR A;  4AUW A;  2UWJ E;  1KFM A;  1Q81 Q;  4C7R A;  5KTB A;  1FAV A;  1DX7 A;  5KKZ C;  5CJ4 A;  1LTJ C;  1T2K C;  3CL3 D;  1J2J B;  1VQ6 P;  2OYH A;  3ZDM A;  3VOP A;  1LT1 A;  2C0X A;  1JCD A;  1IK9 A;  1JUN A;  2A45 H;  3FGA D;  3L72 D;  4PD4 D;  3TGU D;  4IOI H;  3HE5 B;  2KLV A;  1BE3 E;  2AXC A;  1S5L E;  3V4W A;  2O01 J;  2N1T C;  1NTM K;  4H13 C;  4PV1 C;  2J58 A;  3W68 A;  3CI9 A;  3RK3 D;  1NTZ K;  2E76 D;  1LTS C;  4AYC A;  3G3Z A;  2LR2 A;  1K73 Q;  1PP9 D;  2ZT9 B;  3H1L E;  1SVF A;  2YMK A;  4UB8 H;  1KZU B;  1H0T B;  1S3J A;  3RL0 B;  3H1J J;  3TNU B;  1L0N K;  2BEQ D;  3HE5 A;  1JY2 P;  5KLI B;  2QJY C;  3UIA A;  1SQV G;  4PD4 I;  3CX5 I;  1OFC X;  1SQB K;  2QM7 A;  1RY3 A;  1S1C X;  2MKV A;  1GW4 A;  1Q7Y Q;  4D6T E;  4JF7 A;  3Q5S A;  3B5N D;  1NTK D;  3H6P A;  2BCC D;  3L72 E;  4IFF A;  2P2U A;  3CC2 P;  1YJN P;  3K5B A;  2E74 C;  1H0T A;  3MUD A;  3H1K D;  3TNU A;  1KYO D;  1NHL A;  3GG2 A;  1GK4 A;  1OIP A;  3RK3 E;  5KLV K;  5AVZ B;  4I2L C;  2RN0 A;  2Q3E A;  1RE3 C;  5CJ0 A;  5APU A;  2HYN A;  3KQG A;  2LXC B;  3PTZ A;  2FKW B;  3IAO A;  2RMZ A;  1JTH B;  4RJT A;  2IFM A;  2D2C D;  2NPS C;  1HBW A;  1HVV A;  2Y0D A;  5APW A;  4Y99 C;  2OYO A;  3V4Q A;  3H1H J;  2PGD A;  3EFG A;  2AXT H;  1IK7 A;  2YO3 A;  5CCH A;  1LP1 B;  2KS1 B;  3H1J G;  3CCR P;  2V4H A;  1KYO I;  1OVV A;  2WSE H;  2FXP A;  2FYU D;  3OAK A;  1SFC D;  1DD4 A;  4DOJ A;  5AVV B;  2Q7C A;  3CC4 P;  4WVZ A;  1DD3 A;  5TJH A;  2O01 H;  4W80 A;  5M1B A;  3II6 A;  1FZB A;  2OYI B;  1RF1 C;  3H1K E;  1YI2 P;  2CPB A;  5AW5 B;  1PPJ G;  1LTG C;  3E1I A;  3TDK A;  2H8P D;  1FE6 A;  1MFT A;  3Q5P A;  5CBN A;  5CCG D;  3H1I J;  1LP1 A;  2KS1 A;  4K35 A;  3HUS C;  1ZXG A;  1FZF A;  5KJ7 D;  2BEZ F;  4ASW A;  2JWA A;  5B5E E;  5GTI E;  3G6E P;  3SSU A;  1LWU B;  2M3B A;  3EWK A;  3KXD A;  1WRG A;  1GK6 A;  4H0L D;  3L71 E;  2I8D A;  1PIX A;  1SP4 A;  2O01 N;  1PZQ A;  4HYT B;  2C0W A;  1KD1 Q;  4L76 A;  1H88 A;  3WU2 E;  1EC5 A;  2HPC B;  3L74 D;  1MV8 A;  3H25 A;  1EDK A;  4IL6 E;  1KIL D;  3CCV P;  3H1H G;  4GIF A;  2K9J B;  2IDB A;  1AVY A;  1LWU A;  1CSB A;  1NTM J;  2W6J H;  3CXH E;  1G2C B;  1X79 B;  1SQX D;  4WY4 B;  3V2Q A;  1NTZ J;  4AQR D;  1FZG A;  1EQ7 A;  2IBZ D;  3PHL A;  3CCU P;  1L4A C;  3AE9 C;  2B88 A;  2HPC A;  1VQ7 P;  2JP3 A;  4I7Z C;  2M8R A;  2E5Y A;  2IZ1 A;  2PRR A;  1BGY J;  1L0N J;  1N7S B;  3CCL P;  3H1I G;  2K9J A;  1OZH A;  5AVX B;  2P7J A;  3HE4 B;  2WMM A;  1SQB J;  5AVT B;  1G2C A;  1N2D C;  2A45 I;  2QJP B;  4U3F J;  3MHV A;  3BRT B;  1FZC B;  2P67 A;  3L75 E;  1M1J C;  1ZLL A;  1X22 A;  1KB9 D;  4JYB A;  3L74 E;  1J1E C;  1LTI C;  1W2E A;  2N1T D;  3U1C A;  4PV1 D;  2IBZ I;  2ZXX A;  5C39 A;  4EOT A;  3MGN A;  2K37 A;  1HF9 A;  3V2R A;  3TSI A;  1YIJ P;  5H2F E;  1N7S A;  2FYN C;  1A02 F;  1JY2 O;  1IO4 A;  2B89 A;  1IJD B;  2XZR A;  1UII A;  2HG5 D;  1JO5 A;  3HE4 A;  1KQG B;  1IFI A;  1Z56 A;  3L73 J;  3A2A A;  1WT6 A;  5KLV J;  2C9L Y;  1VQO P;  3P7K A;  3A0H E;  1ZOY C;  3U1A A;  5KAF E;  5B66 H;  1NTM G;  3G4S P;  1FZC A;  1GL2 D;  3BVH A;  1MZ9 A;  1NTZ G;  4DCK A;  1SLQ A;  2Y0C A;  1SQV D;  3M0D C;  1RQU A;  5KAI H;  1SFC C;  2GUV A;  1JY3 P;  1EZV E;  4NPD A;  4TLF A;  3VP9 A;  1M1K Q;  2KZJ A;  1OXZ A;  2YIU C;  1E79 H;  1BGY G;  1L0N G;  4PJ0 H;  1U7J A;  2JDI H;  1T3J A;  3QWO C;  1Q82 Q;  3GLM A;  1KB9 E;  1SQQ K;  1SQB G;  5CCG C;  1J1D B;  2ZAE B;  1SS1 A;  4K3A A;  1PGQ A;  1OW6 A;  4U3F G;  1E5W A;  3V6I A;  3FX0 A;  2QSI A;  3FXD A;  3E7K A;  1NU1 K;  3CCE P;  4H0L C;  1JY2 N;  3PH0 A;  2KXP B;  2W83 C;  2ZVO B;  2A06 G;  2QJK C;  3F89 A;  1AQ5 A;  1RF0 A;  2Q3I A;  2NPS D;  3D6Y A;  1JB0 J;  3BAT A;  4OGQ D;  3U59 A;  3WUT A;  1UIX A;  3L73 G;  5KLV G;  2R3S A;  2A45 G;  3A0B E;  2Q5U A;  3H1J D;  1L0L E;  3RK3 B;  2WQY C;  2E76 B;  4L75 A;  2QG4 A;  2J5U A;  5BU8 B;  2JEE A;  5CHX A;  3R2P A;  1CZQ A;  4QMA A;  5APV A;  4W7Y A;  2N9B A;  3FWN A;  3M9H A;  2XKM A;  1ZP0 C;  3OJA B;  3M06 A;  1VQL P;  1N73 C;  4N3Y B;  3HD7 C;  1BCC J;  4WBA A;  2O1K A;  1PPJ D;  2JKV A;  1XTC C;  3CD6 P;  3VMZ A;  2FXM A;  1N7L A;  1AA0 A;  5AW7 B;  3KZI E;  1PL5 A;  3CCM P;  3BCC E;  1NAY A;  1OVR A;  3O6Q B;  1RQV A;  4YTP C;  2WSE J;  2QM8 A;  1K05 A;  2AEF A;  3CX5 D;  1GD2 E;  3B5N B;  1FC2 C;  4H44 C;  5CMZ A;  1QGK B;  4BWN A;  1K9M Q;  3NXS A;  3L35 A;  3I5C A;  2POH A;  2RH0 A;  1YQ4 C;  2P1J A;  4EYY Q;  1JCC A;  3H1J E;  1K8A Q;  3M9Q A;  1DIP A;  2O3J A;  2WWW A;  2H43 A;  5E79 E;  3H1H D;  1PFI A;  1VPC A;  3O6Q A;  1VQ8 P;  4LLH A;  3MTU E;  3NFQ A;  5AW0 B;  1BE3 J;  3SWK A;  3B5N A;  2GM4 A;  3EFF K;  1GL2 C;  3IN6 A;  2D2C B;  2HOD B;  3N7N A;  4GOE A;  2Z5I A;  1L4A D;  1LTT C;  1PPJ E;  1KQS O;  1LT9 C;  1FDM A;  3JC2 2;  3MIW A;  4OH8 B;  3AEA C;  1BCC G;  1LGH B;  1P84 H;  5AVY B;  1Q2N A;  4PD4 E;  3TGU E;  3CX5 E;  1SFC B;  3AE8 C;  3H1I D;  3D71 A;  1W5C E;  4O9B A;  1JNM A;  1SQP K;  3CMA P;  1VDF A;  1T3U A;  3KYQ A;  3JCU E;  3IF4 A;  2HOD A;  4HB1 A;  2W90 A;  4RO0 A;  2YKQ A;  4D6T J;  1ZN5 A;  1IFN A;  4U7J A;  2AEM A;  1PP9 E;  2K88 A;  2ZYA A;  2M0B A;  1PGO A;  3IR9 A;  3A3Y B;  1SQQ J;  3Q5R A;  1USE A;  1IFD A;  2FFD B;  3B71 A;  4H0L B;  1SFC A;  1PGP A;  4OGQ C;  1NU1 J;  1MUU A;  3AE7 C;  2E42 A;  1MKM A;  5DJU B;  1BE3 G;  1NTM D;  4UB6 E;  4GT1 A;  2KK7 A;  4A7P A;  3C8V A;  1NTZ D;  1N86 A;  1KIL B;  1HUC A;  1NTK E;  2WSC J;  1URQ B;  2BCC E;  4Y28 J;  5KJ7 A;  3GHG C;  1VF5 C;  3MD0 A;  2E75 C;  1KOR A;  2FFD A;  1BDC A;  4ZNC A;  3LID A;  2W27 A;  1KYO E;  2MJZ A;  1JM0 A;  2XU6 A;  3AE2 C;  3SFD C;  1BGY D;  1L0N D;  5BU5 A;  3P32 A;  3CCJ P;  2IPP A;  2JR8 A;  4YXD C;  2IYO A;  1SQB D;  2Q1K A;  1USD A;  3RK2 C;  1U57 A;  5AW3 B;  5KKZ B;  3L4F A;  1N73 B;  1LTJ B;  4U3F D;  1KIL A;  1QL1 A;  1S5L H;  4D6T G;  1XTG B;  1RE4 A;  2FYZ A;  1URQ A;  4B86 A;  2A06 D;  2WPQ A;  2KI7 B;  4I1L A;  1SQQ G;  1JY3 N;  1QVF O;  2B9B A;  3I56 P;  1VQ9 P;  1WMK A;  4DZO A;  3FWL A;  5GTH E;  3L73 D;  1NTZ E;  5KLV D;  1QX8 A;  1FZA A;  2G8Y A;  2YXQ B;  1NU1 G;  2N1T B;  2FYU E;  1HTL C;  2OYH C;  4H13 B;  1ZR2 A;  4PV1 B;  1PV3 A;  3L71 J;  1QVG O;  1N73 A;  1LTJ A;  1KMI Z;  3AE6 C;  1EXJ A;  1L0L K;  4OVN F;  2PP6 A;  5AW8 B;  1KTM A;  3VMX A;  1FOS E; 
#chains in the Genus database with same CATH homology
 2K37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...