2K37A

Csma
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
59
structure length
59
Chain Sequence
MSGGGVFTDILAAAGRIFEVMVEGHWETVGMLFDSLGKGTMRINRNAYGSMGGGSLRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chlorosome Protein A
publication title The three-dimensional structure of CsmA: A small antenna protein from the green sulfur bacterium Chlorobium tepidum.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 17
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2008-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.950 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces bacteriochlorophyll c-binding protein 2k37A00
2K37A
chains in the Genus database with same CATH superfamily
1URQD 3MHVA 3ITKA 5AW7B 3GF7A 1X22A 4U3FG 5APXA 2K9JA 2KS1A 3NTNA 2JJLA 2J5UA 2Z5HA 2BCCE 2IFNA 1S5LE 3L75G 1SQPK 3OJAB 4O9BA 1QX8A 4PV1D 3CCRP 3D71A 3V6IA 3NFQA 1DIPA 1L4AB 1DH3A 2HPCB 5KLVJ 5KAFH 2JP3A 1YTZI 1EZVD 2BCCJ 3A0BH 3JSVC 1FZCA 1RE3A 1FOSE 1VQ9P 3L74G 4OVNF 1SQBK 4NPDA 2YIUC 1T2KC 1L0NK 1EQ7A 2MJZA 2WMMA 3HE4A 3WUUA 1K9MQ 1LGHB 2L91A 4XFJA 3L72G 2R3SA 3OA7A 4EYYQ 2YXRB 1LT9C 1RF0C 5AW2B 2HFED 3CX5D 3KYQA 3H1HJ 3L70D 2R5DA 1VF5C 3PRJA 1U7JA 3FGAD 5KLIC 4HKZH 1LWUA 4ZKUA 1H89A 2QG4A 5KKZC 1HJ0A 4IOIH 1FZBA 1ZP0C 3WU2E 4I2LC 2FYZA 1SQBE 1SQPJ 1HVVA 2J58A 1FBMA 2I1KA 1L0NE 1Q2NA 3NMDA 2AXTH 1PP9J 1T3UA 3WUTA 3BCCE 2WPSA 1IFDA 2ZFCA 1NU1G 1L0LG 2Q9IA 1EDLA 1KB9D 2ITAA 1WT6A 3CCMP 1NTZK 1JY3O 2FXMA 2CPSA 1X79B 3MZWB 2WSSH 1SQBJ 1H8AA 3Q5RA 5AW8B 1R8EA 3Q5SA 3V2RA 1W2BO 3L73G 1SVFA 1VQOP 1SS1A 1NHLA 1NAYA 1GL2A 1JB0J 2M0BA 1VQ6P 3AE1C 3V2NA 1EDKA 3SWKA 2FFDC 1L2PA 1OZHA 3P7KA 3B5NC 5KTBA 4R4MA 3AE4C 4DT0A 1NTMG 4UB6H 4WY4A 1NTZE 3H1IJ 3RL0D 4GOFA 2HODA 2WPVB 1BDCA 2E76D 1MZ9A 2O01J 2IFMA 3CXHD 4PD4I 1OW7A 1LTBC 1CI6A 3W68A 2P1JA 5CMZA 3CWBE 1PGOA 2P67A 1USDA 5CCGA 2IX7C 3H1JE 1FU1A 2G3AA 3HRNA 1NTZJ 2KNCB 3Q5PA 5KJ7A 1Z56A 1U57A 2P58A 3GHGB 3EWKA 3GF3A 2JWDA 1LJ2A 5GTIH 1PPJE 2E74C 3CX5H 2WSEJ 3TK1A 3HTKB 1URQC 3H1JJ 1AVYA 2VRSA 2NPSD 3F5HA 4W7YA 4U3FE 1NO4A 1FZGA 1VQ8P 2KSJA 1S1CX 1LTGC 5TISE 1J1EC 5CCHD 1Y9BA 1VQPP 3FXDA 1OX3A 3BASA 1ZR4A 1AA0A 3MIWA 1P84E 4DOJA 1SP4A 3L75E 1EZVG 1KB9H 1ZRTE 2AEJA 2WSCH 4PV1C 1YJWP 1BSHA 1LTJC 4LGDE 1BGYJ 1H0TA 1M8OB 4UB8E 3B8EB 3RL0B 1K05A 1YIJP 2XNDH 2N1TB 4WB4A 3QWOC 1GK6A 5KAIH 3L74E 2E76B 3L70G 3L75J 3PHLA 2OYIC 4WBAA 2E75B 2Y0EA 3O8ZA 1OW8A 1RF0A 3TGUD 2GUVA 1N7SA 3L72E 1FZEA 3HE5A 1NOHA 1NU1K 2FYNC 2XNXA 1VQLP 1JO5A 4DJGA 2PFXA 3SFEC 4RJTA 3CCJP 3GHGC 3HD7A 1M1KQ 3CC7P 1FDIA 2OYHC 2YKQA 2QJPB 3L4FA 3WMM0 2FXPA 3AEFC 1YQ4C 4DZOA 1KQGB 3SWFA 3L71D 5KAFE 1NU1E 3A0BE 1NTMK 4OGQD 1Q86Q 1GK4A 2P2UA 1SQXJ 3H25A 3JCUH 3G6EP 1Q82Q 3L73E 1HGVA 4JYCA 4XE5B 4EI2A 1N73C 2LXBA 3FXEA 2B87B 3Q1MA 3W67A 1L4AA 1QEXA 2KXPB 1M56D 4I7ZB 1BE3D 2H88C 1VQMP 3CD6P 3C9IA 1NTME 3L73J 3U1CA 3V5BA 4HYTB 3RL0C 5APYA 3KXDA 1OMIA 1FJKA 1QVFO 2E76C 3HUSC 4IFMA 2AXTE 2FBWC 1E5WA 2IBZD 1YBKA 2Y9ZA 3VN0A 2M8RA 3RK3D 1L0LD 2XU6A 1OWAA 5AVYB 2R44A 1RE4A 1FAVA 1ZR2A 3AEEC 2D2CD 1H0TB 2KP8A 2KLUA 2NPSC 2YIUB 3M0DC 4UB6E 1RQVA 1NGMB 1BCCJ 4C7RA 2OARA 3QH9A 2A45H 2ZYAA 1M90Q 3AE7C 1XTCC 2YKPA 5CCHC 2MKVA 2OTJP 2V7QJ 1LT9B 2FYUD 5BU5A 1SFCD 1QLED 1VF5B 1Y47A 1W2EA 5KLIB 1EZVE 4H13C 1LTAC 5KKZB 1DD3A 3RGUA 2P7JA 4I7ZC 3TGUG 3TF5A 2J59M 2L5GB 1KZUB 5GTIE 3T97B 2WSFJ 3CX5E 2BASA 3L70E 3L35A 3P8CD 1XTGB 1P84I 2YMKA 2M5AB 3Q3DA 3H1KD 1ZMEC 2FY8A 1SQVJ 1NKZB 1M57D 2A45G 2KNCA 3V2PA 4N78D 3AECC 1FC2C 1ZN5A 3GHGA 3PH0A 1GDTA 5B5EH 2FFDB 2IZ0A 3L71G 1S5LX 1IFNA 2BEZF 3CCVP 1KN7A 3NXSA 3B5NB 1KYOI 1KB9E 2IYOA 2KOGA 3HTKA 3U59A 4CPGA 3V2QA 2RN0A 4D6TD 2ZXXA 2Z5IA 4ASWA 1NTKD 1SQQD 3CMEP 3D6ZA 4OGQC 5KAIE 3B71A 2ZVNB 2FXOA 1SFCB 3PJSK 1BE3G 3FWLA 4I1LA 1N73A 5C39A 4EOTA 2FKWB 2IZ1A 1DEBA 1KILC 1HBWA 1M1JC 4KJMA 3CCLP 3A5TA 2B9BA 4R4LA 5B66H 2E74B 1PGJA 4L76A 2HG5D 3CXHE 2M3BA 2IBZG 2W83C 2WTYA 2N1TA 3O6QB 3TNUB 1URQB 3C1LA 3MUDC 3I55P 3HUSA 4BRYB 1EXIA 2LXCB 2W6JH 2W6AA 1X0TA 5APVA 5AW9B 5KLVD 1PFIA 3CCSP 1KC8Q 1J1EB 3RK3C 1IO4A 1CSBA 3KPEA 1CW5A 3S4RA 1L0NJ 3R2PA 3TYYA 4KHXA 4AYCA 1MFZA 4Z1MH 3JCUE 2Q5UA 4IL6H 3VMAA 1FJPA 2O1KA 3BCCJ 5AW6B 4PV1B 3E1IA 1LTJB 1AV1A 2C0XA 3H1HD 1FDMA 3H1LD 5AW0B 1U7MA 2D2CC 3LIEA 4PJ0H 3N7NA 3I56P 2Q1KA 1X8YA 1R5SA 1K73Q 2FYUG 1YQ3C 1YJ9P 1K8AQ 2QEXP 4XA4A 1OIPA 1SQPD 4B86A 3AEBC 5CBOA 2XDJA 2GUSA 2OYIB 5DJTB 2N9BA 1PP9D 3LW5J 2IYPA 4WWIA 2FYNB 2QJKC 3AE8C 1SFCC 3CMAP 1FDOA 2W27A 3V4WA 3GW6A 2B87A 1FOSF 1RHZB 3IAOA 1UIIA 1JCCA 1G1JA 2ZYDA 3II6A 2ZVOB 2OYHB 2WITA 4GDOA 4L73A 3TGUE 1VQKP 1LNQA 3H1KG 3CWBJ 3D6YA 4RO0A 4ZMDA 5AVZB 4RKUJ 1GL2D 2POHA 1NWQA 2AXCA 1GZLA 2JEEA 1VDFA 1EZVI 2JKVA 5EFWB 2JWAA 3H1ID 2H8PD 3PTZA 3G9RA 4WVZA 4KT0J 2WQYC 3VTPC 4C46A 1IC2A 5GTHH 4D6TG 1N73B 3PP5A 1NTKG 1SQQG 2RH0A 1GD2E 4H13D 4U3FJ 3CX5I 3L71E 1S5LH 2QM7A 2DW3A 2YO3A 1KD1Q 1LP1B 2WPQA 3B4SA 3F89A 4W7ZA 5AVVB 1JY2N 1N86A 2Q6QA 1FS0E 4YTPC 4L74A 3HUSB 5KJ7D 3RK2C 1N2DC 3VMXA 1JTHB 1HF9A 3L71J 1LT9A 1LT1A 2K37A 1HUCA 1L0LK 3FX0A 1BE3E 4HJGH 1W5CE 3L36A 4H0LD 3L74J 2WT7B 2KZIA 1OVRA 5APTA 1YITP 5KLVG 1EDJA 1EXJA 5CHXA 4GKGA 5B5EE 3L72J 3FWNA 2IBZE 1KQSO 3T97A 2ZYGA 1IFIA 3RK3E 1MUUA 2NZ2A 1BGYD 2NPSB 4JYBA 1RF1C 3CL3D 3EFGA 1HJBA 1GMJA 2M5AA 1L0LE 2AEMA 1N8RQ 1LTIC 3IR9A 2W8ZA 3H1HG 1DX7A 4W80A 2OQQA 5E79H 3H1LG 3CXHI 3H6PA 4JBZA 1DEEG 2R32A 1PIXA 1MFTA 2A06D 2FFDA 4H13B 4JQ0D 1RE3C 2G8YA 2KZJA 3K5BA 1NU1J 1L0LJ 3B5NA 1S9KD 1SQPG 1KILD 2Y0CA 3CC4P 2O01H 1N7SD 1PP9G 2FYUE 1KYOD 4JF7A 5B66E 2ZJSE 3G71P 2K1AA 1GU4A 2WWWA 1S2EA 1LWUC 1SFCA 3HD7D 1KMIZ 4OH8B 5APWA 1H88A 3KHUA 1NTMJ 4H0LB 4U7JA 4EIJA 1SQXD 2I1JA 2WSEH 1GW3A 2HR3A 1VL2A 3ABVC 4MN4C 3P8CE 1PGPA 4IL6E 1YTZT 3O6QA 3A0HH 3TNUA 1N7LA 4GODA 1HTLC 1URQA 3H1IG 3H1KE 1PZQA 1NTKK 2HLOA 4BRYA 2B89A 1G2CB 2QJYC 2W6BA 4N78E 1GL2C 4PJ0E 1JY3P 3M9HA 4OGQB 3VMZA 2O01N 1Q7YQ 1HWTC 3CCQP 4Y28J 4BWNA 2C9NY 2QIWA 3D70A 1ZW0A 4WY4C 4EDFA 4ASVA 3V4QA 4D6TE 1M7LA 1LTJA 1NTKE 1SQQE 1KILB 3RBXA 1M1JB 1USEA 2OYOA 1ZOYC 3TSIA 5AW5B 5DJUB 2K88A 4BXLA 4TT3H 3MTUE 2QSIA 2H43A 4C7NB 2A45I 5CCGC 1VQ4P 1S72P 3VMYA 4NPFX 2OYIA 3A7OA 5KJ7C 1OVVA 1IFPA 1KFNA 1J1DC 1IZNB 2K3RA 2ZT9C 2BEQD 4I6MC 2B88A 3RK3B 1IFMA 4ZNCA 3G3ZA 5AVSB 3I5CA 1KYOH 1T8ZA 1BCCD 3H32B 1T3JA 4PD4D 4H0LC 1JOCA 1BGYG 3L70J 2QRXA 2Q3IA 2OYHA 5GTHE 5KLVE 2KB7P 4H44D 4IFFA 3WUVA 2D2CB 1FE6A 3SFDC 2M3EA 4Y99B 1RF1A 1PGQA 3Q2YA 3VYIA 1VQ7P 3R4YA 3MGNA 3M0AA 3GG2A 1KTMA 2A06G 3EQ2A 3P8MC 1NAFA 3RK2D 3C8VA 3S1KA 1A02J 2ZXEB 3AE5C 1LTSC 3H1HE 2WSCJ 2QJKB 3H1LE 2QA4P 2IBZI 2IPPA 1Y8AA 3BVHA 1SQVD 2YKOA 2IDBA 1CZQA 1SLQA 5TJHA 1QVGO 1SQPE 1KFMA 2E42A 1LP1A 4L75A 1FZFA 4YXDC 1N7SC 1RQUA 1PP9E 3M9BA 2Y9YA 3H1LJ 2KK7A 2QVAA 2E5TA 4AQRD 1JTHA 3N4XA 2H7HA 2W90A 4HB1A 1SQXG 1QGKB 1AQ5A 5BU8B 3HD7C 2V4HA 3VP8A 2BCCD 2O1JA 1GW4A 3IFMA 1JY2O 4LC1A 3KQGA 2XKMA 4GT1A 2WT7A 1X9VA 3E7KA 5E79E 5CJ4A 1KQLA 5AVRB 3A2AA 4H44B 1Q81Q 2PRRA 1BSNA 1IK7A 1KV4A 3IF4A 4HH2A 4PD4H 3H1IE 2NPSA 4NPEA 3AE9C 2SPZA 3M0DA 4Y99C 4K35A 2V7QH 1AFOA 1HGZA 5AVUB 2KSEA 2OTKE 2WZ7A 3RK2B 2KYVA 5CCHA 2GM4A 1A02F 3KZIH 2YO2A 1L4AC 4GIFA 1IJDB 1G1IA 2N1TD 2AEFA 1ZXGA 4N6JA 4YPCA 5H2FH 2Q3EA 1FZAA 1LTTC 3CPWO 1SQBD 1Q90D 3JC22 3LIDA 2E75D 2XV5A 1L0ND 2K9JB 2WSFH 2KS1B 4A7PA 3VOPA 2KUBA 5APQA 3SWYA 1HH0A 3M9QA 3BCCD 1YYCA 5APUA 4ZKPA 3CI9A 3A0HE 5L8RJ 1BCCG 1PV3A 4DCKA 1RF1B 3OAKA 4GOEA 1KORA 1RE4C 3VP9A 3A3YB 2RKLA 2XZRA 2E43A 4AUWA 2LR2A 3CCEP 3G4SP 3TGUJ 5CBNA 1J2JB 2KIKA 4M3LA 3AEDC 4LLHA 4WY4D 1FZCB 2QE7H 3PLNA 1BGYE 1VPCA 2E5YA 2JDIH 3HE4B 4H44C 3AE6C 1VQ5P 1NTZD 2R5BA 3M06A 3GLMA 1G2CA 2N9YB 3KDPB 1VQNP 5CCGD 3AE2C 1LWUB 2A06E 3BATA 1SQVG 3CWBD 3OW2O 1GU5A 3H1JD 1S9KE 1JY3N 2ZT9D 1KILE 1JM0A 1IFJA 1QL2A 3S9OA 1KB9I 1SQXK 1S3JA 1KILA 2Y0DA 2Z4EA 2WVRA 2PAJA 2Q7CA 1KYOE 1M1JA 1PPJD 2OGUA 3BRTB 1OW6A 2O3JA 3RBZA 1R5LA 1K04A 3USSA 1QL1A 2KI7B 4QMAA 3MUDA 4C7NA 2BCCG 5APSA 2QJYB 4U3FD 2P10A 3WU2H 1BE3J 3CC2P 1GL2B 3CLQA 3CXHH 2YNYA 1SQXE 2JR8A 3E1RA 1RH5B 2K9YA 5AW4B 1MKMA 4JPZB 2FYUK 2ZAEB 1RY3A 5K5GB 1E79H 1P84D 3H32A 3EFFK 3L75D 2OTLP 1IK9A 1GTWA 1ZRTD 4WY4B 2PP6A 5AW1B 1OVUA 1JEKA 4TLFA 1YJNP 1EDIA 1DD4A 1UIXA 1FZCC 1T2KD 2CK3H 2HODB 2YXQB 2YMYA 1ZLLA 3U1AA 2CPBA 3UIAA 5AW3B 2LKMA 3AE3C 1AJYA 1CI6B 3L74D 4RESB 3LW5H 1VF5D 1JMMA 3CCUP 3L72D 1EC5A 1J1DB 2HPCA 2ZT9B 5AVQB 1SQBG 1NJIQ 4YXWH 2QM8A 1L0NG 2RMZA 3GMAA 2N1TC 2C0WA 3BCCG 4N3YB 2FYUJ 5AVXB 1NYHA 1OXZA 2KLVA 1S4XA 3RL0g 2E75C 1OFCX 1TU3F 3TDKA 1KQFB 1NH4A 1PL5A 1ZV8A 1NU1D 1SQQK 2JO1A 3AEGC 3IN6A 1JUNA 4IL6X 1BCCE 1WRGA 2PGDA 4PD4E 5AVTB 1YHQP 2GA1A 2NRGA 1NVOA 2HYNA 3MD0A 1JCDA 3L73D 3B5ND 1JY2P 1AVOA 1L4AD 5CJ0A 1YI2P 3BRVB 2QJPC 1NTZG 1WMKA 5BVZA 3H1KJ 4K3AA 2WPRA 3L37A 3KZIE 3ZDMA 4IFDK 2I8DA 1SQVK 5TISH 1NKNA 5M1BA 3MP7B 1NTMD 5H2FE 4OWFA 1P84H 3SSUA 1N7SB 3CWBG 3HE5B 3H1JG 1AQTA 1JMBA 3M91A 3AEAC 5KLVK 1MV8A 4UB8H 3P32A 4D6TJ 5AVWB 1D7MA 1NTKJ 1SQQJ 2H89C 1SQVE 1PPJG 3HD7B 2C9LY 2E74D 1BDDA 2R3CA 1JNMA 1T6AA 2UWJE
chains in the Genus database with same CATH topology
2K37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K37 A; 
#chains in the Genus database with same CATH topology
 1URQ D;  3MHV A;  3ITK A;  5AW7 B;  3GF7 A;  1X22 A;  4U3F G;  5APX A;  2K9J A;  2KS1 A;  3NTN A;  2JJL A;  2J5U A;  2Z5H A;  2BCC E;  2IFN A;  1S5L E;  3L75 G;  1SQP K;  3OJA B;  4O9B A;  1QX8 A;  4PV1 D;  3CCR P;  3D71 A;  3V6I A;  3NFQ A;  1DIP A;  1L4A B;  1DH3 A;  2HPC B;  5KLV J;  5KAF H;  2JP3 A;  1YTZ I;  1EZV D;  2BCC J;  3A0B H;  3JSV C;  1FZC A;  1RE3 A;  1FOS E;  1VQ9 P;  3L74 G;  4OVN F;  1SQB K;  4NPD A;  2YIU C;  1T2K C;  1L0N K;  1EQ7 A;  2MJZ A;  2WMM A;  3HE4 A;  3WUU A;  1K9M Q;  1LGH B;  2L91 A;  4XFJ A;  3L72 G;  2R3S A;  3OA7 A;  4EYY Q;  2YXR B;  1LT9 C;  1RF0 C;  5AW2 B;  2HFE D;  3CX5 D;  3KYQ A;  3H1H J;  3L70 D;  2R5D A;  1VF5 C;  3PRJ A;  1U7J A;  3FGA D;  5KLI C;  4HKZ H;  1LWU A;  4ZKU A;  1H89 A;  2QG4 A;  5KKZ C;  1HJ0 A;  4IOI H;  1FZB A;  1ZP0 C;  3WU2 E;  4I2L C;  2FYZ A;  1SQB E;  1SQP J;  1HVV A;  2J58 A;  1FBM A;  2I1K A;  1L0N E;  1Q2N A;  3NMD A;  2AXT H;  1PP9 J;  1T3U A;  3WUT A;  3BCC E;  2WPS A;  1IFD A;  2ZFC A;  1NU1 G;  1L0L G;  2Q9I A;  1EDL A;  1KB9 D;  2ITA A;  1WT6 A;  3CCM P;  1NTZ K;  1JY3 O;  2FXM A;  2CPS A;  1X79 B;  3MZW B;  2WSS H;  1SQB J;  1H8A A;  3Q5R A;  5AW8 B;  1R8E A;  3Q5S A;  3V2R A;  1W2B O;  3L73 G;  1SVF A;  1VQO P;  1SS1 A;  1NHL A;  1NAY A;  1GL2 A;  1JB0 J;  2M0B A;  1VQ6 P;  3AE1 C;  3V2N A;  1EDK A;  3SWK A;  2FFD C;  1L2P A;  1OZH A;  3P7K A;  3B5N C;  5KTB A;  4R4M A;  3AE4 C;  4DT0 A;  1NTM G;  4UB6 H;  4WY4 A;  1NTZ E;  3H1I J;  3RL0 D;  4GOF A;  2HOD A;  2WPV B;  1BDC A;  2E76 D;  1MZ9 A;  2O01 J;  2IFM A;  3CXH D;  4PD4 I;  1OW7 A;  1LTB C;  1CI6 A;  3W68 A;  2P1J A;  5CMZ A;  3CWB E;  1PGO A;  2P67 A;  1USD A;  5CCG A;  2IX7 C;  3H1J E;  1FU1 A;  2G3A A;  3HRN A;  1NTZ J;  2KNC B;  3Q5P A;  5KJ7 A;  1Z56 A;  1U57 A;  2P58 A;  3GHG B;  3EWK A;  3GF3 A;  2JWD A;  1LJ2 A;  5GTI H;  1PPJ E;  2E74 C;  3CX5 H;  2WSE J;  3TK1 A;  3HTK B;  1URQ C;  3H1J J;  1AVY A;  2VRS A;  2NPS D;  3F5H A;  4W7Y A;  4U3F E;  1NO4 A;  1FZG A;  1VQ8 P;  2KSJ A;  1S1C X;  1LTG C;  5TIS E;  1J1E C;  5CCH D;  1Y9B A;  1VQP P;  3FXD A;  1OX3 A;  3BAS A;  1ZR4 A;  1AA0 A;  3MIW A;  1P84 E;  4DOJ A;  1SP4 A;  3L75 E;  1EZV G;  1KB9 H;  1ZRT E;  2AEJ A;  2WSC H;  4PV1 C;  1YJW P;  1BSH A;  1LTJ C;  4LGD E;  1BGY J;  1H0T A;  1M8O B;  4UB8 E;  3B8E B;  3RL0 B;  1K05 A;  1YIJ P;  2XND H;  2N1T B;  4WB4 A;  3QWO C;  1GK6 A;  5KAI H;  3L74 E;  2E76 B;  3L70 G;  3L75 J;  3PHL A;  2OYI C;  4WBA A;  2E75 B;  2Y0E A;  3O8Z A;  1OW8 A;  1RF0 A;  3TGU D;  2GUV A;  1N7S A;  3L72 E;  1FZE A;  3HE5 A;  1NOH A;  1NU1 K;  2FYN C;  2XNX A;  1VQL P;  1JO5 A;  4DJG A;  2PFX A;  3SFE C;  4RJT A;  3CCJ P;  3GHG C;  3HD7 A;  1M1K Q;  3CC7 P;  1FDI A;  2OYH C;  2YKQ A;  2QJP B;  3L4F A;  3WMM 0;  2FXP A;  3AEF C;  1YQ4 C;  4DZO A;  1KQG B;  3SWF A;  3L71 D;  5KAF E;  1NU1 E;  3A0B E;  1NTM K;  4OGQ D;  1Q86 Q;  1GK4 A;  2P2U A;  1SQX J;  3H25 A;  3JCU H;  3G6E P;  1Q82 Q;  3L73 E;  1HGV A;  4JYC A;  4XE5 B;  4EI2 A;  1N73 C;  2LXB A;  3FXE A;  2B87 B;  3Q1M A;  3W67 A;  1L4A A;  1QEX A;  2KXP B;  1M56 D;  4I7Z B;  1BE3 D;  2H88 C;  1VQM P;  3CD6 P;  3C9I A;  1NTM E;  3L73 J;  3U1C A;  3V5B A;  4HYT B;  3RL0 C;  5APY A;  3KXD A;  1OMI A;  1FJK A;  1QVF O;  2E76 C;  3HUS C;  4IFM A;  2AXT E;  2FBW C;  1E5W A;  2IBZ D;  1YBK A;  2Y9Z A;  3VN0 A;  2M8R A;  3RK3 D;  1L0L D;  2XU6 A;  1OWA A;  5AVY B;  2R44 A;  1RE4 A;  1FAV A;  1ZR2 A;  3AEE C;  2D2C D;  1H0T B;  2KP8 A;  2KLU A;  2NPS C;  2YIU B;  3M0D C;  4UB6 E;  1RQV A;  1NGM B;  1BCC J;  4C7R A;  2OAR A;  3QH9 A;  2A45 H;  2ZYA A;  1M90 Q;  3AE7 C;  1XTC C;  2YKP A;  5CCH C;  2MKV A;  2OTJ P;  2V7Q J;  1LT9 B;  2FYU D;  5BU5 A;  1SFC D;  1QLE D;  1VF5 B;  1Y47 A;  1W2E A;  5KLI B;  1EZV E;  4H13 C;  1LTA C;  5KKZ B;  1DD3 A;  3RGU A;  2P7J A;  4I7Z C;  3TGU G;  3TF5 A;  2J59 M;  2L5G B;  1KZU B;  5GTI E;  3T97 B;  2WSF J;  3CX5 E;  2BAS A;  3L70 E;  3L35 A;  3P8C D;  1XTG B;  1P84 I;  2YMK A;  2M5A B;  3Q3D A;  3H1K D;  1ZME C;  2FY8 A;  1SQV J;  1NKZ B;  1M57 D;  2A45 G;  2KNC A;  3V2P A;  4N78 D;  3AEC C;  1FC2 C;  1ZN5 A;  3GHG A;  3PH0 A;  1GDT A;  5B5E H;  2FFD B;  2IZ0 A;  3L71 G;  1S5L X;  1IFN A;  2BEZ F;  3CCV P;  1KN7 A;  3NXS A;  3B5N B;  1KYO I;  1KB9 E;  2IYO A;  2KOG A;  3HTK A;  3U59 A;  4CPG A;  3V2Q A;  2RN0 A;  4D6T D;  2ZXX A;  2Z5I A;  4ASW A;  1NTK D;  1SQQ D;  3CME P;  3D6Z A;  4OGQ C;  5KAI E;  3B71 A;  2ZVN B;  2FXO A;  1SFC B;  3PJS K;  1BE3 G;  3FWL A;  4I1L A;  1N73 A;  5C39 A;  4EOT A;  2FKW B;  2IZ1 A;  1DEB A;  1KIL C;  1HBW A;  1M1J C;  4KJM A;  3CCL P;  3A5T A;  2B9B A;  4R4L A;  5B66 H;  2E74 B;  1PGJ A;  4L76 A;  2HG5 D;  3CXH E;  2M3B A;  2IBZ G;  2W83 C;  2WTY A;  2N1T A;  3O6Q B;  3TNU B;  1URQ B;  3C1L A;  3MUD C;  3I55 P;  3HUS A;  4BRY B;  1EXI A;  2LXC B;  2W6J H;  2W6A A;  1X0T A;  5APV A;  5AW9 B;  5KLV D;  1PFI A;  3CCS P;  1KC8 Q;  1J1E B;  3RK3 C;  1IO4 A;  1CSB A;  3KPE A;  1CW5 A;  3S4R A;  1L0N J;  3R2P A;  3TYY A;  4KHX A;  4AYC A;  1MFZ A;  4Z1M H;  3JCU E;  2Q5U A;  4IL6 H;  3VMA A;  1FJP A;  2O1K A;  3BCC J;  5AW6 B;  4PV1 B;  3E1I A;  1LTJ B;  1AV1 A;  2C0X A;  3H1H D;  1FDM A;  3H1L D;  5AW0 B;  1U7M A;  2D2C C;  3LIE A;  4PJ0 H;  3N7N A;  3I56 P;  2Q1K A;  1X8Y A;  1R5S A;  1K73 Q;  2FYU G;  1YQ3 C;  1YJ9 P;  1K8A Q;  2QEX P;  4XA4 A;  1OIP A;  1SQP D;  4B86 A;  3AEB C;  5CBO A;  2XDJ A;  2GUS A;  2OYI B;  5DJT B;  2N9B A;  1PP9 D;  3LW5 J;  2IYP A;  4WWI A;  2FYN B;  2QJK C;  3AE8 C;  1SFC C;  3CMA P;  1FDO A;  2W27 A;  3V4W A;  3GW6 A;  2B87 A;  1FOS F;  1RHZ B;  3IAO A;  1UII A;  1JCC A;  1G1J A;  2ZYD A;  3II6 A;  2ZVO B;  2OYH B;  2WIT A;  4GDO A;  4L73 A;  3TGU E;  1VQK P;  1LNQ A;  3H1K G;  3CWB J;  3D6Y A;  4RO0 A;  4ZMD A;  5AVZ B;  4RKU J;  1GL2 D;  2POH A;  1NWQ A;  2AXC A;  1GZL A;  2JEE A;  1VDF A;  1EZV I;  2JKV A;  5EFW B;  2JWA A;  3H1I D;  2H8P D;  3PTZ A;  3G9R A;  4WVZ A;  4KT0 J;  2WQY C;  3VTP C;  4C46 A;  1IC2 A;  5GTH H;  4D6T G;  1N73 B;  3PP5 A;  1NTK G;  1SQQ G;  2RH0 A;  1GD2 E;  4H13 D;  4U3F J;  3CX5 I;  3L71 E;  1S5L H;  2QM7 A;  2DW3 A;  2YO3 A;  1KD1 Q;  1LP1 B;  2WPQ A;  3B4S A;  3F89 A;  4W7Z A;  5AVV B;  1JY2 N;  1N86 A;  2Q6Q A;  1FS0 E;  4YTP C;  4L74 A;  3HUS B;  5KJ7 D;  3RK2 C;  1N2D C;  3VMX A;  1JTH B;  1HF9 A;  3L71 J;  1LT9 A;  1LT1 A;  2K37 A;  1HUC A;  1L0L K;  3FX0 A;  1BE3 E;  4HJG H;  1W5C E;  3L36 A;  4H0L D;  3L74 J;  2WT7 B;  2KZI A;  1OVR A;  5APT A;  1YIT P;  5KLV G;  1EDJ A;  1EXJ A;  5CHX A;  4GKG A;  5B5E E;  3L72 J;  3FWN A;  2IBZ E;  1KQS O;  3T97 A;  2ZYG A;  1IFI A;  3RK3 E;  1MUU A;  2NZ2 A;  1BGY D;  2NPS B;  4JYB A;  1RF1 C;  3CL3 D;  3EFG A;  1HJB A;  1GMJ A;  2M5A A;  1L0L E;  2AEM A;  1N8R Q;  1LTI C;  3IR9 A;  2W8Z A;  3H1H G;  1DX7 A;  4W80 A;  2OQQ A;  5E79 H;  3H1L G;  3CXH I;  3H6P A;  4JBZ A;  1DEE G;  2R32 A;  1PIX A;  1MFT A;  2A06 D;  2FFD A;  4H13 B;  4JQ0 D;  1RE3 C;  2G8Y A;  2KZJ A;  3K5B A;  1NU1 J;  1L0L J;  3B5N A;  1S9K D;  1SQP G;  1KIL D;  2Y0C A;  3CC4 P;  2O01 H;  1N7S D;  1PP9 G;  2FYU E;  1KYO D;  4JF7 A;  5B66 E;  2ZJS E;  3G71 P;  2K1A A;  1GU4 A;  2WWW A;  1S2E A;  1LWU C;  1SFC A;  3HD7 D;  1KMI Z;  4OH8 B;  5APW A;  1H88 A;  3KHU A;  1NTM J;  4H0L B;  4U7J A;  4EIJ A;  1SQX D;  2I1J A;  2WSE H;  1GW3 A;  2HR3 A;  1VL2 A;  3ABV C;  4MN4 C;  3P8C E;  1PGP A;  4IL6 E;  1YTZ T;  3O6Q A;  3A0H H;  3TNU A;  1N7L A;  4GOD A;  1HTL C;  1URQ A;  3H1I G;  3H1K E;  1PZQ A;  1NTK K;  2HLO A;  4BRY A;  2B89 A;  1G2C B;  2QJY C;  2W6B A;  4N78 E;  1GL2 C;  4PJ0 E;  1JY3 P;  3M9H A;  4OGQ B;  3VMZ A;  2O01 N;  1Q7Y Q;  1HWT C;  3CCQ P;  4Y28 J;  4BWN A;  2C9N Y;  2QIW A;  3D70 A;  1ZW0 A;  4WY4 C;  4EDF A;  4ASV A;  3V4Q A;  4D6T E;  1M7L A;  1LTJ A;  1NTK E;  1SQQ E;  1KIL B;  3RBX A;  1M1J B;  1USE A;  2OYO A;  1ZOY C;  3TSI A;  5AW5 B;  5DJU B;  2K88 A;  4BXL A;  4TT3 H;  3MTU E;  2QSI A;  2H43 A;  4C7N B;  2A45 I;  5CCG C;  1VQ4 P;  1S72 P;  3VMY A;  4NPF X;  2OYI A;  3A7O A;  5KJ7 C;  1OVV A;  1IFP A;  1KFN A;  1J1D C;  1IZN B;  2K3R A;  2ZT9 C;  2BEQ D;  4I6M C;  2B88 A;  3RK3 B;  1IFM A;  4ZNC A;  3G3Z A;  5AVS B;  3I5C A;  1KYO H;  1T8Z A;  1BCC D;  3H32 B;  1T3J A;  4PD4 D;  4H0L C;  1JOC A;  1BGY G;  3L70 J;  2QRX A;  2Q3I A;  2OYH A;  5GTH E;  5KLV E;  2KB7 P;  4H44 D;  4IFF A;  3WUV A;  2D2C B;  1FE6 A;  3SFD C;  2M3E A;  4Y99 B;  1RF1 A;  1PGQ A;  3Q2Y A;  3VYI A;  1VQ7 P;  3R4Y A;  3MGN A;  3M0A A;  3GG2 A;  1KTM A;  2A06 G;  3EQ2 A;  3P8M C;  1NAF A;  3RK2 D;  3C8V A;  3S1K A;  1A02 J;  2ZXE B;  3AE5 C;  1LTS C;  3H1H E;  2WSC J;  2QJK B;  3H1L E;  2QA4 P;  2IBZ I;  2IPP A;  1Y8A A;  3BVH A;  1SQV D;  2YKO A;  2IDB A;  1CZQ A;  1SLQ A;  5TJH A;  1QVG O;  1SQP E;  1KFM A;  2E42 A;  1LP1 A;  4L75 A;  1FZF A;  4YXD C;  1N7S C;  1RQU A;  1PP9 E;  3M9B A;  2Y9Y A;  3H1L J;  2KK7 A;  2QVA A;  2E5T A;  4AQR D;  1JTH A;  3N4X A;  2H7H A;  2W90 A;  4HB1 A;  1SQX G;  1QGK B;  1AQ5 A;  5BU8 B;  3HD7 C;  2V4H A;  3VP8 A;  2BCC D;  2O1J A;  1GW4 A;  3IFM A;  1JY2 O;  4LC1 A;  3KQG A;  2XKM A;  4GT1 A;  2WT7 A;  1X9V A;  3E7K A;  5E79 E;  5CJ4 A;  1KQL A;  5AVR B;  3A2A A;  4H44 B;  1Q81 Q;  2PRR A;  1BSN A;  1IK7 A;  1KV4 A;  3IF4 A;  4HH2 A;  4PD4 H;  3H1I E;  2NPS A;  4NPE A;  3AE9 C;  2SPZ A;  3M0D A;  4Y99 C;  4K35 A;  2V7Q H;  1AFO A;  1HGZ A;  5AVU B;  2KSE A;  2OTK E;  2WZ7 A;  3RK2 B;  2KYV A;  5CCH A;  2GM4 A;  1A02 F;  3KZI H;  2YO2 A;  1L4A C;  4GIF A;  1IJD B;  1G1I A;  2N1T D;  2AEF A;  1ZXG A;  4N6J A;  4YPC A;  5H2F H;  2Q3E A;  1FZA A;  1LTT C;  3CPW O;  1SQB D;  1Q90 D;  3JC2 2;  3LID A;  2E75 D;  2XV5 A;  1L0N D;  2K9J B;  2WSF H;  2KS1 B;  4A7P A;  3VOP A;  2KUB A;  5APQ A;  3SWY A;  1HH0 A;  3M9Q A;  3BCC D;  1YYC A;  5APU A;  4ZKP A;  3CI9 A;  3A0H E;  5L8R J;  1BCC G;  1PV3 A;  4DCK A;  1RF1 B;  3OAK A;  4GOE A;  1KOR A;  1RE4 C;  3VP9 A;  3A3Y B;  2RKL A;  2XZR A;  2E43 A;  4AUW A;  2LR2 A;  3CCE P;  3G4S P;  3TGU J;  5CBN A;  1J2J B;  2KIK A;  4M3L A;  3AED C;  4LLH A;  4WY4 D;  1FZC B;  2QE7 H;  3PLN A;  1BGY E;  1VPC A;  2E5Y A;  2JDI H;  3HE4 B;  4H44 C;  3AE6 C;  1VQ5 P;  1NTZ D;  2R5B A;  3M06 A;  3GLM A;  1G2C A;  2N9Y B;  3KDP B;  1VQN P;  5CCG D;  3AE2 C;  1LWU B;  2A06 E;  3BAT A;  1SQV G;  3CWB D;  3OW2 O;  1GU5 A;  3H1J D;  1S9K E;  1JY3 N;  2ZT9 D;  1KIL E;  1JM0 A;  1IFJ A;  1QL2 A;  3S9O A;  1KB9 I;  1SQX K;  1S3J A;  1KIL A;  2Y0D A;  2Z4E A;  2WVR A;  2PAJ A;  2Q7C A;  1KYO E;  1M1J A;  1PPJ D;  2OGU A;  3BRT B;  1OW6 A;  2O3J A;  3RBZ A;  1R5L A;  1K04 A;  3USS A;  1QL1 A;  2KI7 B;  4QMA A;  3MUD A;  4C7N A;  2BCC G;  5APS A;  2QJY B;  4U3F D;  2P10 A;  3WU2 H;  1BE3 J;  3CC2 P;  1GL2 B;  3CLQ A;  3CXH H;  2YNY A;  1SQX E;  2JR8 A;  3E1R A;  1RH5 B;  2K9Y A;  5AW4 B;  1MKM A;  4JPZ B;  2FYU K;  2ZAE B;  1RY3 A;  5K5G B;  1E79 H;  1P84 D;  3H32 A;  3EFF K;  3L75 D;  2OTL P;  1IK9 A;  1GTW A;  1ZRT D;  4WY4 B;  2PP6 A;  5AW1 B;  1OVU A;  1JEK A;  4TLF A;  1YJN P;  1EDI A;  1DD4 A;  1UIX A;  1FZC C;  1T2K D;  2CK3 H;  2HOD B;  2YXQ B;  2YMY A;  1ZLL A;  3U1A A;  2CPB A;  3UIA A;  5AW3 B;  2LKM A;  3AE3 C;  1AJY A;  1CI6 B;  3L74 D;  4RES B;  3LW5 H;  1VF5 D;  1JMM A;  3CCU P;  3L72 D;  1EC5 A;  1J1D B;  2HPC A;  2ZT9 B;  5AVQ B;  1SQB G;  1NJI Q;  4YXW H;  2QM8 A;  1L0N G;  2RMZ A;  3GMA A;  2N1T C;  2C0W A;  3BCC G;  4N3Y B;  2FYU J;  5AVX B;  1NYH A;  1OXZ A;  2KLV A;  1S4X A;  3RL0 g;  2E75 C;  1OFC X;  1TU3 F;  3TDK A;  1KQF B;  1NH4 A;  1PL5 A;  1ZV8 A;  1NU1 D;  1SQQ K;  2JO1 A;  3AEG C;  3IN6 A;  1JUN A;  4IL6 X;  1BCC E;  1WRG A;  2PGD A;  4PD4 E;  5AVT B;  1YHQ P;  2GA1 A;  2NRG A;  1NVO A;  2HYN A;  3MD0 A;  1JCD A;  3L73 D;  3B5N D;  1JY2 P;  1AVO A;  1L4A D;  5CJ0 A;  1YI2 P;  3BRV B;  2QJP C;  1NTZ G;  1WMK A;  5BVZ A;  3H1K J;  4K3A A;  2WPR A;  3L37 A;  3KZI E;  3ZDM A;  4IFD K;  2I8D A;  1SQV K;  5TIS H;  1NKN A;  5M1B A;  3MP7 B;  1NTM D;  5H2F E;  4OWF A;  1P84 H;  3SSU A;  1N7S B;  3CWB G;  3HE5 B;  3H1J G;  1AQT A;  1JMB A;  3M91 A;  3AEA C;  5KLV K;  1MV8 A;  4UB8 H;  3P32 A;  4D6T J;  5AVW B;  1D7M A;  1NTK J;  1SQQ J;  2H89 C;  1SQV E;  1PPJ G;  3HD7 B;  2C9L Y;  2E74 D;  1BDD A;  2R3C A;  1JNM A;  1T6A A;  2UWJ E; 
#chains in the Genus database with same CATH homology
 2K37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...