2K37A

Csma
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
59
structure length
59
Chain Sequence
MSGGGVFTDILAAAGRIFEVMVEGHWETVGMLFDSLGKGTMRINRNAYGSMGGGSLRGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional structure of CsmA: A small antenna protein from the green sulfur bacterium Chlorobium tepidum.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Chlorosome Protein A
total genus 17
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2008-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.950 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces bacteriochlorophyll c-binding protein 2k37A00
2K37A
chains in the Genus database with same CATH superfamily
1KILC 2WSCJ 5BU8B 4YXWH 2HPCA 2Y0CA 2O01J 3MIWA 5CCHA 1RF1A 1Y9BA 2M0BA 3MHVA 3PRJA 3P7KA 1KB9H 3G9RA 1LJ2A 1T8ZA 1E79H 1FJKA 1HTLC 1KILD 2AXCA 3BCCD 3EFFK 1N73A 1H0TB 3BATA 1IFIA 2WSEH 2O1KA 2G8YA 3M91A 1SQQG 1SQXE 3CXHH 3K5BA 1KB9I 1R5SA 4KHXA 2QJYC 1NKNA 2BCCJ 2JO1A 4H44B 3SFDC 2L91A 1EZVD 1HJBA 1MKMA 1N86A 1OW7A 3CXHD 3L35A 1LT1A 3CXHE 4H0LB 1SQXG 4ZKPA 1M1JA 1RE4A 1SQVK 1L0ND 1M1JC 1LGHB 1RE4C 3RL0D 1FOSE 1PGPA 1XTCC 1NAYA 4O9BA 2Q5UA 1AV1A 4U3FJ 3B71A 1YJNP 5GTIH 2OYIB 4EOTA 2V7QH 1KN7A 1IO4A 1VQ9P 1FZCA 1J2JB 1PPJE 2IZ1A 2W83C 1LTBC 4D6TJ 4N3YB 2QA4P 1GMJA 3QWOC 1WT6A 1JTHB 1PP9D 2WMMA 4BXLA 3Q5SA 1N7SD 2NPSA 2V4HA 3L36A 2IDBA 1JCDA 3HUSC 3PJSK 4ZNCA 2K9JB 4MN4C 1ZW0A 1NTMG 3L70J 3U59A 3L71J 2WPVB 2OYHA 1NU1J 3IF4A 2JWDA 4HH2A 5TISE 3O8ZA 2XU6A 3V2QA 1SQBG 2YMYA 3FGAD 4WY4B 2QEXP 2OQQA 3AE4C 3HE4B 3PH0A 1EDJA 1EQ7A 4UB6E 4ZMDA 1Y47A 1FZBA 1L0LK 1W2EA 1ZXGA 2FXPA 2K9YA 1JCCA 3KXDA 3L74G 4IL6H 2E5YA 2B89A 1LT9C 4BRYA 1KD1Q 1USDA 1NTZJ 3M0DA 5APQA 3CCRP 2YKQA 1ZN5A 4TT3H 1K05A 2Y0DA 3TGUG 4AQRD 2RMZA 2FFDC 2IFNA 2KSJA 3MGNA 2FFDA 3TGUD 4PV1B 3CWBG 2QVAA 1URQA 2ZT9B 5GTIE 2PAJA 1PL5A 2RKLA 5KTBA 1Q7YQ 1RF0A 4HKZH 3H1HD 2UWJE 3HRNA 2Q1KA 3AE3C 1SP4A 2ZT9C 3VP8A 1JTHA 3RK3B 2OTJP 3D6YA 1QL1A 5KLIB 2NPSB 3FX0A 1BE3G 1P84D 3BRTB 1VQ5P 3I55P 3BVHA 2ZVOB 2WZ7A 2OYHC 1BGYJ 5KLVK 1OFCX 1W5CE 2IZ0A 3H1IG 5E79H 1VQKP 2C0WA 1GL2D 3L37A 5AW3B 5H2FE 3CCLP 1KZUB 3P8MC 2POHA 4R4LA 5APTA 3IR9A 2XNDH 1G2CB 2N9YB 1RF1C 2IBZG 3T97B 3CLQA 3H1IE 5B66E 2W90A 4M3LA 1OVVA 1LWUB 1SQVD 2QRXA 4L76A 1Q2NA 3JC22 1J1DC 3Q5RA 1JMBA 1BGYG 3C9IA 3V4WA 1HUCA 3VTPC 1JM0A 5APUA 1VQ7P 3C1LA 3H1IJ 3CC7P 1L0NJ 1BDDA 2YIUB 1X22A 2ZJSE 1KYOE 3HTKB 3M9HA 1IZNB 3WU2H 4IL6X 1L4AD 2A45H 2WSFJ 1FDOA 3RK2B 3H6PA 5DJUB 2JR8A 5APSA 3AE6C 3L4FA 5AVRB 1JNMA 2GUVA 2ZYAA 3NXSA 1JMMA 1X0TA 1NTME 4PJ0E 1N7SC 3ZDMA 4D6TD 3H32B 1FBMA 3U1CA 1EDLA 2JP3A 3FXEA 3QH9A 1BDCA 3TDKA 2K1AA 1AQTA 5APXA 2DW3A 1IK9A 3MTUE 1DD3A 1LP1A 2KLVA 3BCCJ 1AVOA 3A0HH 3L74E 3V5BA 1AFOA 4EIJA 2H43A 2ZXEB 1KB9E 3RL0C 3TK1A 1QLED 2BCCD 3BASA 1GTWA 2YXRB 2ZYGA 4H44D 1E5WA 3UIAA 4IFMA 4PD4H 4W7YA 2WSSH 3RK2C 3AE8C 5APVA 4ZKUA 1FZEA 1J1EC 2KZIA 1NTZE 2LKMA 1DD4A 2BEZF 2YIUC 3BRVB 3L73E 4I7ZB 4UB8E 3W67A 1CI6A 2Y9ZA 2KXPB 4OH8B 1KQSO 3CD6P 1U7JA 2QG4A 3E1RA 1HH0A 2WWWA 3A3YB 5CCGC 3RL0g 1EZVE 2V7QJ 5EFWB 4NPDA 3NMDA 1BE3E 3MUDA 2OTLP 1OWAA 3TNUA 2Y0EA 1X9VA 3EQ2A 3R2PA 1IFNA 1AVYA 2B88A 1S5LH 1N7SB 5BU5A 4XFJA 3OW2O 3Q1MA 3PHLA 1RE3C 2XZRA 3V6IA 1NU1G 1EDIA 2PGDA 2WSCH 5KLVJ 3RBXA 3CCMP 2R5BA 3Q5PA 3L72E 1BGYD 1SVFA 3N4XA 1L0NK 3USSA 2YO3A 1N2DC 1YQ4C 1QGKB 1P84I 2D2CB 2ZXXA 2Z5HA 1JY3O 2KIKA 5AW4B 1P84H 4GDOA 3L71E 2E75C 4DJGA 1EDKA 2XNXA 4IOIH 5GTHH 1T2KD 2C9NY 2HODB 1RY3A 2HODA 5M1BA 4EI2A 1FZCC 1KILA 2ZVNB 1FZFA 1HVVA 2KSEA 1NTKG 4YPCA 3EFGA 4U3FG 3AE9C 5TJHA 2QJPC 1SQPG 1UIXA 4OVNF 4EDFA 2CK3H 3AEEC 3H1LD 3LIEA 2FFDB 1SQPD 2RN0A 3AE5C 4HJGH 3KPEA 1KQFB 4EYYQ 1MFTA 2Q3EA 2WVRA 1M90Q 3D71A 1JY3P 2IX7C 3CMEP 2B9BA 5AW0B 1LTIC 2KLUA 3S4RA 2IBZI 1OVUA 2KOGA 2N9BA 5K5GB 1NWQA 1K9MQ 2NPSD 2P2UA 1QEXA 3ITKA 4WY4C 1QVGO 1TU3F 2XV5A 5CBNA 1OVRA 1BSNA 1T6AA 3CWBD 3EWKA 1FDIA 4PJ0H 1IFDA 1NH4A 1ZR2A 2W8ZA 4N78E 1YIJP 3ABVC 1SQQE 4PV1C 1IFPA 2WSEJ 1NHLA 2XKMA 4IFFA 1FC2C 1GL2A 1VF5D 4I2LC 2VRSA 1CW5A 2QM8A 2RH0A 2LXBA 3LIDA 5H2FH 1NTZG 1JO5A 2I8DA 1KV4A 3FWLA 1W2BO 2WPRA 2BEQD 3KHUA 3P8CE 5KAFH 1N73B 1KILE 1SFCB 2OARA 3L75J 2OYIC 1SFCA 1SFCC 2R3SA 1OMIA 5B66H 1LTJC 1AA0A 3HD7A 4L74A 1BCCJ 1ZRTD 3H1JG 1PGQA 1PZQA 5KKZB 2GM4A 4CPGA 4RO0A 3HTKA 2WT7B 1L4AB 1SS1A 3SWKA 4JF7A 1PFIA 1L4AA 1PIXA 2QJPB 2XDJA 2YKPA 3AECC 3H1ID 3VOPA 4C46A 3TSIA 5KJ7A 1EZVI 2A45I 4RJTA 3NTNA 1FOSF 1SQVE 4ASWA 1NOHA 2FYNC 1HBWA 3H1JE 5B5EE 1FZCB 1GDTA 4K35A 3U1AA 1UIIA 4U3FD 4LLHA 4C7NA 1M7LA 3RK3E 3G4SP 2Q3IA 2J5UA 3JCUE 1RHZB 2D2CC 2WITA 4W80A 5AVQB 4DZOA 1LTSC 2FXMA 2A45G 5CCGD 1T2KC 1MUUA 3HUSA 1MZ9A 1NTKD 3O6QA 1H88A 2YKOA 1NTKE 4RKUJ 4H0LC 1KB9D 5AVXB 3VP9A 4A7PA 3AE7C 5KLVE 1PGJA 2E43A 1DH3A 2CPSA 1LTJA 3BCCE 2GUSA 1S3JA 2E76D 1LTAC 3A0HE 2P1JA 3V2NA 1Q86Q 3L74D 1CSBA 3L73D 1URQC 4PD4E 3HD7B 2O3JA 2E75B 1LNQA 1U7MA 2K37A 3H1HG 4Y99B 4YXDC 3BCCG 5KAIH 1CI6B 3I5CA 5KAFE 1XTGB 1K04A 1IJDB 1URQD 3RGUA 1DEBA 1J1EB 1FS0E 1NVOA 4NPFX 2I1KA 5AW2B 1GZLA 1GK4A 5DJTB 1VDFA 3H1HE 4N6JA 3Q3DA 2QIWA 2FBWC 2N1TC 5CMZA 4DOJA 2JJLA 3GF7A 3CCUP 1NGMB 2B87B 4YTPC 4OGQD 2QSIA 2FYNB 1VQPP 4L75A 1Y8AA 1JB0J 3S1KA 1IFMA 1BE3D 2FYUJ 2G3AA 3L72D 3V4QA 2ZYDA 3GW6A 1QVFO 2D2CD 1NJIQ 2HPCB 1IC2A 1VQ8P 2R32A 5CCHD 3G71P 1PPJG 2FYUK 3L70G 2OTKE 4LGDE 1FAVA 1NAFA 5AW1B 1JOCA 1OX3A 1P84E 4TLFA 1EXJA 3P8CD 5APWA 4H13D 1HWTC 1VQNP 4I1LA 1A02F 1SQBJ 2E76C 1BGYE 3SSUA 3L75D 3C8VA 4JYBA 4WB4A 2KI7B 3IAOA 3LW5J 2JDIH 4HYTB 1LWUA 2C0XA 2KZJA 3AEBC 1RQVA 4H0LD 3H1LE 3RL0B 1R8EA 2AXTH 1BCCD 1SQXJ 2HLOA 4ASVA 1VQOP 2Z5IA 2HG5D 1S5LE 1SQPJ 1M56D 2E74C 3B5NC 1L4AC 5AVYB 2A06E 3IN6A 3P32A 3PP5A 3AE2C 2A06D 3KQGA 4KT0J 1T3UA 5KKZC 1SQQK 3V2RA 1JY2P 1MV8A 1NTMJ 1OW8A 3TGUE 2QE7H 1YYCA 1NO4A 2B87A 1SQBK 2ZT9D 4HB1A 2WTYA 1G1JA 3CWBE 3CX5H 1WRGA 2M8RA 3F89A 2A06G 5KJ7D 3JCUH 2OYIA 2KP8A 1LTGC 3HE5B 3CWBJ 1VF5B 3G6EP 3CCSP 3O6QB 2IYOA 1RF1B 3NFQA 2NZ2A 1NTKJ 2NPSC 4JBZA 4WY4D 3AEFC 5CHXA 1VQ6P 1SFCD 1SQXK 3E1IA 1L0LD 1LWUC 1LP1B 2YO2A 4N78D 5TISH 2R44A 2K3RA 1H89A 1OXZA 1VPCA 3L74J 1FJPA 2QJKB 1YQ3C 4UB8H 5AW7B 4DT0A 1KC8Q 2L5GB 2AXTE 3II6A 3WUUA 1GU5A 1DEEG 2KYVA 1L2PA 4PV1D 4C7RA 5AW8B 4BRYB 1S1CX 2JWAA 1GW3A 4WWIA 1NTZK 3H1JJ 5AVUB 1YBKA 3RK2D 3GHGC 1H0TA 4NPEA 3B8EB 2H7HA 3MZWB 1Q81Q 2W6JH 2GA1A 2YXQB 3CL3D 3FWNA 3PTZA 3CCEP 2H8PD 1N7SA 5L8RJ 1A02J 3RK3D 2O01H 3KYQA 4QMAA 3WMM0 4AYCA 2MKVA 3CX5D 5KJ7C 1HJ0A 2FYUE 3CCVP 2E74B 2FYUD 1BE3J 1PPJD 2ZFCA 3B5NB 3M9BA 1S72P 4BWNA 3L70D 2M3BA 1GU4A 2KB7P 3HUSB 1RH5B 1N7LA 1QX8A 3L71D 4JYCA 4R4MA 5KLVD 3S9OA 5CBOA 5CCHC 1ZOYC 2YNYA 3PLNA 5CJ0A 1JUNA 3H1LG 5GTHE 1HGVA 3L73J 3D70A 1ZLLA 1YJWP 2OYOA 2Z4EA 3HD7D 1AQ5A 4WY4A 4OWFA 2J59M 2N1TA 2W6AA 2P7JA 1PGOA 3AEGC 4K3AA 5KAIE 2AEFA 2IYPA 2N1TD 1SQBE 1FE6A 1M57D 4L73A 3T97A 1GD2E 4GKGA 5BVZA 3CC2P 4H13C 3WUVA 2ITAA 2MJZA 3I56P 1SLQA 2BASA 2FXOA 1KQGB 3H1LJ 4RESB 1OIPA 4H44C 4I6MC 3H1KJ 2BCCG 2J58A 2PFXA 3L73G 4I7ZC 5C39A 2AEMA 4OGQB 3VMZA 3H1HJ 1S9KE 3CI9A 1BSHA 3CCJP 2SPZA 1JY2N 1KMIZ 4GOEA 3L72J 2OGUA 2CPBA 3WUTA 3GG2A 3AEDC 3HE5A 5CCGA 1OW6A 1VL2A 4OGQC 1SQQD 3A2AA 1ZR4A 2KK7A 3JSVC 4PD4I 1JY2O 2H89C 4JQ0D 2WPQA 3CXHI 4H13B 3HD7C 3D6ZA 1KILB 1NU1E 1RE3A 2HFED 3L75E 3VMAA 1AJYA 1DX7A 1RF0C 3AEAC 3KZIE 3MP7B 2YMKA 3L72G 3M0AA 1Q82Q 1FU1A 2M3EA 2QJYB 4Z1MH 1SQXD 1BCCE 1JY3N 3RBZA 1IK7A 4DCKA 2WT7A 4IFDK 3OJAB 2H88C 3L71G 1EZVG 2K88A 1T3JA 1M8OB 3GHGB 2ZAEB 4WVZA 2Q9IA 1YI2P 3KZIH 2NRGA 3SFEC 5B5EH 2KS1A 2M5AB 2IBZD 2O01N 1IFJA 1KYOI 2KS1B 2IBZE 3H1JD 1S4XA 1NTMD 2LXCB 2Y9YA 3IFMA 4W7ZA 2FYUG 5AW6B 3RK3C 2R5DA 3G3ZA 2R3CA 1J1DB 4U3FE 4Y99C 3M06A 1K8AQ 1SQPE 3A0BE 3H1KE 1DIPA 5AVVB 4C7NB 3GF3A 1PP9G 4D6TG 2E42A 2HYNA 2O1JA 4GOFA 3MUDC 3N7NA 1KYOH 3WU2E 2I1JA 4WBAA 3VMXA 3B5NA 3TF5A 1G1IA 1PP9J 2KNCA 2Q7CA 2KNCB 3H32A 5KLVG 1FZGA 5AVWB 2FYZA 3VMYA 3CC4P 4D6TE 1PP9E 1CZQA 1FZAA 1VF5C 1YTZT 2IFMA 2K9JA 3FXDA 3KDPB 1L0LE 3CPWO 1KFNA 3GLMA 5AW5B 1LTJB 2AEJA 2OYHB 1OZHA 4LC1A 1L0LJ 5KLIC 4Y28J 1ZP0C 3R4YA 2QJKC 2W27A 3HE4A 3SWYA 5E79E 4GODA 3F5HA 1L0LG 1ZMEC 1GL2C 2BCCE 2HR3A 2P67A 2KUBA 3CX5I 3LW5H 1ZV8A 3SWFA 1GW4A 1SQPK 2E5TA 1QL2A 2M5AA 1U57A 1YHQP 2WSFH 1NTKK 1VQMP 1HF9A 3TNUB 2Q6QA 1NTZD 1L0NE 2JEEA 2C9LY 5CJ4A 3A0BH 4XA4A 1X79B 1EXIA 1VQ4P 1HGZA 3E7KA 2P10A 1PV3A 3TGUJ 1LT9B 1RQUA 3B4SA 3TYYA 1S9KD 1LT9A 2IPPA 1YITP 2E74D 3B5ND 3OA7A 3M9QA 2QM7A 1Q90D 5APYA 4XE5B 2PP6A 1L0NG 1YTZI 1KORA 3L70E 4JPZB 4GT1A 1N73C 1NYHA 1NTMK 3MD0A 3L75G 3A5TA 3CCQP 1KQLA 1FDMA 1K73Q 3W68A 1NU1K 1KFMA 4IL6E 3M0DC 3GMAA 3A7OA 3CX5E 1S5LX 1BCCG 4U7JA 4UB6H 1NU1D 3AE1C 2WPSA 5AVTB 1M1KQ 4KJMA 1X8YA 1R5LA 1S2EA 1WMKA 1GL2B 1G2CA 1ZRTE 2FY8A 4AUWA 2N1TB 3CMAP 3VYIA 1SQBD 3Q2YA 1EC5A 2E76B 1H8AA 2FKWB 3GHGA 1SQVG 1NKZB 3H1KG 3V2PA 1JEKA 2W6BA 1KTMA 5AVZB 1Z56A 2P58A 2JKVA 3OAKA 1D7MA 1MFZA 2PRRA 5AW9B 4B86A 1LTTC 1GK6A 2E75D 1M1JB 4PD4D 1SQVJ 1VQLP 1YJ9P 2WQYC 3VN0A 3H1KD 2LR2A 1URQB 1KYOD 1N8RQ 3H25A 5AVSB 4GIFA 1USEA 1SQQJ
chains in the Genus database with same CATH topology
2K37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K37 A; 
#chains in the Genus database with same CATH topology
 1KIL C;  2WSC J;  5BU8 B;  4YXW H;  2HPC A;  2Y0C A;  2O01 J;  3MIW A;  5CCH A;  1RF1 A;  1Y9B A;  2M0B A;  3MHV A;  3PRJ A;  3P7K A;  1KB9 H;  3G9R A;  1LJ2 A;  1T8Z A;  1E79 H;  1FJK A;  1HTL C;  1KIL D;  2AXC A;  3BCC D;  3EFF K;  1N73 A;  1H0T B;  3BAT A;  1IFI A;  2WSE H;  2O1K A;  2G8Y A;  3M91 A;  1SQQ G;  1SQX E;  3CXH H;  3K5B A;  1KB9 I;  1R5S A;  4KHX A;  2QJY C;  1NKN A;  2BCC J;  2JO1 A;  4H44 B;  3SFD C;  2L91 A;  1EZV D;  1HJB A;  1MKM A;  1N86 A;  1OW7 A;  3CXH D;  3L35 A;  1LT1 A;  3CXH E;  4H0L B;  1SQX G;  4ZKP A;  1M1J A;  1RE4 A;  1SQV K;  1L0N D;  1M1J C;  1LGH B;  1RE4 C;  3RL0 D;  1FOS E;  1PGP A;  1XTC C;  1NAY A;  4O9B A;  2Q5U A;  1AV1 A;  4U3F J;  3B71 A;  1YJN P;  5GTI H;  2OYI B;  4EOT A;  2V7Q H;  1KN7 A;  1IO4 A;  1VQ9 P;  1FZC A;  1J2J B;  1PPJ E;  2IZ1 A;  2W83 C;  1LTB C;  4D6T J;  4N3Y B;  2QA4 P;  1GMJ A;  3QWO C;  1WT6 A;  1JTH B;  1PP9 D;  2WMM A;  4BXL A;  3Q5S A;  1N7S D;  2NPS A;  2V4H A;  3L36 A;  2IDB A;  1JCD A;  3HUS C;  3PJS K;  4ZNC A;  2K9J B;  4MN4 C;  1ZW0 A;  1NTM G;  3L70 J;  3U59 A;  3L71 J;  2WPV B;  2OYH A;  1NU1 J;  3IF4 A;  2JWD A;  4HH2 A;  5TIS E;  3O8Z A;  2XU6 A;  3V2Q A;  1SQB G;  2YMY A;  3FGA D;  4WY4 B;  2QEX P;  2OQQ A;  3AE4 C;  3HE4 B;  3PH0 A;  1EDJ A;  1EQ7 A;  4UB6 E;  4ZMD A;  1Y47 A;  1FZB A;  1L0L K;  1W2E A;  1ZXG A;  2FXP A;  2K9Y A;  1JCC A;  3KXD A;  3L74 G;  4IL6 H;  2E5Y A;  2B89 A;  1LT9 C;  4BRY A;  1KD1 Q;  1USD A;  1NTZ J;  3M0D A;  5APQ A;  3CCR P;  2YKQ A;  1ZN5 A;  4TT3 H;  1K05 A;  2Y0D A;  3TGU G;  4AQR D;  2RMZ A;  2FFD C;  2IFN A;  2KSJ A;  3MGN A;  2FFD A;  3TGU D;  4PV1 B;  3CWB G;  2QVA A;  1URQ A;  2ZT9 B;  5GTI E;  2PAJ A;  1PL5 A;  2RKL A;  5KTB A;  1Q7Y Q;  1RF0 A;  4HKZ H;  3H1H D;  2UWJ E;  3HRN A;  2Q1K A;  3AE3 C;  1SP4 A;  2ZT9 C;  3VP8 A;  1JTH A;  3RK3 B;  2OTJ P;  3D6Y A;  1QL1 A;  5KLI B;  2NPS B;  3FX0 A;  1BE3 G;  1P84 D;  3BRT B;  1VQ5 P;  3I55 P;  3BVH A;  2ZVO B;  2WZ7 A;  2OYH C;  1BGY J;  5KLV K;  1OFC X;  1W5C E;  2IZ0 A;  3H1I G;  5E79 H;  1VQK P;  2C0W A;  1GL2 D;  3L37 A;  5AW3 B;  5H2F E;  3CCL P;  1KZU B;  3P8M C;  2POH A;  4R4L A;  5APT A;  3IR9 A;  2XND H;  1G2C B;  2N9Y B;  1RF1 C;  2IBZ G;  3T97 B;  3CLQ A;  3H1I E;  5B66 E;  2W90 A;  4M3L A;  1OVV A;  1LWU B;  1SQV D;  2QRX A;  4L76 A;  1Q2N A;  3JC2 2;  1J1D C;  3Q5R A;  1JMB A;  1BGY G;  3C9I A;  3V4W A;  1HUC A;  3VTP C;  1JM0 A;  5APU A;  1VQ7 P;  3C1L A;  3H1I J;  3CC7 P;  1L0N J;  1BDD A;  2YIU B;  1X22 A;  2ZJS E;  1KYO E;  3HTK B;  3M9H A;  1IZN B;  3WU2 H;  4IL6 X;  1L4A D;  2A45 H;  2WSF J;  1FDO A;  3RK2 B;  3H6P A;  5DJU B;  2JR8 A;  5APS A;  3AE6 C;  3L4F A;  5AVR B;  1JNM A;  2GUV A;  2ZYA A;  3NXS A;  1JMM A;  1X0T A;  1NTM E;  4PJ0 E;  1N7S C;  3ZDM A;  4D6T D;  3H32 B;  1FBM A;  3U1C A;  1EDL A;  2JP3 A;  3FXE A;  3QH9 A;  1BDC A;  3TDK A;  2K1A A;  1AQT A;  5APX A;  2DW3 A;  1IK9 A;  3MTU E;  1DD3 A;  1LP1 A;  2KLV A;  3BCC J;  1AVO A;  3A0H H;  3L74 E;  3V5B A;  1AFO A;  4EIJ A;  2H43 A;  2ZXE B;  1KB9 E;  3RL0 C;  3TK1 A;  1QLE D;  2BCC D;  3BAS A;  1GTW A;  2YXR B;  2ZYG A;  4H44 D;  1E5W A;  3UIA A;  4IFM A;  4PD4 H;  4W7Y A;  2WSS H;  3RK2 C;  3AE8 C;  5APV A;  4ZKU A;  1FZE A;  1J1E C;  2KZI A;  1NTZ E;  2LKM A;  1DD4 A;  2BEZ F;  2YIU C;  3BRV B;  3L73 E;  4I7Z B;  4UB8 E;  3W67 A;  1CI6 A;  2Y9Z A;  2KXP B;  4OH8 B;  1KQS O;  3CD6 P;  1U7J A;  2QG4 A;  3E1R A;  1HH0 A;  2WWW A;  3A3Y B;  5CCG C;  3RL0 g;  1EZV E;  2V7Q J;  5EFW B;  4NPD A;  3NMD A;  1BE3 E;  3MUD A;  2OTL P;  1OWA A;  3TNU A;  2Y0E A;  1X9V A;  3EQ2 A;  3R2P A;  1IFN A;  1AVY A;  2B88 A;  1S5L H;  1N7S B;  5BU5 A;  4XFJ A;  3OW2 O;  3Q1M A;  3PHL A;  1RE3 C;  2XZR A;  3V6I A;  1NU1 G;  1EDI A;  2PGD A;  2WSC H;  5KLV J;  3RBX A;  3CCM P;  2R5B A;  3Q5P A;  3L72 E;  1BGY D;  1SVF A;  3N4X A;  1L0N K;  3USS A;  2YO3 A;  1N2D C;  1YQ4 C;  1QGK B;  1P84 I;  2D2C B;  2ZXX A;  2Z5H A;  1JY3 O;  2KIK A;  5AW4 B;  1P84 H;  4GDO A;  3L71 E;  2E75 C;  4DJG A;  1EDK A;  2XNX A;  4IOI H;  5GTH H;  1T2K D;  2C9N Y;  2HOD B;  1RY3 A;  2HOD A;  5M1B A;  4EI2 A;  1FZC C;  1KIL A;  2ZVN B;  1FZF A;  1HVV A;  2KSE A;  1NTK G;  4YPC A;  3EFG A;  4U3F G;  3AE9 C;  5TJH A;  2QJP C;  1SQP G;  1UIX A;  4OVN F;  4EDF A;  2CK3 H;  3AEE C;  3H1L D;  3LIE A;  2FFD B;  1SQP D;  2RN0 A;  3AE5 C;  4HJG H;  3KPE A;  1KQF B;  4EYY Q;  1MFT A;  2Q3E A;  2WVR A;  1M90 Q;  3D71 A;  1JY3 P;  2IX7 C;  3CME P;  2B9B A;  5AW0 B;  1LTI C;  2KLU A;  3S4R A;  2IBZ I;  1OVU A;  2KOG A;  2N9B A;  5K5G B;  1NWQ A;  1K9M Q;  2NPS D;  2P2U A;  1QEX A;  3ITK A;  4WY4 C;  1QVG O;  1TU3 F;  2XV5 A;  5CBN A;  1OVR A;  1BSN A;  1T6A A;  3CWB D;  3EWK A;  1FDI A;  4PJ0 H;  1IFD A;  1NH4 A;  1ZR2 A;  2W8Z A;  4N78 E;  1YIJ P;  3ABV C;  1SQQ E;  4PV1 C;  1IFP A;  2WSE J;  1NHL A;  2XKM A;  4IFF A;  1FC2 C;  1GL2 A;  1VF5 D;  4I2L C;  2VRS A;  1CW5 A;  2QM8 A;  2RH0 A;  2LXB A;  3LID A;  5H2F H;  1NTZ G;  1JO5 A;  2I8D A;  1KV4 A;  3FWL A;  1W2B O;  2WPR A;  2BEQ D;  3KHU A;  3P8C E;  5KAF H;  1N73 B;  1KIL E;  1SFC B;  2OAR A;  3L75 J;  2OYI C;  1SFC A;  1SFC C;  2R3S A;  1OMI A;  5B66 H;  1LTJ C;  1AA0 A;  3HD7 A;  4L74 A;  1BCC J;  1ZRT D;  3H1J G;  1PGQ A;  1PZQ A;  5KKZ B;  2GM4 A;  4CPG A;  4RO0 A;  3HTK A;  2WT7 B;  1L4A B;  1SS1 A;  3SWK A;  4JF7 A;  1PFI A;  1L4A A;  1PIX A;  2QJP B;  2XDJ A;  2YKP A;  3AEC C;  3H1I D;  3VOP A;  4C46 A;  3TSI A;  5KJ7 A;  1EZV I;  2A45 I;  4RJT A;  3NTN A;  1FOS F;  1SQV E;  4ASW A;  1NOH A;  2FYN C;  1HBW A;  3H1J E;  5B5E E;  1FZC B;  1GDT A;  4K35 A;  3U1A A;  1UII A;  4U3F D;  4LLH A;  4C7N A;  1M7L A;  3RK3 E;  3G4S P;  2Q3I A;  2J5U A;  3JCU E;  1RHZ B;  2D2C C;  2WIT A;  4W80 A;  5AVQ B;  4DZO A;  1LTS C;  2FXM A;  2A45 G;  5CCG D;  1T2K C;  1MUU A;  3HUS A;  1MZ9 A;  1NTK D;  3O6Q A;  1H88 A;  2YKO A;  1NTK E;  4RKU J;  4H0L C;  1KB9 D;  5AVX B;  3VP9 A;  4A7P A;  3AE7 C;  5KLV E;  1PGJ A;  2E43 A;  1DH3 A;  2CPS A;  1LTJ A;  3BCC E;  2GUS A;  1S3J A;  2E76 D;  1LTA C;  3A0H E;  2P1J A;  3V2N A;  1Q86 Q;  3L74 D;  1CSB A;  3L73 D;  1URQ C;  4PD4 E;  3HD7 B;  2O3J A;  2E75 B;  1LNQ A;  1U7M A;  2K37 A;  3H1H G;  4Y99 B;  4YXD C;  3BCC G;  5KAI H;  1CI6 B;  3I5C A;  5KAF E;  1XTG B;  1K04 A;  1IJD B;  1URQ D;  3RGU A;  1DEB A;  1J1E B;  1FS0 E;  1NVO A;  4NPF X;  2I1K A;  5AW2 B;  1GZL A;  1GK4 A;  5DJT B;  1VDF A;  3H1H E;  4N6J A;  3Q3D A;  2QIW A;  2FBW C;  2N1T C;  5CMZ A;  4DOJ A;  2JJL A;  3GF7 A;  3CCU P;  1NGM B;  2B87 B;  4YTP C;  4OGQ D;  2QSI A;  2FYN B;  1VQP P;  4L75 A;  1Y8A A;  1JB0 J;  3S1K A;  1IFM A;  1BE3 D;  2FYU J;  2G3A A;  3L72 D;  3V4Q A;  2ZYD A;  3GW6 A;  1QVF O;  2D2C D;  1NJI Q;  2HPC B;  1IC2 A;  1VQ8 P;  2R32 A;  5CCH D;  3G71 P;  1PPJ G;  2FYU K;  3L70 G;  2OTK E;  4LGD E;  1FAV A;  1NAF A;  5AW1 B;  1JOC A;  1OX3 A;  1P84 E;  4TLF A;  1EXJ A;  3P8C D;  5APW A;  4H13 D;  1HWT C;  1VQN P;  4I1L A;  1A02 F;  1SQB J;  2E76 C;  1BGY E;  3SSU A;  3L75 D;  3C8V A;  4JYB A;  4WB4 A;  2KI7 B;  3IAO A;  3LW5 J;  2JDI H;  4HYT B;  1LWU A;  2C0X A;  2KZJ A;  3AEB C;  1RQV A;  4H0L D;  3H1L E;  3RL0 B;  1R8E A;  2AXT H;  1BCC D;  1SQX J;  2HLO A;  4ASV A;  1VQO P;  2Z5I A;  2HG5 D;  1S5L E;  1SQP J;  1M56 D;  2E74 C;  3B5N C;  1L4A C;  5AVY B;  2A06 E;  3IN6 A;  3P32 A;  3PP5 A;  3AE2 C;  2A06 D;  3KQG A;  4KT0 J;  1T3U A;  5KKZ C;  1SQQ K;  3V2R A;  1JY2 P;  1MV8 A;  1NTM J;  1OW8 A;  3TGU E;  2QE7 H;  1YYC A;  1NO4 A;  2B87 A;  1SQB K;  2ZT9 D;  4HB1 A;  2WTY A;  1G1J A;  3CWB E;  3CX5 H;  1WRG A;  2M8R A;  3F89 A;  2A06 G;  5KJ7 D;  3JCU H;  2OYI A;  2KP8 A;  1LTG C;  3HE5 B;  3CWB J;  1VF5 B;  3G6E P;  3CCS P;  3O6Q B;  2IYO A;  1RF1 B;  3NFQ A;  2NZ2 A;  1NTK J;  2NPS C;  4JBZ A;  4WY4 D;  3AEF C;  5CHX A;  1VQ6 P;  1SFC D;  1SQX K;  3E1I A;  1L0L D;  1LWU C;  1LP1 B;  2YO2 A;  4N78 D;  5TIS H;  2R44 A;  2K3R A;  1H89 A;  1OXZ A;  1VPC A;  3L74 J;  1FJP A;  2QJK B;  1YQ3 C;  4UB8 H;  5AW7 B;  4DT0 A;  1KC8 Q;  2L5G B;  2AXT E;  3II6 A;  3WUU A;  1GU5 A;  1DEE G;  2KYV A;  1L2P A;  4PV1 D;  4C7R A;  5AW8 B;  4BRY B;  1S1C X;  2JWA A;  1GW3 A;  4WWI A;  1NTZ K;  3H1J J;  5AVU B;  1YBK A;  3RK2 D;  3GHG C;  1H0T A;  4NPE A;  3B8E B;  2H7H A;  3MZW B;  1Q81 Q;  2W6J H;  2GA1 A;  2YXQ B;  3CL3 D;  3FWN A;  3PTZ A;  3CCE P;  2H8P D;  1N7S A;  5L8R J;  1A02 J;  3RK3 D;  2O01 H;  3KYQ A;  4QMA A;  3WMM 0;  4AYC A;  2MKV A;  3CX5 D;  5KJ7 C;  1HJ0 A;  2FYU E;  3CCV P;  2E74 B;  2FYU D;  1BE3 J;  1PPJ D;  2ZFC A;  3B5N B;  3M9B A;  1S72 P;  4BWN A;  3L70 D;  2M3B A;  1GU4 A;  2KB7 P;  3HUS B;  1RH5 B;  1N7L A;  1QX8 A;  3L71 D;  4JYC A;  4R4M A;  5KLV D;  3S9O A;  5CBO A;  5CCH C;  1ZOY C;  2YNY A;  3PLN A;  5CJ0 A;  1JUN A;  3H1L G;  5GTH E;  1HGV A;  3L73 J;  3D70 A;  1ZLL A;  1YJW P;  2OYO A;  2Z4E A;  3HD7 D;  1AQ5 A;  4WY4 A;  4OWF A;  2J59 M;  2N1T A;  2W6A A;  2P7J A;  1PGO A;  3AEG C;  4K3A A;  5KAI E;  2AEF A;  2IYP A;  2N1T D;  1SQB E;  1FE6 A;  1M57 D;  4L73 A;  3T97 A;  1GD2 E;  4GKG A;  5BVZ A;  3CC2 P;  4H13 C;  3WUV A;  2ITA A;  2MJZ A;  3I56 P;  1SLQ A;  2BAS A;  2FXO A;  1KQG B;  3H1L J;  4RES B;  1OIP A;  4H44 C;  4I6M C;  3H1K J;  2BCC G;  2J58 A;  2PFX A;  3L73 G;  4I7Z C;  5C39 A;  2AEM A;  4OGQ B;  3VMZ A;  3H1H J;  1S9K E;  3CI9 A;  1BSH A;  3CCJ P;  2SPZ A;  1JY2 N;  1KMI Z;  4GOE A;  3L72 J;  2OGU A;  2CPB A;  3WUT A;  3GG2 A;  3AED C;  3HE5 A;  5CCG A;  1OW6 A;  1VL2 A;  4OGQ C;  1SQQ D;  3A2A A;  1ZR4 A;  2KK7 A;  3JSV C;  4PD4 I;  1JY2 O;  2H89 C;  4JQ0 D;  2WPQ A;  3CXH I;  4H13 B;  3HD7 C;  3D6Z A;  1KIL B;  1NU1 E;  1RE3 A;  2HFE D;  3L75 E;  3VMA A;  1AJY A;  1DX7 A;  1RF0 C;  3AEA C;  3KZI E;  3MP7 B;  2YMK A;  3L72 G;  3M0A A;  1Q82 Q;  1FU1 A;  2M3E A;  2QJY B;  4Z1M H;  1SQX D;  1BCC E;  1JY3 N;  3RBZ A;  1IK7 A;  4DCK A;  2WT7 A;  4IFD K;  3OJA B;  2H88 C;  3L71 G;  1EZV G;  2K88 A;  1T3J A;  1M8O B;  3GHG B;  2ZAE B;  4WVZ A;  2Q9I A;  1YI2 P;  3KZI H;  2NRG A;  3SFE C;  5B5E H;  2KS1 A;  2M5A B;  2IBZ D;  2O01 N;  1IFJ A;  1KYO I;  2KS1 B;  2IBZ E;  3H1J D;  1S4X A;  1NTM D;  2LXC B;  2Y9Y A;  3IFM A;  4W7Z A;  2FYU G;  5AW6 B;  3RK3 C;  2R5D A;  3G3Z A;  2R3C A;  1J1D B;  4U3F E;  4Y99 C;  3M06 A;  1K8A Q;  1SQP E;  3A0B E;  3H1K E;  1DIP A;  5AVV B;  4C7N B;  3GF3 A;  1PP9 G;  4D6T G;  2E42 A;  2HYN A;  2O1J A;  4GOF A;  3MUD C;  3N7N A;  1KYO H;  3WU2 E;  2I1J A;  4WBA A;  3VMX A;  3B5N A;  3TF5 A;  1G1I A;  1PP9 J;  2KNC A;  2Q7C A;  2KNC B;  3H32 A;  5KLV G;  1FZG A;  5AVW B;  2FYZ A;  3VMY A;  3CC4 P;  4D6T E;  1PP9 E;  1CZQ A;  1FZA A;  1VF5 C;  1YTZ T;  2IFM A;  2K9J A;  3FXD A;  3KDP B;  1L0L E;  3CPW O;  1KFN A;  3GLM A;  5AW5 B;  1LTJ B;  2AEJ A;  2OYH B;  1OZH A;  4LC1 A;  1L0L J;  5KLI C;  4Y28 J;  1ZP0 C;  3R4Y A;  2QJK C;  2W27 A;  3HE4 A;  3SWY A;  5E79 E;  4GOD A;  3F5H A;  1L0L G;  1ZME C;  1GL2 C;  2BCC E;  2HR3 A;  2P67 A;  2KUB A;  3CX5 I;  3LW5 H;  1ZV8 A;  3SWF A;  1GW4 A;  1SQP K;  2E5T A;  1QL2 A;  2M5A A;  1U57 A;  1YHQ P;  2WSF H;  1NTK K;  1VQM P;  1HF9 A;  3TNU B;  2Q6Q A;  1NTZ D;  1L0N E;  2JEE A;  2C9L Y;  5CJ4 A;  3A0B H;  4XA4 A;  1X79 B;  1EXI A;  1VQ4 P;  1HGZ A;  3E7K A;  2P10 A;  1PV3 A;  3TGU J;  1LT9 B;  1RQU A;  3B4S A;  3TYY A;  1S9K D;  1LT9 A;  2IPP A;  1YIT P;  2E74 D;  3B5N D;  3OA7 A;  3M9Q A;  2QM7 A;  1Q90 D;  5APY A;  4XE5 B;  2PP6 A;  1L0N G;  1YTZ I;  1KOR A;  3L70 E;  4JPZ B;  4GT1 A;  1N73 C;  1NYH A;  1NTM K;  3MD0 A;  3L75 G;  3A5T A;  3CCQ P;  1KQL A;  1FDM A;  1K73 Q;  3W68 A;  1NU1 K;  1KFM A;  4IL6 E;  3M0D C;  3GMA A;  3A7O A;  3CX5 E;  1S5L X;  1BCC G;  4U7J A;  4UB6 H;  1NU1 D;  3AE1 C;  2WPS A;  5AVT B;  1M1K Q;  4KJM A;  1X8Y A;  1R5L A;  1S2E A;  1WMK A;  1GL2 B;  1G2C A;  1ZRT E;  2FY8 A;  4AUW A;  2N1T B;  3CMA P;  3VYI A;  1SQB D;  3Q2Y A;  1EC5 A;  2E76 B;  1H8A A;  2FKW B;  3GHG A;  1SQV G;  1NKZ B;  3H1K G;  3V2P A;  1JEK A;  2W6B A;  1KTM A;  5AVZ B;  1Z56 A;  2P58 A;  2JKV A;  3OAK A;  1D7M A;  1MFZ A;  2PRR A;  5AW9 B;  4B86 A;  1LTT C;  1GK6 A;  2E75 D;  1M1J B;  4PD4 D;  1SQV J;  1VQL P;  1YJ9 P;  2WQY C;  3VN0 A;  3H1K D;  2LR2 A;  1URQ B;  1KYO D;  1N8R Q;  3H25 A;  5AVS B;  4GIF A;  1USE A;  1SQQ J; 
#chains in the Genus database with same CATH homology
 2K37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...