2K37A

Csma
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
59
structure length
59
Chain Sequence
b'MSGGGVFTDILAAAGRIFEVMVEGHWETVGMLFDSLGKGTMRINRNAYGSMGGGSLRGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chlorosome Protein A
publication title The three-dimensional structure of CsmA: A small antenna protein from the green sulfur bacterium Chlorobium tepidum.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 17
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2008-04-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.950 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces bacteriochlorophyll c-binding protein 2k37A00
2K37A
chains in the Genus database with same CATH superfamily
3AE7C 3AEGC 1LTJA 2HFED 2RMZA 1RE4C 2N1TA 1EDIA 1AJYA 1MUUA 2IZ1A 3VYIA 1SQQK 4PD4D 4YPCA 1ZN5A 3LW5J 3ZDMA 1ZR4A 2CK3H 1Q82Q 2Y0CA 4KT0J 1SQXG 5E79H 1LT9B 4WB4A 1CI6A 3Q5PA 1MFZA 3H1JG 2PP6A 4TT3H 3B5NB 3HTKA 3AEFC 1FZEA 4WY4A 3U59A 3JC22 1X9VA 2WSCH 4UB8H 1VL2A 2K9YA 4UB6E 3G6EP 1FAVA 2NPSB 3V5BA 1JM0A 1FZCB 1M7LA 4RESB 3Q2YA 2ZVOB 3EQ2A 5AW4B 1SLQA 3BRTB 1L4AB 2YXQB 1N2DC 1KTMA 4IL6H 1ZXGA 1NU1K 3HUSB 2QRXA 2PRRA 3QH9A 1OIPA 1EXJA 4B86A 3V2RA 1T2KC 5E79E 1N7SA 1NTKG 2YIUC 3O8ZA 3IR9A 1FBMA 1M1KQ 1HH0A 4D6TE 2D2CB 2J58A 3N4XA 3SSUA 1SQVE 4PV1C 1GL2C 3SFDC 2OARA 1EC5A 1PP9J 3L75D 1HGVA 2M5AA 3MUDC 5APXA 4XA4A 4UB8E 1RE3C 3Q3DA 4U3FE 1YITP 1IC2A 2QJPB 2RN0A 4JQ0D 3V4WA 3SWFA 1DD4A 1H8AA 3ABVC 5DJTB 2A45H 4CPGA 1M57D 1CSBA 3GW6A 2QJYB 3I56P 1PP9D 3QWOC 5GTHH 2Y9YA 4D6TJ 2UWJE 4IL6E 4L74A 2R3CA 2B88A 1FOSE 1P84D 1JY3P 1SQVJ 1T3JA 3L37A 2JKVA 2ZAEB 1KC8Q 2KOGA 4DJGA 1PPJG 2WPVB 1PL5A 2WSCJ 3PJSK 4D6TD 4U3FJ 5M1BA 1BCCD 1TU3F 2YNYA 4NPDA 3TGUG 2QSIA 1L0LE 1SQVD 4ZKUA 4R4MA 3H1LG 1YQ4C 1NYHA 3PRJA 1OVRA 1S2EA 2NPSA 5CJ0A 4U3FD 5AVRB 5KTBA 4U7JA 5AVUB 1L4AA 3GMAA 3CWBG 2AXCA 2OTJP 1M1JC 3HUSA 3MZWB 1ZP0C 1DH3A 5GTHE 4W80A 3TYYA 4RO0A 1VPCA 1XTCC 1AVYA 1KILD 2E43A 3WUTA 2LKMA 1L0LJ 3D6YA 5CMZA 3MHVA 3E1IA 4N78D 2FBWC 2Q3IA 3EFGA 5CCHC 3C8VA 2QJKC 2Y9ZA 4N6JA 2Q1KA 1N7LA 1AA0A 3CL3D 1SQPG 1OVUA 2M3EA 1NVOA 2E42A 1L0LD 3PP5A 1HTLC 1R5LA 1OX3A 1KZUB 3RBZA 2HPCB 3FGAD 2MJZA 1L0NE 1RQUA 4PV1B 2KXPB 4IOIH 5KLIC 1ZOYC 1USEA 2V7QJ 2PAJA 3L70J 3H32A 4DOJA 4DT0A 1WT6A 5BU5A 2YO2A 3RK3E 3HRNA 2WZ7A 1SQVK 3L73G 2B87A 3SWYA 3I5CA 4I2LC 1JO5A 3KXDA 2J59M 1RE4A 4HH2A 2IYPA 3V6IA 1VQOP 2WWWA 3L71G 2E75C 3L70D 2O01H 1DD3A 1LTGC 2FKWB 2FXOA 1QLED 1X8YA 2O3JA 3TNUB 5AW7B 1M56D 3CCQP 1KFMA 1AVOA 1YJ9P 1BDDA 3H1HG 1J2JB 2QM7A 1HUCA 3SWKA 1H88A 1FS0E 1E5WA 3C9IA 1A02J 1SFCD 3CC4P 1DEBA 1JY2P 2I1KA 4H13D 4PJ0E 2IBZE 1OW8A 1JCDA 1JY3N 1LGHB 1NTMK 2OYOA 4ZNCA 3LW5H 2JWAA 2BCCG 1G1JA 2R5DA 1LTTC 3Q1MA 4GOFA 1EZVE 2SPZA 1NAYA 3CCEP 3M0DC 2ZVNB 1NTZG 4EOTA 1H89A 3KPEA 5KJ7D 3JCUH 3KZIH 2JP3A 3BCCE 4H44D 1M1JB 4O9BA 1NU1E 1GD2E 3IFMA 3K5BA 1SQBK 4GKGA 3AEEC 3D6ZA 2WVRA 1PGJA 1S5LX 3CI9A 1AV1A 2XU6A 4EIJA 3AEBC 2IYOA 3IN6A 1SQXE 3AE9C 5KLVG 2HPCA 3H25A 1VQLP 3H1JE 1S1CX 2HYNA 2K3RA 1KQGB 3A0HE 2R3SA 1GL2A 2KSJA 3L4FA 1EDLA 3BRVB 4BWNA 3BCCJ 3A0BH 1UIIA 3MUDA 3SFEC 1NU1J 1RE3A 1VF5C 5KLIB 2HODB 2E5YA 2ZYAA 3CLQA 1J1EC 2Y0DA 1Q90D 1OXZA 1LNQA 2R32A 3D70A 3HD7D 4JYCA 1YBKA 3II6A 3P8CD 3AECC 1Q2NA 3IF4A 1K05A 1ZMEC 3BCCD 3JCUE 1G1IA 1SQXJ 1OZHA 5AW3B 1NU1D 3TNUA 3CCUP 2E75B 1RQVA 1MKMA 2W6JH 1KD1Q 2ZT9D 1JY3O 3H1JJ 4OGQB 3A5TA 1GW4A 5APTA 2N1TD 4RJTA 4YXWH 5AVZB 5B5EH 5CCGA 2JJLA 2VRSA 4N3YB 2WMMA 1SQXD 1VDFA 3W67A 1NTKE 4ZMDA 2B89A 5AW2B 5APVA 3H1JD 1P84H 3PLNA 1VQ8P 1LTIC 2QIWA 1G2CA 3FXDA 2RKLA 3RL0g 1PV3A 2ZXEB 3RL0D 1NKNA 1RF0C 3A0BE 5KAIE 3BASA 4GOEA 1VQ7P 4WY4D 2FYUK 1FE6A 2AXTH 1K8AQ 2N9BA 3TDKA 1VQNP 1YTZT 2V4HA 1M1JA 3L75E 1NTKJ 4IFFA 3NMDA 2M0BA 4M3LA 1SFCC 5B5EE 4JBZA 1N73C 2PFXA 5CCHA 4WBAA 4H13C 1PP9E 2Q6QA 2C9NY 4DZOA 2OTLP 1NTKD 3RK3C 2IX7C 3HE5B 1S9KD 1T6AA 1IFNA 1P84E 5AW6B 3LIEA 3B4SA 3TK1A 1KV4A 1URQC 1N7SD 3RBXA 2K88A 3M9QA 1AFOA 5APSA 3H1KG 3TSIA 5KJ7C 1JMBA 2HODA 3L75J 2W27A 4H44C 4EDFA 3H1LE 1SQXK 1MFTA 2QM8A 3WMM0 1BCCE 1VF5B 2WSEH 3M91A 1DIPA 2QE7H 3NFQA 3RK2D 2WQYC 2AXTE 5K5GB 2QVAA 5CBNA 3CCLP 2FYNC 2W90A 1OMIA 3VMYA 3CWBE 3H32B 1IZNB 4OH8B 2P58A 3CCSP 2KLVA 2K37A 3TGUJ 3F89A 2B87B 2E74B 1GU5A 3OAKA 3C1LA 3H1LJ 3D71A 3CX5I 4Y99C 2OYHC 2V7QH 1PPJD 1BCCJ 2GM4A 1KILE 4BXLA 2E76D 3L72E 2A06G 2IFMA 3AEAC 3P8MC 2POHA 2W8ZA 3TGUD 4N78E 4QMAA 5CJ4A 3H1LD 3E7KA 3B5ND 2Z4EA 1KFNA 5AW5B 3H1IE 2QG4A 3CWBJ 1S3JA 1NTKK 1NTME 1YTZI 2FXMA 2ZJSE 2H7HA 2YO3A 1X22A 2KUBA 5BVZA 1K04A 1KB9I 3M0DA 2N1TC 4C7NB 3PTZA 1USDA 3GHGC 1LJ2A 2NPSD 1EXIA 2BEZF 2O1JA 1FJKA 1U57A 3CWBD 2BEQD 2ITAA 4L75A 1GK4A 3L72J 1RY3A 1XTGB 1L4AD 1W2BO 4IFMA 4D6TG 1D7MA 1M8OB 2N9YB 2I8DA 1KN7A 3S4RA 1SQBE 1SFCB 3RL0C 1FZBA 3I55P 3H1IJ 1GU4A 3HE5A 1NTMJ 3M06A 1R8EA 3L70E 1Y9BA 3L72D 2WSEJ 3VMXA 3RK3B 1W5CE 3VOPA 1EQ7A 4L76A 4WY4C 1SQPD 2KP8A 3GG2A 3EFFK 1NGMB 1YQ3C 3Q5SA 1KYOI 3L74G 2D2CD 1URQB 3P7KA 1QVGO 4YXDC 1IFJA 3H1ID 1LWUC 2YIUB 1NTMD 1WRGA 1N8RQ 2GUSA 4HB1A 2Q3EA 3N7NA 1VQ5P 5AVTB 1VQ6P 2HR3A 4OWFA 2JEEA 1SQBJ 1ZRTE 2YKQA 3JSVC 4PJ0H 1KORA 4WWIA 1FDMA 1GL2B 1BE3G 3CXHI 3R4YA 1NHLA 3VP8A 1QL1A 1NTZE 3V2QA 1JOCA 2FFDC 3L71D 4EYYQ 2L91A 5APQA 1Q81Q 3MP7B 1SQBD 1FDIA 1L0LG 5KAFH 2K9JB 2MKVA 3H1HD 1GK6A 2GA1A 1WMKA 3BVHA 1IK9A 4GODA 3AE6C 2KYVA 4C7RA 3HE4B 2BCCJ 2WSSH 3RK2C 3G3ZA 3CXHH 1NKZB 2KNCB 3R2PA 1YJWP 1RF0A 1NTZJ 2A45G 4HYTB 2NRGA 1JEKA 2WITA 1GW3A 4C7NA 2BCCD 1YYCA 3USSA 1SQPK 3CX5D 4H0LD 2FYUE 3A0HH 1NH4A 4GT1A 1ZRTD 4W7YA 1G2CB 2CPBA 2RH0A 2WTYA 2IDBA 2CPSA 3V2NA 3GHGB 1NTZD 1JTHB 5H2FH 2E76C 1LT9C 5KLVJ 1SFCA 1N73A 1QEXA 3P8CE 4L73A 1LP1A 2AEMA 1W2EA 5KAFE 1L0NG 3B5NC 1KB9D 4TLFA 3MGNA 1JB0J 2WSFH 1BGYG 4LLHA 1PGQA 3TF5A 4ASVA 1ZV8A 2FYUJ 1NOHA 5KLVD 1URQA 2NZ2A 3CXHE 5APWA 4ASWA 2NPSC 3FWLA 1FZCC 2QJKB 2LXCB 3WU2H 2YMKA 1GTWA 2IZ0A 5AVSB 4PV1D 1L4AC 1SQQG 3G9RA 2FYUD 2XNXA 2P1JA 3KYQA 3G71P 2AEJA 3O6QA 1FZFA 2YKOA 5CBOA 5KAIH 1OVVA 1KILC 1KYOD 5H2FE 1HGZA 3CPWO 1ZR2A 5AW9B 1OW6A 2FFDB 1Y8AA 2K9JA 3MTUE 2D2CC 5AVQB 1NTZK 2OYHA 3HE4A 2IBZG 5CCGD 3AE8C 1J1DC 3CXHD 3CCRP 2KNCA 4LC1A 1EZVG 3RK2B 3FXEA 2ZFCA 2B9BA 2QEXP 2QJPC 5DJUB 1MV8A 2XZRA 1IJDB 1RHZB 1FJPA 3WU2E 2XV5A 2G3AA 2Y0EA 1S9KE 2QJYC 1QL2A 2KIKA 2KS1A 1FZAA 5KLVK 3GF3A 1NU1G 3GHGA 2KB7P 1JTHA 1QGKB 1CW5A 2WSFJ 1HVVA 2R5BA 2WT7A 2K1AA 3V2PA 2E76B 2WPQA 4AUWA 3B71A 1DEEG 3GLMA 3H1KJ 5AW0B 3AE5C 5APUA 5BU8B 2W83C 1ZW0A 1VQ4P 1YIJP 1HJBA 1PGPA 1JY2N 2OYIC 2OGUA 5CCHD 5AVWB 2KZIA 4H0LC 5AVXB 2A06E 3U1AA 5TISH 1IO4A 1LWUA 3KQGA 3H1KD 1PPJE 1AQ5A 4LGDE 2E5TA 2W6AA 3TGUE 5AVVB 2IPPA 3AE3C 3RGUA 4DCKA 2FY8A 3BATA 2FFDA 2FYZA 1NJIQ 1KILB 1J1EB 1PGOA 3KDPB 2E75D 2A45I 3FX0A 4OGQD 2C0WA 1S5LH 2DW3A 4XE5B 1QVFO 2M8RA 1NWQA 4GDOA 1YI2P 1K73Q 1PFIA 2A06D 1J1DB 4AYCA 3G4SP 5TISE 2R44A 3WUVA 2J5UA 3L74E 2H43A 2Z5IA 4NPEA 3AE2C 1IFDA 5TJHA 3S1KA 3Q5RA 3L75G 3HD7C 1HJ0A 1SQPE 1JY2O 1FZGA 1JMMA 1KQLA 3CMAP 1RF1C 1PP9G 2ZT9C 2H89C 1BE3E 1LT9A 5CCGC 1LTJC 3AE4C 4W7ZA 5GTIH 1Q7YQ 1OW7A 3CX5H 2GUVA 3M0AA 2L5GB 3OA7A 3L73E 3B5NA 3L74J 1BSHA 1S5LE 1QX8A 4MN4C 1ZLLA 4I6MC 3T97B 4ZKPA 3L71E 3M9BA 5APYA 1SQPJ 2OYIB 1BCCG 2PGDA 4H0LB 1KQFB 1N73B 1SQVG 2ZYDA 1FZCA 1VQKP 1IFMA 3L74D 3CC2P 4IFDK 1LP1B 4H13B 1KB9H 1CZQA 3H1HE 3H6PA 1BE3J 3UIAA 3KHUA 2WPRA 2KSEA 3EWKA 3NXSA 2AEFA 3U1CA 4U3FG 4JPZB 1YHQP 3L73J 1Y47A 2O01N 1BSNA 1VF5D 2O1KA 2IBZI 3VTPC 3CCMP 2KI7B 1IFIA 1KILA 4H44B 4RKUJ 1BE3D 1VQPP 3L71J 3PHLA 3W68A 1S72P 2BASA 4Z1MH 5KKZC 2WPSA 3MIWA 1BDCA 1EZVI 2XDJA 2BCCE 5GTIE 1K9MQ 3CX5E 2Q9IA 3P32A 3L72G 1R5SA 3L73D 3S9OA 1AQTA 3O6QB 2W6BA 2ZYGA 3H1HJ 3OJAB 2OTKE 3CD6P 3F5HA 2FYNB 3B8EB 1VQMP 1PZQA 2E74D 1KYOH 3H1IG 2ZXXA 4AQRD 1NTMG 1BGYE 2P10A 1N7SC 1Q86Q 4BRYB 5EFWB 2P67A 3L35A 1LTSC 1U7JA 4K35A 4NPFX 3OW2O 1FDOA 1KB9E 4PD4I 4Y99B 1YJNP 2OYHB 2KK7A 1M90Q 1H0TB 3A7OA 1N86A 1LT1A 5KLVE 4EI2A 1SS1A 4JF7A 1U7MA 3HD7B 2H88C 1SQQE 4XFJA 1IK7A 2FXPA 4OGQC 4I7ZC 2P7JA 3AE1C 4KHXA 3LIDA 1OWAA 1SQBG 1MZ9A 1OFCX 1L0NJ 4GIFA 1UIXA 1RF1B 2JDIH 4OVNF 1BGYJ 1EDJA 2ZT9B 3L70G 4C46A 1X79B 1LTJB 2QA4P 2Q5UA 2N1TB 2KS1B 1KQSO 4PD4H 3CCJP 2XKMA 1FOSF 3T97A 3L36A 2HLOA 1LTAC 3CCVP 5B66H 1GZLA 2Q7CA 1L0ND 3NTNA 1KYOE 3E1RA 2I1JA 2OYIA 2OQQA 1L2PA 2WT7B 1T8ZA 2LR2A 1BGYD 1HBWA 3VP9A 2XNDH 1SQQJ 3CMEP 4IL6X 2H8PD 2YMYA 1HWTC 1CI6B 3RK3D 1T3UA 3RL0B 1FC2C 1FU1A 1SVFA 1L0LK 3VN0A 4A7PA 1SP4A 5L8RJ 4KJMA 1PIXA 1URQD 3MD0A 2JWDA 3HTKB 2KLUA 1T2KD 2YXRB 1KMIZ 2Z5HA 4WY4B 1SQQD 3FWNA 1RH5B 5AW8B 5KJ7A 3VMZA 5C39A 5AVYB 3ITKA 3M9HA 1EDKA 4HKZH 1LWUB 2C9LY 1GL2D 1X0TA 5KKZB 2C0XA 3HUSC 4Y28J 1GDTA 3V4QA 4WVZA 1JUNA 4PD4E 4R4LA 1HF9A 2IFNA 2LXBA 5B66E 3A2AA 1VQ9P 5CHXA 3WUUA 5AW1B 3AEDC 1DX7A 4JYBA 4BRYA 2IBZD 1NAFA 2JR8A 1GMJA 2O01J 1N7SB 2JO1A 2G8YA 1Z56A 2FYUG 1EZVD 1JNMA 2YKPA 2KZJA 3GF7A 1L0NK 4K3AA 1H0TA 1IFPA 1E79H 2HG5D 4I1LA 3HD7A 2M3BA 1P84I 3KZIE 4YTPC 1S4XA 4UB6H 1JCCA 1NO4A 3IAOA 3A3YB 3VMAA 2M5AB 3CC7P 3PH0A 2P2UA 4HJGH 4I7ZB 1RF1A 3H1KE 1A02F 1LTBC 2E74C 3BCCG
chains in the Genus database with same CATH topology
2K37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K37 A; 
#chains in the Genus database with same CATH topology
 3AE7 C;  3AEG C;  1LTJ A;  2HFE D;  2RMZ A;  1RE4 C;  2N1T A;  1EDI A;  1AJY A;  1MUU A;  2IZ1 A;  3VYI A;  1SQQ K;  4PD4 D;  4YPC A;  1ZN5 A;  3LW5 J;  3ZDM A;  1ZR4 A;  2CK3 H;  1Q82 Q;  2Y0C A;  4KT0 J;  1SQX G;  5E79 H;  1LT9 B;  4WB4 A;  1CI6 A;  3Q5P A;  1MFZ A;  3H1J G;  2PP6 A;  4TT3 H;  3B5N B;  3HTK A;  3AEF C;  1FZE A;  4WY4 A;  3U59 A;  3JC2 2;  1X9V A;  2WSC H;  4UB8 H;  1VL2 A;  2K9Y A;  4UB6 E;  3G6E P;  1FAV A;  2NPS B;  3V5B A;  1JM0 A;  1FZC B;  1M7L A;  4RES B;  3Q2Y A;  2ZVO B;  3EQ2 A;  5AW4 B;  1SLQ A;  3BRT B;  1L4A B;  2YXQ B;  1N2D C;  1KTM A;  4IL6 H;  1ZXG A;  1NU1 K;  3HUS B;  2QRX A;  2PRR A;  3QH9 A;  1OIP A;  1EXJ A;  4B86 A;  3V2R A;  1T2K C;  5E79 E;  1N7S A;  1NTK G;  2YIU C;  3O8Z A;  3IR9 A;  1FBM A;  1M1K Q;  1HH0 A;  4D6T E;  2D2C B;  2J58 A;  3N4X A;  3SSU A;  1SQV E;  4PV1 C;  1GL2 C;  3SFD C;  2OAR A;  1EC5 A;  1PP9 J;  3L75 D;  1HGV A;  2M5A A;  3MUD C;  5APX A;  4XA4 A;  4UB8 E;  1RE3 C;  3Q3D A;  4U3F E;  1YIT P;  1IC2 A;  2QJP B;  2RN0 A;  4JQ0 D;  3V4W A;  3SWF A;  1DD4 A;  1H8A A;  3ABV C;  5DJT B;  2A45 H;  4CPG A;  1M57 D;  1CSB A;  3GW6 A;  2QJY B;  3I56 P;  1PP9 D;  3QWO C;  5GTH H;  2Y9Y A;  4D6T J;  2UWJ E;  4IL6 E;  4L74 A;  2R3C A;  2B88 A;  1FOS E;  1P84 D;  1JY3 P;  1SQV J;  1T3J A;  3L37 A;  2JKV A;  2ZAE B;  1KC8 Q;  2KOG A;  4DJG A;  1PPJ G;  2WPV B;  1PL5 A;  2WSC J;  3PJS K;  4D6T D;  4U3F J;  5M1B A;  1BCC D;  1TU3 F;  2YNY A;  4NPD A;  3TGU G;  2QSI A;  1L0L E;  1SQV D;  4ZKU A;  4R4M A;  3H1L G;  1YQ4 C;  1NYH A;  3PRJ A;  1OVR A;  1S2E A;  2NPS A;  5CJ0 A;  4U3F D;  5AVR B;  5KTB A;  4U7J A;  5AVU B;  1L4A A;  3GMA A;  3CWB G;  2AXC A;  2OTJ P;  1M1J C;  3HUS A;  3MZW B;  1ZP0 C;  1DH3 A;  5GTH E;  4W80 A;  3TYY A;  4RO0 A;  1VPC A;  1XTC C;  1AVY A;  1KIL D;  2E43 A;  3WUT A;  2LKM A;  1L0L J;  3D6Y A;  5CMZ A;  3MHV A;  3E1I A;  4N78 D;  2FBW C;  2Q3I A;  3EFG A;  5CCH C;  3C8V A;  2QJK C;  2Y9Z A;  4N6J A;  2Q1K A;  1N7L A;  1AA0 A;  3CL3 D;  1SQP G;  1OVU A;  2M3E A;  1NVO A;  2E42 A;  1L0L D;  3PP5 A;  1HTL C;  1R5L A;  1OX3 A;  1KZU B;  3RBZ A;  2HPC B;  3FGA D;  2MJZ A;  1L0N E;  1RQU A;  4PV1 B;  2KXP B;  4IOI H;  5KLI C;  1ZOY C;  1USE A;  2V7Q J;  2PAJ A;  3L70 J;  3H32 A;  4DOJ A;  4DT0 A;  1WT6 A;  5BU5 A;  2YO2 A;  3RK3 E;  3HRN A;  2WZ7 A;  1SQV K;  3L73 G;  2B87 A;  3SWY A;  3I5C A;  4I2L C;  1JO5 A;  3KXD A;  2J59 M;  1RE4 A;  4HH2 A;  2IYP A;  3V6I A;  1VQO P;  2WWW A;  3L71 G;  2E75 C;  3L70 D;  2O01 H;  1DD3 A;  1LTG C;  2FKW B;  2FXO A;  1QLE D;  1X8Y A;  2O3J A;  3TNU B;  5AW7 B;  1M56 D;  3CCQ P;  1KFM A;  1AVO A;  1YJ9 P;  1BDD A;  3H1H G;  1J2J B;  2QM7 A;  1HUC A;  3SWK A;  1H88 A;  1FS0 E;  1E5W A;  3C9I A;  1A02 J;  1SFC D;  3CC4 P;  1DEB A;  1JY2 P;  2I1K A;  4H13 D;  4PJ0 E;  2IBZ E;  1OW8 A;  1JCD A;  1JY3 N;  1LGH B;  1NTM K;  2OYO A;  4ZNC A;  3LW5 H;  2JWA A;  2BCC G;  1G1J A;  2R5D A;  1LTT C;  3Q1M A;  4GOF A;  1EZV E;  2SPZ A;  1NAY A;  3CCE P;  3M0D C;  2ZVN B;  1NTZ G;  4EOT A;  1H89 A;  3KPE A;  5KJ7 D;  3JCU H;  3KZI H;  2JP3 A;  3BCC E;  4H44 D;  1M1J B;  4O9B A;  1NU1 E;  1GD2 E;  3IFM A;  3K5B A;  1SQB K;  4GKG A;  3AEE C;  3D6Z A;  2WVR A;  1PGJ A;  1S5L X;  3CI9 A;  1AV1 A;  2XU6 A;  4EIJ A;  3AEB C;  2IYO A;  3IN6 A;  1SQX E;  3AE9 C;  5KLV G;  2HPC A;  3H25 A;  1VQL P;  3H1J E;  1S1C X;  2HYN A;  2K3R A;  1KQG B;  3A0H E;  2R3S A;  1GL2 A;  2KSJ A;  3L4F A;  1EDL A;  3BRV B;  4BWN A;  3BCC J;  3A0B H;  1UII A;  3MUD A;  3SFE C;  1NU1 J;  1RE3 A;  1VF5 C;  5KLI B;  2HOD B;  2E5Y A;  2ZYA A;  3CLQ A;  1J1E C;  2Y0D A;  1Q90 D;  1OXZ A;  1LNQ A;  2R32 A;  3D70 A;  3HD7 D;  4JYC A;  1YBK A;  3II6 A;  3P8C D;  3AEC C;  1Q2N A;  3IF4 A;  1K05 A;  1ZME C;  3BCC D;  3JCU E;  1G1I A;  1SQX J;  1OZH A;  5AW3 B;  1NU1 D;  3TNU A;  3CCU P;  2E75 B;  1RQV A;  1MKM A;  2W6J H;  1KD1 Q;  2ZT9 D;  1JY3 O;  3H1J J;  4OGQ B;  3A5T A;  1GW4 A;  5APT A;  2N1T D;  4RJT A;  4YXW H;  5AVZ B;  5B5E H;  5CCG A;  2JJL A;  2VRS A;  4N3Y B;  2WMM A;  1SQX D;  1VDF A;  3W67 A;  1NTK E;  4ZMD A;  2B89 A;  5AW2 B;  5APV A;  3H1J D;  1P84 H;  3PLN A;  1VQ8 P;  1LTI C;  2QIW A;  1G2C A;  3FXD A;  2RKL A;  3RL0 g;  1PV3 A;  2ZXE B;  3RL0 D;  1NKN A;  1RF0 C;  3A0B E;  5KAI E;  3BAS A;  4GOE A;  1VQ7 P;  4WY4 D;  2FYU K;  1FE6 A;  2AXT H;  1K8A Q;  2N9B A;  3TDK A;  1VQN P;  1YTZ T;  2V4H A;  1M1J A;  3L75 E;  1NTK J;  4IFF A;  3NMD A;  2M0B A;  4M3L A;  1SFC C;  5B5E E;  4JBZ A;  1N73 C;  2PFX A;  5CCH A;  4WBA A;  4H13 C;  1PP9 E;  2Q6Q A;  2C9N Y;  4DZO A;  2OTL P;  1NTK D;  3RK3 C;  2IX7 C;  3HE5 B;  1S9K D;  1T6A A;  1IFN A;  1P84 E;  5AW6 B;  3LIE A;  3B4S A;  3TK1 A;  1KV4 A;  1URQ C;  1N7S D;  3RBX A;  2K88 A;  3M9Q A;  1AFO A;  5APS A;  3H1K G;  3TSI A;  5KJ7 C;  1JMB A;  2HOD A;  3L75 J;  2W27 A;  4H44 C;  4EDF A;  3H1L E;  1SQX K;  1MFT A;  2QM8 A;  3WMM 0;  1BCC E;  1VF5 B;  2WSE H;  3M91 A;  1DIP A;  2QE7 H;  3NFQ A;  3RK2 D;  2WQY C;  2AXT E;  5K5G B;  2QVA A;  5CBN A;  3CCL P;  2FYN C;  2W90 A;  1OMI A;  3VMY A;  3CWB E;  3H32 B;  1IZN B;  4OH8 B;  2P58 A;  3CCS P;  2KLV A;  2K37 A;  3TGU J;  3F89 A;  2B87 B;  2E74 B;  1GU5 A;  3OAK A;  3C1L A;  3H1L J;  3D71 A;  3CX5 I;  4Y99 C;  2OYH C;  2V7Q H;  1PPJ D;  1BCC J;  2GM4 A;  1KIL E;  4BXL A;  2E76 D;  3L72 E;  2A06 G;  2IFM A;  3AEA C;  3P8M C;  2POH A;  2W8Z A;  3TGU D;  4N78 E;  4QMA A;  5CJ4 A;  3H1L D;  3E7K A;  3B5N D;  2Z4E A;  1KFN A;  5AW5 B;  3H1I E;  2QG4 A;  3CWB J;  1S3J A;  1NTK K;  1NTM E;  1YTZ I;  2FXM A;  2ZJS E;  2H7H A;  2YO3 A;  1X22 A;  2KUB A;  5BVZ A;  1K04 A;  1KB9 I;  3M0D A;  2N1T C;  4C7N B;  3PTZ A;  1USD A;  3GHG C;  1LJ2 A;  2NPS D;  1EXI A;  2BEZ F;  2O1J A;  1FJK A;  1U57 A;  3CWB D;  2BEQ D;  2ITA A;  4L75 A;  1GK4 A;  3L72 J;  1RY3 A;  1XTG B;  1L4A D;  1W2B O;  4IFM A;  4D6T G;  1D7M A;  1M8O B;  2N9Y B;  2I8D A;  1KN7 A;  3S4R A;  1SQB E;  1SFC B;  3RL0 C;  1FZB A;  3I55 P;  3H1I J;  1GU4 A;  3HE5 A;  1NTM J;  3M06 A;  1R8E A;  3L70 E;  1Y9B A;  3L72 D;  2WSE J;  3VMX A;  3RK3 B;  1W5C E;  3VOP A;  1EQ7 A;  4L76 A;  4WY4 C;  1SQP D;  2KP8 A;  3GG2 A;  3EFF K;  1NGM B;  1YQ3 C;  3Q5S A;  1KYO I;  3L74 G;  2D2C D;  1URQ B;  3P7K A;  1QVG O;  4YXD C;  1IFJ A;  3H1I D;  1LWU C;  2YIU B;  1NTM D;  1WRG A;  1N8R Q;  2GUS A;  4HB1 A;  2Q3E A;  3N7N A;  1VQ5 P;  5AVT B;  1VQ6 P;  2HR3 A;  4OWF A;  2JEE A;  1SQB J;  1ZRT E;  2YKQ A;  3JSV C;  4PJ0 H;  1KOR A;  4WWI A;  1FDM A;  1GL2 B;  1BE3 G;  3CXH I;  3R4Y A;  1NHL A;  3VP8 A;  1QL1 A;  1NTZ E;  3V2Q A;  1JOC A;  2FFD C;  3L71 D;  4EYY Q;  2L91 A;  5APQ A;  1Q81 Q;  3MP7 B;  1SQB D;  1FDI A;  1L0L G;  5KAF H;  2K9J B;  2MKV A;  3H1H D;  1GK6 A;  2GA1 A;  1WMK A;  3BVH A;  1IK9 A;  4GOD A;  3AE6 C;  2KYV A;  4C7R A;  3HE4 B;  2BCC J;  2WSS H;  3RK2 C;  3G3Z A;  3CXH H;  1NKZ B;  2KNC B;  3R2P A;  1YJW P;  1RF0 A;  1NTZ J;  2A45 G;  4HYT B;  2NRG A;  1JEK A;  2WIT A;  1GW3 A;  4C7N A;  2BCC D;  1YYC A;  3USS A;  1SQP K;  3CX5 D;  4H0L D;  2FYU E;  3A0H H;  1NH4 A;  4GT1 A;  1ZRT D;  4W7Y A;  1G2C B;  2CPB A;  2RH0 A;  2WTY A;  2IDB A;  2CPS A;  3V2N A;  3GHG B;  1NTZ D;  1JTH B;  5H2F H;  2E76 C;  1LT9 C;  5KLV J;  1SFC A;  1N73 A;  1QEX A;  3P8C E;  4L73 A;  1LP1 A;  2AEM A;  1W2E A;  5KAF E;  1L0N G;  3B5N C;  1KB9 D;  4TLF A;  3MGN A;  1JB0 J;  2WSF H;  1BGY G;  4LLH A;  1PGQ A;  3TF5 A;  4ASV A;  1ZV8 A;  2FYU J;  1NOH A;  5KLV D;  1URQ A;  2NZ2 A;  3CXH E;  5APW A;  4ASW A;  2NPS C;  3FWL A;  1FZC C;  2QJK B;  2LXC B;  3WU2 H;  2YMK A;  1GTW A;  2IZ0 A;  5AVS B;  4PV1 D;  1L4A C;  1SQQ G;  3G9R A;  2FYU D;  2XNX A;  2P1J A;  3KYQ A;  3G71 P;  2AEJ A;  3O6Q A;  1FZF A;  2YKO A;  5CBO A;  5KAI H;  1OVV A;  1KIL C;  1KYO D;  5H2F E;  1HGZ A;  3CPW O;  1ZR2 A;  5AW9 B;  1OW6 A;  2FFD B;  1Y8A A;  2K9J A;  3MTU E;  2D2C C;  5AVQ B;  1NTZ K;  2OYH A;  3HE4 A;  2IBZ G;  5CCG D;  3AE8 C;  1J1D C;  3CXH D;  3CCR P;  2KNC A;  4LC1 A;  1EZV G;  3RK2 B;  3FXE A;  2ZFC A;  2B9B A;  2QEX P;  2QJP C;  5DJU B;  1MV8 A;  2XZR A;  1IJD B;  1RHZ B;  1FJP A;  3WU2 E;  2XV5 A;  2G3A A;  2Y0E A;  1S9K E;  2QJY C;  1QL2 A;  2KIK A;  2KS1 A;  1FZA A;  5KLV K;  3GF3 A;  1NU1 G;  3GHG A;  2KB7 P;  1JTH A;  1QGK B;  1CW5 A;  2WSF J;  1HVV A;  2R5B A;  2WT7 A;  2K1A A;  3V2P A;  2E76 B;  2WPQ A;  4AUW A;  3B71 A;  1DEE G;  3GLM A;  3H1K J;  5AW0 B;  3AE5 C;  5APU A;  5BU8 B;  2W83 C;  1ZW0 A;  1VQ4 P;  1YIJ P;  1HJB A;  1PGP A;  1JY2 N;  2OYI C;  2OGU A;  5CCH D;  5AVW B;  2KZI A;  4H0L C;  5AVX B;  2A06 E;  3U1A A;  5TIS H;  1IO4 A;  1LWU A;  3KQG A;  3H1K D;  1PPJ E;  1AQ5 A;  4LGD E;  2E5T A;  2W6A A;  3TGU E;  5AVV B;  2IPP A;  3AE3 C;  3RGU A;  4DCK A;  2FY8 A;  3BAT A;  2FFD A;  2FYZ A;  1NJI Q;  1KIL B;  1J1E B;  1PGO A;  3KDP B;  2E75 D;  2A45 I;  3FX0 A;  4OGQ D;  2C0W A;  1S5L H;  2DW3 A;  4XE5 B;  1QVF O;  2M8R A;  1NWQ A;  4GDO A;  1YI2 P;  1K73 Q;  1PFI A;  2A06 D;  1J1D B;  4AYC A;  3G4S P;  5TIS E;  2R44 A;  3WUV A;  2J5U A;  3L74 E;  2H43 A;  2Z5I A;  4NPE A;  3AE2 C;  1IFD A;  5TJH A;  3S1K A;  3Q5R A;  3L75 G;  3HD7 C;  1HJ0 A;  1SQP E;  1JY2 O;  1FZG A;  1JMM A;  1KQL A;  3CMA P;  1RF1 C;  1PP9 G;  2ZT9 C;  2H89 C;  1BE3 E;  1LT9 A;  5CCG C;  1LTJ C;  3AE4 C;  4W7Z A;  5GTI H;  1Q7Y Q;  1OW7 A;  3CX5 H;  2GUV A;  3M0A A;  2L5G B;  3OA7 A;  3L73 E;  3B5N A;  3L74 J;  1BSH A;  1S5L E;  1QX8 A;  4MN4 C;  1ZLL A;  4I6M C;  3T97 B;  4ZKP A;  3L71 E;  3M9B A;  5APY A;  1SQP J;  2OYI B;  1BCC G;  2PGD A;  4H0L B;  1KQF B;  1N73 B;  1SQV G;  2ZYD A;  1FZC A;  1VQK P;  1IFM A;  3L74 D;  3CC2 P;  4IFD K;  1LP1 B;  4H13 B;  1KB9 H;  1CZQ A;  3H1H E;  3H6P A;  1BE3 J;  3UIA A;  3KHU A;  2WPR A;  2KSE A;  3EWK A;  3NXS A;  2AEF A;  3U1C A;  4U3F G;  4JPZ B;  1YHQ P;  3L73 J;  1Y47 A;  2O01 N;  1BSN A;  1VF5 D;  2O1K A;  2IBZ I;  3VTP C;  3CCM P;  2KI7 B;  1IFI A;  1KIL A;  4H44 B;  4RKU J;  1BE3 D;  1VQP P;  3L71 J;  3PHL A;  3W68 A;  1S72 P;  2BAS A;  4Z1M H;  5KKZ C;  2WPS A;  3MIW A;  1BDC A;  1EZV I;  2XDJ A;  2BCC E;  5GTI E;  1K9M Q;  3CX5 E;  2Q9I A;  3P32 A;  3L72 G;  1R5S A;  3L73 D;  3S9O A;  1AQT A;  3O6Q B;  2W6B A;  2ZYG A;  3H1H J;  3OJA B;  2OTK E;  3CD6 P;  3F5H A;  2FYN B;  3B8E B;  1VQM P;  1PZQ A;  2E74 D;  1KYO H;  3H1I G;  2ZXX A;  4AQR D;  1NTM G;  1BGY E;  2P10 A;  1N7S C;  1Q86 Q;  4BRY B;  5EFW B;  2P67 A;  3L35 A;  1LTS C;  1U7J A;  4K35 A;  4NPF X;  3OW2 O;  1FDO A;  1KB9 E;  4PD4 I;  4Y99 B;  1YJN P;  2OYH B;  2KK7 A;  1M90 Q;  1H0T B;  3A7O A;  1N86 A;  1LT1 A;  5KLV E;  4EI2 A;  1SS1 A;  4JF7 A;  1U7M A;  3HD7 B;  2H88 C;  1SQQ E;  4XFJ A;  1IK7 A;  2FXP A;  4OGQ C;  4I7Z C;  2P7J A;  3AE1 C;  4KHX A;  3LID A;  1OWA A;  1SQB G;  1MZ9 A;  1OFC X;  1L0N J;  4GIF A;  1UIX A;  1RF1 B;  2JDI H;  4OVN F;  1BGY J;  1EDJ A;  2ZT9 B;  3L70 G;  4C46 A;  1X79 B;  1LTJ B;  2QA4 P;  2Q5U A;  2N1T B;  2KS1 B;  1KQS O;  4PD4 H;  3CCJ P;  2XKM A;  1FOS F;  3T97 A;  3L36 A;  2HLO A;  1LTA C;  3CCV P;  5B66 H;  1GZL A;  2Q7C A;  1L0N D;  3NTN A;  1KYO E;  3E1R A;  2I1J A;  2OYI A;  2OQQ A;  1L2P A;  2WT7 B;  1T8Z A;  2LR2 A;  1BGY D;  1HBW A;  3VP9 A;  2XND H;  1SQQ J;  3CME P;  4IL6 X;  2H8P D;  2YMY A;  1HWT C;  1CI6 B;  3RK3 D;  1T3U A;  3RL0 B;  1FC2 C;  1FU1 A;  1SVF A;  1L0L K;  3VN0 A;  4A7P A;  1SP4 A;  5L8R J;  4KJM A;  1PIX A;  1URQ D;  3MD0 A;  2JWD A;  3HTK B;  2KLU A;  1T2K D;  2YXR B;  1KMI Z;  2Z5H A;  4WY4 B;  1SQQ D;  3FWN A;  1RH5 B;  5AW8 B;  5KJ7 A;  3VMZ A;  5C39 A;  5AVY B;  3ITK A;  3M9H A;  1EDK A;  4HKZ H;  1LWU B;  2C9L Y;  1GL2 D;  1X0T A;  5KKZ B;  2C0X A;  3HUS C;  4Y28 J;  1GDT A;  3V4Q A;  4WVZ A;  1JUN A;  4PD4 E;  4R4L A;  1HF9 A;  2IFN A;  2LXB A;  5B66 E;  3A2A A;  1VQ9 P;  5CHX A;  3WUU A;  5AW1 B;  3AED C;  1DX7 A;  4JYB A;  4BRY A;  2IBZ D;  1NAF A;  2JR8 A;  1GMJ A;  2O01 J;  1N7S B;  2JO1 A;  2G8Y A;  1Z56 A;  2FYU G;  1EZV D;  1JNM A;  2YKP A;  2KZJ A;  3GF7 A;  1L0N K;  4K3A A;  1H0T A;  1IFP A;  1E79 H;  2HG5 D;  4I1L A;  3HD7 A;  2M3B A;  1P84 I;  3KZI E;  4YTP C;  1S4X A;  4UB6 H;  1JCC A;  1NO4 A;  3IAO A;  3A3Y B;  3VMA A;  2M5A B;  3CC7 P;  3PH0 A;  2P2U A;  4HJG H;  4I7Z B;  1RF1 A;  3H1K E;  1A02 F;  1LTB C;  2E74 C;  3BCC G; 
#chains in the Genus database with same CATH homology
 2K37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...