4BRYA

The idas:geminin heterodimeric parallel coiled-coil
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
69
structure length
69
Chain Sequence
ENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Geminin and Idas Coiled Coils Preferentially Form a Heterodimer that Inhibits Geminin Function in DNA Replication Licensing
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords GEMININ
total genus 31
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 4bryA00
3E1RA 3WUUA 3F5HA 1UIIA 2Q6QA 3WUVA 4BRYA 3WUTA 2ZXXA 4BRYB 2WVRA
chains in the Genus database with same CATH superfamily
1Q90D 2KS1B 2BCCJ 4XE5B 1LTGC 1EXJA 1FZCB 3LW5J 1FZCA 4OGQC 3WUTA 1QL2A 3CXHI 2K9JA 3AEEC 1CZQA 3H1LE 2WPQA 4L74A 5KAFH 1LT1A 2HODB 3M0DA 1SFCD 2WPRA 3TDKA 1GMJA 2IYOA 4OH8B 1SQVG 4D6TJ 1DD4A 3TGUG 3SWFA 3CX5I 3V2QA 1KILB 1P84D 2OGUA 3QWOC 1YTZT 2OTJP 4WBAA 3B71A 1K8AQ 1FZGA 1CW5A 1RE3C 5KLVJ 1RF1C 4IFFA 1USEA 4MN4C 3RK2B 3RL0C 4K35A 1FDIA 1R5LA 2ZYDA 1P84E 1LTJA 2XU6A 1OXZA 3AE1C 3HE4A 3L73E 5CCHD 3I5CA 1KFNA 1SQPG 4EOTA 1YHQP 1N8RQ 5B66E 1SQBJ 2FXOA 2Q6QA 1XTCC 3N7NA 4NPEA 4LLHA 1G2CB 1LJ2A 1N2DC 2E43A 2WSFJ 4TLFA 1SQPE 2KLUA 1S1CX 2M5AB 4AYCA 4JYCA 1JMMA 5AW0B 3V4WA 1L0NJ 2FYZA 2V7QH 3L73G 1VQLP 2GM4A 5AVQB 4JPZB 3EQ2A 3HTKA 5BU5A 1QGKB 3CPWO 5CBOA 2E74D 2HPCA 1IFJA 2HLOA 1OFCX 1QVFO 2PFXA 3CWBE 1EC5A 3HE5B 3CC2P 4IFMA 2IBZD 4RJTA 4WY4A 5E79E 2KYVA 2C9LY 1KQFB 2IDBA 2E75C 2NPSA 2N9YB 2FFDC 1PGOA 4ZMDA 1OMIA 3MTUE 2IBZE 4RO0A 1NTZG 3NTNA 3PP5A 2Q7CA 3TYYA 3A0BE 1P84I 3CXHH 1L0LD 2WSEJ 1KZUB 1MV8A 3H1ID 3MGNA 3TK1A 1LGHB 3RGUA 3RK3D 3B5NB 4YPCA 1VQ8P 1VQKP 1N7SB 1RF0A 3H1LJ 2N1TB 2SPZA 1NTZE 1YTZI 2XNXA 4BRYB 2FFDB 4UB6E 1VQ7P 1KTMA 5B5EE 4H13B 2WWWA 2I1KA 2O01N 5APXA 1GW3A 1LT9B 1FZAA 1G1JA 1NH4A 4GIFA 1NJIQ 2W6AA 1AVOA 3EFGA 4RKUJ 3M9BA 5BVZA 3F5HA 2O1KA 2QSIA 3CXHE 3P7KA 2OYOA 2ZFCA 4HKZH 2KI7B 2RKLA 1N73C 3HD7B 3L72G 1RE4C 2B89A 1PP9J 1SQQJ 2K1AA 3A0BH 2G8YA 5CCGC 4R4MA 2D2CC 2KS1A 2WSCJ 4WWIA 4R4LA 1M1JA 2IBZI 3CXHD 4WVZA 3GF3A 4ZKPA 3Q5RA 3FGAD 1NTKJ 3PHLA 3TNUA 2PP6A 1NGMB 1HBWA 1JUNA 1GK4A 1CI6A 1VF5D 3FWNA 4ZKUA 2R5BA 2E75B 2GUVA 3JCUH 2B9BA 3S9OA 2H88C 4D6TE 2WSFH 2AXTE 1SVFA 2E5TA 1URQD 1M90Q 2P67A 4I7ZC 4N6JA 4U3FJ 1SFCA 1VQ6P 2AEMA 3T97A 3HD7C 3L70E 3O6QA 5KKZB 2ZT9D 2WT7A 2H43A 2WZ7A 3CWBJ 4H44C 1T3UA 1SQVE 1AA0A 2QVAA 4DJGA 4HB1A 2FXPA 1FS0E 1L0LG 4HYTB 5AW3B 1NU1E 1OVRA 1NTZD 5APQA 1L0NE 2R5DA 4Y28J 3TGUD 3AEBC 1U7MA 2IYPA 1NAYA 1PP9D 1BSNA 1ZN5A 1BE3E 2MKVA 1JTHA 1JTHB 2P2UA 3JSVC 4H13C 3D71A 2M3BA 3AE6C 1NTKG 1X9VA 1LNQA 3HE5A 1FBMA 1K04A 2IBZG 3H32A 2BASA 4PD4E 1HGZA 3H1HJ 1Q2NA 3L70J 1H0TA 1NU1D 2J59M 3L35A 1K9MQ 4DOJA 1FJKA 5BU8B 2YKPA 3L74J 1SQQD 1CSBA 1S5LH 3B5ND 1J1EC 1LP1A 3NFQA 1N7LA 5AVZB 2Y9ZA 1EDLA 1VQPP 2XDJA 3AE2C 4OVNF 3UIAA 2QJKC 4WY4D 3D6YA 1NTKE 1WRGA 2KNCB 2VRSA 2W83C 3QH9A 4C7NA 1VF5C 2FYUG 2N1TA 1KYOH 2IFMA 4U7JA 1VQ4P 3AEFC 1H88A 3CLQA 1SQXJ 2H89C 2Y0CA 1SQQE 1YQ3C 3E1IA 2FY8A 3H1KJ 4NPDA 2JR8A 1JMBA 4Z1MH 5GTHH 3VOPA 5KLVK 4PV1D 2JEEA 3G6EP 3L75G 3HD7D 3H1JG 4LC1A 5H2FH 2BCCD 3E1RA 3H1IJ 2J5UA 3SWKA 1H8AA 2BEZF 4H44B 1M56D 1ZOYC 2H8PD 4H0LC 1PIXA 4O9BA 3SWYA 3VMYA 1Y8AA 3Q3DA 1EDJA 1J1DC 1KYOD 2G3AA 3L71J 1NAFA 3M0AA 2K9JB 1SQXE 2C0WA 3RL0B 3RBZA 1EXIA 1LT9A 2M3EA 2UWJE 2A06D 1URQB 1A02J 3SFDC 3WMM0 1FAVA 2XNDH 3B5NC 2FYUJ 1GTWA 3RK3C 3LW5H 2GA1A 2YXRB 1FOSE 1L4AC 1OX3A 1LTBC 3CX5E 3OAKA 5K5GB 1FZCC 2AXTH 3EFFK 2CK3H 3T97B 2RN0A 3H1JD 1E79H 2QJYC 4PD4I 2KOGA 2WPVB 1KB9E 1QVGO 1HJ0A 3H1HG 1KMIZ 5APYA 3N4XA 3ZDMA 3H1IG 3V2PA 1VDFA 4Y99C 2Q3EA 2E76C 1S72P 1GW4A 1VL2A 1DH3A 3WU2E 1DEBA 1BDCA 2E74B 3HUSC 4C7RA 1PPJE 5KLIB 1YJ9P 2ZT9B 3TNUB 2I1JA 2YKOA 1ZP0C 1YI2P 1SQBD 3KYQA 1Q82Q 3I56P 1NTKK 2QIWA 2AEJA 2KSJA 2XV5A 4Y99B 3CX5H 1HJBA 1L4AA 2YMKA 3WUVA 5EFWB 1EZVI 1ZRTE 2QJYB 1H89A 1GU4A 1S3JA 2E76D 2QJPB 4BWNA 1YQ4C 3GG2A 1NU1G 1KQSO 4U3FE 1AFOA 4WY4B 2JDIH 2A45H 2O01J 1IFIA 2HODA 3IAOA 3V2NA 5KLVE 3L75D 2B87A 5B5EH 1QLED 3G4SP 3Q1MA 3FXEA 1EDIA 2WMMA 2IFNA 4PJ0E 5AW9B 1GL2A 1N86A 4BXLA 1OW8A 1LTSC 2ZAEB 1PGJA 4IOIH 4LGDE 3Q2YA 2WSSH 1KILC 3JC22 1RE4A 2A06E 2FYUD 1KQGB 1LTIC 2Y0EA 2ZYAA 1KV4A 1AVYA 3ABVC 3B5NA 3HE4B 3BCCG 3M91A 1W2EA 3GF7A 3E7KA 3R2PA 3R4YA 4WB4A 5AW1B 1BSHA 1X0TA 3AEAC 1SQQG 4GOEA 1BGYD 2KUBA 1DD3A 1FZBA 1NO4A 1DEEG 3LIDA 2IX7C 1K73Q 1GD2E 4CPGA 3FXDA 3LIEA 3CCJP 3Q5PA 1EZVD 2HG5D 1YJWP 2WPSA 1T2KC 1D7MA 1FC2C 4C46A 1BCCE 4JBZA 2NPSD 3OJAB 1KILD 2FYNB 2WVRA 1NTMJ 1NTZJ 1PPJG 1SFCC 3A7OA 3EWKA 3II6A 4H44D 4DCKA 3Q5SA 1S9KE 1X8YA 2QM7A 3L74D 2AEFA 3S1KA 4PV1C 5B66H 1JY2O 2JJLA 1JEKA 2O1JA 3CMEP 3I55P 1NYHA 2Z5IA 3H1LG 1SQVK 4I2LC 4UB8H 2QG4A 3L36A 2WTYA 2R44A 1VQ9P 1SQBG 2M0BA 3L74E 2Y0DA 1GK6A 2K88A 1IC2A 5AVSB 5CCHC 1K05A 1QX8A 1R5SA 2IZ0A 2NRGA 3AE4C 1UIIA 1L0NG 1IFNA 1L4AD 1Q81Q 1QEXA 3PTZA 3H1HD 1L0LE 5KTBA 2OYIA 3P8CD 1MFZA 2E5YA 2V4HA 4XA4A 3D70A 4YXWH 2O3JA 4ASVA 1MUUA 2L91A 2YIUB 4KJMA 1NTMG 2E76B 1PZQA 2QM8A 1BCCG 1WT6A 2YNYA 2W90A 5KKZC 3A5TA 2YO3A 2JWDA 2KZIA 3G3ZA 2L5GB 3M9QA 1RE3A 1RF0C 5C39A 4N3YB 5M1BA 1LWUC 3U59A 4N78E 1KN7A 2POHA 2V7QJ 3H6PA 3VTPC 1H0TB 1JB0J 1S5LX 3RK3B 3MUDA 5AVTB 1URQA 4YTPC 1T8ZA 3C8VA 5APWA 2KIKA 1NTMD 1OW7A 3BCCE 5DJTB 5AVYB 1LWUB 1M57D 1NTZK 3L72E 3NXSA 4H13D 3VMXA 1ZLLA 2B88A 2ZXXA 1PGPA 3V5BA 3H1JJ 4PV1B 2HPCB 2P7JA 4N78D 1KORA 2M8RA 3IFMA 1NTME 1SQPK 1YBKA 3BCCD 4H0LD 4UB8E 1JNMA 3GHGC 3P8MC 4D6TD 1SQPD 2LR2A 3D6ZA 2ZT9C 1LP1B 5AVWB 4B86A 5CCGD 2C0XA 1M8OB 1QL1A 2E74C 3HUSB 1EDKA 1PV3A 4U3FG 5DJUB 1IO4A 3B4SA 5KAIH 2OYHC 2B87B 3OW2O 1NTMK 1JOCA 4IL6E 1IK7A 1FE6A 3MUDC 3P8CE 4GOFA 2JP3A 5APSA 5GTIE 3CCVP 1T2KD 1LTAC 1MKMA 4EIJA 1NKZB 1VF5B 2XKMA 3CCRP 2FBWC 3JCUE 1NWQA 4L75A 3HRNA 3RBXA 4GT1A 3H1KD 5CMZA 5H2FE 1KYOI 1BDDA 1YYCA 5E79H 4NPFX 3RK3E 3C9IA 2K3RA 2FXMA 5AVVB 1FJPA 3MD0A 4PD4D 2YMYA 5AVRB 3SFEC 4EYYQ 5GTIH 2QEXP 1VQOP 1BGYG 1UIXA 1ZR2A 4A7PA 1Z56A 2P1JA 1JY3N 3O6QB 1FDOA 1OW6A 3KQGA 4D6TG 3U1CA 3M0DC 5KAIE 2Q9IA 3L75J 1AV1A 1URQC 2E75D 2HR3A 1HGVA 4RESB 4W7YA 3CCEP 3USSA 2ZJSE 3L70D 5AVUB 4I1LA 2N9BA 3P32A 3IR9A 5APUA 1SQVD 2ITAA 3AEGC 1L0LK 2WSCH 1ZMEC 5CJ4A 1IK9A 1HTLC 1RQVA 1SQPJ 3M9HA 1SQXG 4ZNCA 1RF1A 1NVOA 1OVVA 3AE9C 4M3LA 1DIPA 1ZV8A 1JY2N 4AQRD 2A06G 2OARA 3GHGB 3OA7A 2Q1KA 2I8DA 3BVHA 1EQ7A 3L4FA 3VP8A 3CMAP 2OYIC 5L8RJ 5KJ7C 1HWTC 2OYHA 1U57A 3AEDC 1PFIA 1KC8Q 3A0HE 1JY3O 3H1JE 5AVXB 2Z5HA 1AQ5A 1S5LE 3KDPB 3WU2H 2JO1A 3L72D 1KB9I 1JY2P 3L72J 1Q7YQ 5AW2B 1KQLA 1PGQA 3BATA 3BCCJ 2WITA 2QJKB 5CJ0A 1X79B 3PRJA 1SS1A 3CWBD 3KHUA 2AXCA 4L73A 1AJYA 3CCMP 1GDTA 5TISE 1FZFA 3AECC 2QJPC 3IN6A 1FDMA 3H1IE 2R3CA 1N73A 1N73B 1GL2D 4HJGH 2FYUK 1BGYJ 2YKQA 1PP9E 5KJ7A 1SP4A 2FYNC 2PAJA 1R8EA 2QE7H 2QA4P 1JCDA 2OYHB 4JYBA 2YIUC 3KZIE 1OWAA 1KD1Q 2NPSB 1GL2B 1L2PA 2P10A 1LWUA 2RMZA 2W6JH 2A45I 2Y9YA 3A3YB 3BRVB 3RL0D 3U1AA 3CC7P 1P84H 1VQNP 3PH0A 3H1KE 5APTA 4TT3H 1MFTA 4I7ZB 1BE3G 2W27A 2HYNA 1A02F 2KP8A 4GDOA 4GODA 3KZIH 3CCLP 2A45G 3H32B 2K37A 4EI2A 1NTKD 1ZXGA 2PRRA 5AW6B 4DT0A 5CBNA 3BASA 3KXDA 1PL5A 2J58A 3VP9A 2ZYGA 1Y47A 3HUSA 1SQBK 2KLVA 3IF4A 1AQTA 3L70G 2XZRA 2P58A 5CHXA 2K9YA 5TISH 1JCCA 2FKWB 1G1IA 3L37A 1IFMA 1ZW0A 3RL0g 4WY4C 2OTLP 3CL3D 1OZHA 1L0ND 2WQYC 3AE8C 2RH0A 3AE5C 4JF7A 3VMAA 3WUUA 3TGUE 2D2CD 1HH0A 1JM0A 3MIWA 5KLVG 4BRYA 3L71E 4XFJA 1USDA 1MZ9A 1IFPA 1FOSF 4AUWA 1N7SD 3B8EB 1IJDB 2OTKE 1FU1A 1SQXK 2PGDA 4PD4H 1CI6B 1VPCA 4W80A 3CCSP 1KILA 1KYOE 4OGQD 3A2AA 3M06A 4IFDK 2LKMA 2BEQD 3H1KG 3HTKB 1LTJB 1GL2C 2N1TC 3L74G 3NMDA 1SQBE 5KLIC 1JY3P 1N7SC 4EDFA 1Q86Q 2JWAA 3PLNA 4ASWA 3GHGA 1PPJD 1BGYE 1M7LA 1IFDA 1WMKA 3CI9A 3L73J 2JKVA 1OIPA 1G2CA 2YO2A 3A0HH 2ZXEB 1T6AA 2Q3IA 1EZVG 2CPSA 2OQQA 1BE3D 2KSEA 1ZR4A 3CX5D 5AW8B 3CCQP 3V6IA 4JQ0D 1KB9D 4OWFA 1PP9G 1KILE 3F89A 4U3FD 5KJ7D 3VYIA 3W68A 3W67A 5KLVD 2Q5UA 3VN0A 3V4QA 2MJZA 1L4AB 3GMAA 1SFCB 2KXPB 3GLMA 1IZNB 2E42A 1KFMA 3GW6A 3C1LA 1W2BO 3MZWB 3K5BA 2FFDA 3FX0A 2W8ZA 3KPEA 2BCCE 1RH5B 1T3JA 1HF9A 1SLQA 2C9NY 2QRXA 3CC4P 4KHXA 3RK2D 3G9RA 1W5CE 3L71G 2OYIB 1KB9H 5AW7B 4I6MC 1BE3J 4H0LB 3S4RA 1XTGB 1M1KQ 1GU5A 2LXCB 1SQQK 1DX7A 1VQ5P 2O01H 4YXDC 1ZRTD 3CWBG 3H25A 3G71P 5APVA 4DZOA 3HD7A 3ITKA 3MP7B 1YIJP 1L0LJ 3V2RA 1HVVA 1SQVJ 3CD6P 3AE7C 1NHLA 1J2JB 1TU3F 2IZ1A 3TGUJ 1NU1K 3TSIA 3CCUP 1M1JB 1S4XA 4K3AA 1BCCD 1RQUA 1NKNA 2KZJA 3L75E 3TF5A 1Y9BA 2ZVNB 2R32A 5KAFE 1RHZB 2BCCG 1FZEA 2R3SA 2W6BA 1GZLA 1U7JA 2YXQB 2M5AA 2ZVOB 2N1TD 2GUSA 3L73D 3O8ZA 3RK2C 4QMAA 1OVUA 2FYUE 3AE3C 1RF1B 2D2CB 2KNCA 1SQXD 4IL6H 4C7NB 1HUCA 1N7SA 2DW3A 1M1JC 5AW4B 1S9KD 1RY3A 4IL6X 1NOHA 1YITP 4GKGA 3L71D 5CCGA 1X22A 4PJ0H 1J1EB 2WT7B 4KT0J 2H7HA 1VQMP 1J1DB 3SSUA 5GTHE 1L0NK 2IPPA 4OGQB 1BCCJ 1EZVE 2HFED 4HH2A 1JO5A 3VMZA 3BRTB 5TJHA 4UB6H 2WSEH 3H1HE 2KB7P 2CPBA 2NPSC 3H1LD 3PJSK 1E5WA 1LT9C 4L76A 2NZ2A 4W7ZA 1LTJC 1YJNP 2Z4EA 5CCHA 1NU1J 1LTTC 2KK7A 1S2EA 3FWLA 3MHVA 5AW5B 2LXBA
chains in the Genus database with same CATH topology
3E1RA 3WUUA 3F5HA 1UIIA 2Q6QA 3WUVA 4BRYA 3WUTA 2ZXXA 4BRYB 2WVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E1R A;  3WUU A;  3F5H A;  1UII A;  2Q6Q A;  3WUV A;  4BRY A;  3WUT A;  2ZXX A;  4BRY B;  2WVR A; 
#chains in the Genus database with same CATH topology
 1Q90 D;  2KS1 B;  2BCC J;  4XE5 B;  1LTG C;  1EXJ A;  1FZC B;  3LW5 J;  1FZC A;  4OGQ C;  3WUT A;  1QL2 A;  3CXH I;  2K9J A;  3AEE C;  1CZQ A;  3H1L E;  2WPQ A;  4L74 A;  5KAF H;  1LT1 A;  2HOD B;  3M0D A;  1SFC D;  2WPR A;  3TDK A;  1GMJ A;  2IYO A;  4OH8 B;  1SQV G;  4D6T J;  1DD4 A;  3TGU G;  3SWF A;  3CX5 I;  3V2Q A;  1KIL B;  1P84 D;  2OGU A;  3QWO C;  1YTZ T;  2OTJ P;  4WBA A;  3B71 A;  1K8A Q;  1FZG A;  1CW5 A;  1RE3 C;  5KLV J;  1RF1 C;  4IFF A;  1USE A;  4MN4 C;  3RK2 B;  3RL0 C;  4K35 A;  1FDI A;  1R5L A;  2ZYD A;  1P84 E;  1LTJ A;  2XU6 A;  1OXZ A;  3AE1 C;  3HE4 A;  3L73 E;  5CCH D;  3I5C A;  1KFN A;  1SQP G;  4EOT A;  1YHQ P;  1N8R Q;  5B66 E;  1SQB J;  2FXO A;  2Q6Q A;  1XTC C;  3N7N A;  4NPE A;  4LLH A;  1G2C B;  1LJ2 A;  1N2D C;  2E43 A;  2WSF J;  4TLF A;  1SQP E;  2KLU A;  1S1C X;  2M5A B;  4AYC A;  4JYC A;  1JMM A;  5AW0 B;  3V4W A;  1L0N J;  2FYZ A;  2V7Q H;  3L73 G;  1VQL P;  2GM4 A;  5AVQ B;  4JPZ B;  3EQ2 A;  3HTK A;  5BU5 A;  1QGK B;  3CPW O;  5CBO A;  2E74 D;  2HPC A;  1IFJ A;  2HLO A;  1OFC X;  1QVF O;  2PFX A;  3CWB E;  1EC5 A;  3HE5 B;  3CC2 P;  4IFM A;  2IBZ D;  4RJT A;  4WY4 A;  5E79 E;  2KYV A;  2C9L Y;  1KQF B;  2IDB A;  2E75 C;  2NPS A;  2N9Y B;  2FFD C;  1PGO A;  4ZMD A;  1OMI A;  3MTU E;  2IBZ E;  4RO0 A;  1NTZ G;  3NTN A;  3PP5 A;  2Q7C A;  3TYY A;  3A0B E;  1P84 I;  3CXH H;  1L0L D;  2WSE J;  1KZU B;  1MV8 A;  3H1I D;  3MGN A;  3TK1 A;  1LGH B;  3RGU A;  3RK3 D;  3B5N B;  4YPC A;  1VQ8 P;  1VQK P;  1N7S B;  1RF0 A;  3H1L J;  2N1T B;  2SPZ A;  1NTZ E;  1YTZ I;  2XNX A;  4BRY B;  2FFD B;  4UB6 E;  1VQ7 P;  1KTM A;  5B5E E;  4H13 B;  2WWW A;  2I1K A;  2O01 N;  5APX A;  1GW3 A;  1LT9 B;  1FZA A;  1G1J A;  1NH4 A;  4GIF A;  1NJI Q;  2W6A A;  1AVO A;  3EFG A;  4RKU J;  3M9B A;  5BVZ A;  3F5H A;  2O1K A;  2QSI A;  3CXH E;  3P7K A;  2OYO A;  2ZFC A;  4HKZ H;  2KI7 B;  2RKL A;  1N73 C;  3HD7 B;  3L72 G;  1RE4 C;  2B89 A;  1PP9 J;  1SQQ J;  2K1A A;  3A0B H;  2G8Y A;  5CCG C;  4R4M A;  2D2C C;  2KS1 A;  2WSC J;  4WWI A;  4R4L A;  1M1J A;  2IBZ I;  3CXH D;  4WVZ A;  3GF3 A;  4ZKP A;  3Q5R A;  3FGA D;  1NTK J;  3PHL A;  3TNU A;  2PP6 A;  1NGM B;  1HBW A;  1JUN A;  1GK4 A;  1CI6 A;  1VF5 D;  3FWN A;  4ZKU A;  2R5B A;  2E75 B;  2GUV A;  3JCU H;  2B9B A;  3S9O A;  2H88 C;  4D6T E;  2WSF H;  2AXT E;  1SVF A;  2E5T A;  1URQ D;  1M90 Q;  2P67 A;  4I7Z C;  4N6J A;  4U3F J;  1SFC A;  1VQ6 P;  2AEM A;  3T97 A;  3HD7 C;  3L70 E;  3O6Q A;  5KKZ B;  2ZT9 D;  2WT7 A;  2H43 A;  2WZ7 A;  3CWB J;  4H44 C;  1T3U A;  1SQV E;  1AA0 A;  2QVA A;  4DJG A;  4HB1 A;  2FXP A;  1FS0 E;  1L0L G;  4HYT B;  5AW3 B;  1NU1 E;  1OVR A;  1NTZ D;  5APQ A;  1L0N E;  2R5D A;  4Y28 J;  3TGU D;  3AEB C;  1U7M A;  2IYP A;  1NAY A;  1PP9 D;  1BSN A;  1ZN5 A;  1BE3 E;  2MKV A;  1JTH A;  1JTH B;  2P2U A;  3JSV C;  4H13 C;  3D71 A;  2M3B A;  3AE6 C;  1NTK G;  1X9V A;  1LNQ A;  3HE5 A;  1FBM A;  1K04 A;  2IBZ G;  3H32 A;  2BAS A;  4PD4 E;  1HGZ A;  3H1H J;  1Q2N A;  3L70 J;  1H0T A;  1NU1 D;  2J59 M;  3L35 A;  1K9M Q;  4DOJ A;  1FJK A;  5BU8 B;  2YKP A;  3L74 J;  1SQQ D;  1CSB A;  1S5L H;  3B5N D;  1J1E C;  1LP1 A;  3NFQ A;  1N7L A;  5AVZ B;  2Y9Z A;  1EDL A;  1VQP P;  2XDJ A;  3AE2 C;  4OVN F;  3UIA A;  2QJK C;  4WY4 D;  3D6Y A;  1NTK E;  1WRG A;  2KNC B;  2VRS A;  2W83 C;  3QH9 A;  4C7N A;  1VF5 C;  2FYU G;  2N1T A;  1KYO H;  2IFM A;  4U7J A;  1VQ4 P;  3AEF C;  1H88 A;  3CLQ A;  1SQX J;  2H89 C;  2Y0C A;  1SQQ E;  1YQ3 C;  3E1I A;  2FY8 A;  3H1K J;  4NPD A;  2JR8 A;  1JMB A;  4Z1M H;  5GTH H;  3VOP A;  5KLV K;  4PV1 D;  2JEE A;  3G6E P;  3L75 G;  3HD7 D;  3H1J G;  4LC1 A;  5H2F H;  2BCC D;  3E1R A;  3H1I J;  2J5U A;  3SWK A;  1H8A A;  2BEZ F;  4H44 B;  1M56 D;  1ZOY C;  2H8P D;  4H0L C;  1PIX A;  4O9B A;  3SWY A;  3VMY A;  1Y8A A;  3Q3D A;  1EDJ A;  1J1D C;  1KYO D;  2G3A A;  3L71 J;  1NAF A;  3M0A A;  2K9J B;  1SQX E;  2C0W A;  3RL0 B;  3RBZ A;  1EXI A;  1LT9 A;  2M3E A;  2UWJ E;  2A06 D;  1URQ B;  1A02 J;  3SFD C;  3WMM 0;  1FAV A;  2XND H;  3B5N C;  2FYU J;  1GTW A;  3RK3 C;  3LW5 H;  2GA1 A;  2YXR B;  1FOS E;  1L4A C;  1OX3 A;  1LTB C;  3CX5 E;  3OAK A;  5K5G B;  1FZC C;  2AXT H;  3EFF K;  2CK3 H;  3T97 B;  2RN0 A;  3H1J D;  1E79 H;  2QJY C;  4PD4 I;  2KOG A;  2WPV B;  1KB9 E;  1QVG O;  1HJ0 A;  3H1H G;  1KMI Z;  5APY A;  3N4X A;  3ZDM A;  3H1I G;  3V2P A;  1VDF A;  4Y99 C;  2Q3E A;  2E76 C;  1S72 P;  1GW4 A;  1VL2 A;  1DH3 A;  3WU2 E;  1DEB A;  1BDC A;  2E74 B;  3HUS C;  4C7R A;  1PPJ E;  5KLI B;  1YJ9 P;  2ZT9 B;  3TNU B;  2I1J A;  2YKO A;  1ZP0 C;  1YI2 P;  1SQB D;  3KYQ A;  1Q82 Q;  3I56 P;  1NTK K;  2QIW A;  2AEJ A;  2KSJ A;  2XV5 A;  4Y99 B;  3CX5 H;  1HJB A;  1L4A A;  2YMK A;  3WUV A;  5EFW B;  1EZV I;  1ZRT E;  2QJY B;  1H89 A;  1GU4 A;  1S3J A;  2E76 D;  2QJP B;  4BWN A;  1YQ4 C;  3GG2 A;  1NU1 G;  1KQS O;  4U3F E;  1AFO A;  4WY4 B;  2JDI H;  2A45 H;  2O01 J;  1IFI A;  2HOD A;  3IAO A;  3V2N A;  5KLV E;  3L75 D;  2B87 A;  5B5E H;  1QLE D;  3G4S P;  3Q1M A;  3FXE A;  1EDI A;  2WMM A;  2IFN A;  4PJ0 E;  5AW9 B;  1GL2 A;  1N86 A;  4BXL A;  1OW8 A;  1LTS C;  2ZAE B;  1PGJ A;  4IOI H;  4LGD E;  3Q2Y A;  2WSS H;  1KIL C;  3JC2 2;  1RE4 A;  2A06 E;  2FYU D;  1KQG B;  1LTI C;  2Y0E A;  2ZYA A;  1KV4 A;  1AVY A;  3ABV C;  3B5N A;  3HE4 B;  3BCC G;  3M91 A;  1W2E A;  3GF7 A;  3E7K A;  3R2P A;  3R4Y A;  4WB4 A;  5AW1 B;  1BSH A;  1X0T A;  3AEA C;  1SQQ G;  4GOE A;  1BGY D;  2KUB A;  1DD3 A;  1FZB A;  1NO4 A;  1DEE G;  3LID A;  2IX7 C;  1K73 Q;  1GD2 E;  4CPG A;  3FXD A;  3LIE A;  3CCJ P;  3Q5P A;  1EZV D;  2HG5 D;  1YJW P;  2WPS A;  1T2K C;  1D7M A;  1FC2 C;  4C46 A;  1BCC E;  4JBZ A;  2NPS D;  3OJA B;  1KIL D;  2FYN B;  2WVR A;  1NTM J;  1NTZ J;  1PPJ G;  1SFC C;  3A7O A;  3EWK A;  3II6 A;  4H44 D;  4DCK A;  3Q5S A;  1S9K E;  1X8Y A;  2QM7 A;  3L74 D;  2AEF A;  3S1K A;  4PV1 C;  5B66 H;  1JY2 O;  2JJL A;  1JEK A;  2O1J A;  3CME P;  3I55 P;  1NYH A;  2Z5I A;  3H1L G;  1SQV K;  4I2L C;  4UB8 H;  2QG4 A;  3L36 A;  2WTY A;  2R44 A;  1VQ9 P;  1SQB G;  2M0B A;  3L74 E;  2Y0D A;  1GK6 A;  2K88 A;  1IC2 A;  5AVS B;  5CCH C;  1K05 A;  1QX8 A;  1R5S A;  2IZ0 A;  2NRG A;  3AE4 C;  1UII A;  1L0N G;  1IFN A;  1L4A D;  1Q81 Q;  1QEX A;  3PTZ A;  3H1H D;  1L0L E;  5KTB A;  2OYI A;  3P8C D;  1MFZ A;  2E5Y A;  2V4H A;  4XA4 A;  3D70 A;  4YXW H;  2O3J A;  4ASV A;  1MUU A;  2L91 A;  2YIU B;  4KJM A;  1NTM G;  2E76 B;  1PZQ A;  2QM8 A;  1BCC G;  1WT6 A;  2YNY A;  2W90 A;  5KKZ C;  3A5T A;  2YO3 A;  2JWD A;  2KZI A;  3G3Z A;  2L5G B;  3M9Q A;  1RE3 A;  1RF0 C;  5C39 A;  4N3Y B;  5M1B A;  1LWU C;  3U59 A;  4N78 E;  1KN7 A;  2POH A;  2V7Q J;  3H6P A;  3VTP C;  1H0T B;  1JB0 J;  1S5L X;  3RK3 B;  3MUD A;  5AVT B;  1URQ A;  4YTP C;  1T8Z A;  3C8V A;  5APW A;  2KIK A;  1NTM D;  1OW7 A;  3BCC E;  5DJT B;  5AVY B;  1LWU B;  1M57 D;  1NTZ K;  3L72 E;  3NXS A;  4H13 D;  3VMX A;  1ZLL A;  2B88 A;  2ZXX A;  1PGP A;  3V5B A;  3H1J J;  4PV1 B;  2HPC B;  2P7J A;  4N78 D;  1KOR A;  2M8R A;  3IFM A;  1NTM E;  1SQP K;  1YBK A;  3BCC D;  4H0L D;  4UB8 E;  1JNM A;  3GHG C;  3P8M C;  4D6T D;  1SQP D;  2LR2 A;  3D6Z A;  2ZT9 C;  1LP1 B;  5AVW B;  4B86 A;  5CCG D;  2C0X A;  1M8O B;  1QL1 A;  2E74 C;  3HUS B;  1EDK A;  1PV3 A;  4U3F G;  5DJU B;  1IO4 A;  3B4S A;  5KAI H;  2OYH C;  2B87 B;  3OW2 O;  1NTM K;  1JOC A;  4IL6 E;  1IK7 A;  1FE6 A;  3MUD C;  3P8C E;  4GOF A;  2JP3 A;  5APS A;  5GTI E;  3CCV P;  1T2K D;  1LTA C;  1MKM A;  4EIJ A;  1NKZ B;  1VF5 B;  2XKM A;  3CCR P;  2FBW C;  3JCU E;  1NWQ A;  4L75 A;  3HRN A;  3RBX A;  4GT1 A;  3H1K D;  5CMZ A;  5H2F E;  1KYO I;  1BDD A;  1YYC A;  5E79 H;  4NPF X;  3RK3 E;  3C9I A;  2K3R A;  2FXM A;  5AVV B;  1FJP A;  3MD0 A;  4PD4 D;  2YMY A;  5AVR B;  3SFE C;  4EYY Q;  5GTI H;  2QEX P;  1VQO P;  1BGY G;  1UIX A;  1ZR2 A;  4A7P A;  1Z56 A;  2P1J A;  1JY3 N;  3O6Q B;  1FDO A;  1OW6 A;  3KQG A;  4D6T G;  3U1C A;  3M0D C;  5KAI E;  2Q9I A;  3L75 J;  1AV1 A;  1URQ C;  2E75 D;  2HR3 A;  1HGV A;  4RES B;  4W7Y A;  3CCE P;  3USS A;  2ZJS E;  3L70 D;  5AVU B;  4I1L A;  2N9B A;  3P32 A;  3IR9 A;  5APU A;  1SQV D;  2ITA A;  3AEG C;  1L0L K;  2WSC H;  1ZME C;  5CJ4 A;  1IK9 A;  1HTL C;  1RQV A;  1SQP J;  3M9H A;  1SQX G;  4ZNC A;  1RF1 A;  1NVO A;  1OVV A;  3AE9 C;  4M3L A;  1DIP A;  1ZV8 A;  1JY2 N;  4AQR D;  2A06 G;  2OAR A;  3GHG B;  3OA7 A;  2Q1K A;  2I8D A;  3BVH A;  1EQ7 A;  3L4F A;  3VP8 A;  3CMA P;  2OYI C;  5L8R J;  5KJ7 C;  1HWT C;  2OYH A;  1U57 A;  3AED C;  1PFI A;  1KC8 Q;  3A0H E;  1JY3 O;  3H1J E;  5AVX B;  2Z5H A;  1AQ5 A;  1S5L E;  3KDP B;  3WU2 H;  2JO1 A;  3L72 D;  1KB9 I;  1JY2 P;  3L72 J;  1Q7Y Q;  5AW2 B;  1KQL A;  1PGQ A;  3BAT A;  3BCC J;  2WIT A;  2QJK B;  5CJ0 A;  1X79 B;  3PRJ A;  1SS1 A;  3CWB D;  3KHU A;  2AXC A;  4L73 A;  1AJY A;  3CCM P;  1GDT A;  5TIS E;  1FZF A;  3AEC C;  2QJP C;  3IN6 A;  1FDM A;  3H1I E;  2R3C A;  1N73 A;  1N73 B;  1GL2 D;  4HJG H;  2FYU K;  1BGY J;  2YKQ A;  1PP9 E;  5KJ7 A;  1SP4 A;  2FYN C;  2PAJ A;  1R8E A;  2QE7 H;  2QA4 P;  1JCD A;  2OYH B;  4JYB A;  2YIU C;  3KZI E;  1OWA A;  1KD1 Q;  2NPS B;  1GL2 B;  1L2P A;  2P10 A;  1LWU A;  2RMZ A;  2W6J H;  2A45 I;  2Y9Y A;  3A3Y B;  3BRV B;  3RL0 D;  3U1A A;  3CC7 P;  1P84 H;  1VQN P;  3PH0 A;  3H1K E;  5APT A;  4TT3 H;  1MFT A;  4I7Z B;  1BE3 G;  2W27 A;  2HYN A;  1A02 F;  2KP8 A;  4GDO A;  4GOD A;  3KZI H;  3CCL P;  2A45 G;  3H32 B;  2K37 A;  4EI2 A;  1NTK D;  1ZXG A;  2PRR A;  5AW6 B;  4DT0 A;  5CBN A;  3BAS A;  3KXD A;  1PL5 A;  2J58 A;  3VP9 A;  2ZYG A;  1Y47 A;  3HUS A;  1SQB K;  2KLV A;  3IF4 A;  1AQT A;  3L70 G;  2XZR A;  2P58 A;  5CHX A;  2K9Y A;  5TIS H;  1JCC A;  2FKW B;  1G1I A;  3L37 A;  1IFM A;  1ZW0 A;  3RL0 g;  4WY4 C;  2OTL P;  3CL3 D;  1OZH A;  1L0N D;  2WQY C;  3AE8 C;  2RH0 A;  3AE5 C;  4JF7 A;  3VMA A;  3WUU A;  3TGU E;  2D2C D;  1HH0 A;  1JM0 A;  3MIW A;  5KLV G;  4BRY A;  3L71 E;  4XFJ A;  1USD A;  1MZ9 A;  1IFP A;  1FOS F;  4AUW A;  1N7S D;  3B8E B;  1IJD B;  2OTK E;  1FU1 A;  1SQX K;  2PGD A;  4PD4 H;  1CI6 B;  1VPC A;  4W80 A;  3CCS P;  1KIL A;  1KYO E;  4OGQ D;  3A2A A;  3M06 A;  4IFD K;  2LKM A;  2BEQ D;  3H1K G;  3HTK B;  1LTJ B;  1GL2 C;  2N1T C;  3L74 G;  3NMD A;  1SQB E;  5KLI C;  1JY3 P;  1N7S C;  4EDF A;  1Q86 Q;  2JWA A;  3PLN A;  4ASW A;  3GHG A;  1PPJ D;  1BGY E;  1M7L A;  1IFD A;  1WMK A;  3CI9 A;  3L73 J;  2JKV A;  1OIP A;  1G2C A;  2YO2 A;  3A0H H;  2ZXE B;  1T6A A;  2Q3I A;  1EZV G;  2CPS A;  2OQQ A;  1BE3 D;  2KSE A;  1ZR4 A;  3CX5 D;  5AW8 B;  3CCQ P;  3V6I A;  4JQ0 D;  1KB9 D;  4OWF A;  1PP9 G;  1KIL E;  3F89 A;  4U3F D;  5KJ7 D;  3VYI A;  3W68 A;  3W67 A;  5KLV D;  2Q5U A;  3VN0 A;  3V4Q A;  2MJZ A;  1L4A B;  3GMA A;  1SFC B;  2KXP B;  3GLM A;  1IZN B;  2E42 A;  1KFM A;  3GW6 A;  3C1L A;  1W2B O;  3MZW B;  3K5B A;  2FFD A;  3FX0 A;  2W8Z A;  3KPE A;  2BCC E;  1RH5 B;  1T3J A;  1HF9 A;  1SLQ A;  2C9N Y;  2QRX A;  3CC4 P;  4KHX A;  3RK2 D;  3G9R A;  1W5C E;  3L71 G;  2OYI B;  1KB9 H;  5AW7 B;  4I6M C;  1BE3 J;  4H0L B;  3S4R A;  1XTG B;  1M1K Q;  1GU5 A;  2LXC B;  1SQQ K;  1DX7 A;  1VQ5 P;  2O01 H;  4YXD C;  1ZRT D;  3CWB G;  3H25 A;  3G71 P;  5APV A;  4DZO A;  3HD7 A;  3ITK A;  3MP7 B;  1YIJ P;  1L0L J;  3V2R A;  1HVV A;  1SQV J;  3CD6 P;  3AE7 C;  1NHL A;  1J2J B;  1TU3 F;  2IZ1 A;  3TGU J;  1NU1 K;  3TSI A;  3CCU P;  1M1J B;  1S4X A;  4K3A A;  1BCC D;  1RQU A;  1NKN A;  2KZJ A;  3L75 E;  3TF5 A;  1Y9B A;  2ZVN B;  2R32 A;  5KAF E;  1RHZ B;  2BCC G;  1FZE A;  2R3S A;  2W6B A;  1GZL A;  1U7J A;  2YXQ B;  2M5A A;  2ZVO B;  2N1T D;  2GUS A;  3L73 D;  3O8Z A;  3RK2 C;  4QMA A;  1OVU A;  2FYU E;  3AE3 C;  1RF1 B;  2D2C B;  2KNC A;  1SQX D;  4IL6 H;  4C7N B;  1HUC A;  1N7S A;  2DW3 A;  1M1J C;  5AW4 B;  1S9K D;  1RY3 A;  4IL6 X;  1NOH A;  1YIT P;  4GKG A;  3L71 D;  5CCG A;  1X22 A;  4PJ0 H;  1J1E B;  2WT7 B;  4KT0 J;  2H7H A;  1VQM P;  1J1D B;  3SSU A;  5GTH E;  1L0N K;  2IPP A;  4OGQ B;  1BCC J;  1EZV E;  2HFE D;  4HH2 A;  1JO5 A;  3VMZ A;  3BRT B;  5TJH A;  4UB6 H;  2WSE H;  3H1H E;  2KB7 P;  2CPB A;  2NPS C;  3H1L D;  3PJS K;  1E5W A;  1LT9 C;  4L76 A;  2NZ2 A;  4W7Z A;  1LTJ C;  1YJN P;  2Z4E A;  5CCH A;  1NU1 J;  1LTT C;  2KK7 A;  1S2E A;  3FWL A;  3MHV A;  5AW5 B;  2LXB A; 
#chains in the Genus database with same CATH homology
 3E1R A;  3WUU A;  3F5H A;  1UII A;  2Q6Q A;  3WUV A;  4BRY A;  3WUT A;  2ZXX A;  4BRY B;  2WVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...