4BRYA

The idas:geminin heterodimeric parallel coiled-coil
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
69
structure length
69
Chain Sequence
ENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords GEMININ
publication title The Geminin and Idas Coiled Coils Preferentially Form a Heterodimer that Inhibits Geminin Function in DNA Replication Licensing
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 4bryA00
4BRYB 3WUUA 3WUVA 2WVRA 2ZXXA 3F5HA 3WUTA 3E1RA 2Q6QA 4BRYA 1UIIA
chains in the Genus database with same CATH superfamily
1P84I 3CLQA 4RKUJ 3G9RA 1L0LK 3OAKA 3L72E 1GL2C 5M1BA 4ZNCA 1AVOA 3EFFK 3L74D 5KLVJ 2HYNA 4GT1A 2JJLA 1OW7A 3H6PA 2QEXP 1VQ8P 2V7QH 2GA1A 1PIXA 2E75C 4H13D 5KAIH 1IFNA 1FU1A 2WZ7A 5APTA 5TISH 2KLVA 3B4SA 3L72G 2BCCD 4PD4E 2O1JA 1KYOH 1OW6A 5AW4B 1LWUA 2QJPC 1J1DC 1HGZA 1VL2A 1YYCA 2YXRB 1LTJA 2E76B 1ZV8A 3D6ZA 2YIUB 3PH0A 5KLVE 1CSBA 2OTKE 3Q1MA 2Q3IA 3U1AA 1M56D 2HR3A 4IFDK 3GG2A 2LR2A 3WUTA 2D2CB 3M0DC 3L75J 1FZGA 2GUSA 3W67A 5AW6B 2YMYA 2ZYAA 1T3UA 2H88C 1NKNA 4W7YA 5AVUB 1NO4A 5CCGD 3LW5H 5KLVG 2W6BA 4HYTB 2ZYDA 3NTNA 2KNCB 1PP9J 2DW3A 5AW9B 1SQVK 2WSFH 1GL2D 3HD7B 5GTHH 2P10A 1YQ3C 1JEKA 2ZXXA 1RF0C 4I7ZB 2Y9ZA 1Y9BA 3AE8C 3H1HE 1XTGB 4WY4C 2O01N 4GKGA 2IPPA 3JSVC 3T97B 1RF1A 4U7JA 1URQD 3H32B 3BRVB 1EDJA 4R4LA 1W5CE 4R4MA 1S3JA 1LTBC 4D6TJ 3TNUA 2W6AA 1PP9E 2KZJA 3H1HG 3H1IJ 2J5UA 3MHVA 2FXMA 1NTKJ 5AW1B 1NVOA 3IFMA 2G8YA 2YKQA 1VQOP 2AEJA 5APQA 2FYNB 3RK3C 1SQQK 4Z1MH 2POHA 4U3FD 1PP9G 1VF5B 1YIJP 1S1CX 1NHLA 3A0HE 2AXCA 2KS1B 2OYHB 1IFDA 1N8RQ 1SQXK 1NJIQ 3JC22 3OW2O 2ITAA 4C7NA 4ASVA 1OVRA 4YXWH 5E79E 4PV1B 3H1IE 1R8EA 2H8PD 3I56P 4DT0A 3BRTB 1CI6B 3MTUE 2WWWA 3MUDC 5APWA 1AV1A 4OH8B 3AEGC 1JMMA 1WRGA 2OYIB 2BEZF 2JWAA 1MKMA 2D2CD 2KXPB 4Y28J 3U1CA 2WSCH 5APVA 1M57D 2Y0DA 1FOSE 3CX5D 1SQVD 2R3SA 3VMYA 2M5AB 3H1IG 3L72D 2B87B 5CJ0A 3CCUP 1RQVA 1L0NJ 4IL6E 3GMAA 4NPDA 2QG4A 1S9KD 3HE5A 2WSEH 4H44B 1S5LE 1DEEG 4BRYB 3CCLP 2YKPA 1LTIC 3OJAB 3BVHA 2JP3A 3CCVP 2BEQD 3M06A 3Q2YA 1NKZB 2O01J 1L4AA 3M0DA 2Q1KA 2QE7H 2IFMA 1LT9A 3A0BH 4PD4D 3I55P 3JCUH 2A45H 2WT7A 2IBZI 1XTCC 2C0XA 3HE4A 1IJDB 2CK3H 2GUVA 1P84D 3RK2B 3UIAA 3AECC 1ZXGA 3CI9A 1KZUB 1JTHA 2J59M 3CXHH 5KLVD 1SFCC 3WMM0 4PJ0E 3CCJP 1Q81Q 2E74B 2HPCB 1SQBJ 2PP6A 1NTKK 4ZKUA 1FE6A 2M3BA 2NPSA 2IBZE 3N7NA 1RY3A 3PJSK 4DZOA 1L0NG 3RBZA 5AVVB 1USEA 4LC1A 1HF9A 3AE7C 1OX3A 3D70A 2HODB 1MUUA 5KAFE 5TJHA 2N9BA 1L0LJ 5AW8B 2H7HA 5AW0B 2P7JA 2YMKA 5APUA 1LWUC 3F5HA 5B5EE 1LTJC 4PV1D 3G71P 2IBZG 2FFDB 1U57A 1DH3A 1QVGO 2W27A 1KB9I 1SQBE 2IFNA 3L75D 1RQUA 2VRSA 4UB8H 4H13B 4OGQC 4Y99C 2E5TA 4TT3H 1DD3A 2IZ1A 3B5NA 1GD2E 1K05A 1PP9D 1BE3J 2FYUK 1FZEA 3PHLA 1SQBG 1LTSC 1TU3F 1FZFA 1N7SB 1X8YA 2Q6QA 1SFCD 3O8ZA 1S2EA 1LTTC 5C39A 1KORA 1GMJA 5AVRB 4OWFA 1HH0A 1KYOI 2QRXA 2ZYGA 1K9MQ 3HTKA 1VQPP 1YHQP 2H43A 2K37A 1T6AA 4GODA 3L73J 5KLIB 3NFQA 1L0LG 3TF5A 3CCRP 1M8OB 2QJYB 2I1KA 1FZAA 1NYHA 1EXIA 3RK2D 1Q90D 1W2BO 4D6TD 1AJYA 5GTIE 2FY8A 1RF1C 2R44A 2QSIA 1N73A 3H1ID 1ZRTE 1EZVI 2KS1A 2A06E 5KAIE 1FZCB 4UB6E 1NTKD 2YXQB 3CCQP 2JKVA 3HRNA 3L36A 3L70J 5TISE 2Z5IA 1GL2B 2FYZA 4MN4C 1VQ4P 1NU1K 2Y0CA 3AE1C 3V5BA 2AXTH 3BCCJ 5B66H 3L73E 3CCSP 1LP1A 2A06G 1DEBA 2IX7C 2WSFJ 1USDA 3FGAD 4NPEA 1EQ7A 3RL0g 1E79H 2WVRA 2WMMA 4GDOA 2QJPB 1J1DB 4YPCA 1SQVE 1PGPA 2WQYC 3AE9C 1OW8A 3L73G 4JQ0D 1S9KE 4AQRD 1SQQJ 3AEFC 3G4SP 4DCKA 2KZIA 3BCCE 4K35A 1PL5A 4A7PA 2QIWA 3U59A 1NTZK 1SQVG 4NPFX 1M1KQ 1L0ND 2LKMA 3G6EP 3AE6C 3RK3E 1SQXJ 3V2PA 3L70G 2OYOA 3WU2H 1QL1A 1P84E 2YNYA 2JR8A 1H0TA 1N7SD 2R32A 2MJZA 4EDFA 3BCCG 2IBZD 3TGUJ 3GHGA 2W90A 1SQQE 1KQFB 3AE5C 1L4AC 1KILA 2WPQA 3H1LJ 3O6QB 4HH2A 1LT9C 4WY4B 3TYYA 4OVNF 1FDOA 1SQXE 1KD1Q 2AEFA 1M1JA 5CCHD 3AE2C 2ZVNB 1J1EC 1NTMJ 1SQQG 2WSCJ 1SQBD 2BASA 2N1TA 3A3YB 3CMEP 3BASA 1QX8A 1IZNB 2K9JB 5CBOA 1KQLA 2KLUA 3A5TA 1WMKA 2E76C 3TGUE 1SQXG 2E75D 1AA0A 2OARA 2WPVB 1N86A 1OMIA 5AW3B 3H1LE 3L75E 2NPSC 1L0LD 4EYYQ 5AW7B 1YJ9P 2YO3A 3FXEA 3EQ2A 1JY3O 2OGUA 1HTLC 3TGUG 2Z4EA 2QM8A 2FKWB 2NRGA 4JBZA 3KZIE 1DD4A 2A45I 5BVZA 1GW3A 3SSUA 2Q5UA 4WVZA 2ZT9C 5H2FE 2K9YA 1X9VA 5EFWB 2R5DA 2O1KA 5CBNA 3H1LG 3L75G 3V4WA 3HUSB 3VOPA 1GU5A 1G2CA 1JCDA 5AVTB 2M8RA 2G3AA 1T2KC 5AVXB 1X0TA 3H1JJ 1PPJD 4N3YB 3CD6P 1QL2A 1BE3D 3MP7B 2WITA 1ZRTD 1JCCA 2C0WA 4YTPC 2A06D 2KSJA 1A02F 1OWAA 4HKZH 1FBMA 3B5NC 1Q82Q 2RKLA 3AEDC 1G1IA 5CCGA 3A0BE 1ZP0C 1SP4A 4D6TE 1N2DC 1JY3N 2QM7A 1BCCJ 1VQMP 2WTYA 1NH4A 1VPCA 2R3CA 3S9OA 1NTKE 3L73D 4L75A 3KQGA 5AW5B 1RE3A 2KP8A 3H1JE 1BSHA 3RGUA 4WBAA 2J58A 4WY4D 1OZHA 4D6TG 2I8DA 1VQ7P 2FYUJ 2NPSD 2YO2A 3FWLA 1URQA 3CCMP 3L70D 1NTKG 2OQQA 3GLMA 1HWTC 2HLOA 1N73C 3G3ZA 2L5GB 5APYA 1NTMK 1UIXA 2OYHC 1ZOYC 1BCCE 3H1JG 1SFCB 2E42A 2UWJE 3B8EB 3BCCD 4W7ZA 2ZT9D 1M7LA 1BGYJ 3F89A 4DOJA 2L91A 3CWBJ 3IF4A 1WT6A 1T2KD 3VP8A 3RK3D 2P2UA 4JPZB 1JY3P 4JF7A 2QJKC 1LT1A 2FYUE 2XU6A 1H88A 1BCCG 1ZLLA 1X79B 3VTPC 3V4QA 3MD0A 3VMXA 1SS1A 4L76A 5E79H 2FXOA 1L0NE 3RL0C 1SQQD 1LWUB 2WPRA 1NU1J 1LTJB 1CZQA 3SWYA 2FYUG 2PRRA 5KJ7A 4KHXA 1LTGC 3C9IA 4OGQB 1SQXD 2XKMA 4Y99B 3Q5RA 1JMBA 4IL6H 1HUCA 2ZFCA 4EI2A 1YJWP 1NAYA 2W83C 3V2NA 1S5LH 5CJ4A 1YBKA 3PP5A 5L8RJ 1FC2C 3PRJA 1MZ9A 1AVYA 1Y47A 3TK1A 1SQPK 2JEEA 5AVZB 4GOEA 3TGUD 2KNCA 3S1KA 3WUUA 3QWOC 1NU1E 1JB0J 3Q5SA 3H1LD 3HD7A 1S4XA 3PTZA 2CPSA 3GHGC 4GIFA 1NTZJ 1L2PA 2IYPA 4LGDE 1Q86Q 1KILC 2FBWC 2P67A 3AE4C 4JYCA 1JM0A 3T97A 5APXA 2V7QJ 2KUBA 1RF1B 1NU1G 3H32A 3KYQA 1L0LE 2PAJA 4PJ0H 2N9YB 4BWNA 1M1JC 1JY2O 1RHZB 2AEMA 5B66E 2NZ2A 3A2AA 3TNUB 4KJMA 2N1TC 3FX0A 1KB9E 4I2LC 3QH9A 2P1JA 3IAOA 3ABVC 3HUSA 1HGVA 1NTZE 4B86A 1VQLP 5KAFH 1GZLA 5CHXA 1PPJE 1QEXA 1BE3E 3KDPB 3AEBC 5B5EH 2OYHA 1VQNP 1HJBA 1NGMB 3TSIA 5AVWB 1JY2N 1PGQA 1NTZG 3SFEC 3M9QA 1ZW0A 4C7NB 3H1JD 1KN7A 2KIKA 2Z5HA 4YXDC 1KYOE 1VQ5P 3LW5J 1PPJG 3W68A 1GK4A 1AQTA 3V2QA 1BE3G 1VQ6P 2E75B 3WU2E 1CI6A 5KKZC 4N6JA 4OGQD 2FXPA 1ZR4A 3E7KA 2OYIA 1T8ZA 1KILD 2CPBA 3VP9A 2XZRA 2QA4P 1BCCD 3FXDA 5KLIC 1EZVE 2IYOA 2IZ0A 3P8CD 2O3JA 2M5AA 3H1KJ 4ASWA 2B87A 1HBWA 3H25A 5CCGC 2MKVA 3L70E 1FZBA 2PFXA 3BATA 3HE5B 4ZMDA 4BRYA 4I6MC 1GU4A 1FJPA 2Q9IA 2FYUD 1GDTA 1R5SA 1L4AB 1EZVG 1RE3C 1JO5A 2ZVOB 3CMAP 1YJNP 3M91A 1LT9B 5GTIH 1JY2P 3GF3A 2WT7B 5GTHE 3WUVA 3HE4B 1G1JA 3MZWB 1VQKP 4UB6H 2KB7P 3M9BA 1IFJA 2B89A 5BU8B 1MFTA 1U7JA 1EDLA 1J1EB 4RO0A 1W2EA 1URQC 3H1KE 1BGYD 5AVYB 1JTHB 3M0AA 3NMDA 1EDKA 4H0LC 1OIPA 3CWBD 2QVAA 3SWFA 3SWKA 1H8AA 1MV8A 3D71A 1RH5B 3K5BA 2HPCA 1DIPA 1Y8AA 2W6JH 3H1KG 2NPSB 1HJ0A 3CX5H 5APSA 3H1HJ 1K04A 3Q3DA 4XA4A 1K73Q 3OA7A 4I1LA 1NU1D 3TDKA 2HODA 1IK7A 3N4XA 3CC7P 4AYCA 5DJUB 4C46A 4EOTA 1CW5A 1EDIA 4XFJA 2ZT9B 1VQ9P 4RJTA 4IFFA 1K8AQ 1YQ4C 2JDIH 2FFDA 2YIUC 1ZN5A 2H89C 3RK3B 1BDDA 2WSEJ 2K88A 4PD4H 5KJ7C 3L37A 3E1RA 3R4YA 1GTWA 1P84H 4N78E 2D2CC 1QVFO 4RESB 1LGHB 1KV4A 3B5NB 4AUWA 3IR9A 1NTME 4L73A 2R5BA 1KB9D 3CC4P 1FOSF 2SPZA 1Z56A 1N7SA 4H0LD 1NTZD 1R5LA 3VMZA 3CXHI 3HD7C 1L4AD 3C8VA 1NOHA 3L71J 3HTKB 1NTMG 4I7ZC 3I5CA 5KLVK 5AW2B 4L74A 1ZMEC 3A7OA 1EC5A 1YTZT 1YI2P 4K3AA 1SQPJ 3JCUE 5CCHA 1KYOD 1J2JB 2KYVA 3MIWA 1N73B 3RBXA 3AEEC 5CMZA 2KK7A 4TLFA 1FZCA 3B71A 4JYBA 2YKOA 5DJTB 1GL2A 3CL3D 1PFIA 1T3JA 2E76D 1FDMA 3CXHE 1Q2NA 3L4FA 4C7RA 3FWNA 1A02J 3L71E 2K3RA 3HUSC 3D6YA 1EZVD 2WSSH 5KJ7D 2A45G 2QJKB 5BU5A 2FYNC 3L74J 3USSA 1LP1B 4WWIA 3KZIH 2JWDA 1IFPA 4O9BA 4ZKPA 5AVQB 1RE4C 1VDFA 1VF5C 1KILE 1SQPE 5H2FH 4CPGA 2M0BA 1KFNA 3RL0B 1X22A 2C9LY 3EWKA 3P8CE 3L71G 1FS0E 2WPSA 3ZDMA 1LNQA 5K5GB 2BCCJ 1U7MA 2HG5D 2E43A 1N7LA 1IK9A 1AFOA 1BDCA 4PV1C 2LXBA 1FDIA 1IFIA 3A0HH 3HD7D 1PZQA 1KQGB 1SQPG 3KXDA 3GW6A 3ITKA 2HFED 1KTMA 2OYIC 3H1KD 2XNXA 2XDJA 4IFMA 3L74E 5KTBA 3B5ND 4BXLA 4UB8E 3Q5PA 4W80A 2KSEA 4DJGA 1H89A 1H0TB 1IC2A 1YITP 4IL6X 1BGYE 2ZXEB 3R2PA 2LXCB 2BCCE 5AVSB 4H44C 1NAFA 3P32A 2RH0A 1S5LX 3CWBE 3P8MC 3L74G 3CPWO 1JUNA 4WB4A 3GHGB 1RF0A 1JNMA 3LIEA 1QGKB 1KMIZ 2B88A 3II6A 2JO1A 1NWQA 4KT0J 2V4HA 4GOFA 1KILB 1GW4A 3O6QA 4WY4A 3P7KA 2E5YA 2RMZA 1BGYG 2Y0EA 1AQ5A 2BCCG 1M90Q 3RK2C 1VF5D 1MFZA 2ZJSE 1M1JB 3CWBG 1PGOA 2RN0A 3LIDA 2N1TB 2K9JA 2ZAEB 3AE3C 2I1JA 2Y9YA 2E74C 4N78D 3H1HD 2KI7B 2M3EA 3L35A 3SFDC 3CCEP 3VN0A 2K1AA 1FAVA 3KHUA 1PV3A 1NTMD 2XV5A 3C1LA 4EIJA 2AXTE 1LJ2A 1JOCA 3PLNA 4HB1A 3RL0D 1YTZI 2W8ZA 1SLQA 1OVVA 2XNDH 2O01H 3CC2P 2P58A 4U3FJ 3MGNA 1KFMA 2KOGA 1L0NK 3EFGA 4H44D 2FFDC 2Q3EA 5KKZB 3MUDA 1G2CB 3GF7A 4M3LA 2C9NY 1DX7A 4H13C 1OFCX 4QMAA 1RE4A 2OTLP 2B9BA 1BSNA 1SVFA 1S72P 3VMAA 3VYIA 3NXSA 2Q7CA 3CXHD 1PGJA 4XE5B 3E1IA 4IOIH 4LLHA 4U3FE 3CX5I 1SQVJ 3L71D 1N7SC 1KC8Q 3L72J 1UIIA 4HJGH 1GK6A 2IDBA 1IFMA 1ZR2A 2E74D 3IN6A 3V2RA 1HVVA 1SQPD 1E5WA 1KQSO 3S4RA 1SQBK 1D7MA 1Q7YQ 3V6IA 4U3FG 2GM4A 1QLED 3AEAC 1OVUA 2QJYC 3KPEA 1URQB 1EXJA 1KB9H 3M9HA 4PD4I 1FJKA 5CCHC 1OXZA 4H0LB 1LTAC 2PGDA 2OTJP 3CX5E 1IO4A 2N1TD 1SFCA 1FZCC
chains in the Genus database with same CATH topology
4BRYB 3WUUA 3WUVA 2WVRA 2ZXXA 3F5HA 3WUTA 3E1RA 2Q6QA 4BRYA 1UIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BRY B;  3WUU A;  3WUV A;  2WVR A;  2ZXX A;  3F5H A;  3WUT A;  3E1R A;  2Q6Q A;  4BRY A;  1UII A; 
#chains in the Genus database with same CATH topology
 1P84 I;  3CLQ A;  4RKU J;  3G9R A;  1L0L K;  3OAK A;  3L72 E;  1GL2 C;  5M1B A;  4ZNC A;  1AVO A;  3EFF K;  3L74 D;  5KLV J;  2HYN A;  4GT1 A;  2JJL A;  1OW7 A;  3H6P A;  2QEX P;  1VQ8 P;  2V7Q H;  2GA1 A;  1PIX A;  2E75 C;  4H13 D;  5KAI H;  1IFN A;  1FU1 A;  2WZ7 A;  5APT A;  5TIS H;  2KLV A;  3B4S A;  3L72 G;  2BCC D;  4PD4 E;  2O1J A;  1KYO H;  1OW6 A;  5AW4 B;  1LWU A;  2QJP C;  1J1D C;  1HGZ A;  1VL2 A;  1YYC A;  2YXR B;  1LTJ A;  2E76 B;  1ZV8 A;  3D6Z A;  2YIU B;  3PH0 A;  5KLV E;  1CSB A;  2OTK E;  3Q1M A;  2Q3I A;  3U1A A;  1M56 D;  2HR3 A;  4IFD K;  3GG2 A;  2LR2 A;  3WUT A;  2D2C B;  3M0D C;  3L75 J;  1FZG A;  2GUS A;  3W67 A;  5AW6 B;  2YMY A;  2ZYA A;  1T3U A;  2H88 C;  1NKN A;  4W7Y A;  5AVU B;  1NO4 A;  5CCG D;  3LW5 H;  5KLV G;  2W6B A;  4HYT B;  2ZYD A;  3NTN A;  2KNC B;  1PP9 J;  2DW3 A;  5AW9 B;  1SQV K;  2WSF H;  1GL2 D;  3HD7 B;  5GTH H;  2P10 A;  1YQ3 C;  1JEK A;  2ZXX A;  1RF0 C;  4I7Z B;  2Y9Z A;  1Y9B A;  3AE8 C;  3H1H E;  1XTG B;  4WY4 C;  2O01 N;  4GKG A;  2IPP A;  3JSV C;  3T97 B;  1RF1 A;  4U7J A;  1URQ D;  3H32 B;  3BRV B;  1EDJ A;  4R4L A;  1W5C E;  4R4M A;  1S3J A;  1LTB C;  4D6T J;  3TNU A;  2W6A A;  1PP9 E;  2KZJ A;  3H1H G;  3H1I J;  2J5U A;  3MHV A;  2FXM A;  1NTK J;  5AW1 B;  1NVO A;  3IFM A;  2G8Y A;  2YKQ A;  1VQO P;  2AEJ A;  5APQ A;  2FYN B;  3RK3 C;  1SQQ K;  4Z1M H;  2POH A;  4U3F D;  1PP9 G;  1VF5 B;  1YIJ P;  1S1C X;  1NHL A;  3A0H E;  2AXC A;  2KS1 B;  2OYH B;  1IFD A;  1N8R Q;  1SQX K;  1NJI Q;  3JC2 2;  3OW2 O;  2ITA A;  4C7N A;  4ASV A;  1OVR A;  4YXW H;  5E79 E;  4PV1 B;  3H1I E;  1R8E A;  2H8P D;  3I56 P;  4DT0 A;  3BRT B;  1CI6 B;  3MTU E;  2WWW A;  3MUD C;  5APW A;  1AV1 A;  4OH8 B;  3AEG C;  1JMM A;  1WRG A;  2OYI B;  2BEZ F;  2JWA A;  1MKM A;  2D2C D;  2KXP B;  4Y28 J;  3U1C A;  2WSC H;  5APV A;  1M57 D;  2Y0D A;  1FOS E;  3CX5 D;  1SQV D;  2R3S A;  3VMY A;  2M5A B;  3H1I G;  3L72 D;  2B87 B;  5CJ0 A;  3CCU P;  1RQV A;  1L0N J;  4IL6 E;  3GMA A;  4NPD A;  2QG4 A;  1S9K D;  3HE5 A;  2WSE H;  4H44 B;  1S5L E;  1DEE G;  4BRY B;  3CCL P;  2YKP A;  1LTI C;  3OJA B;  3BVH A;  2JP3 A;  3CCV P;  2BEQ D;  3M06 A;  3Q2Y A;  1NKZ B;  2O01 J;  1L4A A;  3M0D A;  2Q1K A;  2QE7 H;  2IFM A;  1LT9 A;  3A0B H;  4PD4 D;  3I55 P;  3JCU H;  2A45 H;  2WT7 A;  2IBZ I;  1XTC C;  2C0X A;  3HE4 A;  1IJD B;  2CK3 H;  2GUV A;  1P84 D;  3RK2 B;  3UIA A;  3AEC C;  1ZXG A;  3CI9 A;  1KZU B;  1JTH A;  2J59 M;  3CXH H;  5KLV D;  1SFC C;  3WMM 0;  4PJ0 E;  3CCJ P;  1Q81 Q;  2E74 B;  2HPC B;  1SQB J;  2PP6 A;  1NTK K;  4ZKU A;  1FE6 A;  2M3B A;  2NPS A;  2IBZ E;  3N7N A;  1RY3 A;  3PJS K;  4DZO A;  1L0N G;  3RBZ A;  5AVV B;  1USE A;  4LC1 A;  1HF9 A;  3AE7 C;  1OX3 A;  3D70 A;  2HOD B;  1MUU A;  5KAF E;  5TJH A;  2N9B A;  1L0L J;  5AW8 B;  2H7H A;  5AW0 B;  2P7J A;  2YMK A;  5APU A;  1LWU C;  3F5H A;  5B5E E;  1LTJ C;  4PV1 D;  3G71 P;  2IBZ G;  2FFD B;  1U57 A;  1DH3 A;  1QVG O;  2W27 A;  1KB9 I;  1SQB E;  2IFN A;  3L75 D;  1RQU A;  2VRS A;  4UB8 H;  4H13 B;  4OGQ C;  4Y99 C;  2E5T A;  4TT3 H;  1DD3 A;  2IZ1 A;  3B5N A;  1GD2 E;  1K05 A;  1PP9 D;  1BE3 J;  2FYU K;  1FZE A;  3PHL A;  1SQB G;  1LTS C;  1TU3 F;  1FZF A;  1N7S B;  1X8Y A;  2Q6Q A;  1SFC D;  3O8Z A;  1S2E A;  1LTT C;  5C39 A;  1KOR A;  1GMJ A;  5AVR B;  4OWF A;  1HH0 A;  1KYO I;  2QRX A;  2ZYG A;  1K9M Q;  3HTK A;  1VQP P;  1YHQ P;  2H43 A;  2K37 A;  1T6A A;  4GOD A;  3L73 J;  5KLI B;  3NFQ A;  1L0L G;  3TF5 A;  3CCR P;  1M8O B;  2QJY B;  2I1K A;  1FZA A;  1NYH A;  1EXI A;  3RK2 D;  1Q90 D;  1W2B O;  4D6T D;  1AJY A;  5GTI E;  2FY8 A;  1RF1 C;  2R44 A;  2QSI A;  1N73 A;  3H1I D;  1ZRT E;  1EZV I;  2KS1 A;  2A06 E;  5KAI E;  1FZC B;  4UB6 E;  1NTK D;  2YXQ B;  3CCQ P;  2JKV A;  3HRN A;  3L36 A;  3L70 J;  5TIS E;  2Z5I A;  1GL2 B;  2FYZ A;  4MN4 C;  1VQ4 P;  1NU1 K;  2Y0C A;  3AE1 C;  3V5B A;  2AXT H;  3BCC J;  5B66 H;  3L73 E;  3CCS P;  1LP1 A;  2A06 G;  1DEB A;  2IX7 C;  2WSF J;  1USD A;  3FGA D;  4NPE A;  1EQ7 A;  3RL0 g;  1E79 H;  2WVR A;  2WMM A;  4GDO A;  2QJP B;  1J1D B;  4YPC A;  1SQV E;  1PGP A;  2WQY C;  3AE9 C;  1OW8 A;  3L73 G;  4JQ0 D;  1S9K E;  4AQR D;  1SQQ J;  3AEF C;  3G4S P;  4DCK A;  2KZI A;  3BCC E;  4K35 A;  1PL5 A;  4A7P A;  2QIW A;  3U59 A;  1NTZ K;  1SQV G;  4NPF X;  1M1K Q;  1L0N D;  2LKM A;  3G6E P;  3AE6 C;  3RK3 E;  1SQX J;  3V2P A;  3L70 G;  2OYO A;  3WU2 H;  1QL1 A;  1P84 E;  2YNY A;  2JR8 A;  1H0T A;  1N7S D;  2R32 A;  2MJZ A;  4EDF A;  3BCC G;  2IBZ D;  3TGU J;  3GHG A;  2W90 A;  1SQQ E;  1KQF B;  3AE5 C;  1L4A C;  1KIL A;  2WPQ A;  3H1L J;  3O6Q B;  4HH2 A;  1LT9 C;  4WY4 B;  3TYY A;  4OVN F;  1FDO A;  1SQX E;  1KD1 Q;  2AEF A;  1M1J A;  5CCH D;  3AE2 C;  2ZVN B;  1J1E C;  1NTM J;  1SQQ G;  2WSC J;  1SQB D;  2BAS A;  2N1T A;  3A3Y B;  3CME P;  3BAS A;  1QX8 A;  1IZN B;  2K9J B;  5CBO A;  1KQL A;  2KLU A;  3A5T A;  1WMK A;  2E76 C;  3TGU E;  1SQX G;  2E75 D;  1AA0 A;  2OAR A;  2WPV B;  1N86 A;  1OMI A;  5AW3 B;  3H1L E;  3L75 E;  2NPS C;  1L0L D;  4EYY Q;  5AW7 B;  1YJ9 P;  2YO3 A;  3FXE A;  3EQ2 A;  1JY3 O;  2OGU A;  1HTL C;  3TGU G;  2Z4E A;  2QM8 A;  2FKW B;  2NRG A;  4JBZ A;  3KZI E;  1DD4 A;  2A45 I;  5BVZ A;  1GW3 A;  3SSU A;  2Q5U A;  4WVZ A;  2ZT9 C;  5H2F E;  2K9Y A;  1X9V A;  5EFW B;  2R5D A;  2O1K A;  5CBN A;  3H1L G;  3L75 G;  3V4W A;  3HUS B;  3VOP A;  1GU5 A;  1G2C A;  1JCD A;  5AVT B;  2M8R A;  2G3A A;  1T2K C;  5AVX B;  1X0T A;  3H1J J;  1PPJ D;  4N3Y B;  3CD6 P;  1QL2 A;  1BE3 D;  3MP7 B;  2WIT A;  1ZRT D;  1JCC A;  2C0W A;  4YTP C;  2A06 D;  2KSJ A;  1A02 F;  1OWA A;  4HKZ H;  1FBM A;  3B5N C;  1Q82 Q;  2RKL A;  3AED C;  1G1I A;  5CCG A;  3A0B E;  1ZP0 C;  1SP4 A;  4D6T E;  1N2D C;  1JY3 N;  2QM7 A;  1BCC J;  1VQM P;  2WTY A;  1NH4 A;  1VPC A;  2R3C A;  3S9O A;  1NTK E;  3L73 D;  4L75 A;  3KQG A;  5AW5 B;  1RE3 A;  2KP8 A;  3H1J E;  1BSH A;  3RGU A;  4WBA A;  2J58 A;  4WY4 D;  1OZH A;  4D6T G;  2I8D A;  1VQ7 P;  2FYU J;  2NPS D;  2YO2 A;  3FWL A;  1URQ A;  3CCM P;  3L70 D;  1NTK G;  2OQQ A;  3GLM A;  1HWT C;  2HLO A;  1N73 C;  3G3Z A;  2L5G B;  5APY A;  1NTM K;  1UIX A;  2OYH C;  1ZOY C;  1BCC E;  3H1J G;  1SFC B;  2E42 A;  2UWJ E;  3B8E B;  3BCC D;  4W7Z A;  2ZT9 D;  1M7L A;  1BGY J;  3F89 A;  4DOJ A;  2L91 A;  3CWB J;  3IF4 A;  1WT6 A;  1T2K D;  3VP8 A;  3RK3 D;  2P2U A;  4JPZ B;  1JY3 P;  4JF7 A;  2QJK C;  1LT1 A;  2FYU E;  2XU6 A;  1H88 A;  1BCC G;  1ZLL A;  1X79 B;  3VTP C;  3V4Q A;  3MD0 A;  3VMX A;  1SS1 A;  4L76 A;  5E79 H;  2FXO A;  1L0N E;  3RL0 C;  1SQQ D;  1LWU B;  2WPR A;  1NU1 J;  1LTJ B;  1CZQ A;  3SWY A;  2FYU G;  2PRR A;  5KJ7 A;  4KHX A;  1LTG C;  3C9I A;  4OGQ B;  1SQX D;  2XKM A;  4Y99 B;  3Q5R A;  1JMB A;  4IL6 H;  1HUC A;  2ZFC A;  4EI2 A;  1YJW P;  1NAY A;  2W83 C;  3V2N A;  1S5L H;  5CJ4 A;  1YBK A;  3PP5 A;  5L8R J;  1FC2 C;  3PRJ A;  1MZ9 A;  1AVY A;  1Y47 A;  3TK1 A;  1SQP K;  2JEE A;  5AVZ B;  4GOE A;  3TGU D;  2KNC A;  3S1K A;  3WUU A;  3QWO C;  1NU1 E;  1JB0 J;  3Q5S A;  3H1L D;  3HD7 A;  1S4X A;  3PTZ A;  2CPS A;  3GHG C;  4GIF A;  1NTZ J;  1L2P A;  2IYP A;  4LGD E;  1Q86 Q;  1KIL C;  2FBW C;  2P67 A;  3AE4 C;  4JYC A;  1JM0 A;  3T97 A;  5APX A;  2V7Q J;  2KUB A;  1RF1 B;  1NU1 G;  3H32 A;  3KYQ A;  1L0L E;  2PAJ A;  4PJ0 H;  2N9Y B;  4BWN A;  1M1J C;  1JY2 O;  1RHZ B;  2AEM A;  5B66 E;  2NZ2 A;  3A2A A;  3TNU B;  4KJM A;  2N1T C;  3FX0 A;  1KB9 E;  4I2L C;  3QH9 A;  2P1J A;  3IAO A;  3ABV C;  3HUS A;  1HGV A;  1NTZ E;  4B86 A;  1VQL P;  5KAF H;  1GZL A;  5CHX A;  1PPJ E;  1QEX A;  1BE3 E;  3KDP B;  3AEB C;  5B5E H;  2OYH A;  1VQN P;  1HJB A;  1NGM B;  3TSI A;  5AVW B;  1JY2 N;  1PGQ A;  1NTZ G;  3SFE C;  3M9Q A;  1ZW0 A;  4C7N B;  3H1J D;  1KN7 A;  2KIK A;  2Z5H A;  4YXD C;  1KYO E;  1VQ5 P;  3LW5 J;  1PPJ G;  3W68 A;  1GK4 A;  1AQT A;  3V2Q A;  1BE3 G;  1VQ6 P;  2E75 B;  3WU2 E;  1CI6 A;  5KKZ C;  4N6J A;  4OGQ D;  2FXP A;  1ZR4 A;  3E7K A;  2OYI A;  1T8Z A;  1KIL D;  2CPB A;  3VP9 A;  2XZR A;  2QA4 P;  1BCC D;  3FXD A;  5KLI C;  1EZV E;  2IYO A;  2IZ0 A;  3P8C D;  2O3J A;  2M5A A;  3H1K J;  4ASW A;  2B87 A;  1HBW A;  3H25 A;  5CCG C;  2MKV A;  3L70 E;  1FZB A;  2PFX A;  3BAT A;  3HE5 B;  4ZMD A;  4BRY A;  4I6M C;  1GU4 A;  1FJP A;  2Q9I A;  2FYU D;  1GDT A;  1R5S A;  1L4A B;  1EZV G;  1RE3 C;  1JO5 A;  2ZVO B;  3CMA P;  1YJN P;  3M91 A;  1LT9 B;  5GTI H;  1JY2 P;  3GF3 A;  2WT7 B;  5GTH E;  3WUV A;  3HE4 B;  1G1J A;  3MZW B;  1VQK P;  4UB6 H;  2KB7 P;  3M9B A;  1IFJ A;  2B89 A;  5BU8 B;  1MFT A;  1U7J A;  1EDL A;  1J1E B;  4RO0 A;  1W2E A;  1URQ C;  3H1K E;  1BGY D;  5AVY B;  1JTH B;  3M0A A;  3NMD A;  1EDK A;  4H0L C;  1OIP A;  3CWB D;  2QVA A;  3SWF A;  3SWK A;  1H8A A;  1MV8 A;  3D71 A;  1RH5 B;  3K5B A;  2HPC A;  1DIP A;  1Y8A A;  2W6J H;  3H1K G;  2NPS B;  1HJ0 A;  3CX5 H;  5APS A;  3H1H J;  1K04 A;  3Q3D A;  4XA4 A;  1K73 Q;  3OA7 A;  4I1L A;  1NU1 D;  3TDK A;  2HOD A;  1IK7 A;  3N4X A;  3CC7 P;  4AYC A;  5DJU B;  4C46 A;  4EOT A;  1CW5 A;  1EDI A;  4XFJ A;  2ZT9 B;  1VQ9 P;  4RJT A;  4IFF A;  1K8A Q;  1YQ4 C;  2JDI H;  2FFD A;  2YIU C;  1ZN5 A;  2H89 C;  3RK3 B;  1BDD A;  2WSE J;  2K88 A;  4PD4 H;  5KJ7 C;  3L37 A;  3E1R A;  3R4Y A;  1GTW A;  1P84 H;  4N78 E;  2D2C C;  1QVF O;  4RES B;  1LGH B;  1KV4 A;  3B5N B;  4AUW A;  3IR9 A;  1NTM E;  4L73 A;  2R5B A;  1KB9 D;  3CC4 P;  1FOS F;  2SPZ A;  1Z56 A;  1N7S A;  4H0L D;  1NTZ D;  1R5L A;  3VMZ A;  3CXH I;  3HD7 C;  1L4A D;  3C8V A;  1NOH A;  3L71 J;  3HTK B;  1NTM G;  4I7Z C;  3I5C A;  5KLV K;  5AW2 B;  4L74 A;  1ZME C;  3A7O A;  1EC5 A;  1YTZ T;  1YI2 P;  4K3A A;  1SQP J;  3JCU E;  5CCH A;  1KYO D;  1J2J B;  2KYV A;  3MIW A;  1N73 B;  3RBX A;  3AEE C;  5CMZ A;  2KK7 A;  4TLF A;  1FZC A;  3B71 A;  4JYB A;  2YKO A;  5DJT B;  1GL2 A;  3CL3 D;  1PFI A;  1T3J A;  2E76 D;  1FDM A;  3CXH E;  1Q2N A;  3L4F A;  4C7R A;  3FWN A;  1A02 J;  3L71 E;  2K3R A;  3HUS C;  3D6Y A;  1EZV D;  2WSS H;  5KJ7 D;  2A45 G;  2QJK B;  5BU5 A;  2FYN C;  3L74 J;  3USS A;  1LP1 B;  4WWI A;  3KZI H;  2JWD A;  1IFP A;  4O9B A;  4ZKP A;  5AVQ B;  1RE4 C;  1VDF A;  1VF5 C;  1KIL E;  1SQP E;  5H2F H;  4CPG A;  2M0B A;  1KFN A;  3RL0 B;  1X22 A;  2C9L Y;  3EWK A;  3P8C E;  3L71 G;  1FS0 E;  2WPS A;  3ZDM A;  1LNQ A;  5K5G B;  2BCC J;  1U7M A;  2HG5 D;  2E43 A;  1N7L A;  1IK9 A;  1AFO A;  1BDC A;  4PV1 C;  2LXB A;  1FDI A;  1IFI A;  3A0H H;  3HD7 D;  1PZQ A;  1KQG B;  1SQP G;  3KXD A;  3GW6 A;  3ITK A;  2HFE D;  1KTM A;  2OYI C;  3H1K D;  2XNX A;  2XDJ A;  4IFM A;  3L74 E;  5KTB A;  3B5N D;  4BXL A;  4UB8 E;  3Q5P A;  4W80 A;  2KSE A;  4DJG A;  1H89 A;  1H0T B;  1IC2 A;  1YIT P;  4IL6 X;  1BGY E;  2ZXE B;  3R2P A;  2LXC B;  2BCC E;  5AVS B;  4H44 C;  1NAF A;  3P32 A;  2RH0 A;  1S5L X;  3CWB E;  3P8M C;  3L74 G;  3CPW O;  1JUN A;  4WB4 A;  3GHG B;  1RF0 A;  1JNM A;  3LIE A;  1QGK B;  1KMI Z;  2B88 A;  3II6 A;  2JO1 A;  1NWQ A;  4KT0 J;  2V4H A;  4GOF A;  1KIL B;  1GW4 A;  3O6Q A;  4WY4 A;  3P7K A;  2E5Y A;  2RMZ A;  1BGY G;  2Y0E A;  1AQ5 A;  2BCC G;  1M90 Q;  3RK2 C;  1VF5 D;  1MFZ A;  2ZJS E;  1M1J B;  3CWB G;  1PGO A;  2RN0 A;  3LID A;  2N1T B;  2K9J A;  2ZAE B;  3AE3 C;  2I1J A;  2Y9Y A;  2E74 C;  4N78 D;  3H1H D;  2KI7 B;  2M3E A;  3L35 A;  3SFD C;  3CCE P;  3VN0 A;  2K1A A;  1FAV A;  3KHU A;  1PV3 A;  1NTM D;  2XV5 A;  3C1L A;  4EIJ A;  2AXT E;  1LJ2 A;  1JOC A;  3PLN A;  4HB1 A;  3RL0 D;  1YTZ I;  2W8Z A;  1SLQ A;  1OVV A;  2XND H;  2O01 H;  3CC2 P;  2P58 A;  4U3F J;  3MGN A;  1KFM A;  2KOG A;  1L0N K;  3EFG A;  4H44 D;  2FFD C;  2Q3E A;  5KKZ B;  3MUD A;  1G2C B;  3GF7 A;  4M3L A;  2C9N Y;  1DX7 A;  4H13 C;  1OFC X;  4QMA A;  1RE4 A;  2OTL P;  2B9B A;  1BSN A;  1SVF A;  1S72 P;  3VMA A;  3VYI A;  3NXS A;  2Q7C A;  3CXH D;  1PGJ A;  4XE5 B;  3E1I A;  4IOI H;  4LLH A;  4U3F E;  3CX5 I;  1SQV J;  3L71 D;  1N7S C;  1KC8 Q;  3L72 J;  1UII A;  4HJG H;  1GK6 A;  2IDB A;  1IFM A;  1ZR2 A;  2E74 D;  3IN6 A;  3V2R A;  1HVV A;  1SQP D;  1E5W A;  1KQS O;  3S4R A;  1SQB K;  1D7M A;  1Q7Y Q;  3V6I A;  4U3F G;  2GM4 A;  1QLE D;  3AEA C;  1OVU A;  2QJY C;  3KPE A;  1URQ B;  1EXJ A;  1KB9 H;  3M9H A;  4PD4 I;  1FJK A;  5CCH C;  1OXZ A;  4H0L B;  1LTA C;  2PGD A;  2OTJ P;  3CX5 E;  1IO4 A;  2N1T D;  1SFC A;  1FZC C; 
#chains in the Genus database with same CATH homology
 4BRY B;  3WUU A;  3WUV A;  2WVR A;  2ZXX A;  3F5H A;  3WUT A;  3E1R A;  2Q6Q A;  4BRY A;  1UII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...