4BRYA

The idas:geminin heterodimeric parallel coiled-coil
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
69
structure length
69
Chain Sequence
ENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GEMININ
publication title The Geminin and Idas Coiled Coils Preferentially Form a Heterodimer that Inhibits Geminin Function in DNA Replication Licensing
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 31
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2013-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 4bryA00
4BRYA 3F5HA 3WUUA 2WVRA 4BRYB 3WUVA 3E1RA 2Q6QA 3WUTA 2ZXXA 1UIIA
chains in the Genus database with same CATH superfamily
2O01H 2A06E 2HPCA 3JCUE 3VP9A 2QA4P 3RK3B 2XV5A 1N73C 5KAFE 3VMZA 3A0BH 5CJ4A 2W83C 1KN7A 2AEFA 1PL5A 3Q5RA 2RN0A 2OARA 1L0LE 5KAIE 1A02J 4JYBA 2LKMA 3KHUA 1MV8A 5KLVG 1NU1K 1HWTC 5M1BA 1LTJB 2N1TB 3R4YA 1FBMA 2M5AA 1OVUA 2H88C 3BATA 2C9LY 2M3EA 3RK2B 3FWLA 4ZNCA 3P8CD 2BCCG 2HR3A 3HE5B 3TYYA 3RL0C 5AVWB 5APQA 3CC7P 1ZV8A 3H1LJ 3M0AA 4D6TE 1GU4A 2Q3IA 1M7LA 5KLVK 3TGUJ 3AE1C 3MIWA 4O9BA 2Y0CA 1S5LE 2ZYGA 1NU1J 2KB7P 1P84E 1IFJA 2YMKA 5KLIC 2W27A 1AVOA 1N73B 3T97A 4M3LA 3B5ND 3CCVP 3H1HG 4D6TG 2KS1B 1SQBE 2NPSD 4PJ0E 1SQQE 1KV4A 1IZNB 2AEMA 2IBZD 5KLVJ 2FXMA 3L74G 4PD4H 2QEXP 1Q7YQ 1N7SC 1OFCX 5AW2B 1LJ2A 3CX5I 1JY2N 1SQBG 2ZVOB 3MD0A 1NYHA 1PZQA 2BCCJ 1XTCC 3KDPB 3KZIH 1T6AA 1BGYD 3U1CA 5AVUB 3NTNA 2K9YA 2QJPC 1S72P 3D6YA 3HUSB 1AJYA 1SQBK 4UB8H 2WPRA 1FAVA 3IN6A 2O3JA 2WSCH 3TNUA 5KLIB 3H1HJ 5GTHH 4D6TJ 1PV3A 4L73A 2YO2A 3G9RA 4C46A 2P7JA 1XTGB 1YTZT 1IJDB 1S4XA 2FYUD 3MP7B 3L74J 4U7JA 2E75D 1JMBA 1W2EA 4BRYB 1X79B 1IFPA 2Y0EA 3H6PA 1N7LA 1N7SB 1PGJA 1FOSF 2N9BA 1AA0A 1L4AD 3FXDA 5AVXB 2FKWB 1SQBJ 5KJ7D 1OVRA 1L0NG 2YXQB 4H0LB 1PPJD 4EOTA 1KQSO 4BWNA 3G4SP 2AXCA 4IFFA 3B5NC 2D2CD 1FE6A 1JCDA 1JB0J 2NPSC 1JY3N 4PV1D 1Y8AA 4ASWA 3P32A 3PLNA 1L0NK 1GL2C 1NAFA 2H8PD 5APXA 2QG4A 3L72E 2V4HA 2K9JA 3S1KA 1KTMA 2OYIB 2FFDB 1J1DC 1SQXG 4U3FJ 4IL6H 1OW8A 3FWNA 1HVVA 1PP9G 3PHLA 1AFOA 1J2JB 3KXDA 2O01J 3GF7A 3H1LD 4TLFA 5C39A 2R5BA 4LC1A 2OYOA 4NPEA 2R3CA 1ZN5A 1DD3A 1L2PA 5AW7B 1PGOA 2Z4EA 2YNYA 1J1EC 1D7MA 3E7KA 1L0NJ 1VF5D 3AE7C 3C1LA 1EXIA 1SQXK 1MZ9A 2AXTH 2HODA 3CXHH 3P7KA 2ZXEB 3S9OA 1IO4A 1RE4C 3P8CE 1NGMB 3AEGC 1E79H 1KZUB 1QEXA 2NPSB 3SWYA 1X9VA 3AEAC 3V2RA 4UB8E 5TISH 1M1KQ 4AQRD 2QIWA 2E75C 3VMXA 1VQ7P 3SFDC 3FXEA 3AE3C 1GL2B 2C0WA 1M1JA 5GTHE 1L4AC 1ZR4A 2HFED 4H44D 2B88A 5KJ7C 1LTBC 2GA1A 1SQXJ 5E79E 1PP9J 2BCCD 1RY3A 4L76A 2H89C 5AVZB 1KFMA 4WY4D 1M90Q 4PV1C 3RK3D 1LP1B 1JNMA 1J1EB 1PFIA 4I7ZB 1S5LX 2KIKA 3LIDA 5CCHA 3H1HD 1VQ6P 5APYA 3A0HH 3SFEC 1OW6A 1YJNP 3ZDMA 2I1JA 1MFTA 2IBZG 1R5LA 1BE3G 2N1TD 2E5YA 2R5DA 3L74D 3V2QA 2WITA 2E75B 5APVA 4DT0A 3MZWB 3RK2D 1AQ5A 1BCCJ 3IFMA 1HJBA 1VF5C 4IL6E 2ZT9B 2HLOA 2HG5D 4ASVA 1BGYG 5AVRB 3H1IJ 1ZLLA 1ZRTE 2G3AA 1KYOD 1G2CB 1NKNA 4YPCA 2FYUE 2M8RA 2KSEA 3IR9A 3O8ZA 2Y0DA 1NWQA 3EFGA 1LTJA 1FZBA 1RF0C 2OTJP 3BRTB 1PPJE 2KZJA 3ITKA 4H44C 5KTBA 1QL2A 4U3FD 2FYUG 5CCGA 2M0BA 3A5TA 3R2PA 1BE3J 5AVTB 2QSIA 3LIEA 4GODA 5TISE 1TU3F 2KLVA 1NOHA 1OMIA 2E43A 1KYOI 4WY4C 1HGVA 1PPJG 2FYZA 1L0ND 3RK3C 3VMYA 3PJSK 3QWOC 1LGHB 1IFIA 1BGYJ 3CCSP 2PFXA 1N8RQ 4NPFX 4GIFA 2JKVA 5GTIE 1N73A 3UIAA 1SFCB 2WTYA 1YQ4C 2WQYC 4NPDA 3H1LE 1PGQA 1S9KD 1K73Q 2N1TC 1LWUC 1FU1A 3WUVA 1K8AQ 1KB9D 5TJHA 4C7NA 1NU1E 3HD7D 3A0HE 5B5EE 1KQFB 2IYOA 1JY3P 1SQXD 1HTLC 3VOPA 1RF1B 3M06A 4EIJA 3H1LG 1UIIA 2GUVA 1DH3A 1RH5B 3I55P 4H0LD 1K05A 1IC2A 2KI7B 5KLVE 4TT3H 4WY4B 3MTUE 5CHXA 3HUSA 1RQVA 1FZAA 1DEBA 1AVYA 1ZOYC 2P1JA 1URQD 4PD4D 1JCCA 1MKMA 2JP3A 1YBKA 2BCCE 1GTWA 2JEEA 2P2UA 3AEBC 1FOSE 2WSFJ 3CL3D 2JJLA 4A7PA 1LWUB 2B87B 5AW5B 3GHGC 1N7SA 3RK3E 2XKMA 1GU5A 1BCCD 2YKQA 2PRRA 2AEJA 3L71D 4LLHA 1PGPA 1VQOP 3AE6C 3LW5J 4JYCA 2KNCA 1KB9H 1G1IA 2I8DA 3H1KD 3CCLP 4LGDE 3H1HE 3B8EB 4XA4A 3H1ID 1N86A 3KYQA 2E76B 5EFWB 2CK3H 4YTPC 2KOGA 3B71A 3HUSC 3L74E 2Q1KA 1HUCA 3B4SA 4ZKUA 3VYIA 1VQ5P 5H2FE 3RGUA 1T8ZA 3BASA 3HD7C 3NMDA 3Q5PA 2OYIA 5B66H 2CPSA 1JO5A 1KYOE 1BE3D 1GL2D 3C9IA 1CW5A 5KKZC 1OVVA 3MUDA 2W6JH 1Y9BA 1Q82Q 3GHGB 4H0LC 2P67A 2FXOA 2O1JA 1KILC 3MGNA 1X0TA 3OA7A 1ZW0A 1Q81Q 1FZCB 2E5TA 2NZ2A 1URQC 2WSEH 4U3FE 1OX3A 3SWFA 3QH9A 3B5NA 1QLED 1IFNA 2NPSA 2POHA 1NO4A 4GDOA 2W90A 1EDIA 1S1CX 2XU6A 2IBZI 3A0BE 2BASA 3EWKA 2OYIC 2FFDC 1GL2A 1L0NE 2JO1A 3I56P 1FJPA 2B9BA 4U3FG 1JM0A 1EC5A 3SWKA 3HD7B 1OXZA 3MUDC 1DEEG 1GW3A 5KKZB 3MHVA 1H89A 1HGZA 5AVVB 3CXHD 2ZT9D 3N4XA 1S9KE 3GG2A 1JEKA 2BEZF 3CMAP 1SVFA 3D70A 1QL1A 1KB9E 3C8VA 1KILB 2M5AB 5APSA 2KYVA 4GKGA 2WPQA 3CI9A 4RO0A 2ZAEB 1SQXE 1VQ9P 1H8AA 1URQB 1PP9E 3CLQA 1RE4A 2C0XA 3HTKB 4CPGA 1W2BO 5AW9B 1X8YA 5APUA 3G3ZA 3IF4A 5AW1B 2PP6A 2IDBA 4WVZA 2WMMA 2WSSH 2Q6QA 1RQUA 3L70J 1L4AA 1CI6A 5B66E 3CXHI 2ZXXA 5KJ7A 4PD4E 2YIUB 1NTMG 4OGQB 2XZRA 5APTA 2KSJA 1H88A 3F89A 3G6EP 3O6QB 5DJTB 1RE3C 1DX7A 1VQNP 5CMZA 4BXLA 3PTZA 4I7ZC 1KQGB 3L36A 3KZIE 3U59A 3H32A 1BCCE 3NFQA 2YMYA 1SFCD 1FJKA 4ZKPA 2WT7B 1NTMK 2VRSA 3N7NA 1USEA 1HBWA 2GM4A 1ZMEC 1Y47A 1EDJA 2E42A 3H1IE 2ITAA 4JPZB 1S3JA 3AEFC 3II6A 1BCCG 3Q2YA 1YJWP 1YJ9P 3L71G 4UB6H 2L91A 2ZT9C 2WSFH 1KD1Q 3TNUB 3H1KG 2XNDH 3H1IG 4H13B 1NTMJ 2N9YB 3CWBG 3CD6P 3I5CA 4XFJA 3LW5H 2IBZE 3V6IA 1BE3E 3AEDC 4DJGA 1M8OB 5AVYB 3AE5C 3E1RA 2R32A 2B89A 3S4RA 4N6JA 1VL2A 3AE2C 2H7HA 3V4QA 4HH2A 1RF0A 5BU5A 2W6BA 1BGYE 3M9QA 1CSBA 3TSIA 1NH4A 1KMIZ 2OGUA 4R4LA 4GOFA 3KQGA 3HE4B 1WRGA 2J5UA 3VN0A 1SQPJ 3PH0A 3L71J 2WSEJ 1KFNA 1JTHB 2W8ZA 3H1KJ 4WY4A 2ZYDA 2O1KA 5AW3B 2WPVB 1GW4A 2K9JB 2E76D 3CWBJ 3AECC 1SFCC 1JY2P 4JBZA 4WWIA 2K1AA 1NTZD 3HRNA 1LNQA 3H1JG 3CC2P 3PP5A 2AXTE 2PAJA 1T3JA 4KT0J 2N1TA 3CXHE 2J58A 2QJYB 2K3RA 2Z5HA 2C9NY 1LWUA 1M56D 1SQVJ 2IYPA 2B87A 5AW6B 4L74A 1Q86Q 2WWWA 1IK9A 4HB1A 1RF1C 4N78D 4DOJA 2Q7CA 3L70D 2OYHC 2PGDA 3HE5A 3TDKA 4OVNF 1R8EA 3Q5SA 2Q5UA 2ZJSE 3JC22 1N2DC 1S2EA 3BCCG 2W6AA 2WZ7A 2DW3A 3L4FA 4UB6E 1FDIA 1LT9C 2A45H 1LTAC 3AE4C 1WT6A 4Y99B 2L5GB 1S5LH 2KS1A 1SS1A 1JMMA 2K37A 2FBWC 1P84H 1YYCA 3GW6A 4EI2A 3CPWO 3H1JJ 1EZVG 1X22A 4C7RA 4W7ZA 4PJ0H 1FC2C 2HYNA 3GHGA 4KHXA 2OYHB 3M0DC 2QJKB 2R44A 2KUBA 2E76C 1NHLA 1NTMD 1FZCA 3BCCJ 1ZXGA 4Y28J 3VP8A 2GUSA 1EDLA 1KILD 3RL0g 3BVHA 4HYTB 4RKUJ 1LT9B 1LTIC 1MFZA 1CZQA 4RESB 2E74C 3WUTA 3M9BA 5BU8B 2K88A 2OTLP 1KB9I 4YXDC 4RJTA 3M9HA 3L75G 1NTKJ 3HD7A 1VQ4P 2FYNB 2FY8A 1U7JA 4BRYA 2YXRB 2IX7C 1U7MA 3K5BA 1SQPD 2A06G 3GLMA 2RMZA 3FX0A 3WU2H 1T3UA 4OGQD 1FZCC 1LTTC 1KILA 3D6ZA 1NAYA 2RH0A 3CWBD 2XDJA 1L0LG 4XE5B 4IOIH 5CJ0A 4PD4I 3CX5D 1URQA 1GDTA 5CBOA 1AQTA 3TF5A 2WVRA 3L73J 1YTZI 3HTKA 1Q90D 1DIPA 3ABVC 1OZHA 1PIXA 2E74B 2J59M 1A02F 1SQVD 1LTGC 3EFFK 4ZMDA 2LXBA 3CCUP 2FFDA 2YO3A 1L0LK 1VPCA 3L75J 4W80A 3W68A 1KQLA 2A45G 1NTZE 5AW4B 3O6QA 1GD2E 4KJMA 3CCEP 1ZP0C 3V5BA 4H13D 4C7NB 1HH0A 4IL6X 2UWJE 4HKZH 3CCJP 3W67A 4N78E 2KP8A 2QRXA 1L0LJ 3L70E 4K3AA 3A3YB 3SSUA 2WT7A 1SQQG 2G8YA 1NTZG 1H0TB 1VQLP 1E5WA 3RL0B 1FZFA 4AYCA 1VDFA 4I1LA 3H1JD 3CCMP 1IK7A 2HPCB 1UIXA 3CX5H 3GMAA 3CCQP 3L70G 4EDFA 1SQQK 1NTZK 2YIUC 1T2KD 4OGQC 5BVZA 2YKOA 1R5SA 4W7YA 1ZRTD 1BDCA 3BCCD 5E79H 3FGAD 1VQMP 1VQPP 1RE3A 1EDKA 3WU2E 1LP1A 1OIPA 2KK7A 1VQ8P 1USDA 1NKZB 3BRVB 1GMJA 2QM8A 2MJZA 2KNCB 3WUUA 1SQQJ 1NTZJ 1U57A 4GT1A 2NRGA 1NTKD 1NTME 1GZLA 1EZVD 4JF7A 1QVFO 2LXCB 1BSHA 3HE4A 1KILE 2QJPB 2V7QJ 3T97B 3IAOA 3V4WA 1JTHA 4H13C 3Q3DA 1YI2P 3VMAA 1QGKB 1G2CA 2CPBA 3G71P 1SP4A 3L73D 1FZEA 4AUWA 3TGUD 1FS0E 1SQPE 3L72G 1JY2O 3L71E 1LT1A 1K9MQ 1YQ3C 1NU1D 1EZVI 4YXWH 3H1KE 4DCKA 1IFMA 3A7OA 1W5CE 1AV1A 3L75D 2R3SA 3PRJA 4JQ0D 4WB4A 1T2KC 4L75A 3CWBE 2Y9YA 3WMM0 3B5NB 2ZFCA 2MKVA 3CX5E 3CMEP 1SQPG 1QX8A 4N3YB 1IFDA 5CCHD 2A06D 4GOEA 5KLVD 2I1KA 1DD4A 1BSNA 3L37A 3AE8C 1OWAA 2IZ0A 1SQVE 1OW7A 2IPPA 2H43A 4B86A 1Z56A 1L0LD 1K04A 1J1DB 5APWA 2P10A 3Q1MA 1SFCA 3P8MC 2KZIA 1SQPK 4K35A 3L35A 1NJIQ 2Q3EA 1EXJA 3D71A 5GTIH 2QJYC 1QVGO 2D2CC 1G1JA 2KXPB 3L72J 1SQVG 2O01N 4OH8B 2BEQD 3F5HA 1RF1A 1KC8Q 1EQ7A 2M3BA 2OTKE 2OYHA 4D6TD 5K5GB 2Y9ZA 3VTPC 3TK1A 1SLQA 4HJGH 5B5EH 1JY3O 5DJUB 1FZGA 1MUUA 1SQVK 3NXSA 1M1JC 3USSA 3H1JE 3RBZA 1BDDA 4Y99C 1P84D 5CCGD 1LT9A 2FXPA 1SQBD 4I6MC 3JCUH 1L4AB 3V2PA 1CI6B 2JWDA 1SQQD 2ZYAA 4R4MA 5KAFH 1GK6A 2WPSA 3CC4P 2ZVNB 3BCCE 2E74D 1HF9A 5KAIH 2WSCJ 1HJ0A 5L8RJ 2D2CB 2A45I 3AEEC 1M57D 4PV1B 3OJAB 3H32B 2HODB 1YITP 5CCHC 5AW8B 2QJKC 1YHQP 2LR2A 4EYYQ 5AVSB 1JOCA 3KPEA 1P84I 3M0DA 1RHZB 4IFDK 1JUNA 1VQKP 1NTKE 4I2LC 3OAKA 1FDMA 1EZVE 1LTSC 2SPZA 1M1JB 2IFMA 3V2NA 5AW0B 2JWAA 3RL0D 2QE7H 4Z1MH 5H2FH 1VF5B 1WMKA 2YKPA 2QM7A 1NTKG 2FYNC 2FYUK 1YIJP 2QVAA 1ZR2A 2XNXA 3H25A 2P58A 2IZ1A 3AE9C 4IFMA 1FDOA 2JR8A 3L73E 3RBXA 1Q2NA 1KYOH 1LTJC 2OQQA 4MN4C 4OWFA 2JDIH 3TGUE 4DZOA 3E1IA 1NVOA 4WBAA 3EQ2A 1NTKK 2Z5IA 5CCGC 3RK2C 3CCRP 2KLUA 2V7QH 3OW2O 4QMAA 2Q9IA 2FYUJ 3L75E 3A2AA 5CBNA 4H44B 1PP9D 3M91A 1N7SD 2IFNA 1GK4A 3L73G 1H0TA 3GF3A 3U1AA 5AVQB 1KORA 3TGUG 2RKLA 3JSVC 3L72D 1NU1G
chains in the Genus database with same CATH topology
4BRYA 3F5HA 3WUUA 2WVRA 4BRYB 3WUVA 3E1RA 2Q6QA 3WUTA 2ZXXA 1UIIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BRY A;  3F5H A;  3WUU A;  2WVR A;  4BRY B;  3WUV A;  3E1R A;  2Q6Q A;  3WUT A;  2ZXX A;  1UII A; 
#chains in the Genus database with same CATH topology
 2O01 H;  2A06 E;  2HPC A;  3JCU E;  3VP9 A;  2QA4 P;  3RK3 B;  2XV5 A;  1N73 C;  5KAF E;  3VMZ A;  3A0B H;  5CJ4 A;  2W83 C;  1KN7 A;  2AEF A;  1PL5 A;  3Q5R A;  2RN0 A;  2OAR A;  1L0L E;  5KAI E;  1A02 J;  4JYB A;  2LKM A;  3KHU A;  1MV8 A;  5KLV G;  1NU1 K;  1HWT C;  5M1B A;  1LTJ B;  2N1T B;  3R4Y A;  1FBM A;  2M5A A;  1OVU A;  2H88 C;  3BAT A;  2C9L Y;  2M3E A;  3RK2 B;  3FWL A;  4ZNC A;  3P8C D;  2BCC G;  2HR3 A;  3HE5 B;  3TYY A;  3RL0 C;  5AVW B;  5APQ A;  3CC7 P;  1ZV8 A;  3H1L J;  3M0A A;  4D6T E;  1GU4 A;  2Q3I A;  1M7L A;  5KLV K;  3TGU J;  3AE1 C;  3MIW A;  4O9B A;  2Y0C A;  1S5L E;  2ZYG A;  1NU1 J;  2KB7 P;  1P84 E;  1IFJ A;  2YMK A;  5KLI C;  2W27 A;  1AVO A;  1N73 B;  3T97 A;  4M3L A;  3B5N D;  3CCV P;  3H1H G;  4D6T G;  2KS1 B;  1SQB E;  2NPS D;  4PJ0 E;  1SQQ E;  1KV4 A;  1IZN B;  2AEM A;  2IBZ D;  5KLV J;  2FXM A;  3L74 G;  4PD4 H;  2QEX P;  1Q7Y Q;  1N7S C;  1OFC X;  5AW2 B;  1LJ2 A;  3CX5 I;  1JY2 N;  1SQB G;  2ZVO B;  3MD0 A;  1NYH A;  1PZQ A;  2BCC J;  1XTC C;  3KDP B;  3KZI H;  1T6A A;  1BGY D;  3U1C A;  5AVU B;  3NTN A;  2K9Y A;  2QJP C;  1S72 P;  3D6Y A;  3HUS B;  1AJY A;  1SQB K;  4UB8 H;  2WPR A;  1FAV A;  3IN6 A;  2O3J A;  2WSC H;  3TNU A;  5KLI B;  3H1H J;  5GTH H;  4D6T J;  1PV3 A;  4L73 A;  2YO2 A;  3G9R A;  4C46 A;  2P7J A;  1XTG B;  1YTZ T;  1IJD B;  1S4X A;  2FYU D;  3MP7 B;  3L74 J;  4U7J A;  2E75 D;  1JMB A;  1W2E A;  4BRY B;  1X79 B;  1IFP A;  2Y0E A;  3H6P A;  1N7L A;  1N7S B;  1PGJ A;  1FOS F;  2N9B A;  1AA0 A;  1L4A D;  3FXD A;  5AVX B;  2FKW B;  1SQB J;  5KJ7 D;  1OVR A;  1L0N G;  2YXQ B;  4H0L B;  1PPJ D;  4EOT A;  1KQS O;  4BWN A;  3G4S P;  2AXC A;  4IFF A;  3B5N C;  2D2C D;  1FE6 A;  1JCD A;  1JB0 J;  2NPS C;  1JY3 N;  4PV1 D;  1Y8A A;  4ASW A;  3P32 A;  3PLN A;  1L0N K;  1GL2 C;  1NAF A;  2H8P D;  5APX A;  2QG4 A;  3L72 E;  2V4H A;  2K9J A;  3S1K A;  1KTM A;  2OYI B;  2FFD B;  1J1D C;  1SQX G;  4U3F J;  4IL6 H;  1OW8 A;  3FWN A;  1HVV A;  1PP9 G;  3PHL A;  1AFO A;  1J2J B;  3KXD A;  2O01 J;  3GF7 A;  3H1L D;  4TLF A;  5C39 A;  2R5B A;  4LC1 A;  2OYO A;  4NPE A;  2R3C A;  1ZN5 A;  1DD3 A;  1L2P A;  5AW7 B;  1PGO A;  2Z4E A;  2YNY A;  1J1E C;  1D7M A;  3E7K A;  1L0N J;  1VF5 D;  3AE7 C;  3C1L A;  1EXI A;  1SQX K;  1MZ9 A;  2AXT H;  2HOD A;  3CXH H;  3P7K A;  2ZXE B;  3S9O A;  1IO4 A;  1RE4 C;  3P8C E;  1NGM B;  3AEG C;  1E79 H;  1KZU B;  1QEX A;  2NPS B;  3SWY A;  1X9V A;  3AEA C;  3V2R A;  4UB8 E;  5TIS H;  1M1K Q;  4AQR D;  2QIW A;  2E75 C;  3VMX A;  1VQ7 P;  3SFD C;  3FXE A;  3AE3 C;  1GL2 B;  2C0W A;  1M1J A;  5GTH E;  1L4A C;  1ZR4 A;  2HFE D;  4H44 D;  2B88 A;  5KJ7 C;  1LTB C;  2GA1 A;  1SQX J;  5E79 E;  1PP9 J;  2BCC D;  1RY3 A;  4L76 A;  2H89 C;  5AVZ B;  1KFM A;  4WY4 D;  1M90 Q;  4PV1 C;  3RK3 D;  1LP1 B;  1JNM A;  1J1E B;  1PFI A;  4I7Z B;  1S5L X;  2KIK A;  3LID A;  5CCH A;  3H1H D;  1VQ6 P;  5APY A;  3A0H H;  3SFE C;  1OW6 A;  1YJN P;  3ZDM A;  2I1J A;  1MFT A;  2IBZ G;  1R5L A;  1BE3 G;  2N1T D;  2E5Y A;  2R5D A;  3L74 D;  3V2Q A;  2WIT A;  2E75 B;  5APV A;  4DT0 A;  3MZW B;  3RK2 D;  1AQ5 A;  1BCC J;  3IFM A;  1HJB A;  1VF5 C;  4IL6 E;  2ZT9 B;  2HLO A;  2HG5 D;  4ASV A;  1BGY G;  5AVR B;  3H1I J;  1ZLL A;  1ZRT E;  2G3A A;  1KYO D;  1G2C B;  1NKN A;  4YPC A;  2FYU E;  2M8R A;  2KSE A;  3IR9 A;  3O8Z A;  2Y0D A;  1NWQ A;  3EFG A;  1LTJ A;  1FZB A;  1RF0 C;  2OTJ P;  3BRT B;  1PPJ E;  2KZJ A;  3ITK A;  4H44 C;  5KTB A;  1QL2 A;  4U3F D;  2FYU G;  5CCG A;  2M0B A;  3A5T A;  3R2P A;  1BE3 J;  5AVT B;  2QSI A;  3LIE A;  4GOD A;  5TIS E;  1TU3 F;  2KLV A;  1NOH A;  1OMI A;  2E43 A;  1KYO I;  4WY4 C;  1HGV A;  1PPJ G;  2FYZ A;  1L0N D;  3RK3 C;  3VMY A;  3PJS K;  3QWO C;  1LGH B;  1IFI A;  1BGY J;  3CCS P;  2PFX A;  1N8R Q;  4NPF X;  4GIF A;  2JKV A;  5GTI E;  1N73 A;  3UIA A;  1SFC B;  2WTY A;  1YQ4 C;  2WQY C;  4NPD A;  3H1L E;  1PGQ A;  1S9K D;  1K73 Q;  2N1T C;  1LWU C;  1FU1 A;  3WUV A;  1K8A Q;  1KB9 D;  5TJH A;  4C7N A;  1NU1 E;  3HD7 D;  3A0H E;  5B5E E;  1KQF B;  2IYO A;  1JY3 P;  1SQX D;  1HTL C;  3VOP A;  1RF1 B;  3M06 A;  4EIJ A;  3H1L G;  1UII A;  2GUV A;  1DH3 A;  1RH5 B;  3I55 P;  4H0L D;  1K05 A;  1IC2 A;  2KI7 B;  5KLV E;  4TT3 H;  4WY4 B;  3MTU E;  5CHX A;  3HUS A;  1RQV A;  1FZA A;  1DEB A;  1AVY A;  1ZOY C;  2P1J A;  1URQ D;  4PD4 D;  1JCC A;  1MKM A;  2JP3 A;  1YBK A;  2BCC E;  1GTW A;  2JEE A;  2P2U A;  3AEB C;  1FOS E;  2WSF J;  3CL3 D;  2JJL A;  4A7P A;  1LWU B;  2B87 B;  5AW5 B;  3GHG C;  1N7S A;  3RK3 E;  2XKM A;  1GU5 A;  1BCC D;  2YKQ A;  2PRR A;  2AEJ A;  3L71 D;  4LLH A;  1PGP A;  1VQO P;  3AE6 C;  3LW5 J;  4JYC A;  2KNC A;  1KB9 H;  1G1I A;  2I8D A;  3H1K D;  3CCL P;  4LGD E;  3H1H E;  3B8E B;  4XA4 A;  3H1I D;  1N86 A;  3KYQ A;  2E76 B;  5EFW B;  2CK3 H;  4YTP C;  2KOG A;  3B71 A;  3HUS C;  3L74 E;  2Q1K A;  1HUC A;  3B4S A;  4ZKU A;  3VYI A;  1VQ5 P;  5H2F E;  3RGU A;  1T8Z A;  3BAS A;  3HD7 C;  3NMD A;  3Q5P A;  2OYI A;  5B66 H;  2CPS A;  1JO5 A;  1KYO E;  1BE3 D;  1GL2 D;  3C9I A;  1CW5 A;  5KKZ C;  1OVV A;  3MUD A;  2W6J H;  1Y9B A;  1Q82 Q;  3GHG B;  4H0L C;  2P67 A;  2FXO A;  2O1J A;  1KIL C;  3MGN A;  1X0T A;  3OA7 A;  1ZW0 A;  1Q81 Q;  1FZC B;  2E5T A;  2NZ2 A;  1URQ C;  2WSE H;  4U3F E;  1OX3 A;  3SWF A;  3QH9 A;  3B5N A;  1QLE D;  1IFN A;  2NPS A;  2POH A;  1NO4 A;  4GDO A;  2W90 A;  1EDI A;  1S1C X;  2XU6 A;  2IBZ I;  3A0B E;  2BAS A;  3EWK A;  2OYI C;  2FFD C;  1GL2 A;  1L0N E;  2JO1 A;  3I56 P;  1FJP A;  2B9B A;  4U3F G;  1JM0 A;  1EC5 A;  3SWK A;  3HD7 B;  1OXZ A;  3MUD C;  1DEE G;  1GW3 A;  5KKZ B;  3MHV A;  1H89 A;  1HGZ A;  5AVV B;  3CXH D;  2ZT9 D;  3N4X A;  1S9K E;  3GG2 A;  1JEK A;  2BEZ F;  3CMA P;  1SVF A;  3D70 A;  1QL1 A;  1KB9 E;  3C8V A;  1KIL B;  2M5A B;  5APS A;  2KYV A;  4GKG A;  2WPQ A;  3CI9 A;  4RO0 A;  2ZAE B;  1SQX E;  1VQ9 P;  1H8A A;  1URQ B;  1PP9 E;  3CLQ A;  1RE4 A;  2C0X A;  3HTK B;  4CPG A;  1W2B O;  5AW9 B;  1X8Y A;  5APU A;  3G3Z A;  3IF4 A;  5AW1 B;  2PP6 A;  2IDB A;  4WVZ A;  2WMM A;  2WSS H;  2Q6Q A;  1RQU A;  3L70 J;  1L4A A;  1CI6 A;  5B66 E;  3CXH I;  2ZXX A;  5KJ7 A;  4PD4 E;  2YIU B;  1NTM G;  4OGQ B;  2XZR A;  5APT A;  2KSJ A;  1H88 A;  3F89 A;  3G6E P;  3O6Q B;  5DJT B;  1RE3 C;  1DX7 A;  1VQN P;  5CMZ A;  4BXL A;  3PTZ A;  4I7Z C;  1KQG B;  3L36 A;  3KZI E;  3U59 A;  3H32 A;  1BCC E;  3NFQ A;  2YMY A;  1SFC D;  1FJK A;  4ZKP A;  2WT7 B;  1NTM K;  2VRS A;  3N7N A;  1USE A;  1HBW A;  2GM4 A;  1ZME C;  1Y47 A;  1EDJ A;  2E42 A;  3H1I E;  2ITA A;  4JPZ B;  1S3J A;  3AEF C;  3II6 A;  1BCC G;  3Q2Y A;  1YJW P;  1YJ9 P;  3L71 G;  4UB6 H;  2L91 A;  2ZT9 C;  2WSF H;  1KD1 Q;  3TNU B;  3H1K G;  2XND H;  3H1I G;  4H13 B;  1NTM J;  2N9Y B;  3CWB G;  3CD6 P;  3I5C A;  4XFJ A;  3LW5 H;  2IBZ E;  3V6I A;  1BE3 E;  3AED C;  4DJG A;  1M8O B;  5AVY B;  3AE5 C;  3E1R A;  2R32 A;  2B89 A;  3S4R A;  4N6J A;  1VL2 A;  3AE2 C;  2H7H A;  3V4Q A;  4HH2 A;  1RF0 A;  5BU5 A;  2W6B A;  1BGY E;  3M9Q A;  1CSB A;  3TSI A;  1NH4 A;  1KMI Z;  2OGU A;  4R4L A;  4GOF A;  3KQG A;  3HE4 B;  1WRG A;  2J5U A;  3VN0 A;  1SQP J;  3PH0 A;  3L71 J;  2WSE J;  1KFN A;  1JTH B;  2W8Z A;  3H1K J;  4WY4 A;  2ZYD A;  2O1K A;  5AW3 B;  2WPV B;  1GW4 A;  2K9J B;  2E76 D;  3CWB J;  3AEC C;  1SFC C;  1JY2 P;  4JBZ A;  4WWI A;  2K1A A;  1NTZ D;  3HRN A;  1LNQ A;  3H1J G;  3CC2 P;  3PP5 A;  2AXT E;  2PAJ A;  1T3J A;  4KT0 J;  2N1T A;  3CXH E;  2J58 A;  2QJY B;  2K3R A;  2Z5H A;  2C9N Y;  1LWU A;  1M56 D;  1SQV J;  2IYP A;  2B87 A;  5AW6 B;  4L74 A;  1Q86 Q;  2WWW A;  1IK9 A;  4HB1 A;  1RF1 C;  4N78 D;  4DOJ A;  2Q7C A;  3L70 D;  2OYH C;  2PGD A;  3HE5 A;  3TDK A;  4OVN F;  1R8E A;  3Q5S A;  2Q5U A;  2ZJS E;  3JC2 2;  1N2D C;  1S2E A;  3BCC G;  2W6A A;  2WZ7 A;  2DW3 A;  3L4F A;  4UB6 E;  1FDI A;  1LT9 C;  2A45 H;  1LTA C;  3AE4 C;  1WT6 A;  4Y99 B;  2L5G B;  1S5L H;  2KS1 A;  1SS1 A;  1JMM A;  2K37 A;  2FBW C;  1P84 H;  1YYC A;  3GW6 A;  4EI2 A;  3CPW O;  3H1J J;  1EZV G;  1X22 A;  4C7R A;  4W7Z A;  4PJ0 H;  1FC2 C;  2HYN A;  3GHG A;  4KHX A;  2OYH B;  3M0D C;  2QJK B;  2R44 A;  2KUB A;  2E76 C;  1NHL A;  1NTM D;  1FZC A;  3BCC J;  1ZXG A;  4Y28 J;  3VP8 A;  2GUS A;  1EDL A;  1KIL D;  3RL0 g;  3BVH A;  4HYT B;  4RKU J;  1LT9 B;  1LTI C;  1MFZ A;  1CZQ A;  4RES B;  2E74 C;  3WUT A;  3M9B A;  5BU8 B;  2K88 A;  2OTL P;  1KB9 I;  4YXD C;  4RJT A;  3M9H A;  3L75 G;  1NTK J;  3HD7 A;  1VQ4 P;  2FYN B;  2FY8 A;  1U7J A;  4BRY A;  2YXR B;  2IX7 C;  1U7M A;  3K5B A;  1SQP D;  2A06 G;  3GLM A;  2RMZ A;  3FX0 A;  3WU2 H;  1T3U A;  4OGQ D;  1FZC C;  1LTT C;  1KIL A;  3D6Z A;  1NAY A;  2RH0 A;  3CWB D;  2XDJ A;  1L0L G;  4XE5 B;  4IOI H;  5CJ0 A;  4PD4 I;  3CX5 D;  1URQ A;  1GDT A;  5CBO A;  1AQT A;  3TF5 A;  2WVR A;  3L73 J;  1YTZ I;  3HTK A;  1Q90 D;  1DIP A;  3ABV C;  1OZH A;  1PIX A;  2E74 B;  2J59 M;  1A02 F;  1SQV D;  1LTG C;  3EFF K;  4ZMD A;  2LXB A;  3CCU P;  2FFD A;  2YO3 A;  1L0L K;  1VPC A;  3L75 J;  4W80 A;  3W68 A;  1KQL A;  2A45 G;  1NTZ E;  5AW4 B;  3O6Q A;  1GD2 E;  4KJM A;  3CCE P;  1ZP0 C;  3V5B A;  4H13 D;  4C7N B;  1HH0 A;  4IL6 X;  2UWJ E;  4HKZ H;  3CCJ P;  3W67 A;  4N78 E;  2KP8 A;  2QRX A;  1L0L J;  3L70 E;  4K3A A;  3A3Y B;  3SSU A;  2WT7 A;  1SQQ G;  2G8Y A;  1NTZ G;  1H0T B;  1VQL P;  1E5W A;  3RL0 B;  1FZF A;  4AYC A;  1VDF A;  4I1L A;  3H1J D;  3CCM P;  1IK7 A;  2HPC B;  1UIX A;  3CX5 H;  3GMA A;  3CCQ P;  3L70 G;  4EDF A;  1SQQ K;  1NTZ K;  2YIU C;  1T2K D;  4OGQ C;  5BVZ A;  2YKO A;  1R5S A;  4W7Y A;  1ZRT D;  1BDC A;  3BCC D;  5E79 H;  3FGA D;  1VQM P;  1VQP P;  1RE3 A;  1EDK A;  3WU2 E;  1LP1 A;  1OIP A;  2KK7 A;  1VQ8 P;  1USD A;  1NKZ B;  3BRV B;  1GMJ A;  2QM8 A;  2MJZ A;  2KNC B;  3WUU A;  1SQQ J;  1NTZ J;  1U57 A;  4GT1 A;  2NRG A;  1NTK D;  1NTM E;  1GZL A;  1EZV D;  4JF7 A;  1QVF O;  2LXC B;  1BSH A;  3HE4 A;  1KIL E;  2QJP B;  2V7Q J;  3T97 B;  3IAO A;  3V4W A;  1JTH A;  4H13 C;  3Q3D A;  1YI2 P;  3VMA A;  1QGK B;  1G2C A;  2CPB A;  3G71 P;  1SP4 A;  3L73 D;  1FZE A;  4AUW A;  3TGU D;  1FS0 E;  1SQP E;  3L72 G;  1JY2 O;  3L71 E;  1LT1 A;  1K9M Q;  1YQ3 C;  1NU1 D;  1EZV I;  4YXW H;  3H1K E;  4DCK A;  1IFM A;  3A7O A;  1W5C E;  1AV1 A;  3L75 D;  2R3S A;  3PRJ A;  4JQ0 D;  4WB4 A;  1T2K C;  4L75 A;  3CWB E;  2Y9Y A;  3WMM 0;  3B5N B;  2ZFC A;  2MKV A;  3CX5 E;  3CME P;  1SQP G;  1QX8 A;  4N3Y B;  1IFD A;  5CCH D;  2A06 D;  4GOE A;  5KLV D;  2I1K A;  1DD4 A;  1BSN A;  3L37 A;  3AE8 C;  1OWA A;  2IZ0 A;  1SQV E;  1OW7 A;  2IPP A;  2H43 A;  4B86 A;  1Z56 A;  1L0L D;  1K04 A;  1J1D B;  5APW A;  2P10 A;  3Q1M A;  1SFC A;  3P8M C;  2KZI A;  1SQP K;  4K35 A;  3L35 A;  1NJI Q;  2Q3E A;  1EXJ A;  3D71 A;  5GTI H;  2QJY C;  1QVG O;  2D2C C;  1G1J A;  2KXP B;  3L72 J;  1SQV G;  2O01 N;  4OH8 B;  2BEQ D;  3F5H A;  1RF1 A;  1KC8 Q;  1EQ7 A;  2M3B A;  2OTK E;  2OYH A;  4D6T D;  5K5G B;  2Y9Z A;  3VTP C;  3TK1 A;  1SLQ A;  4HJG H;  5B5E H;  1JY3 O;  5DJU B;  1FZG A;  1MUU A;  1SQV K;  3NXS A;  1M1J C;  3USS A;  3H1J E;  3RBZ A;  1BDD A;  4Y99 C;  1P84 D;  5CCG D;  1LT9 A;  2FXP A;  1SQB D;  4I6M C;  3JCU H;  1L4A B;  3V2P A;  1CI6 B;  2JWD A;  1SQQ D;  2ZYA A;  4R4M A;  5KAF H;  1GK6 A;  2WPS A;  3CC4 P;  2ZVN B;  3BCC E;  2E74 D;  1HF9 A;  5KAI H;  2WSC J;  1HJ0 A;  5L8R J;  2D2C B;  2A45 I;  3AEE C;  1M57 D;  4PV1 B;  3OJA B;  3H32 B;  2HOD B;  1YIT P;  5CCH C;  5AW8 B;  2QJK C;  1YHQ P;  2LR2 A;  4EYY Q;  5AVS B;  1JOC A;  3KPE A;  1P84 I;  3M0D A;  1RHZ B;  4IFD K;  1JUN A;  1VQK P;  1NTK E;  4I2L C;  3OAK A;  1FDM A;  1EZV E;  1LTS C;  2SPZ A;  1M1J B;  2IFM A;  3V2N A;  5AW0 B;  2JWA A;  3RL0 D;  2QE7 H;  4Z1M H;  5H2F H;  1VF5 B;  1WMK A;  2YKP A;  2QM7 A;  1NTK G;  2FYN C;  2FYU K;  1YIJ P;  2QVA A;  1ZR2 A;  2XNX A;  3H25 A;  2P58 A;  2IZ1 A;  3AE9 C;  4IFM A;  1FDO A;  2JR8 A;  3L73 E;  3RBX A;  1Q2N A;  1KYO H;  1LTJ C;  2OQQ A;  4MN4 C;  4OWF A;  2JDI H;  3TGU E;  4DZO A;  3E1I A;  1NVO A;  4WBA A;  3EQ2 A;  1NTK K;  2Z5I A;  5CCG C;  3RK2 C;  3CCR P;  2KLU A;  2V7Q H;  3OW2 O;  4QMA A;  2Q9I A;  2FYU J;  3L75 E;  3A2A A;  5CBN A;  4H44 B;  1PP9 D;  3M91 A;  1N7S D;  2IFN A;  1GK4 A;  3L73 G;  1H0T A;  3GF3 A;  3U1A A;  5AVQ B;  1KOR A;  3TGU G;  2RKL A;  3JSV C;  3L72 D;  1NU1 G; 
#chains in the Genus database with same CATH homology
 4BRY A;  3F5H A;  3WUU A;  2WVR A;  4BRY B;  3WUV A;  3E1R A;  2Q6Q A;  3WUT A;  2ZXX A;  1UII A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...