1N7SB

High resolution structure of a truncated neuronal snare complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
68
structure length
68
Chain Sequence
GSALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords vesicle-associated membrane protein 2
publication title High Resolution Structure, Stability, and Synaptotagmin Binding of a Truncated Neuronal SNARE Complex
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
total genus 31
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2002-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n7sB00
2NPSC 1SFCB 3RK2C 4WY4A 3P8CE 3HD7B 3B5NB 1SFCA 1N7SD 1GL2C 5CCGC 3HTKB 3RL0C 3TSIA 1URQC 2N1TC 1KILC 1GL2B 3RL0B 4JF7A 2KOGA 3KYQA 2N1TB 1L4AB 1KILB 3M0DC 2NPSB 2WZ7A 3HD7A 3RK2B 1N7SC 1HVVA 3B5NA 2PP6A 2XDJA 5KJ7A 3RK3D 1L4AA 5CCHA 2NPSA 1JTHB 4WY4D 4WY4C 1N7SB 4OH8B 1SFCD 1URQB 1JTHA 1SFCC 1GL2A 5CCGA 3HD7D 3B5ND 4LGDE 5KJ7D 4W7YA 1T3JA 5KJ7C 1URQA 2HFED 2N1TA 2NPSD 1XTGB 2M8RA 1NHLA 1KILA 3RK3C 4W7ZA 2YMYA 2H8PD 3VOPA 1GL2D 5CCGD 4W80A 3RK3B 3RL0D 2HG5D 1N7SA 4N78E 1URQD 2N1TD 3HD7C 3B5NC 3PP5A 1L4AD 4WY4B 5CCHD 1KILD 1L4AC 5CCHC 3RK2D
chains in the Genus database with same CATH superfamily
4H0LB 1L0LK 1IC2A 3IN6A 2IYPA 1S5LX 3L75E 5GTHE 1NTMD 3AE4C 4QMAA 3CXHI 3N4XA 5CCGC 2C0WA 1LWUA 5AVRB 1EXIA 3RL0C 4BWNA 5AW9B 4ASWA 3MUDC 2YKQA 2XU6A 4HKZH 2YNYA 3D70A 2KIKA 3RL0B 3SWYA 4YXDC 3L70D 1L0NK 2M3BA 4HB1A 2W27A 1U57A 3L4FA 1SP4A 1OVRA 1JM0A 2LXBA 3H1JJ 3H32B 1D7MA 2KS1A 3HUSC 1NU1J 4PD4I 1VQ9P 3HE4A 1BSNA 1MKMA 2A45G 3HUSB 3NXSA 3A2AA 1ZW0A 2J58A 3MP7B 2LR2A 2WSEH 3WU2H 3CCEP 2YIUC 1QL2A 3WMM0 1NTZG 1N8RQ 3II6A 3QH9A 3VN0A 1CZQA 1EC5A 2XZRA 4DJGA 3AEAC 1LT9B 4N78E 1BCCJ 3B5NC 2ZXEB 1FC2C 1LT9A 1YITP 3S9OA 2M5AB 3L70E 3RK2C 3KDPB 4H44D 1FZCC 1L0LG 1MZ9A 3B5NB 1RF0A 4U7JA 5GTIE 1SQXJ 2M5AA 3A7OA 2PAJA 1L2PA 3GLMA 1NTKJ 4Y99C 1NJIQ 3I55P 5BU8B 1H0TB 3AE1C 1VQOP 5KKZC 2D2CB 2OARA 1H0TA 2WPRA 3ZDMA 4JF7A 2AXTH 1IFJA 3WU2E 1HF9A 3GF7A 1HVVA 4L73A 2G3AA 1EZVD 1L0NG 4RKUJ 1VQ4P 1ZR4A 1R8EA 2WWWA 4OGQC 3PRJA 2IZ0A 2OYHB 1GTWA 3D6ZA 3W68A 2JKVA 3BCCD 3A0BH 1Q82Q 2FYUE 2OYHA 3K5BA 2KI7B 1OWAA 1YBKA 4XA4A 1X8YA 3O6QA 1S9KE 2K3RA 2MKVA 4N3YB 1YJ9P 1GL2D 3TNUB 4LLHA 3KPEA 2ZYAA 3MGNA 3TNUA 2BCCJ 2R5BA 4NPEA 2QEXP 5E79E 5AW4B 3CC7P 3CXHD 1Z56A 2RMZA 3CXHH 3U1CA 2QJYC 1NGMB 3F5HA 3H1JE 3VP9A 2WT7B 1LTSC 1N7SD 2K9JB 2KB7P 1DD3A 1NU1E 1JY3P 2W6JH 3C8VA 1DX7A 1M57D 5CJ4A 1BSHA 5CMZA 2K37A 3A0BE 1HJBA 2ZT9D 3VMYA 1AV1A 2XV5A 3L74J 2M0BA 2FY8A 5AVXB 4EIJA 5KLVK 3QWOC 2ZFCA 3RK3D 3S4RA 2O1JA 2JDIH 3GG2A 4H44B 4RESB 3WUTA 4PD4H 2FYNC 1JOCA 3TGUD 1GDTA 3ITKA 3CMEP 1BCCE 3VTPC 1SQPD 1OW7A 4K3AA 1S5LH 2IBZI 2BEZF 1SQXE 1OZHA 1NTKE 1PP9E 1BCCG 1ZN5A 3NMDA 2Q7CA 2L5GB 3TYYA 1R5LA 2Y9ZA 1J1EB 1KYOI 4U3FD 3AEGC 4KT0J 3L71D 2ZVOB 2ZYGA 1AVYA 4IL6E 1AQ5A 1YYCA 3B8EB 1BGYJ 1VQNP 3P7KA 1DEBA 1KORA 2K88A 1K05A 3H1KG 3M9HA 1YHQP 1KV4A 4PD4E 1ZMEC 1GL2C 5APQA 3TGUE 1HGZA 1ZLLA 3WUVA 3CX5I 2GA1A 3Q3DA 3VMZA 3RBZA 1IFMA 1RQVA 1S5LE 1T8ZA 1VQ6P 1GL2B 3N7NA 2XNDH 3H1IJ 1IFPA 1FDOA 1OVUA 2GM4A 1S1CX 2G8YA 1KC8Q 3NTNA 1K73Q 1LTJB 1SQVK 1N7SC 3M9BA 1M1JA 4JQ0D 2XDJA 2LKMA 1PPJG 1SQQD 3CCJP 1LTJA 1EDIA 5KLVG 1AJYA 1RF1A 2WPQA 2BCCE 1N7SB 1TU3F 2CPSA 1VQ5P 3H1LE 1Q86Q 2ZJSE 1N73B 2ZT9B 1LT1A 3RK3C 1JEKA 4W7ZA 2HR3A 1IZNB 1SQBD 1KZUB 1HBWA 1H8AA 3RK3B 3CMAP 2QIWA 4IFDK 2MJZA 1UIXA 1URQD 1VQPP 3L74E 1KD1Q 2WSSH 4D6TD 2Y0DA 3L36A 1L4AC 2FKWB 3IR9A 2QM8A 3LIDA 2B87B 1JO5A 3BRTB 4ASVA 2FFDC 2M3EA 1Q2NA 3V5BA 2E5YA 3M06A 2Q1KA 2GUVA 1M8OB 3SWFA 3B4SA 1W5CE 2IYOA 1BE3D 3GMAA 2A06D 3L72D 2RH0A 1YTZI 1FDIA 1KN7A 2YMKA 1LNQA 2KNCB 1YJNP 2R3CA 3T97A 1KQLA 2KLUA 1SQVG 5AVTB 1MUUA 2RKLA 2W6BA 3HTKA 2P1JA 1P84E 5AW6B 4PJ0H 1JY3O 2IBZD 5CBOA 4GT1A 4D6TE 1BGYE 3Q5SA 1GU5A 2N9YB 3CWBD 3L70J 3FX0A 5KJ7C 1NHLA 4WB4A 1NYHA 1CI6A 1W2BO 1VPCA 2YMYA 2WQYC 3G4SP 1KYOH 4CPGA 1PZQA 2JP3A 3H1IE 3CC2P 2Q3EA 1JCDA 4KHXA 4L75A 4WBAA 3RK2D 5AW7B 4AYCA 2WSEJ 5TISE 2HPCA 3AE5C 1M56D 3AE8C 3CX5D 4JYCA 3FXEA 1EDJA 3P8CD 1K04A 4PJ0E 1URQC 2W6AA 5C39A 2OYIC 4NPFX 2FYUJ 3VMXA 4BRYB 3CWBE 3VP8A 4C7NB 2OYIB 3RBXA 4BRYA 4A7PA 5B66H 1NTZD 4EI2A 1KYOE 4OGQD 3AE3C 2O3JA 3MD0A 5KLIC 1CSBA 3BRVB 1IJDB 1KB9E 2KSJA 4I7ZC 3CC4P 2OTLP 3L75G 2NRGA 4ZKPA 2HLOA 3EFGA 1T2KD 1SFCC 5CCGA 4LGDE 1FBMA 1L0LD 1WRGA 3CCUP 2NPSD 2CPBA 3AE7C 2KLVA 2H8PD 4C7RA 5AVWB 5CJ0A 2O01H 2J59M 1GZLA 1VQLP 3H32A 3BCCJ 1VL2A 1S2EA 3A5TA 3G6EP 1NTME 3Q5PA 3HUSA 3JC22 2FYUK 1L0ND 5AVUB 2OTKE 4AQRD 1Y8AA 1IFIA 1USEA 1LTGC 2Y9YA 1OX3A 2YIUB 2RN0A 1J2JB 3WUUA 2V4HA 1LTBC 1Q81Q 4IFFA 3SFDC 2XKMA 5H2FH 1YQ4C 1KQFB 3TDKA 3CCQP 1PP9J 1ZOYC 3RK2B 3B5NA 1FJPA 1FZCB 1W2EA 3L70G 2FYZA 4Y99B 4YTPC 1FZCA 1NU1K 1RE3C 4KJMA 1DD4A 5KKZB 3G71P 4W7YA 1UIIA 4N6JA 1FZEA 3TGUJ 3SFEC 5BU5A 3CCVP 1BDCA 1EQ7A 3P8MC 5KTBA 4OGQB 4GOEA 4L74A 1T2KC 3C1LA 4I1LA 2IZ1A 3V2RA 1VDFA 4PV1C 1T3UA 5H2FE 2WVRA 2NPSC 4UB6H 1AFOA 2I8DA 3D71A 4WVZA 1RHZB 3V4WA 2C9NY 5L8RJ 2WPSA 3FGAD 1JMBA 2P67A 2FYUG 3E1IA 1SQXK 2HODB 1NTKK 4U3FJ 1HTLC 2AXTE 3L71J 4R4MA 3S1KA 1AVOA 1KMIZ 3I5CA 3H1LJ 3JCUH 5AVSB 3H1HD 3CPWO 1EZVE 1KTMA 4RO0A 1USDA 1IO4A 1KQSO 3TF5A 2QJYB 4IOIH 2WT7A 3D6YA 2K9JA 3BCCE 2ZAEB 1RQUA 4O9BA 1PFIA 4I2LC 3NFQA 3H1JG 2QJKC 4UB6E 1NU1G 3HD7D 1FOSE 5B5EH 3U59A 4XFJA 4AUWA 2AXCA 3KQGA 3H1KD 1LTAC 3AEFC 2WSCH 3BVHA 2KK7A 2ZVNB 2K1AA 1SQQJ 3L73D 3R4YA 1YQ3C 5APUA 4W80A 1JMMA 3KHUA 2FYNB 3G3ZA 2N1TD 2W8ZA 3JCUE 2YKOA 1L4AD 3CXHE 3SWKA 2B89A 2K9YA 3H1HE 2Q6QA 5CCHC 2AEJA 2BASA 3U1AA 2KUBA 1R5SA 2B88A 1PPJD 5KLVD 1SQBJ 3AEBC 1SS1A 1Q7YQ 1VF5C 3A0HH 1SQXG 2FXPA 2XNXA 1NTKG 1PGQA 5APYA 1A02J 1PP9G 1JY3N 4D6TJ 1RE4C 3FXDA 3KZIH 3RK3E 1LGHB 3L73E 2WZ7A 2KZIA 1KQGB 1IK9A 2IPPA 3VMAA 1SQPE 1FOSF 5KAIH 4GODA 3PTZA 3USSA 1Q90D 2H43A 4OH8B 4JBZA 3OJAB 2A45I 1GL2A 3TGUG 5KJ7D 2Z4EA 1YJWP 2POHA 1J1DC 2QA4P 2L91A 1NAYA 4U3FE 5K5GB 3F89A 1NKZB 3L71E 2QM7A 4ZKUA 1GU4A 4Z1MH 5APVA 1N7SA 3HD7C 3KZIE 4ZMDA 1KILD 3CWBJ 2PRRA 2BCCG 3HD7B 1N73A 1SQVD 1HJ0A 2UWJE 5AW2B 3H1LG 1VQKP 2O01N 4YPCA 2N1TC 3FWLA 4OWFA 1KFNA 4HYTB 4LC1A 1LP1B 1EDLA 2IFNA 1N7LA 2N1TB 2YKPA 4RJTA 4C46A 2B87A 1SQQE 1L4AB 3M9QA 1X22A 3M0DC 3L74G 2YO3A 2PP6A 5AVYB 1L4AA 1JY2P 1JUNA 2FFDB 1VQ8P 2FXMA 2QJPC 2OTJP 3EWKA 4WY4C 2FFDA 5DJTB 1SQQG 2R5DA 1SFCD 1QVFO 4B86A 3E7KA 2QJPB 1NTMJ 1T3JA 2HFED 1NTZJ 1QLED 1SQBE 2WTYA 1ZV8A 3V6IA 2KNCA 3M0AA 5APXA 1ZRTD 3TK1A 1WT6A 2R3SA 5AW3B 1NO4A 1OXZA 2E42A 2E74C 3L37A 1OIPA 2H7HA 1NAFA 3R2PA 1RY3A 2P10A 1QX8A 1L0LJ 4GIFA 4UB8H 3PLNA 2ZXXA 4TT3H 1QGKB 4D6TG 1BGYG 4K35A 2OGUA 5APSA 2O01J 1QL1A 1JCCA 1BE3E 3L75D 3I56P 2Q3IA 2C9LY 1MFTA 3VYIA 5GTHH 2A06E 4ZNCA 3L72E 1KILC 3FWNA 5AVQB 1PGOA 1RH5B 2KOGA 1E5WA 1FU1A 1L0NJ 3GHGC 3LW5H 2E43A 2NZ2A 3CX5H 1KILB 2N9BA 1K9MQ 1EDKA 3H1IG 1NTMK 2IBZE 4IL6X 3GHGB 2A45H 1SVFA 4H0LC 1URQB 4UB8E 2QG4A 3JSVC 1LWUC 1A02F 3AECC 1URQA 2AEFA 4C7NA 1ZR2A 5AW5B 2OYIA 1Y47A 1M1KQ 1M90Q 3CWBG 3AEEC 1LWUB 2YXQB 5KLIB 1X0TA 4DT0A 4PV1D 3RL0g 4I7ZB 3MUDA 1WMKA 2WSFH 3CX5E 4JPZB 4N78D 1SFCB 1S72P 3B71A 3P8CE 2Q5UA 3HRNA 2H88C 1SFCA 4EDFA 2JR8A 2VRSA 2KS1B 3GW6A 5GTIH 3HE4B 3UIAA 2JWAA 1MV8A 1PIXA 5B66E 2CK3H 1EXJA 1NTZE 4GOFA 3V4QA 2J5UA 4EOTA 2KXPB 1FZBA 2V7QH 1NTMG 1LT9C 3IAOA 1YIJP 2QRXA 2YO2A 2JO1A 1L0LE 1RF0C 1FAVA 1LTIC 2HYNA 3H1HJ 1HGVA 2M8RA 2FYUD 2GUSA 1X9VA 2YXRB 3CI9A 3Q2YA 1OW8A 4YXWH 1S9KD 2D2CC 2QVAA 1JY2O 2LXCB 5CCHD 3V2QA 1L0NE 1PL5A 1G1JA 2R44A 3H1KJ 1AQTA 2WSCJ 2Y0EA 2PFXA 1FZFA 2KYVA 3L73J 1RE3A 5AVZB 2OYOA 1VF5D 3AE6C 5E79H 2OYHC 2W90A 1SQPJ 2WITA 4M3LA 1DEEG 3TSIA 3H1JD 1QVGO 1PV3A 1NU1D 1K8AQ 1HWTC 3OAKA 4PV1B 2FBWC 4DZOA 3O6QB 2NPSB 5KLVJ 3MIWA 3AE9C 3G9RA 4IFMA 5M1BA 1PGPA 1NKNA 3AE2C 2NPSA 2HODA 1HH0A 1NWQA 1CW5A 1M7LA 2WMMA 1IK7A 1FE6A 1GW3A 2ZYDA 3GF3A 1BCCD 1JB0J 1P84I 1OW6A 3CCLP 4R4LA 4BXLA 1FDMA 1SQXD 1EZVG 1NTKD 1PP9D 2Z5IA 1SQPK 2JWDA 3PP5A 1BDDA 1S3JA 3BCCG 1IFNA 1HUCA 2QJKB 1VQMP 2P7JA 4IL6H 3CD6P 4H44C 3EFFK 1QEXA 2KSEA 1U7MA 2P58A 1LJ2A 2WPVB 1DIPA 4PD4D 2P2UA 1YTZT 3CCSP 3BATA 2AEMA 3RGUA 2IFMA 4H13D 5AW0B 1SQVJ 1N2DC 3O8ZA 2JEEA 1JNMA 1OFCX 4HH2A 1XTCC 4TLFA 3H1HG 3PH0A 1J1EC 5CCHA 4GDOA 2Y0CA 2KZJA 4XE5B 2B9BA 1VF5B 4WY4D 3C9IA 5B5EE 2E76D 1VQ7P 3H1KE 2Z5HA 3EQ2A 2BCCD 1KB9I 5CHXA 5AW8B 5BVZA 5AVVB 2Q9IA 1XTGB 1PGJA 1NVOA 4HJGH 3H1LD 1X79B 2E5TA 3Q1MA 1RE4A 5KAFH 1SQQK 3M91A 2E75D 1BE3J 5EFWB 4MN4C 2E74D 2R32A 3L73G 3L72J 2DW3A 1FJKA 1M1JC 1SQPG 1PPJE 1LTJC 2JJLA 5KLVE 3MZWB 1RF1C 3H25A 3A0HE 3E1RA 3L74D 2I1KA 1E79H 3CL3D 1M1JB 4JYBA 1J1DB 1SQBK 4WWIA 1U7JA 1RF1B 5TJHA 1GW4A 1KFMA 1T6AA 5AW1B 3V2PA 3MTUE 5CBNA 4U3FG 4GKGA 3Q5RA 3L71G 3V2NA 1N73C 3LIEA 3PHLA 2ZT9C 3KYQA 1GD2E 3PJSK 1H89A 2BEQD 5KAFE 2O1KA 2PGDA 3ABVC 5KAIE 2I1JA 3HD7A 2IX7C 3MHVA 3L35A 3L75J 3CCRP 1JTHB 1LTTC 3P32A 4H0LD 3IFMA 4EYYQ 1JTHA 1LP1A 4H13C 1P84D 1P84H 3LW5J 1GK6A 2N1TA 4DOJA 1BGYD 3IF4A 1S4XA 3H6PA 1OVVA 4H13B 4L76A 1Y9BA 1G2CB 3VOPA 1AA0A 5CCGD 2E76C 1KILE 1G2CA 3M0DA 3RL0D 2HG5D 3OW2O 1FS0E 4WY4B 1SQVE 1NH4A 2E76B 1NOHA 3H1ID 1SLQA 4WY4A 3HE5B 3T97B 1YI2P 1DH3A 2E75C 3HE5A 5TISH 4Y28J 3HTKB 3CCMP 1OMIA 2SPZA 1SQBG 1IFDA 2FXOA 2E75B 2WSFJ 2QE7H 2W83C 5APTA 3SSUA 2E74B 4NPDA 5APWA 2OQQA 3BASA 2IDBA 1CI6B 2QSIA 1FZAA 5KJ7A 1GK4A 1MFZA 1N86A 2ITAA 1EZVI 1KYOD 1H88A 1JY2N 2H89C 3W67A 1KB9D 3AEDC 1FZGA 2KP8A 1KB9H 5DJUB 1ZP0C 3B5ND 1BE3G 1ZRTE 2A06G 2HPCB 3L72G 1NTZK 4DCKA 2V7QJ 1KILA 2C0XA 4OVNF 3CLQA 1GMJA 1G1IA 3GHGA 2D2CD 3KXDA 3A3YB 3OA7A 4I6MC 2IBZG 1ZXGA
chains in the Genus database with same CATH topology
2QM8A 3LIDA 1L0LK 1IC2A 2BASA 1JO5A 1FZFA 3U1AA 3BRTB 2KYVA 1RE3A 5AVZB 2FFDC 2OYHC 3N4XA 5CCGC 3V5BA 2C0WA 2WITA 4M3LA 1LWUA 3M06A 5AVRB 3RL0C 5AW9B 3TSIA 2XNXA 2GUVA 2YKQA 3SWFA 1A02J 5APYA 2XU6A 1JY3N 2YNYA 1RE4C 1HWTC 3RL0B 3OAKA 3SWYA 4DZOA 1LGHB 1YTZI 1L0NK 2M3BA 2NPSB 3MIWA 2W27A 2WZ7A 2R3CA 3T97A 1KQLA 4IFMA 1NKNA 1IK9A 3L4FA 1SP4A 5AVTB 2IPPA 2NPSA 1MUUA 2HODA 1FOSF 2W6BA 1HH0A 1NWQA 3HTKA 3H32B 2P1JA 1CW5A 3HUSC 1M7LA 2H43A 5AW6B 1JY3O 3HE4A 4OH8B 3OJAB 4GT1A 2A45I 1GW3A 1GL2A 2A45G 1GU5A 5KJ7D 3HUSB 2Z4EA 2POHA 3NXSA 5KJ7C 3A2AA 1J1DC 2J58A 1NHLA 4WB4A 2WSEH 1CI6A 1FDMA 1VPCA 2YMYA 1QL2A 3WMM0 3II6A 1NKZB 3VN0A 1CZQA 2QM7A 4ZKUA 1GU4A 2XZRA 1LT9B 2Z5IA 5APVA 1SQPK 1N7SA 4N78E 3HD7C 3B5NC 3PP5A 1JCDA 2ZXEB 4KHXA 1KILD 4WBAA 1LT9A 1IFNA 3RK2D 5AW7B 1HUCA 3RK2C 4AYCA 3KDPB 2HPCA 1FZCC 2P7JA 3HD7B 1N73A 1MZ9A 3B5NB 1RF0A 3A7OA 2PAJA 4JYCA 5AW2B 4Y99C 3P8CD 1URQC 2N1TC 5BU8B 2W6AA 2P2UA 2OYIC 1KFNA 1YTZT 4HYTB 4LC1A 2IFNA 2OARA 3VMXA 1N7LA 3BATA 2WPRA 2IFMA 4JF7A 3VP8A 1IFJA 2N1TB 2YKPA 4C46A 5AW0B 4C7NB 2OYIB 1L4AB 1N2DC 3M9QA 3O8ZA 3M0DC 2JEEA 1JNMA 2YO3A 1HVVA 4HH2A 2PP6A 1XTCC 3MD0A 5AVYB 1CSBA 1ZR4A 1L4AA 3BRVB 2WWWA 1J1EC 1IJDB 1JY2P 5CCHA 1JUNA 2FFDB 2KSJA 2FXMA 4XE5B 4WY4D 2OYHB 3C9IA 4WY4C 2FFDA 4ZKPA 1GTWA 2HLOA 3EFGA 2R5DA 1SFCD 1T2KD 4B86A 2OYHA 1SFCC 2Z5HA 5CCGA 3EQ2A 4LGDE 1FBMA 1OWAA 5CHXA 5AW8B 5BVZA 1T3JA 1WRGA 5AVVB 4XA4A 2HFED 2Q9IA 1X8YA 2NPSD 2CPBA 1XTGB 2WTYA 1X79B 1ZV8A 3M0AA 1RE4A 5APXA 1S9KE 2KLVA 2H8PD 3TK1A 4N3YB 1SQQK 4C7RA 1WT6A 5AVWB 3M91A 5AW3B 5CJ0A 2O01H 1NO4A 1GL2D 2J59M 1GZLA 3TNUB 3H32A 1OXZA 2E42A 2R32A 3L37A 4LLHA 2H7HA 3KPEA 1NAFA 3R2PA 1RY3A 3MGNA 1FJKA 3TNUA 1M1JC 3A5TA 2R5BA 4GIFA 1LTJC 2JJLA 1RF1C 3HUSA 5AW4B 2FYUK 1Z56A 2I1KA 5AVUB 3U1CA 3CL3D 1M1JB 4AQRD 1IFIA 5APSA 4JYBA 1J1DB 3VP9A 1LTGC 2WT7B 1LTSC 1N7SD 1QL1A 1JCCA 1SQBK 2KB7P 1RF1B 1GW4A 1JY3P 1KFMA 5AW1B 3V2PA 2Q3IA 1J2JB 3VYIA 3MTUE 2C9LY 5CJ4A 1DX7A 5CMZA 1KILC 1LTBC 1HJBA 5AVQB 4IFFA 4GKGA 2XKMA 3VMYA 3V2NA 1N73C 2XV5A 2KOGA 3LIEA 3KYQA 1E5WA 1GD2E 1FU1A 3LW5H 3GHGC 2E43A 1H89A 1KILB 2N9BA 2O1KA 2I1JA 3HD7A 5AVXB 3RK2B 1NTMK 3B5NA 4EIJA 5KLVK 2IX7C 2ZFCA 3RK3D 1FJPA 1FZCB 3L35A 2O1JA 4RESB 1W2EA 3GHGB 1JOCA 1GDTA 2FYZA 1JTHB 4Y99B 1LTTC 3P32A 2A45H 1FZCA 1SVFA 1NU1K 3VTPC 1RE3C 3IFMA 1URQB 1JTHA 1LWUC 1A02F 4W7YA 1GK6A 1URQA 2N1TA 4DOJA 4C7NA 1ZR2A 3H6PA 5AW5B 2OYIA 4N6JA 1ZN5A 1G2CB 1FZEA 3NMDA 1LWUB 2Q7CA 2L5GB 5BU5A 3VOPA 1EQ7A 3TYYA 3P8MC 5CCGD 5KTBA 1J1EB 1G2CA 3M0DA 3RL0D 1T2KC 2HG5D 4I1LA 3V2RA 1VDFA 3MUDA 1T3UA 4WY4B 1AQ5A 1YYCA 2WSFH 3B8EB 1NH4A 2NPSC 1AFOA 1NOHA 4N78D 1SFCB 3P7KA 1DEBA 3V4WA 1SLQA 2C9NY 4WY4A 3P8CE 3HE5B 2WPSA 2Q5UA 1DH3A 3HRNA 3M9HA 2P67A 3E1IA 1SFCA 1SQXK 1GL2C 2HODB 3HE5A 5APQA 2VRSA 1NTKK 1HGZA 1ZLLA 3HTKB 1HTLC 1IFDA 3VMZA 3HE4B 1IFMA 3UIAA 1T8ZA 1MV8A 1GL2B 3N7NA 5APTA 3I5CA 5AVSB 2GM4A 3V4QA 3NTNA 5APWA 1LTJB 3BASA 1SQVK 1CI6B 1N7SC 4EOTA 1IO4A 1FZAA 3M9BA 1M1JA 2XDJA 5KJ7A 1FZBA 1GK4A 2LKMA 1MFZA 1N86A 1LTJA 2WT7A 1LT9C 1RF1A 4O9BA 1PFIA 1H88A 1JY2N 2WPQA 1N7SB 2YO2A 4I2LC 1FZGA 1RF0C 2CPSA 2KP8A 3NFQA 1FAVA 1LTIC 2HYNA 3HD7D 1HGVA 3B5ND 1FOSE 3U59A 4AUWA 3KQGA 2HPCB 1LTAC 2M8RA 1N73B 2WSCH 3BVHA 1NTZK 2GUSA 1KILA 3RK3C 1X9VA 4W7ZA 2C0XA 3CLQA 3CI9A 1G1IA 1KZUB 1HBWA 3GHGA 5APUA 1H8AA 1S9KD 4W80A 1JMMA 3RK3B 1JY2O 3A3YB 4IFDK 3G3ZA 2MJZA 1URQD 2N1TD 3OA7A 4I6MC 2YKOA 1L4AD 3V2QA 5CCHD 3L36A 1L4AC 1G1JA 5CCHC 2FKWB 3IR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPS C;  1SFC B;  3RK2 C;  4WY4 A;  3P8C E;  3HD7 B;  3B5N B;  1SFC A;  1N7S D;  1GL2 C;  5CCG C;  3HTK B;  3RL0 C;  3TSI A;  1URQ C;  2N1T C;  1KIL C;  1GL2 B;  3RL0 B;  4JF7 A;  2KOG A;  3KYQ A;  2N1T B;  1L4A B;  1KIL B;  3M0D C;  2NPS B;  2WZ7 A;  3HD7 A;  3RK2 B;  1N7S C;  1HVV A;  3B5N A;  2PP6 A;  2XDJ A;  5KJ7 A;  3RK3 D;  1L4A A;  5CCH A;  2NPS A;  1JTH B;  4WY4 D;  4WY4 C;  1N7S B;  4OH8 B;  1SFC D;  1URQ B;  1JTH A;  1SFC C;  1GL2 A;  5CCG A;  3HD7 D;  3B5N D;  4LGD E;  5KJ7 D;  4W7Y A;  1T3J A;  5KJ7 C;  1URQ A;  2HFE D;  2N1T A;  2NPS D;  1XTG B;  2M8R A;  1NHL A;  1KIL A;  3RK3 C;  4W7Z A;  2YMY A;  2H8P D;  3VOP A;  1GL2 D;  5CCG D;  4W80 A;  3RK3 B;  3RL0 D;  2HG5 D;  1N7S A;  4N78 E;  1URQ D;  2N1T D;  3HD7 C;  3B5N C;  3PP5 A;  1L4A D;  4WY4 B;  5CCH D;  1KIL D;  1L4A C;  5CCH C;  3RK2 D; 
#chains in the Genus database with same CATH topology
 4H0L B;  1L0L K;  1IC2 A;  3IN6 A;  2IYP A;  1S5L X;  3L75 E;  5GTH E;  1NTM D;  3AE4 C;  4QMA A;  3CXH I;  3N4X A;  5CCG C;  2C0W A;  1LWU A;  5AVR B;  1EXI A;  3RL0 C;  4BWN A;  5AW9 B;  4ASW A;  3MUD C;  2YKQ A;  2XU6 A;  4HKZ H;  2YNY A;  3D70 A;  2KIK A;  3RL0 B;  3SWY A;  4YXD C;  3L70 D;  1L0N K;  2M3B A;  4HB1 A;  2W27 A;  1U57 A;  3L4F A;  1SP4 A;  1OVR A;  1JM0 A;  2LXB A;  3H1J J;  3H32 B;  1D7M A;  2KS1 A;  3HUS C;  1NU1 J;  4PD4 I;  1VQ9 P;  3HE4 A;  1BSN A;  1MKM A;  2A45 G;  3HUS B;  3NXS A;  3A2A A;  1ZW0 A;  2J58 A;  3MP7 B;  2LR2 A;  2WSE H;  3WU2 H;  3CCE P;  2YIU C;  1QL2 A;  3WMM 0;  1NTZ G;  1N8R Q;  3II6 A;  3QH9 A;  3VN0 A;  1CZQ A;  1EC5 A;  2XZR A;  4DJG A;  3AEA C;  1LT9 B;  4N78 E;  1BCC J;  3B5N C;  2ZXE B;  1FC2 C;  1LT9 A;  1YIT P;  3S9O A;  2M5A B;  3L70 E;  3RK2 C;  3KDP B;  4H44 D;  1FZC C;  1L0L G;  1MZ9 A;  3B5N B;  1RF0 A;  4U7J A;  5GTI E;  1SQX J;  2M5A A;  3A7O A;  2PAJ A;  1L2P A;  3GLM A;  1NTK J;  4Y99 C;  1NJI Q;  3I55 P;  5BU8 B;  1H0T B;  3AE1 C;  1VQO P;  5KKZ C;  2D2C B;  2OAR A;  1H0T A;  2WPR A;  3ZDM A;  4JF7 A;  2AXT H;  1IFJ A;  3WU2 E;  1HF9 A;  3GF7 A;  1HVV A;  4L73 A;  2G3A A;  1EZV D;  1L0N G;  4RKU J;  1VQ4 P;  1ZR4 A;  1R8E A;  2WWW A;  4OGQ C;  3PRJ A;  2IZ0 A;  2OYH B;  1GTW A;  3D6Z A;  3W68 A;  2JKV A;  3BCC D;  3A0B H;  1Q82 Q;  2FYU E;  2OYH A;  3K5B A;  2KI7 B;  1OWA A;  1YBK A;  4XA4 A;  1X8Y A;  3O6Q A;  1S9K E;  2K3R A;  2MKV A;  4N3Y B;  1YJ9 P;  1GL2 D;  3TNU B;  4LLH A;  3KPE A;  2ZYA A;  3MGN A;  3TNU A;  2BCC J;  2R5B A;  4NPE A;  2QEX P;  5E79 E;  5AW4 B;  3CC7 P;  3CXH D;  1Z56 A;  2RMZ A;  3CXH H;  3U1C A;  2QJY C;  1NGM B;  3F5H A;  3H1J E;  3VP9 A;  2WT7 B;  1LTS C;  1N7S D;  2K9J B;  2KB7 P;  1DD3 A;  1NU1 E;  1JY3 P;  2W6J H;  3C8V A;  1DX7 A;  1M57 D;  5CJ4 A;  1BSH A;  5CMZ A;  2K37 A;  3A0B E;  1HJB A;  2ZT9 D;  3VMY A;  1AV1 A;  2XV5 A;  3L74 J;  2M0B A;  2FY8 A;  5AVX B;  4EIJ A;  5KLV K;  3QWO C;  2ZFC A;  3RK3 D;  3S4R A;  2O1J A;  2JDI H;  3GG2 A;  4H44 B;  4RES B;  3WUT A;  4PD4 H;  2FYN C;  1JOC A;  3TGU D;  1GDT A;  3ITK A;  3CME P;  1BCC E;  3VTP C;  1SQP D;  1OW7 A;  4K3A A;  1S5L H;  2IBZ I;  2BEZ F;  1SQX E;  1OZH A;  1NTK E;  1PP9 E;  1BCC G;  1ZN5 A;  3NMD A;  2Q7C A;  2L5G B;  3TYY A;  1R5L A;  2Y9Z A;  1J1E B;  1KYO I;  4U3F D;  3AEG C;  4KT0 J;  3L71 D;  2ZVO B;  2ZYG A;  1AVY A;  4IL6 E;  1AQ5 A;  1YYC A;  3B8E B;  1BGY J;  1VQN P;  3P7K A;  1DEB A;  1KOR A;  2K88 A;  1K05 A;  3H1K G;  3M9H A;  1YHQ P;  1KV4 A;  4PD4 E;  1ZME C;  1GL2 C;  5APQ A;  3TGU E;  1HGZ A;  1ZLL A;  3WUV A;  3CX5 I;  2GA1 A;  3Q3D A;  3VMZ A;  3RBZ A;  1IFM A;  1RQV A;  1S5L E;  1T8Z A;  1VQ6 P;  1GL2 B;  3N7N A;  2XND H;  3H1I J;  1IFP A;  1FDO A;  1OVU A;  2GM4 A;  1S1C X;  2G8Y A;  1KC8 Q;  3NTN A;  1K73 Q;  1LTJ B;  1SQV K;  1N7S C;  3M9B A;  1M1J A;  4JQ0 D;  2XDJ A;  2LKM A;  1PPJ G;  1SQQ D;  3CCJ P;  1LTJ A;  1EDI A;  5KLV G;  1AJY A;  1RF1 A;  2WPQ A;  2BCC E;  1N7S B;  1TU3 F;  2CPS A;  1VQ5 P;  3H1L E;  1Q86 Q;  2ZJS E;  1N73 B;  2ZT9 B;  1LT1 A;  3RK3 C;  1JEK A;  4W7Z A;  2HR3 A;  1IZN B;  1SQB D;  1KZU B;  1HBW A;  1H8A A;  3RK3 B;  3CMA P;  2QIW A;  4IFD K;  2MJZ A;  1UIX A;  1URQ D;  1VQP P;  3L74 E;  1KD1 Q;  2WSS H;  4D6T D;  2Y0D A;  3L36 A;  1L4A C;  2FKW B;  3IR9 A;  2QM8 A;  3LID A;  2B87 B;  1JO5 A;  3BRT B;  4ASV A;  2FFD C;  2M3E A;  1Q2N A;  3V5B A;  2E5Y A;  3M06 A;  2Q1K A;  2GUV A;  1M8O B;  3SWF A;  3B4S A;  1W5C E;  2IYO A;  1BE3 D;  3GMA A;  2A06 D;  3L72 D;  2RH0 A;  1YTZ I;  1FDI A;  1KN7 A;  2YMK A;  1LNQ A;  2KNC B;  1YJN P;  2R3C A;  3T97 A;  1KQL A;  2KLU A;  1SQV G;  5AVT B;  1MUU A;  2RKL A;  2W6B A;  3HTK A;  2P1J A;  1P84 E;  5AW6 B;  4PJ0 H;  1JY3 O;  2IBZ D;  5CBO A;  4GT1 A;  4D6T E;  1BGY E;  3Q5S A;  1GU5 A;  2N9Y B;  3CWB D;  3L70 J;  3FX0 A;  5KJ7 C;  1NHL A;  4WB4 A;  1NYH A;  1CI6 A;  1W2B O;  1VPC A;  2YMY A;  2WQY C;  3G4S P;  1KYO H;  4CPG A;  1PZQ A;  2JP3 A;  3H1I E;  3CC2 P;  2Q3E A;  1JCD A;  4KHX A;  4L75 A;  4WBA A;  3RK2 D;  5AW7 B;  4AYC A;  2WSE J;  5TIS E;  2HPC A;  3AE5 C;  1M56 D;  3AE8 C;  3CX5 D;  4JYC A;  3FXE A;  1EDJ A;  3P8C D;  1K04 A;  4PJ0 E;  1URQ C;  2W6A A;  5C39 A;  2OYI C;  4NPF X;  2FYU J;  3VMX A;  4BRY B;  3CWB E;  3VP8 A;  4C7N B;  2OYI B;  3RBX A;  4BRY A;  4A7P A;  5B66 H;  1NTZ D;  4EI2 A;  1KYO E;  4OGQ D;  3AE3 C;  2O3J A;  3MD0 A;  5KLI C;  1CSB A;  3BRV B;  1IJD B;  1KB9 E;  2KSJ A;  4I7Z C;  3CC4 P;  2OTL P;  3L75 G;  2NRG A;  4ZKP A;  2HLO A;  3EFG A;  1T2K D;  1SFC C;  5CCG A;  4LGD E;  1FBM A;  1L0L D;  1WRG A;  3CCU P;  2NPS D;  2CPB A;  3AE7 C;  2KLV A;  2H8P D;  4C7R A;  5AVW B;  5CJ0 A;  2O01 H;  2J59 M;  1GZL A;  1VQL P;  3H32 A;  3BCC J;  1VL2 A;  1S2E A;  3A5T A;  3G6E P;  1NTM E;  3Q5P A;  3HUS A;  3JC2 2;  2FYU K;  1L0N D;  5AVU B;  2OTK E;  4AQR D;  1Y8A A;  1IFI A;  1USE A;  1LTG C;  2Y9Y A;  1OX3 A;  2YIU B;  2RN0 A;  1J2J B;  3WUU A;  2V4H A;  1LTB C;  1Q81 Q;  4IFF A;  3SFD C;  2XKM A;  5H2F H;  1YQ4 C;  1KQF B;  3TDK A;  3CCQ P;  1PP9 J;  1ZOY C;  3RK2 B;  3B5N A;  1FJP A;  1FZC B;  1W2E A;  3L70 G;  2FYZ A;  4Y99 B;  4YTP C;  1FZC A;  1NU1 K;  1RE3 C;  4KJM A;  1DD4 A;  5KKZ B;  3G71 P;  4W7Y A;  1UII A;  4N6J A;  1FZE A;  3TGU J;  3SFE C;  5BU5 A;  3CCV P;  1BDC A;  1EQ7 A;  3P8M C;  5KTB A;  4OGQ B;  4GOE A;  4L74 A;  1T2K C;  3C1L A;  4I1L A;  2IZ1 A;  3V2R A;  1VDF A;  4PV1 C;  1T3U A;  5H2F E;  2WVR A;  2NPS C;  4UB6 H;  1AFO A;  2I8D A;  3D71 A;  4WVZ A;  1RHZ B;  3V4W A;  2C9N Y;  5L8R J;  2WPS A;  3FGA D;  1JMB A;  2P67 A;  2FYU G;  3E1I A;  1SQX K;  2HOD B;  1NTK K;  4U3F J;  1HTL C;  2AXT E;  3L71 J;  4R4M A;  3S1K A;  1AVO A;  1KMI Z;  3I5C A;  3H1L J;  3JCU H;  5AVS B;  3H1H D;  3CPW O;  1EZV E;  1KTM A;  4RO0 A;  1USD A;  1IO4 A;  1KQS O;  3TF5 A;  2QJY B;  4IOI H;  2WT7 A;  3D6Y A;  2K9J A;  3BCC E;  2ZAE B;  1RQU A;  4O9B A;  1PFI A;  4I2L C;  3NFQ A;  3H1J G;  2QJK C;  4UB6 E;  1NU1 G;  3HD7 D;  1FOS E;  5B5E H;  3U59 A;  4XFJ A;  4AUW A;  2AXC A;  3KQG A;  3H1K D;  1LTA C;  3AEF C;  2WSC H;  3BVH A;  2KK7 A;  2ZVN B;  2K1A A;  1SQQ J;  3L73 D;  3R4Y A;  1YQ3 C;  5APU A;  4W80 A;  1JMM A;  3KHU A;  2FYN B;  3G3Z A;  2N1T D;  2W8Z A;  3JCU E;  2YKO A;  1L4A D;  3CXH E;  3SWK A;  2B89 A;  2K9Y A;  3H1H E;  2Q6Q A;  5CCH C;  2AEJ A;  2BAS A;  3U1A A;  2KUB A;  1R5S A;  2B88 A;  1PPJ D;  5KLV D;  1SQB J;  3AEB C;  1SS1 A;  1Q7Y Q;  1VF5 C;  3A0H H;  1SQX G;  2FXP A;  2XNX A;  1NTK G;  1PGQ A;  5APY A;  1A02 J;  1PP9 G;  1JY3 N;  4D6T J;  1RE4 C;  3FXD A;  3KZI H;  3RK3 E;  1LGH B;  3L73 E;  2WZ7 A;  2KZI A;  1KQG B;  1IK9 A;  2IPP A;  3VMA A;  1SQP E;  1FOS F;  5KAI H;  4GOD A;  3PTZ A;  3USS A;  1Q90 D;  2H43 A;  4OH8 B;  4JBZ A;  3OJA B;  2A45 I;  1GL2 A;  3TGU G;  5KJ7 D;  2Z4E A;  1YJW P;  2POH A;  1J1D C;  2QA4 P;  2L91 A;  1NAY A;  4U3F E;  5K5G B;  3F89 A;  1NKZ B;  3L71 E;  2QM7 A;  4ZKU A;  1GU4 A;  4Z1M H;  5APV A;  1N7S A;  3HD7 C;  3KZI E;  4ZMD A;  1KIL D;  3CWB J;  2PRR A;  2BCC G;  3HD7 B;  1N73 A;  1SQV D;  1HJ0 A;  2UWJ E;  5AW2 B;  3H1L G;  1VQK P;  2O01 N;  4YPC A;  2N1T C;  3FWL A;  4OWF A;  1KFN A;  4HYT B;  4LC1 A;  1LP1 B;  1EDL A;  2IFN A;  1N7L A;  2N1T B;  2YKP A;  4RJT A;  4C46 A;  2B87 A;  1SQQ E;  1L4A B;  3M9Q A;  1X22 A;  3M0D C;  3L74 G;  2YO3 A;  2PP6 A;  5AVY B;  1L4A A;  1JY2 P;  1JUN A;  2FFD B;  1VQ8 P;  2FXM A;  2QJP C;  2OTJ P;  3EWK A;  4WY4 C;  2FFD A;  5DJT B;  1SQQ G;  2R5D A;  1SFC D;  1QVF O;  4B86 A;  3E7K A;  2QJP B;  1NTM J;  1T3J A;  2HFE D;  1NTZ J;  1QLE D;  1SQB E;  2WTY A;  1ZV8 A;  3V6I A;  2KNC A;  3M0A A;  5APX A;  1ZRT D;  3TK1 A;  1WT6 A;  2R3S A;  5AW3 B;  1NO4 A;  1OXZ A;  2E42 A;  2E74 C;  3L37 A;  1OIP A;  2H7H A;  1NAF A;  3R2P A;  1RY3 A;  2P10 A;  1QX8 A;  1L0L J;  4GIF A;  4UB8 H;  3PLN A;  2ZXX A;  4TT3 H;  1QGK B;  4D6T G;  1BGY G;  4K35 A;  2OGU A;  5APS A;  2O01 J;  1QL1 A;  1JCC A;  1BE3 E;  3L75 D;  3I56 P;  2Q3I A;  2C9L Y;  1MFT A;  3VYI A;  5GTH H;  2A06 E;  4ZNC A;  3L72 E;  1KIL C;  3FWN A;  5AVQ B;  1PGO A;  1RH5 B;  2KOG A;  1E5W A;  1FU1 A;  1L0N J;  3GHG C;  3LW5 H;  2E43 A;  2NZ2 A;  3CX5 H;  1KIL B;  2N9B A;  1K9M Q;  1EDK A;  3H1I G;  1NTM K;  2IBZ E;  4IL6 X;  3GHG B;  2A45 H;  1SVF A;  4H0L C;  1URQ B;  4UB8 E;  2QG4 A;  3JSV C;  1LWU C;  1A02 F;  3AEC C;  1URQ A;  2AEF A;  4C7N A;  1ZR2 A;  5AW5 B;  2OYI A;  1Y47 A;  1M1K Q;  1M90 Q;  3CWB G;  3AEE C;  1LWU B;  2YXQ B;  5KLI B;  1X0T A;  4DT0 A;  4PV1 D;  3RL0 g;  4I7Z B;  3MUD A;  1WMK A;  2WSF H;  3CX5 E;  4JPZ B;  4N78 D;  1SFC B;  1S72 P;  3B71 A;  3P8C E;  2Q5U A;  3HRN A;  2H88 C;  1SFC A;  4EDF A;  2JR8 A;  2VRS A;  2KS1 B;  3GW6 A;  5GTI H;  3HE4 B;  3UIA A;  2JWA A;  1MV8 A;  1PIX A;  5B66 E;  2CK3 H;  1EXJ A;  1NTZ E;  4GOF A;  3V4Q A;  2J5U A;  4EOT A;  2KXP B;  1FZB A;  2V7Q H;  1NTM G;  1LT9 C;  3IAO A;  1YIJ P;  2QRX A;  2YO2 A;  2JO1 A;  1L0L E;  1RF0 C;  1FAV A;  1LTI C;  2HYN A;  3H1H J;  1HGV A;  2M8R A;  2FYU D;  2GUS A;  1X9V A;  2YXR B;  3CI9 A;  3Q2Y A;  1OW8 A;  4YXW H;  1S9K D;  2D2C C;  2QVA A;  1JY2 O;  2LXC B;  5CCH D;  3V2Q A;  1L0N E;  1PL5 A;  1G1J A;  2R44 A;  3H1K J;  1AQT A;  2WSC J;  2Y0E A;  2PFX A;  1FZF A;  2KYV A;  3L73 J;  1RE3 A;  5AVZ B;  2OYO A;  1VF5 D;  3AE6 C;  5E79 H;  2OYH C;  2W90 A;  1SQP J;  2WIT A;  4M3L A;  1DEE G;  3TSI A;  3H1J D;  1QVG O;  1PV3 A;  1NU1 D;  1K8A Q;  1HWT C;  3OAK A;  4PV1 B;  2FBW C;  4DZO A;  3O6Q B;  2NPS B;  5KLV J;  3MIW A;  3AE9 C;  3G9R A;  4IFM A;  5M1B A;  1PGP A;  1NKN A;  3AE2 C;  2NPS A;  2HOD A;  1HH0 A;  1NWQ A;  1CW5 A;  1M7L A;  2WMM A;  1IK7 A;  1FE6 A;  1GW3 A;  2ZYD A;  3GF3 A;  1BCC D;  1JB0 J;  1P84 I;  1OW6 A;  3CCL P;  4R4L A;  4BXL A;  1FDM A;  1SQX D;  1EZV G;  1NTK D;  1PP9 D;  2Z5I A;  1SQP K;  2JWD A;  3PP5 A;  1BDD A;  1S3J A;  3BCC G;  1IFN A;  1HUC A;  2QJK B;  1VQM P;  2P7J A;  4IL6 H;  3CD6 P;  4H44 C;  3EFF K;  1QEX A;  2KSE A;  1U7M A;  2P58 A;  1LJ2 A;  2WPV B;  1DIP A;  4PD4 D;  2P2U A;  1YTZ T;  3CCS P;  3BAT A;  2AEM A;  3RGU A;  2IFM A;  4H13 D;  5AW0 B;  1SQV J;  1N2D C;  3O8Z A;  2JEE A;  1JNM A;  1OFC X;  4HH2 A;  1XTC C;  4TLF A;  3H1H G;  3PH0 A;  1J1E C;  5CCH A;  4GDO A;  2Y0C A;  2KZJ A;  4XE5 B;  2B9B A;  1VF5 B;  4WY4 D;  3C9I A;  5B5E E;  2E76 D;  1VQ7 P;  3H1K E;  2Z5H A;  3EQ2 A;  2BCC D;  1KB9 I;  5CHX A;  5AW8 B;  5BVZ A;  5AVV B;  2Q9I A;  1XTG B;  1PGJ A;  1NVO A;  4HJG H;  3H1L D;  1X79 B;  2E5T A;  3Q1M A;  1RE4 A;  5KAF H;  1SQQ K;  3M91 A;  2E75 D;  1BE3 J;  5EFW B;  4MN4 C;  2E74 D;  2R32 A;  3L73 G;  3L72 J;  2DW3 A;  1FJK A;  1M1J C;  1SQP G;  1PPJ E;  1LTJ C;  2JJL A;  5KLV E;  3MZW B;  1RF1 C;  3H25 A;  3A0H E;  3E1R A;  3L74 D;  2I1K A;  1E79 H;  3CL3 D;  1M1J B;  4JYB A;  1J1D B;  1SQB K;  4WWI A;  1U7J A;  1RF1 B;  5TJH A;  1GW4 A;  1KFM A;  1T6A A;  5AW1 B;  3V2P A;  3MTU E;  5CBN A;  4U3F G;  4GKG A;  3Q5R A;  3L71 G;  3V2N A;  1N73 C;  3LIE A;  3PHL A;  2ZT9 C;  3KYQ A;  1GD2 E;  3PJS K;  1H89 A;  2BEQ D;  5KAF E;  2O1K A;  2PGD A;  3ABV C;  5KAI E;  2I1J A;  3HD7 A;  2IX7 C;  3MHV A;  3L35 A;  3L75 J;  3CCR P;  1JTH B;  1LTT C;  3P32 A;  4H0L D;  3IFM A;  4EYY Q;  1JTH A;  1LP1 A;  4H13 C;  1P84 D;  1P84 H;  3LW5 J;  1GK6 A;  2N1T A;  4DOJ A;  1BGY D;  3IF4 A;  1S4X A;  3H6P A;  1OVV A;  4H13 B;  4L76 A;  1Y9B A;  1G2C B;  3VOP A;  1AA0 A;  5CCG D;  2E76 C;  1KIL E;  1G2C A;  3M0D A;  3RL0 D;  2HG5 D;  3OW2 O;  1FS0 E;  4WY4 B;  1SQV E;  1NH4 A;  2E76 B;  1NOH A;  3H1I D;  1SLQ A;  4WY4 A;  3HE5 B;  3T97 B;  1YI2 P;  1DH3 A;  2E75 C;  3HE5 A;  5TIS H;  4Y28 J;  3HTK B;  3CCM P;  1OMI A;  2SPZ A;  1SQB G;  1IFD A;  2FXO A;  2E75 B;  2WSF J;  2QE7 H;  2W83 C;  5APT A;  3SSU A;  2E74 B;  4NPD A;  5APW A;  2OQQ A;  3BAS A;  2IDB A;  1CI6 B;  2QSI A;  1FZA A;  5KJ7 A;  1GK4 A;  1MFZ A;  1N86 A;  2ITA A;  1EZV I;  1KYO D;  1H88 A;  1JY2 N;  2H89 C;  3W67 A;  1KB9 D;  3AED C;  1FZG A;  2KP8 A;  1KB9 H;  5DJU B;  1ZP0 C;  3B5N D;  1BE3 G;  1ZRT E;  2A06 G;  2HPC B;  3L72 G;  1NTZ K;  4DCK A;  2V7Q J;  1KIL A;  2C0X A;  4OVN F;  3CLQ A;  1GMJ A;  1G1I A;  3GHG A;  2D2C D;  3KXD A;  3A3Y B;  3OA7 A;  4I6M C;  2IBZ G;  1ZXG A; 
#chains in the Genus database with same CATH homology
 2QM8 A;  3LID A;  1L0L K;  1IC2 A;  2BAS A;  1JO5 A;  1FZF A;  3U1A A;  3BRT B;  2KYV A;  1RE3 A;  5AVZ B;  2FFD C;  2OYH C;  3N4X A;  5CCG C;  3V5B A;  2C0W A;  2WIT A;  4M3L A;  1LWU A;  3M06 A;  5AVR B;  3RL0 C;  5AW9 B;  3TSI A;  2XNX A;  2GUV A;  2YKQ A;  3SWF A;  1A02 J;  5APY A;  2XU6 A;  1JY3 N;  2YNY A;  1RE4 C;  1HWT C;  3RL0 B;  3OAK A;  3SWY A;  4DZO A;  1LGH B;  1YTZ I;  1L0N K;  2M3B A;  2NPS B;  3MIW A;  2W27 A;  2WZ7 A;  2R3C A;  3T97 A;  1KQL A;  4IFM A;  1NKN A;  1IK9 A;  3L4F A;  1SP4 A;  5AVT B;  2IPP A;  2NPS A;  1MUU A;  2HOD A;  1FOS F;  2W6B A;  1HH0 A;  1NWQ A;  3HTK A;  3H32 B;  2P1J A;  1CW5 A;  3HUS C;  1M7L A;  2H43 A;  5AW6 B;  1JY3 O;  3HE4 A;  4OH8 B;  3OJA B;  4GT1 A;  2A45 I;  1GW3 A;  1GL2 A;  2A45 G;  1GU5 A;  5KJ7 D;  3HUS B;  2Z4E A;  2POH A;  3NXS A;  5KJ7 C;  3A2A A;  1J1D C;  2J58 A;  1NHL A;  4WB4 A;  2WSE H;  1CI6 A;  1FDM A;  1VPC A;  2YMY A;  1QL2 A;  3WMM 0;  3II6 A;  1NKZ B;  3VN0 A;  1CZQ A;  2QM7 A;  4ZKU A;  1GU4 A;  2XZR A;  1LT9 B;  2Z5I A;  5APV A;  1SQP K;  1N7S A;  4N78 E;  3HD7 C;  3B5N C;  3PP5 A;  1JCD A;  2ZXE B;  4KHX A;  1KIL D;  4WBA A;  1LT9 A;  1IFN A;  3RK2 D;  5AW7 B;  1HUC A;  3RK2 C;  4AYC A;  3KDP B;  2HPC A;  1FZC C;  2P7J A;  3HD7 B;  1N73 A;  1MZ9 A;  3B5N B;  1RF0 A;  3A7O A;  2PAJ A;  4JYC A;  5AW2 B;  4Y99 C;  3P8C D;  1URQ C;  2N1T C;  5BU8 B;  2W6A A;  2P2U A;  2OYI C;  1KFN A;  1YTZ T;  4HYT B;  4LC1 A;  2IFN A;  2OAR A;  3VMX A;  1N7L A;  3BAT A;  2WPR A;  2IFM A;  4JF7 A;  3VP8 A;  1IFJ A;  2N1T B;  2YKP A;  4C46 A;  5AW0 B;  4C7N B;  2OYI B;  1L4A B;  1N2D C;  3M9Q A;  3O8Z A;  3M0D C;  2JEE A;  1JNM A;  2YO3 A;  1HVV A;  4HH2 A;  2PP6 A;  1XTC C;  3MD0 A;  5AVY B;  1CSB A;  1ZR4 A;  1L4A A;  3BRV B;  2WWW A;  1J1E C;  1IJD B;  1JY2 P;  5CCH A;  1JUN A;  2FFD B;  2KSJ A;  2FXM A;  4XE5 B;  4WY4 D;  2OYH B;  3C9I A;  4WY4 C;  2FFD A;  4ZKP A;  1GTW A;  2HLO A;  3EFG A;  2R5D A;  1SFC D;  1T2K D;  4B86 A;  2OYH A;  1SFC C;  2Z5H A;  5CCG A;  3EQ2 A;  4LGD E;  1FBM A;  1OWA A;  5CHX A;  5AW8 B;  5BVZ A;  1T3J A;  1WRG A;  5AVV B;  4XA4 A;  2HFE D;  2Q9I A;  1X8Y A;  2NPS D;  2CPB A;  1XTG B;  2WTY A;  1X79 B;  1ZV8 A;  3M0A A;  1RE4 A;  5APX A;  1S9K E;  2KLV A;  2H8P D;  3TK1 A;  4N3Y B;  1SQQ K;  4C7R A;  1WT6 A;  5AVW B;  3M91 A;  5AW3 B;  5CJ0 A;  2O01 H;  1NO4 A;  1GL2 D;  2J59 M;  1GZL A;  3TNU B;  3H32 A;  1OXZ A;  2E42 A;  2R32 A;  3L37 A;  4LLH A;  2H7H A;  3KPE A;  1NAF A;  3R2P A;  1RY3 A;  3MGN A;  1FJK A;  3TNU A;  1M1J C;  3A5T A;  2R5B A;  4GIF A;  1LTJ C;  2JJL A;  1RF1 C;  3HUS A;  5AW4 B;  2FYU K;  1Z56 A;  2I1K A;  5AVU B;  3U1C A;  3CL3 D;  1M1J B;  4AQR D;  1IFI A;  5APS A;  4JYB A;  1J1D B;  3VP9 A;  1LTG C;  2WT7 B;  1LTS C;  1N7S D;  1QL1 A;  1JCC A;  1SQB K;  2KB7 P;  1RF1 B;  1GW4 A;  1JY3 P;  1KFM A;  5AW1 B;  3V2P A;  2Q3I A;  1J2J B;  3VYI A;  3MTU E;  2C9L Y;  5CJ4 A;  1DX7 A;  5CMZ A;  1KIL C;  1LTB C;  1HJB A;  5AVQ B;  4IFF A;  4GKG A;  2XKM A;  3VMY A;  3V2N A;  1N73 C;  2XV5 A;  2KOG A;  3LIE A;  3KYQ A;  1E5W A;  1GD2 E;  1FU1 A;  3LW5 H;  3GHG C;  2E43 A;  1H89 A;  1KIL B;  2N9B A;  2O1K A;  2I1J A;  3HD7 A;  5AVX B;  3RK2 B;  1NTM K;  3B5N A;  4EIJ A;  5KLV K;  2IX7 C;  2ZFC A;  3RK3 D;  1FJP A;  1FZC B;  3L35 A;  2O1J A;  4RES B;  1W2E A;  3GHG B;  1JOC A;  1GDT A;  2FYZ A;  1JTH B;  4Y99 B;  1LTT C;  3P32 A;  2A45 H;  1FZC A;  1SVF A;  1NU1 K;  3VTP C;  1RE3 C;  3IFM A;  1URQ B;  1JTH A;  1LWU C;  1A02 F;  4W7Y A;  1GK6 A;  1URQ A;  2N1T A;  4DOJ A;  4C7N A;  1ZR2 A;  3H6P A;  5AW5 B;  2OYI A;  4N6J A;  1ZN5 A;  1G2C B;  1FZE A;  3NMD A;  1LWU B;  2Q7C A;  2L5G B;  5BU5 A;  3VOP A;  1EQ7 A;  3TYY A;  3P8M C;  5CCG D;  5KTB A;  1J1E B;  1G2C A;  3M0D A;  3RL0 D;  1T2K C;  2HG5 D;  4I1L A;  3V2R A;  1VDF A;  3MUD A;  1T3U A;  4WY4 B;  1AQ5 A;  1YYC A;  2WSF H;  3B8E B;  1NH4 A;  2NPS C;  1AFO A;  1NOH A;  4N78 D;  1SFC B;  3P7K A;  1DEB A;  3V4W A;  1SLQ A;  2C9N Y;  4WY4 A;  3P8C E;  3HE5 B;  2WPS A;  2Q5U A;  1DH3 A;  3HRN A;  3M9H A;  2P67 A;  3E1I A;  1SFC A;  1SQX K;  1GL2 C;  2HOD B;  3HE5 A;  5APQ A;  2VRS A;  1NTK K;  1HGZ A;  1ZLL A;  3HTK B;  1HTL C;  1IFD A;  3VMZ A;  3HE4 B;  1IFM A;  3UIA A;  1T8Z A;  1MV8 A;  1GL2 B;  3N7N A;  5APT A;  3I5C A;  5AVS B;  2GM4 A;  3V4Q A;  3NTN A;  5APW A;  1LTJ B;  3BAS A;  1SQV K;  1CI6 B;  1N7S C;  4EOT A;  1IO4 A;  1FZA A;  3M9B A;  1M1J A;  2XDJ A;  5KJ7 A;  1FZB A;  1GK4 A;  2LKM A;  1MFZ A;  1N86 A;  1LTJ A;  2WT7 A;  1LT9 C;  1RF1 A;  4O9B A;  1PFI A;  1H88 A;  1JY2 N;  2WPQ A;  1N7S B;  2YO2 A;  4I2L C;  1FZG A;  1RF0 C;  2CPS A;  2KP8 A;  3NFQ A;  1FAV A;  1LTI C;  2HYN A;  3HD7 D;  1HGV A;  3B5N D;  1FOS E;  3U59 A;  4AUW A;  3KQG A;  2HPC B;  1LTA C;  2M8R A;  1N73 B;  2WSC H;  3BVH A;  1NTZ K;  2GUS A;  1KIL A;  3RK3 C;  1X9V A;  4W7Z A;  2C0X A;  3CLQ A;  3CI9 A;  1G1I A;  1KZU B;  1HBW A;  3GHG A;  5APU A;  1H8A A;  1S9K D;  4W80 A;  1JMM A;  3RK3 B;  1JY2 O;  3A3Y B;  4IFD K;  3G3Z A;  2MJZ A;  1URQ D;  2N1T D;  3OA7 A;  4I6M C;  2YKO A;  1L4A D;  3V2Q A;  5CCH D;  3L36 A;  1L4A C;  1G1J A;  5CCH C;  2FKW B;  3IR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...