1N7SB

High resolution structure of a truncated neuronal snare complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
68
structure length
68
Chain Sequence
GSALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High Resolution Structure, Stability, and Synaptotagmin Binding of a Truncated Neuronal SNARE Complex
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transport protein
molecule keywords vesicle-associated membrane protein 2
total genus 31
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2002-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n7sB00
4LGDE 1SFCB 1KILB 2N1TD 5CCHD 2HFED 3RL0D 3HD7C 2N1TC 5KJ7C 3M0DC 1L4AC 4OH8B 3RK3D 3B5NB 3RK2C 1KILA 3RL0C 1SFCA 3HD7D 5CCGC 1N7SD 2M8RA 5KJ7D 1L4AA 1L4AD 1GL2D 3RK3C 2YMYA 2HG5D 2N1TA 3RK2D 1N7SA 2NPSB 4N78E 5CCGD 1N7SC 1URQC 4WY4B 1JTHA 1GL2A 1GL2C 4W7YA 4W7ZA 1URQA 3KYQA 1XTGB 3TSIA 1KILC 1URQD 3PP5A 5CCGA 1SFCC 3HD7B 1KILD 1JTHB 2PP6A 4WY4A 5KJ7A 4W80A 2KOGA 3B5NC 3HD7A 3RK2B 1SFCD 1T3JA 2N1TB 1L4AB 3P8CE 4WY4D 1HVVA 3RK3B 3B5ND 3RL0B 2NPSC 2XDJA 3B5NA 3HTKB 1URQB 2H8PD 5CCHA 4WY4C 1NHLA 1GL2B 2WZ7A 2NPSD 2NPSA 1N7SB 3VOPA 4JF7A 5CCHC
chains in the Genus database with same CATH superfamily
2WSEH 5KLVG 3M91A 5AVXB 3CCVP 3W68A 1EDKA 2KS1A 1Q2NA 3R2PA 3L36A 1LGHB 1WMKA 1LTAC 2MJZA 3L75D 1SQXD 3CMEP 2OYIB 1NU1K 1SFCB 2V4HA 1BDDA 2P1JA 1KILB 1RE3A 2M3BA 5AW6B 2PFXA 3AE8C 3CCJP 3O6QB 4GT1A 5KTBA 1LTIC 4IFDK 1DEEG 2FXOA 4OGQC 1S4XA 3GHGA 5CCHD 1K73Q 1LJ2A 2H89C 4R4LA 3L73D 5AW8B 2RMZA 2WSCJ 3AE9C 3VMYA 4KT0J 4EIJA 5E79E 2B89A 1U57A 1KD1Q 2KI7B 3H1LJ 5L8RJ 1ZMEC 2M3EA 1JOCA 1NTZE 1SQVD 2I8DA 2N1TC 3C8VA 3FWLA 3IF4A 2J58A 2Y0EA 4JQ0D 4IFMA 2KNCA 5APXA 1VQOP 2WPSA 2WT7B 4D6TG 2K9YA 2YO3A 3M9QA 3B5NB 2O01H 1VQ7P 1JY3P 1X9VA 3TGUJ 1K04A 3SWKA 2H43A 3NFQA 5TISE 5KLIB 2OTKE 2WSSH 3L72G 3N4XA 1M1JB 3BRTB 1T2KC 1DD4A 1PP9D 3A0BE 2YKOA 2QIWA 2E75C 3CMAP 4WBAA 1HUCA 1EZVG 3CCUP 1L4AD 1NAYA 2WWWA 4O9BA 2N9BA 1NTZK 2KUBA 1OXZA 4GKGA 1L0NK 3H32B 2AEMA 4JYCA 4Y99B 3VTPC 4N3YB 1NAFA 2NPSB 5GTIE 3QH9A 2OYHB 1VQNP 4ASVA 3BRVB 2K37A 1WRGA 2PRRA 1OFCX 1PL5A 2W6BA 3AECC 1YIJP 4PV1D 4WY4B 1Q81Q 1GL2C 2E5TA 3K5BA 1SQQJ 1HGZA 4W7YA 3WU2H 3VYIA 1URQA 1BDCA 1DD3A 3CX5E 1NTKG 1XTGB 3EQ2A 4IOIH 1LWUA 2W83C 2LKMA 3TNUB 2H7HA 2YKQA 3V4WA 4DOJA 1URQD 2A06G 2W8ZA 1YBKA 3AE1C 3H1HJ 5AVRB 2XV5A 1SQXJ 2J59M 3U1CA 1LT1A 2C9NY 3AE5C 1FZGA 1ZR4A 4BRYA 4I7ZC 1G1JA 3H25A 3U59A 1U7JA 3WUTA 1BCCE 2AXTE 1W2EA 2R3CA 2FFDA 1BSHA 3HD7B 1RF1B 1IFPA 2E76B 2ITAA 3L73J 2POHA 1A02F 3C1LA 2E74B 3IAOA 1JY2P 1IC2A 4GOFA 1LP1A 1RQUA 3MGNA 2KYVA 1PZQA 1NTKD 1S2EA 3TYYA 1GK6A 2BASA 4C7RA 3CCMP 1CW5A 1QVFO 1T3JA 1NTMG 1KFMA 2JWDA 2QJYB 3CI9A 2FYUD 1KV4A 1EC5A 1QEXA 1KFNA 1L4AB 3MHVA 1IO4A 2YXQB 2O1JA 2QJKB 2AXTH 3RK3B 1Y8AA 3A0HH 5KAFE 3S1KA 1NGMB 1FJPA 1XTCC 2KP8A 2MKVA 1YITP 2NRGA 1YI2P 3NXSA 1RY3A 1SQVE 1FDOA 2KZIA 3RGUA 2AXCA 1CSBA 4K3AA 4IL6H 4ZKUA 1J1DB 3H1ID 2P2UA 3AEAC 2I1KA 1FZCA 3AE4C 1M1KQ 4CPGA 1PPJE 2O3JA 4IL6E 2WITA 3CX5H 3TGUE 1P84E 1U7MA 3AEFC 4JYBA 1G2CB 3FX0A 4I2LC 3CL3D 5APSA 3CCSP 5E79H 4YXDC 1N2DC 2WSEJ 4H44C 1W2BO 3A0HE 3KDPB 1D7MA 5AVUB 2A45I 1JM0A 5AVWB 2B87B 2ZT9C 4JF7A 4UB6E 3A7OA 2FYUE 1FS0E 2ZFCA 4GDOA 1H0TA 5CJ0A 3V5BA 3ZDMA 3EFFK 2YIUC 3L71E 5CBNA 1BGYD 1LWUC 2Y0DA 3H1HD 5BU8B 1VQPP 5TISH 2Z4EA 1SQVK 2K3RA 3LW5J 4C7NA 2IZ1A 1OX3A 3FXEA 3I5CA 1KILE 1VF5D 3HUSC 3L4FA 2E74D 1P84H 1H8AA 2Y0CA 3G9RA 1NTKK 2SPZA 5TJHA 3M0AA 1NWQA 2O01N 3MUDA 1HGVA 1EDJA 1NO4A 3OA7A 4HYTB 3SFEC 1HTLC 1M8OB 2OYOA 3P32A 4K35A 1KB9H 5KKZC 2FY8A 4YXWH 4WB4A 1L0LE 3CXHD 5C39A 1NTKJ 3CC2P 2WPVB 3Q1MA 4OH8B 1SQXE 1LTJC 1WT6A 1FZEA 1M56D 4H0LB 5AW9B 3USSA 4ASWA 1NKNA 2FYUJ 1AVYA 2L5GB 2PAJA 3G71P 2W6AA 2IPPA 2QJPB 1NTZG 3RK2C 3V2NA 2Y9YA 4WWIA 3CXHH 5CCGC 2ZJSE 2Q9IA 2KK7A 5KAIE 2M8RA 3L73G 4A7PA 1RE4A 1YYCA 1H0TB 3H1HG 1USEA 1S9KE 4UB6H 1YJNP 2YMYA 2C0XA 1OZHA 1YTZT 2HG5D 2N1TA 3E1RA 3H1IJ 2IDBA 2Y9ZA 2E43A 3RK2D 1Q90D 2FKWB 1IJDB 3VP8A 1SQPE 1X79B 3VMAA 1G2CA 1HJ0A 2LR2A 3GW6A 3JC22 3VMZA 1QVGO 2C9LY 1EXJA 2Z5HA 2GUVA 2BEQD 4H13C 3H1JJ 1N7LA 5APUA 4MN4C 3WUVA 4AYCA 1SQBJ 1FZCB 1ZR2A 3M9BA 3PRJA 1LT9B 2ZXXA 1L0LD 3CXHE 3IN6A 1J1EC 3A0BH 1JMMA 1NJIQ 2BCCJ 2IYOA 3B71A 1AA0A 1BE3J 2IBZE 2AEFA 3P7KA 3H1IE 4QMAA 5KLVD 1S5LH 5KAFH 3H1LG 3D70A 4PD4H 3CWBG 1GW3A 3V2RA 4PV1C 1KN7A 1BGYJ 3S9OA 4D6TE 3PLNA 1KQLA 1OW6A 3TF5A 1Q7YQ 1RHZB 3PHLA 3PP5A 3OW2O 5AVSB 3RK3E 1SQQK 1ZN5A 3CC7P 3L75E 4W80A 1SFCC 2QM8A 3OJAB 4OVNF 3BASA 1LT9A 1MFTA 3D71A 1FE6A 1IK7A 2C0WA 1W5CE 2PP6A 1BCCJ 2P58A 4OGQB 5AVTB 3KQGA 1IK9A 1MV8A 2OQQA 4LLHA 1GU4A 3JSVC 1NTME 5KJ7A 3D6YA 2KOGA 1S5LE 2G8YA 1RF1A 3HD7A 4TLFA 2FFDB 1AV1A 2WVRA 4DCKA 2N1TB 1VQMP 3AE7C 3KZIE 1NYHA 1OWAA 5APVA 1T6AA 2OGUA 1SP4A 4BRYB 1T2KD 3P8CE 1AFOA 3I56P 4WY4D 1SQXG 1YJ9P 1GZLA 3JCUE 3F5HA 5AW1B 1KYOE 5BU5A 1PGJA 2QE7H 4DT0A 1BCCG 3II6A 3SSUA 1S1CX 4XA4A 1NTMJ 5B5EE 4Y28J 1YJWP 1PP9E 2QM7A 5APTA 5GTIH 2XDJA 1ZOYC 1MUUA 2ZXEB 4KHXA 1OVVA 1ZP0C 3D6ZA 1URQB 3H1KG 1FBMA 2YO2A 5CMZA 1ZXGA 1KB9I 3Q5RA 3H1JD 4EOTA 3L70G 1DX7A 1SQBD 2OYHC 2OYHA 2NPSA 1JMBA 4RKUJ 1YTZI 1L0LJ 3L71G 1BE3G 5B66H 3JCUH 2FYNB 1CZQA 3H32A 2QEXP 1VQ6P 3S4RA 2BCCD 3PH0A 1KYOI 1BE3D 1L0ND 5KLVJ 3G4SP 1VQ5P 1N73C 1BGYG 1MZ9A 1FDIA 4C7NB 4U3FJ 1SQBG 2P7JA 3CX5D 4EYYQ 3P8CD 4HH2A 1KTMA 3CCRP 5H2FE 1IZNB 1EQ7A 1M1JA 2E76D 3AEDC 3H1KE 3TGUG 1DIPA 5KAIH 2B87A 2YMKA 4L74A 1Q82Q 1DEBA 2ZVOB 3CWBE 5AW5B 2WT7A 2HR3A 2KNCB 4GOEA 4RESB 4BWNA 3L74D 4I7ZB 1FC2C 2JJLA 3A2AA 3F89A 1SQPK 5AW7B 1BCCD 1NVOA 3QWOC 2WPRA 3KXDA 5APYA 3RL0D 2YKPA 1GU5A 1SQVG 3GG2A 3HD7C 2KXPB 1K9MQ 2E76C 5AW0B 3H1JE 5KJ7C 2Q1KA 2A06D 1SQBE 2XNXA 1VF5C 1BGYE 2E74C 3GHGB 3ITKA 3RK3D 4KJMA 5AW3B 1EDLA 1JUNA 2P10A 1J2JB 1QX8A 3O6QA 4N6JA 2QRXA 1H88A 3CWBJ 2RH0A 1BE3E 1KILA 1LNQA 2H88C 3AE3C 3RL0C 1SFCA 3V4QA 3AEBC 3Q3DA 2QJYC 1JY2O 2Q3EA 3SFDC 3L72J 3RBZA 1VQ4P 1N7SD 2KS1B 2HYNA 3EWKA 4L75A 3MP7B 4PD4I 3HE4A 1OIPA 1NTMD 1L4AA 3IFMA 1L0LK 3GLMA 3M0DA 3RK3C 1FDMA 1KQFB 4XE5B 2G3AA 3M06A 1AVOA 1K05A 5AW2B 1FJKA 1N7SA 2WTYA 1Q86Q 4N78E 4HJGH 5B5EH 1LP1B 1JB0J 5AVZB 5CCGD 1J1DC 1N7SC 2HODA 2L91A 1HWTC 4NPEA 4OWFA 1GMJA 1FZBA 1X0TA 1ZW0A 2D2CB 4W7ZA 1MFZA 3CCEP 1HH0A 2P67A 2A06E 1PGOA 5CJ4A 3L74G 2CK3H 2QG4A 3W67A 2RN0A 1OW7A 1IFMA 2OARA 3KYQA 1L0NJ 3HE5B 1UIXA 1G1IA 2B88A 2PGDA 3PTZA 2OYIC 1LTBC 3LIDA 4U3FD 1KILC 2JP3A 4H13D 1HBWA 1RF0C 3KZIH 1N86A 1SQPD 2K88A 2Q3IA 3FXDA 1EXIA 3TNUA 4Z1MH 2K1AA 2B9BA 1SQPG 1S5LX 2ZYDA 1GW4A 2ZVNB 1LWUB 3E1IA 4I1LA 5CCGA 3GF3A 1E79H 1Z56A 2JEEA 4U3FG 2I1JA 5H2FH 2GUSA 4NPDA 4WVZA 2BCCE 3RL0g 3L74J 3L75G 3U1AA 1KILD 2HPCA 1FZFA 1AJYA 1JCDA 3LIEA 4WY4A 1AQTA 5DJTB 1HJBA 2IBZD 1AQ5A 5DJUB 3A3YB 3FGAD 3SWYA 2CPBA 4AQRD 1IFNA 2ZYAA 3B5NC 5AVYB 2NZ2A 3BATA 4PD4E 3GF7A 3L70J 1NOHA 5AW4B 5KLIC 5CBOA 3H1KD 1SFCD 1M1JC 2ZAEB 5KKZB 1LTGC 1M90Q 1EZVD 2E5YA 1QGKB 1VQ9P 5GTHE 3CWBD 2IFMA 3TDKA 2E75B 3CLQA 1VQ8P 2R5BA 1PIXA 3HUSA 3L72D 2KSJA 3NTNA 1N73A 1ZRTD 3B5ND 2KLVA 3TSIA 2QJPC 4Y99C 1NKZB 2BCCG 3AEEC 5APWA 2NPSC 3O8ZA 1OVUA 2A45H 1JY3O 3B5NA 2XU6A 3GMAA 1S9KD 4HKZH 3Q5PA 1VQKP 3G3ZA 2H8PD 4BXLA 4ZKPA 4WY4C 4ZMDA 1GL2B 2XZRA 5APQA 1PV3A 1SQXK 4IL6X 3L37A 4ZNCA 1H89A 2R32A 5CCHC 2E42A 1LTSC 3VOPA 4PD4D 2A45G 1RQVA 3VP9A 1RF0A 5M1BA 1FZCC 4OGQD 4UB8E 3TK1A 1GDTA 1LT9C 1OW8A 2LXBA 4L73A 3PJSK 1VDFA 2OYIA 1ZLLA 4N78D 3OAKA 4EI2A 1CI6B 2JKVA 1M57D 3KHUA 3UIAA 3T97B 4LGDE 2IX7C 1RH5B 1SQPJ 2XKMA 1ZRTE 1R5SA 1IFDA 1SQBK 2N1TD 3MTUE 4PV1B 4B86A 1RF1C 3Q5SA 3VMXA 4R4MA 1GTWA 1S72P 2M5AB 3MD0A 1SQQG 1QL2A 1KB9E 1X22A 4PJ0H 1QL1A 1IFIA 3V6IA 4GODA 3WU2E 2HFED 1M7LA 1SLQA 2FBWC 3KPEA 5B66E 1NTKE 5AVQB 4U3FE 4DJGA 1L0NE 2QVAA 4PJ0E 1KMIZ 2O1KA 2YNYA 4DZOA 2E75D 1NU1D 3BCCD 3L70D 3CCQP 2FXMA 1L4AC 3M0DC 4I6MC 2FYUG 3H1KJ 5K5GB 1HF9A 1SS1A 3HTKA 2QJKC 3MIWA 3BVHA 1KZUB 1PGPA 2WSFJ 4GIFA 3Q2YA 3H1JG 2KLUA 4JBZA 2JR8A 4JPZB 2FFDC 3EFGA 3HRNA 1JO5A 1EDIA 2WSCH 3HD7D 3NMDA 3T97A 1CI6A 1FU1A 2WMMA 5BVZA 1NH4A 3L74E 1SQQE 2RKLA 5CHXA 1Y9BA 1BSNA 1QLED 1S3JA 5KJ7D 3V2QA 1GL2D 1PPJG 2HLOA 1VPCA 2IFNA 1KYOD 2FYZA 1PPJD 2V7QJ 1N73B 2JO1A 3LW5H 3VN0A 1P84D 2K9JB 1R8EA 1KORA 2QA4P 2ZYGA 3V2PA 3WMM0 3CPWO 1LTJA 2FXPA 3L35A 1FOSE 4H44B 1URQC 3CD6P 1NTZJ 1A02J 3C9IA 2KSEA 3AE2C 1JTHA 1GL2A 4HB1A 2UWJE 1FZAA 2ZT9B 1NTMK 4TT3H 1NU1E 3BCCE 3CCLP 1KQGB 1RE4C 2R3SA 1P84I 2GA1A 2LXCB 2YIUB 3L71D 4D6TJ 1X8YA 4UB8H 2KB7P 4U7JA 1JNMA 2IBZI 2FYNC 1VQLP 2M0BA 1FAVA 1NU1G 3BCCG 2Q5UA 3G6EP 5GTHH 3L75J 3H6PA 3CXHI 3HUSB 4RJTA 1YHQP 2R44A 2W27A 2GM4A 1GK4A 2JDIH 5KLVK 1KYOH 1YQ3C 2CPSA 3E7KA 4AUWA 1JCCA 2BEZF 2WQYC 1T8ZA 1PGQA 1OVRA 1PP9G 1R5LA 2V7QH 1LTTC 1Y47A 4NPFX 1KQSO 2Z5IA 3MUDC 1JTHB 3I55P 3H1LD 1LTJB 3B8EB 4H0LC 2XNDH 3N7NA 1SQVJ 2IBZG 2IYPA 1NU1J 2QSIA 3BCCJ 2DW3A 2K9JA 3IR9A 4YTPC 3RK2B 3CC4P 2OTJP 4IFFA 1ZV8A 2WSFH 2Q6QA 2O01J 1UIIA 1VL2A 2IZ0A 3TGUD 1KB9D 1VF5B 1KC8Q 1OMIA 3GHGC 1MKMA 2HPCB 3M9HA 4LC1A 1K8AQ 1HVVA 1PP9J 1DH3A 4XFJA 2Q7CA 4H0LD 2N9YB 1RE3C 3RL0B 1SVFA 1L2PA 4YPCA 2R5DA 3WUUA 3ABVC 1L0NG 1YQ4C 3HE5A 2WPQA 3L70E 1JEKA 1FOSF 3SWFA 1TU3F 3AE6C 3HTKB 4H44D 5EFWB 1USDA 4M3LA 3B4SA 2AEJA 3H1HE 3AEGC 3MZWB 2ZT9D 3P8MC 2FYUK 1EZVI 2D2CD 3L73E 1NHLA 4H13B 3RBXA 2YXRB 5CCHA 3FWNA 1GD2E 1IFJA 1EZVE 2JWAA 2OTLP 2J5UA 2HODB 3CX5I 1J1EB 1NTZD 1JY3N 2KZJA 2W90A 1PFIA 3H1LE 2WZ7A 5KLVE 1SQQD 2NPSD 3H1IG 4EDFA 1E5WA 1N7SB 3L72E 3R4YA 4C46A 4RO0A 2W6JH 1JY2N 4L76A 2VRSA 2M5AA 5AVVB 1T3UA 3A5TA 1L0LG 3L71J 2D2CC 4D6TD 2KIKA 1N8RQ 3HE4B
chains in the Genus database with same CATH topology
2WSEH 3M91A 5AVXB 3R2PA 3L36A 1LGHB 1LTAC 2MJZA 2OYIB 1NU1K 1SFCB 3TK1A 2P1JA 5AW6B 1KILB 1RE3A 2M3BA 4GT1A 5KTBA 1LTIC 4IFDK 3GHGA 5CCHD 5AW8B 3VMYA 4EIJA 1JOCA 2N1TC 2J58A 5APXA 4IFMA 2WPSA 2WT7B 2YO3A 3M9QA 3B5NB 2O01H 1JY3P 1X9VA 2H43A 3NFQA 3N4XA 1T2KC 1M1JB 3BRTB 2YKOA 4WBAA 1HUCA 1L4AD 4O9BA 2WWWA 2N9BA 1NTZK 1OXZA 4GKGA 1L0NK 3H32B 4JYCA 4Y99B 3VTPC 4N3YB 1NAFA 2NPSB 2OYHB 3BRVB 1WRGA 2W6BA 4WY4B 1GL2C 4W7YA 1HGZA 3VYIA 1URQA 1XTGB 3EQ2A 1LWUA 2LKMA 3TNUB 2H7HA 2YKQA 3V4WA 4DOJA 1URQD 5AVRB 2XV5A 2J59M 3U1CA 2C9NY 1FZGA 1ZR4A 1G1JA 3U59A 1W2EA 2R3CA 2FFDA 3HD7B 1RF1B 2POHA 1A02F 1JY2P 1IC2A 3MGNA 2KYVA 1GK6A 2BASA 4C7RA 1CW5A 1T3JA 1KFMA 3CI9A 1L4AB 1KFNA 1IO4A 2O1JA 3RK3B 1FJPA 1XTCC 2KP8A 3NXSA 1RY3A 1CSBA 4ZKUA 1J1DB 2P2UA 2I1KA 1FZCA 2WITA 4JYBA 1G2CB 4I2LC 3CL3D 5APSA 1N2DC 3KDPB 5AVUB 2A45I 5AVWB 4JF7A 3A7OA 2ZFCA 5CJ0A 3V5BA 1LWUC 5BU8B 2Z4EA 1SQVK 4C7NA 3I5CA 3L4FA 3HUSC 1H8AA 1NTKK 3M0AA 1NWQA 3MUDA 1HGVA 1NO4A 3OA7A 4HYTB 1HTLC 3P32A 4WB4A 4OH8B 1LTJC 1WT6A 1FZEA 5AW9B 1NKNA 2L5GB 2PAJA 2W6AA 2IPPA 3RK2C 3V2NA 5CCGC 2Q9IA 2M8RA 1RE4A 1YYCA 1S9KE 2YMYA 2C0XA 1YTZT 2HG5D 2N1TA 2E43A 3RK2D 2FKWB 1IJDB 3VP8A 1X79B 1T2KD 2C9LY 1G2CA 3VMZA 2Z5HA 2GUVA 5APUA 4AYCA 1N7LA 1FZCB 1ZR2A 3M9BA 1LT9B 1J1EC 1JMMA 3TSIA 3P7KA 1GW3A 3V2RA 1KQLA 3PP5A 5AVSB 1SQQK 1ZN5A 1SFCC 2QM8A 3OJAB 3BASA 1LT9A 2C0WA 2PP6A 5AVTB 3KQGA 1IK9A 1MV8A 4LLHA 1GU4A 5KJ7A 2KOGA 1RF1A 3HD7A 2FFDB 2N1TB 5APVA 1OWAA 1AFOA 1SP4A 3P8CE 4WY4D 1GZLA 5AW1B 5BU5A 3II6A 4XA4A 2QM7A 5APTA 2XDJA 1MUUA 2ZXEB 4KHXA 1URQB 1FBMA 2YO2A 5CMZA 4EOTA 1DX7A 2OYHC 2OYHA 2NPSA 1YTZI 3H32A 1CZQA 1N73C 1MZ9A 4C7NB 2P7JA 3P8CD 4HH2A 1EQ7A 1M1JA 1DEBA 2WT7A 5AW5B 4RESB 2JJLA 3A2AA 1SQPK 5AW7B 5APYA 3RL0D 2WPRA 1GU5A 2YKPA 3HD7C 5AW0B 5KJ7C 2XNXA 3GHGB 3RK3D 5AW3B 1JUNA 1J2JB 1H88A 1KILA 3RL0C 3V4QA 1SFCA 1JY2O 1N7SD 2HYNA 2GM4A 3HE4A 3IFMA 1FDMA 1L4AA 3M0DA 1L0LK 3RK3C 4XE5B 3M06A 5AW2B 1FJKA 1N7SA 2WTYA 4N78E 5AVZB 5CCGD 1J1DC 1N7SC 2HODA 1HWTC 1FZBA 4W7ZA 1MFZA 1HH0A 2P67A 5CJ4A 1IFMA 2OARA 3KYQA 3HE5B 1G1IA 2OYIC 1LTBC 3LIDA 1KILC 1HBWA 1RF0C 1N86A 2Q3IA 3TNUA 4I1LA 1GW4A 1LWUB 3E1IA 5CCGA 2JEEA 1Z56A 2I1JA 2GUSA 3U1AA 1KILD 2HPCA 1FZFA 1JCDA 3LIEA 4WY4A 1HJBA 1AQ5A 3A3YB 4AQRD 3SWYA 2CPBA 1IFNA 3B5NC 5AVYB 3BATA 1NOHA 5AW4B 1SFCD 1M1JC 1LTGC 2IFMA 3CLQA 2R5BA 3HUSA 2KSJA 3NTNA 1N73A 3B5ND 2KLVA 4Y99C 1NKZB 5APWA 2NPSC 3O8ZA 2A45H 3B5NA 1JY3O 2XU6A 1S9KD 3G3ZA 2H8PD 4ZKPA 4WY4C 1GL2B 2XZRA 5APQA 1SQXK 1H89A 3L37A 2R32A 2E42A 1LTSC 3VOPA 2A45G 3VP9A 1RF0A 1FZCC 1GDTA 1LT9C 1VDFA 2OYIA 1ZLLA 4N78D 3OAKA 1CI6B 3UIAA 4LGDE 2IX7C 2XKMA 1IFDA 1SQBK 2N1TD 3MTUE 4B86A 1RF1C 3VMXA 1GTWA 3MD0A 1QL2A 1QL1A 1IFIA 2HFED 1M7LA 1SLQA 3KPEA 5AVQB 2O1KA 2YNYA 4DZOA 2FXMA 1L4AC 3M0DC 4I6MC 3HTKA 3BVHA 3MIWA 1KZUB 4GIFA 2FFDC 3EFGA 3HRNA 1JO5A 2WSCH 3HD7D 3NMDA 3T97A 1CI6A 1FU1A 5BVZA 1NH4A 5CHXA 5KJ7D 3V2QA 1GL2D 2HLOA 1VPCA 2IFNA 2FYZA 3VN0A 3LW5H 3V2PA 3WMM0 1LTJA 3L35A 1FOSE 1URQC 1A02J 3C9IA 1JTHA 1GL2A 1FZAA 1NTMK 1RE4C 1X8YA 1JNMA 2KB7P 1FAVA 1N73B 2Q5UA 3H6PA 3HUSB 2W27A 1GK4A 5KLVK 2CPSA 4AUWA 1JCCA 1T8ZA 1LTTC 2Z5IA 1JTHB 1LTJB 3B8EB 4W80A 3N7NA 4N6JA 2HPCB 3IR9A 3RK2B 4IFFA 1ZV8A 2WSFH 3GHGC 3M9HA 4LC1A 1HVVA 1DH3A 2Q7CA 1RE3C 3RL0B 1SVFA 2R5DA 3HE5A 2WPQA 1FOSF 3SWFA 3HTKB 3TYYA 4M3LA 3P8MC 5CCHA 2FYUK 1NHLA 1GD2E 1IFJA 2HODB 1PFIA 1J1EB 1JY3N 2WZ7A 2NPSD 1E5WA 1N7SB 4C46A 1JY2N 2VRSA 5AVVB 3A5TA 1T3UA 5CCHC 3HE4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LGD E;  1SFC B;  1KIL B;  2N1T D;  5CCH D;  2HFE D;  3RL0 D;  3HD7 C;  2N1T C;  5KJ7 C;  3M0D C;  1L4A C;  4OH8 B;  3RK3 D;  3B5N B;  3RK2 C;  1KIL A;  3RL0 C;  1SFC A;  3HD7 D;  5CCG C;  1N7S D;  2M8R A;  5KJ7 D;  1L4A A;  1L4A D;  1GL2 D;  3RK3 C;  2YMY A;  2HG5 D;  2N1T A;  3RK2 D;  1N7S A;  2NPS B;  4N78 E;  5CCG D;  1N7S C;  1URQ C;  4WY4 B;  1JTH A;  1GL2 A;  1GL2 C;  4W7Y A;  4W7Z A;  1URQ A;  3KYQ A;  1XTG B;  3TSI A;  1KIL C;  1URQ D;  3PP5 A;  5CCG A;  1SFC C;  3HD7 B;  1KIL D;  1JTH B;  2PP6 A;  4WY4 A;  5KJ7 A;  4W80 A;  2KOG A;  3B5N C;  3HD7 A;  3RK2 B;  1SFC D;  1T3J A;  2N1T B;  1L4A B;  3P8C E;  4WY4 D;  1HVV A;  3RK3 B;  3B5N D;  3RL0 B;  2NPS C;  2XDJ A;  3B5N A;  3HTK B;  1URQ B;  2H8P D;  5CCH A;  4WY4 C;  1NHL A;  1GL2 B;  2WZ7 A;  2NPS D;  2NPS A;  1N7S B;  3VOP A;  4JF7 A;  5CCH C; 
#chains in the Genus database with same CATH topology
 2WSE H;  5KLV G;  3M91 A;  5AVX B;  3CCV P;  3W68 A;  1EDK A;  2KS1 A;  1Q2N A;  3R2P A;  3L36 A;  1LGH B;  1WMK A;  1LTA C;  2MJZ A;  3L75 D;  1SQX D;  3CME P;  2OYI B;  1NU1 K;  1SFC B;  2V4H A;  1BDD A;  2P1J A;  1KIL B;  1RE3 A;  2M3B A;  5AW6 B;  2PFX A;  3AE8 C;  3CCJ P;  3O6Q B;  4GT1 A;  5KTB A;  1LTI C;  4IFD K;  1DEE G;  2FXO A;  4OGQ C;  1S4X A;  3GHG A;  5CCH D;  1K73 Q;  1LJ2 A;  2H89 C;  4R4L A;  3L73 D;  5AW8 B;  2RMZ A;  2WSC J;  3AE9 C;  3VMY A;  4KT0 J;  4EIJ A;  5E79 E;  2B89 A;  1U57 A;  1KD1 Q;  2KI7 B;  3H1L J;  5L8R J;  1ZME C;  2M3E A;  1JOC A;  1NTZ E;  1SQV D;  2I8D A;  2N1T C;  3C8V A;  3FWL A;  3IF4 A;  2J58 A;  2Y0E A;  4JQ0 D;  4IFM A;  2KNC A;  5APX A;  1VQO P;  2WPS A;  2WT7 B;  4D6T G;  2K9Y A;  2YO3 A;  3M9Q A;  3B5N B;  2O01 H;  1VQ7 P;  1JY3 P;  1X9V A;  3TGU J;  1K04 A;  3SWK A;  2H43 A;  3NFQ A;  5TIS E;  5KLI B;  2OTK E;  2WSS H;  3L72 G;  3N4X A;  1M1J B;  3BRT B;  1T2K C;  1DD4 A;  1PP9 D;  3A0B E;  2YKO A;  2QIW A;  2E75 C;  3CMA P;  4WBA A;  1HUC A;  1EZV G;  3CCU P;  1L4A D;  1NAY A;  2WWW A;  4O9B A;  2N9B A;  1NTZ K;  2KUB A;  1OXZ A;  4GKG A;  1L0N K;  3H32 B;  2AEM A;  4JYC A;  4Y99 B;  3VTP C;  4N3Y B;  1NAF A;  2NPS B;  5GTI E;  3QH9 A;  2OYH B;  1VQN P;  4ASV A;  3BRV B;  2K37 A;  1WRG A;  2PRR A;  1OFC X;  1PL5 A;  2W6B A;  3AEC C;  1YIJ P;  4PV1 D;  4WY4 B;  1Q81 Q;  1GL2 C;  2E5T A;  3K5B A;  1SQQ J;  1HGZ A;  4W7Y A;  3WU2 H;  3VYI A;  1URQ A;  1BDC A;  1DD3 A;  3CX5 E;  1NTK G;  1XTG B;  3EQ2 A;  4IOI H;  1LWU A;  2W83 C;  2LKM A;  3TNU B;  2H7H A;  2YKQ A;  3V4W A;  4DOJ A;  1URQ D;  2A06 G;  2W8Z A;  1YBK A;  3AE1 C;  3H1H J;  5AVR B;  2XV5 A;  1SQX J;  2J59 M;  3U1C A;  1LT1 A;  2C9N Y;  3AE5 C;  1FZG A;  1ZR4 A;  4BRY A;  4I7Z C;  1G1J A;  3H25 A;  3U59 A;  1U7J A;  3WUT A;  1BCC E;  2AXT E;  1W2E A;  2R3C A;  2FFD A;  1BSH A;  3HD7 B;  1RF1 B;  1IFP A;  2E76 B;  2ITA A;  3L73 J;  2POH A;  1A02 F;  3C1L A;  2E74 B;  3IAO A;  1JY2 P;  1IC2 A;  4GOF A;  1LP1 A;  1RQU A;  3MGN A;  2KYV A;  1PZQ A;  1NTK D;  1S2E A;  3TYY A;  1GK6 A;  2BAS A;  4C7R A;  3CCM P;  1CW5 A;  1QVF O;  1T3J A;  1NTM G;  1KFM A;  2JWD A;  2QJY B;  3CI9 A;  2FYU D;  1KV4 A;  1EC5 A;  1QEX A;  1KFN A;  1L4A B;  3MHV A;  1IO4 A;  2YXQ B;  2O1J A;  2QJK B;  2AXT H;  3RK3 B;  1Y8A A;  3A0H H;  5KAF E;  3S1K A;  1NGM B;  1FJP A;  1XTC C;  2KP8 A;  2MKV A;  1YIT P;  2NRG A;  1YI2 P;  3NXS A;  1RY3 A;  1SQV E;  1FDO A;  2KZI A;  3RGU A;  2AXC A;  1CSB A;  4K3A A;  4IL6 H;  4ZKU A;  1J1D B;  3H1I D;  2P2U A;  3AEA C;  2I1K A;  1FZC A;  3AE4 C;  1M1K Q;  4CPG A;  1PPJ E;  2O3J A;  4IL6 E;  2WIT A;  3CX5 H;  3TGU E;  1P84 E;  1U7M A;  3AEF C;  4JYB A;  1G2C B;  3FX0 A;  4I2L C;  3CL3 D;  5APS A;  3CCS P;  5E79 H;  4YXD C;  1N2D C;  2WSE J;  4H44 C;  1W2B O;  3A0H E;  3KDP B;  1D7M A;  5AVU B;  2A45 I;  1JM0 A;  5AVW B;  2B87 B;  2ZT9 C;  4JF7 A;  4UB6 E;  3A7O A;  2FYU E;  1FS0 E;  2ZFC A;  4GDO A;  1H0T A;  5CJ0 A;  3V5B A;  3ZDM A;  3EFF K;  2YIU C;  3L71 E;  5CBN A;  1BGY D;  1LWU C;  2Y0D A;  3H1H D;  5BU8 B;  1VQP P;  5TIS H;  2Z4E A;  1SQV K;  2K3R A;  3LW5 J;  4C7N A;  2IZ1 A;  1OX3 A;  3FXE A;  3I5C A;  1KIL E;  1VF5 D;  3HUS C;  3L4F A;  2E74 D;  1P84 H;  1H8A A;  2Y0C A;  3G9R A;  1NTK K;  2SPZ A;  5TJH A;  3M0A A;  1NWQ A;  2O01 N;  3MUD A;  1HGV A;  1EDJ A;  1NO4 A;  3OA7 A;  4HYT B;  3SFE C;  1HTL C;  1M8O B;  2OYO A;  3P32 A;  4K35 A;  1KB9 H;  5KKZ C;  2FY8 A;  4YXW H;  4WB4 A;  1L0L E;  3CXH D;  5C39 A;  1NTK J;  3CC2 P;  2WPV B;  3Q1M A;  4OH8 B;  1SQX E;  1LTJ C;  1WT6 A;  1FZE A;  1M56 D;  4H0L B;  5AW9 B;  3USS A;  4ASW A;  1NKN A;  2FYU J;  1AVY A;  2L5G B;  2PAJ A;  3G71 P;  2W6A A;  2IPP A;  2QJP B;  1NTZ G;  3RK2 C;  3V2N A;  2Y9Y A;  4WWI A;  3CXH H;  5CCG C;  2ZJS E;  2Q9I A;  2KK7 A;  5KAI E;  2M8R A;  3L73 G;  4A7P A;  1RE4 A;  1YYC A;  1H0T B;  3H1H G;  1USE A;  1S9K E;  4UB6 H;  1YJN P;  2YMY A;  2C0X A;  1OZH A;  1YTZ T;  2HG5 D;  2N1T A;  3E1R A;  3H1I J;  2IDB A;  2Y9Z A;  2E43 A;  3RK2 D;  1Q90 D;  2FKW B;  1IJD B;  3VP8 A;  1SQP E;  1X79 B;  3VMA A;  1G2C A;  1HJ0 A;  2LR2 A;  3GW6 A;  3JC2 2;  3VMZ A;  1QVG O;  2C9L Y;  1EXJ A;  2Z5H A;  2GUV A;  2BEQ D;  4H13 C;  3H1J J;  1N7L A;  5APU A;  4MN4 C;  3WUV A;  4AYC A;  1SQB J;  1FZC B;  1ZR2 A;  3M9B A;  3PRJ A;  1LT9 B;  2ZXX A;  1L0L D;  3CXH E;  3IN6 A;  1J1E C;  3A0B H;  1JMM A;  1NJI Q;  2BCC J;  2IYO A;  3B71 A;  1AA0 A;  1BE3 J;  2IBZ E;  2AEF A;  3P7K A;  3H1I E;  4QMA A;  5KLV D;  1S5L H;  5KAF H;  3H1L G;  3D70 A;  4PD4 H;  3CWB G;  1GW3 A;  3V2R A;  4PV1 C;  1KN7 A;  1BGY J;  3S9O A;  4D6T E;  3PLN A;  1KQL A;  1OW6 A;  3TF5 A;  1Q7Y Q;  1RHZ B;  3PHL A;  3PP5 A;  3OW2 O;  5AVS B;  3RK3 E;  1SQQ K;  1ZN5 A;  3CC7 P;  3L75 E;  4W80 A;  1SFC C;  2QM8 A;  3OJA B;  4OVN F;  3BAS A;  1LT9 A;  1MFT A;  3D71 A;  1FE6 A;  1IK7 A;  2C0W A;  1W5C E;  2PP6 A;  1BCC J;  2P58 A;  4OGQ B;  5AVT B;  3KQG A;  1IK9 A;  1MV8 A;  2OQQ A;  4LLH A;  1GU4 A;  3JSV C;  1NTM E;  5KJ7 A;  3D6Y A;  2KOG A;  1S5L E;  2G8Y A;  1RF1 A;  3HD7 A;  4TLF A;  2FFD B;  1AV1 A;  2WVR A;  4DCK A;  2N1T B;  1VQM P;  3AE7 C;  3KZI E;  1NYH A;  1OWA A;  5APV A;  1T6A A;  2OGU A;  1SP4 A;  4BRY B;  1T2K D;  3P8C E;  1AFO A;  3I56 P;  4WY4 D;  1SQX G;  1YJ9 P;  1GZL A;  3JCU E;  3F5H A;  5AW1 B;  1KYO E;  5BU5 A;  1PGJ A;  2QE7 H;  4DT0 A;  1BCC G;  3II6 A;  3SSU A;  1S1C X;  4XA4 A;  1NTM J;  5B5E E;  4Y28 J;  1YJW P;  1PP9 E;  2QM7 A;  5APT A;  5GTI H;  2XDJ A;  1ZOY C;  1MUU A;  2ZXE B;  4KHX A;  1OVV A;  1ZP0 C;  3D6Z A;  1URQ B;  3H1K G;  1FBM A;  2YO2 A;  5CMZ A;  1ZXG A;  1KB9 I;  3Q5R A;  3H1J D;  4EOT A;  3L70 G;  1DX7 A;  1SQB D;  2OYH C;  2OYH A;  2NPS A;  1JMB A;  4RKU J;  1YTZ I;  1L0L J;  3L71 G;  1BE3 G;  5B66 H;  3JCU H;  2FYN B;  1CZQ A;  3H32 A;  2QEX P;  1VQ6 P;  3S4R A;  2BCC D;  3PH0 A;  1KYO I;  1BE3 D;  1L0N D;  5KLV J;  3G4S P;  1VQ5 P;  1N73 C;  1BGY G;  1MZ9 A;  1FDI A;  4C7N B;  4U3F J;  1SQB G;  2P7J A;  3CX5 D;  4EYY Q;  3P8C D;  4HH2 A;  1KTM A;  3CCR P;  5H2F E;  1IZN B;  1EQ7 A;  1M1J A;  2E76 D;  3AED C;  3H1K E;  3TGU G;  1DIP A;  5KAI H;  2B87 A;  2YMK A;  4L74 A;  1Q82 Q;  1DEB A;  2ZVO B;  3CWB E;  5AW5 B;  2WT7 A;  2HR3 A;  2KNC B;  4GOE A;  4RES B;  4BWN A;  3L74 D;  4I7Z B;  1FC2 C;  2JJL A;  3A2A A;  3F89 A;  1SQP K;  5AW7 B;  1BCC D;  1NVO A;  3QWO C;  2WPR A;  3KXD A;  5APY A;  3RL0 D;  2YKP A;  1GU5 A;  1SQV G;  3GG2 A;  3HD7 C;  2KXP B;  1K9M Q;  2E76 C;  5AW0 B;  3H1J E;  5KJ7 C;  2Q1K A;  2A06 D;  1SQB E;  2XNX A;  1VF5 C;  1BGY E;  2E74 C;  3GHG B;  3ITK A;  3RK3 D;  4KJM A;  5AW3 B;  1EDL A;  1JUN A;  2P10 A;  1J2J B;  1QX8 A;  3O6Q A;  4N6J A;  2QRX A;  1H88 A;  3CWB J;  2RH0 A;  1BE3 E;  1KIL A;  1LNQ A;  2H88 C;  3AE3 C;  3RL0 C;  1SFC A;  3V4Q A;  3AEB C;  3Q3D A;  2QJY C;  1JY2 O;  2Q3E A;  3SFD C;  3L72 J;  3RBZ A;  1VQ4 P;  1N7S D;  2KS1 B;  2HYN A;  3EWK A;  4L75 A;  3MP7 B;  4PD4 I;  3HE4 A;  1OIP A;  1NTM D;  1L4A A;  3IFM A;  1L0L K;  3GLM A;  3M0D A;  3RK3 C;  1FDM A;  1KQF B;  4XE5 B;  2G3A A;  3M06 A;  1AVO A;  1K05 A;  5AW2 B;  1FJK A;  1N7S A;  2WTY A;  1Q86 Q;  4N78 E;  4HJG H;  5B5E H;  1LP1 B;  1JB0 J;  5AVZ B;  5CCG D;  1J1D C;  1N7S C;  2HOD A;  2L91 A;  1HWT C;  4NPE A;  4OWF A;  1GMJ A;  1FZB A;  1X0T A;  1ZW0 A;  2D2C B;  4W7Z A;  1MFZ A;  3CCE P;  1HH0 A;  2P67 A;  2A06 E;  1PGO A;  5CJ4 A;  3L74 G;  2CK3 H;  2QG4 A;  3W67 A;  2RN0 A;  1OW7 A;  1IFM A;  2OAR A;  3KYQ A;  1L0N J;  3HE5 B;  1UIX A;  1G1I A;  2B88 A;  2PGD A;  3PTZ A;  2OYI C;  1LTB C;  3LID A;  4U3F D;  1KIL C;  2JP3 A;  4H13 D;  1HBW A;  1RF0 C;  3KZI H;  1N86 A;  1SQP D;  2K88 A;  2Q3I A;  3FXD A;  1EXI A;  3TNU A;  4Z1M H;  2K1A A;  2B9B A;  1SQP G;  1S5L X;  2ZYD A;  1GW4 A;  2ZVN B;  1LWU B;  3E1I A;  4I1L A;  5CCG A;  3GF3 A;  1E79 H;  1Z56 A;  2JEE A;  4U3F G;  2I1J A;  5H2F H;  2GUS A;  4NPD A;  4WVZ A;  2BCC E;  3RL0 g;  3L74 J;  3L75 G;  3U1A A;  1KIL D;  2HPC A;  1FZF A;  1AJY A;  1JCD A;  3LIE A;  4WY4 A;  1AQT A;  5DJT B;  1HJB A;  2IBZ D;  1AQ5 A;  5DJU B;  3A3Y B;  3FGA D;  3SWY A;  2CPB A;  4AQR D;  1IFN A;  2ZYA A;  3B5N C;  5AVY B;  2NZ2 A;  3BAT A;  4PD4 E;  3GF7 A;  3L70 J;  1NOH A;  5AW4 B;  5KLI C;  5CBO A;  3H1K D;  1SFC D;  1M1J C;  2ZAE B;  5KKZ B;  1LTG C;  1M90 Q;  1EZV D;  2E5Y A;  1QGK B;  1VQ9 P;  5GTH E;  3CWB D;  2IFM A;  3TDK A;  2E75 B;  3CLQ A;  1VQ8 P;  2R5B A;  1PIX A;  3HUS A;  3L72 D;  2KSJ A;  3NTN A;  1N73 A;  1ZRT D;  3B5N D;  2KLV A;  3TSI A;  2QJP C;  4Y99 C;  1NKZ B;  2BCC G;  3AEE C;  5APW A;  2NPS C;  3O8Z A;  1OVU A;  2A45 H;  1JY3 O;  3B5N A;  2XU6 A;  3GMA A;  1S9K D;  4HKZ H;  3Q5P A;  1VQK P;  3G3Z A;  2H8P D;  4BXL A;  4ZKP A;  4WY4 C;  4ZMD A;  1GL2 B;  2XZR A;  5APQ A;  1PV3 A;  1SQX K;  4IL6 X;  3L37 A;  4ZNC A;  1H89 A;  2R32 A;  5CCH C;  2E42 A;  1LTS C;  3VOP A;  4PD4 D;  2A45 G;  1RQV A;  3VP9 A;  1RF0 A;  5M1B A;  1FZC C;  4OGQ D;  4UB8 E;  3TK1 A;  1GDT A;  1LT9 C;  1OW8 A;  2LXB A;  4L73 A;  3PJS K;  1VDF A;  2OYI A;  1ZLL A;  4N78 D;  3OAK A;  4EI2 A;  1CI6 B;  2JKV A;  1M57 D;  3KHU A;  3UIA A;  3T97 B;  4LGD E;  2IX7 C;  1RH5 B;  1SQP J;  2XKM A;  1ZRT E;  1R5S A;  1IFD A;  1SQB K;  2N1T D;  3MTU E;  4PV1 B;  4B86 A;  1RF1 C;  3Q5S A;  3VMX A;  4R4M A;  1GTW A;  1S72 P;  2M5A B;  3MD0 A;  1SQQ G;  1QL2 A;  1KB9 E;  1X22 A;  4PJ0 H;  1QL1 A;  1IFI A;  3V6I A;  4GOD A;  3WU2 E;  2HFE D;  1M7L A;  1SLQ A;  2FBW C;  3KPE A;  5B66 E;  1NTK E;  5AVQ B;  4U3F E;  4DJG A;  1L0N E;  2QVA A;  4PJ0 E;  1KMI Z;  2O1K A;  2YNY A;  4DZO A;  2E75 D;  1NU1 D;  3BCC D;  3L70 D;  3CCQ P;  2FXM A;  1L4A C;  3M0D C;  4I6M C;  2FYU G;  3H1K J;  5K5G B;  1HF9 A;  1SS1 A;  3HTK A;  2QJK C;  3MIW A;  3BVH A;  1KZU B;  1PGP A;  2WSF J;  4GIF A;  3Q2Y A;  3H1J G;  2KLU A;  4JBZ A;  2JR8 A;  4JPZ B;  2FFD C;  3EFG A;  3HRN A;  1JO5 A;  1EDI A;  2WSC H;  3HD7 D;  3NMD A;  3T97 A;  1CI6 A;  1FU1 A;  2WMM A;  5BVZ A;  1NH4 A;  3L74 E;  1SQQ E;  2RKL A;  5CHX A;  1Y9B A;  1BSN A;  1QLE D;  1S3J A;  5KJ7 D;  3V2Q A;  1GL2 D;  1PPJ G;  2HLO A;  1VPC A;  2IFN A;  1KYO D;  2FYZ A;  1PPJ D;  2V7Q J;  1N73 B;  2JO1 A;  3LW5 H;  3VN0 A;  1P84 D;  2K9J B;  1R8E A;  1KOR A;  2QA4 P;  2ZYG A;  3V2P A;  3WMM 0;  3CPW O;  1LTJ A;  2FXP A;  3L35 A;  1FOS E;  4H44 B;  1URQ C;  3CD6 P;  1NTZ J;  1A02 J;  3C9I A;  2KSE A;  3AE2 C;  1JTH A;  1GL2 A;  4HB1 A;  2UWJ E;  1FZA A;  2ZT9 B;  1NTM K;  4TT3 H;  1NU1 E;  3BCC E;  3CCL P;  1KQG B;  1RE4 C;  2R3S A;  1P84 I;  2GA1 A;  2LXC B;  2YIU B;  3L71 D;  4D6T J;  1X8Y A;  4UB8 H;  2KB7 P;  4U7J A;  1JNM A;  2IBZ I;  2FYN C;  1VQL P;  2M0B A;  1FAV A;  1NU1 G;  3BCC G;  2Q5U A;  3G6E P;  5GTH H;  3L75 J;  3H6P A;  3CXH I;  3HUS B;  4RJT A;  1YHQ P;  2R44 A;  2W27 A;  2GM4 A;  1GK4 A;  2JDI H;  5KLV K;  1KYO H;  1YQ3 C;  2CPS A;  3E7K A;  4AUW A;  1JCC A;  2BEZ F;  2WQY C;  1T8Z A;  1PGQ A;  1OVR A;  1PP9 G;  1R5L A;  2V7Q H;  1LTT C;  1Y47 A;  4NPF X;  1KQS O;  2Z5I A;  3MUD C;  1JTH B;  3I55 P;  3H1L D;  1LTJ B;  3B8E B;  4H0L C;  2XND H;  3N7N A;  1SQV J;  2IBZ G;  2IYP A;  1NU1 J;  2QSI A;  3BCC J;  2DW3 A;  2K9J A;  3IR9 A;  4YTP C;  3RK2 B;  3CC4 P;  2OTJ P;  4IFF A;  1ZV8 A;  2WSF H;  2Q6Q A;  2O01 J;  1UII A;  1VL2 A;  2IZ0 A;  3TGU D;  1KB9 D;  1VF5 B;  1KC8 Q;  1OMI A;  3GHG C;  1MKM A;  2HPC B;  3M9H A;  4LC1 A;  1K8A Q;  1HVV A;  1PP9 J;  1DH3 A;  4XFJ A;  2Q7C A;  4H0L D;  2N9Y B;  1RE3 C;  3RL0 B;  1SVF A;  1L2P A;  4YPC A;  2R5D A;  3WUU A;  3ABV C;  1L0N G;  1YQ4 C;  3HE5 A;  2WPQ A;  3L70 E;  1JEK A;  1FOS F;  3SWF A;  1TU3 F;  3AE6 C;  3HTK B;  4H44 D;  5EFW B;  1USD A;  4M3L A;  3B4S A;  2AEJ A;  3H1H E;  3AEG C;  3MZW B;  2ZT9 D;  3P8M C;  2FYU K;  1EZV I;  2D2C D;  3L73 E;  1NHL A;  4H13 B;  3RBX A;  2YXR B;  5CCH A;  3FWN A;  1GD2 E;  1IFJ A;  1EZV E;  2JWA A;  2OTL P;  2J5U A;  2HOD B;  3CX5 I;  1J1E B;  1NTZ D;  1JY3 N;  2KZJ A;  2W90 A;  1PFI A;  3H1L E;  2WZ7 A;  5KLV E;  1SQQ D;  2NPS D;  3H1I G;  4EDF A;  1E5W A;  1N7S B;  3L72 E;  3R4Y A;  4C46 A;  4RO0 A;  2W6J H;  1JY2 N;  4L76 A;  2VRS A;  2M5A A;  5AVV B;  1T3U A;  3A5T A;  1L0L G;  3L71 J;  2D2C C;  4D6T D;  2KIK A;  1N8R Q;  3HE4 B; 
#chains in the Genus database with same CATH homology
 2WSE H;  3M91 A;  5AVX B;  3R2P A;  3L36 A;  1LGH B;  1LTA C;  2MJZ A;  2OYI B;  1NU1 K;  1SFC B;  3TK1 A;  2P1J A;  5AW6 B;  1KIL B;  1RE3 A;  2M3B A;  4GT1 A;  5KTB A;  1LTI C;  4IFD K;  3GHG A;  5CCH D;  5AW8 B;  3VMY A;  4EIJ A;  1JOC A;  2N1T C;  2J58 A;  5APX A;  4IFM A;  2WPS A;  2WT7 B;  2YO3 A;  3M9Q A;  3B5N B;  2O01 H;  1JY3 P;  1X9V A;  2H43 A;  3NFQ A;  3N4X A;  1T2K C;  1M1J B;  3BRT B;  2YKO A;  4WBA A;  1HUC A;  1L4A D;  4O9B A;  2WWW A;  2N9B A;  1NTZ K;  1OXZ A;  4GKG A;  1L0N K;  3H32 B;  4JYC A;  4Y99 B;  3VTP C;  4N3Y B;  1NAF A;  2NPS B;  2OYH B;  3BRV B;  1WRG A;  2W6B A;  4WY4 B;  1GL2 C;  4W7Y A;  1HGZ A;  3VYI A;  1URQ A;  1XTG B;  3EQ2 A;  1LWU A;  2LKM A;  3TNU B;  2H7H A;  2YKQ A;  3V4W A;  4DOJ A;  1URQ D;  5AVR B;  2XV5 A;  2J59 M;  3U1C A;  2C9N Y;  1FZG A;  1ZR4 A;  1G1J A;  3U59 A;  1W2E A;  2R3C A;  2FFD A;  3HD7 B;  1RF1 B;  2POH A;  1A02 F;  1JY2 P;  1IC2 A;  3MGN A;  2KYV A;  1GK6 A;  2BAS A;  4C7R A;  1CW5 A;  1T3J A;  1KFM A;  3CI9 A;  1L4A B;  1KFN A;  1IO4 A;  2O1J A;  3RK3 B;  1FJP A;  1XTC C;  2KP8 A;  3NXS A;  1RY3 A;  1CSB A;  4ZKU A;  1J1D B;  2P2U A;  2I1K A;  1FZC A;  2WIT A;  4JYB A;  1G2C B;  4I2L C;  3CL3 D;  5APS A;  1N2D C;  3KDP B;  5AVU B;  2A45 I;  5AVW B;  4JF7 A;  3A7O A;  2ZFC A;  5CJ0 A;  3V5B A;  1LWU C;  5BU8 B;  2Z4E A;  1SQV K;  4C7N A;  3I5C A;  3L4F A;  3HUS C;  1H8A A;  1NTK K;  3M0A A;  1NWQ A;  3MUD A;  1HGV A;  1NO4 A;  3OA7 A;  4HYT B;  1HTL C;  3P32 A;  4WB4 A;  4OH8 B;  1LTJ C;  1WT6 A;  1FZE A;  5AW9 B;  1NKN A;  2L5G B;  2PAJ A;  2W6A A;  2IPP A;  3RK2 C;  3V2N A;  5CCG C;  2Q9I A;  2M8R A;  1RE4 A;  1YYC A;  1S9K E;  2YMY A;  2C0X A;  1YTZ T;  2HG5 D;  2N1T A;  2E43 A;  3RK2 D;  2FKW B;  1IJD B;  3VP8 A;  1X79 B;  1T2K D;  2C9L Y;  1G2C A;  3VMZ A;  2Z5H A;  2GUV A;  5APU A;  4AYC A;  1N7L A;  1FZC B;  1ZR2 A;  3M9B A;  1LT9 B;  1J1E C;  1JMM A;  3TSI A;  3P7K A;  1GW3 A;  3V2R A;  1KQL A;  3PP5 A;  5AVS B;  1SQQ K;  1ZN5 A;  1SFC C;  2QM8 A;  3OJA B;  3BAS A;  1LT9 A;  2C0W A;  2PP6 A;  5AVT B;  3KQG A;  1IK9 A;  1MV8 A;  4LLH A;  1GU4 A;  5KJ7 A;  2KOG A;  1RF1 A;  3HD7 A;  2FFD B;  2N1T B;  5APV A;  1OWA A;  1AFO A;  1SP4 A;  3P8C E;  4WY4 D;  1GZL A;  5AW1 B;  5BU5 A;  3II6 A;  4XA4 A;  2QM7 A;  5APT A;  2XDJ A;  1MUU A;  2ZXE B;  4KHX A;  1URQ B;  1FBM A;  2YO2 A;  5CMZ A;  4EOT A;  1DX7 A;  2OYH C;  2OYH A;  2NPS A;  1YTZ I;  3H32 A;  1CZQ A;  1N73 C;  1MZ9 A;  4C7N B;  2P7J A;  3P8C D;  4HH2 A;  1EQ7 A;  1M1J A;  1DEB A;  2WT7 A;  5AW5 B;  4RES B;  2JJL A;  3A2A A;  1SQP K;  5AW7 B;  5APY A;  3RL0 D;  2WPR A;  1GU5 A;  2YKP A;  3HD7 C;  5AW0 B;  5KJ7 C;  2XNX A;  3GHG B;  3RK3 D;  5AW3 B;  1JUN A;  1J2J B;  1H88 A;  1KIL A;  3RL0 C;  3V4Q A;  1SFC A;  1JY2 O;  1N7S D;  2HYN A;  2GM4 A;  3HE4 A;  3IFM A;  1FDM A;  1L4A A;  3M0D A;  1L0L K;  3RK3 C;  4XE5 B;  3M06 A;  5AW2 B;  1FJK A;  1N7S A;  2WTY A;  4N78 E;  5AVZ B;  5CCG D;  1J1D C;  1N7S C;  2HOD A;  1HWT C;  1FZB A;  4W7Z A;  1MFZ A;  1HH0 A;  2P67 A;  5CJ4 A;  1IFM A;  2OAR A;  3KYQ A;  3HE5 B;  1G1I A;  2OYI C;  1LTB C;  3LID A;  1KIL C;  1HBW A;  1RF0 C;  1N86 A;  2Q3I A;  3TNU A;  4I1L A;  1GW4 A;  1LWU B;  3E1I A;  5CCG A;  2JEE A;  1Z56 A;  2I1J A;  2GUS A;  3U1A A;  1KIL D;  2HPC A;  1FZF A;  1JCD A;  3LIE A;  4WY4 A;  1HJB A;  1AQ5 A;  3A3Y B;  4AQR D;  3SWY A;  2CPB A;  1IFN A;  3B5N C;  5AVY B;  3BAT A;  1NOH A;  5AW4 B;  1SFC D;  1M1J C;  1LTG C;  2IFM A;  3CLQ A;  2R5B A;  3HUS A;  2KSJ A;  3NTN A;  1N73 A;  3B5N D;  2KLV A;  4Y99 C;  1NKZ B;  5APW A;  2NPS C;  3O8Z A;  2A45 H;  3B5N A;  1JY3 O;  2XU6 A;  1S9K D;  3G3Z A;  2H8P D;  4ZKP A;  4WY4 C;  1GL2 B;  2XZR A;  5APQ A;  1SQX K;  1H89 A;  3L37 A;  2R32 A;  2E42 A;  1LTS C;  3VOP A;  2A45 G;  3VP9 A;  1RF0 A;  1FZC C;  1GDT A;  1LT9 C;  1VDF A;  2OYI A;  1ZLL A;  4N78 D;  3OAK A;  1CI6 B;  3UIA A;  4LGD E;  2IX7 C;  2XKM A;  1IFD A;  1SQB K;  2N1T D;  3MTU E;  4B86 A;  1RF1 C;  3VMX A;  1GTW A;  3MD0 A;  1QL2 A;  1QL1 A;  1IFI A;  2HFE D;  1M7L A;  1SLQ A;  3KPE A;  5AVQ B;  2O1K A;  2YNY A;  4DZO A;  2FXM A;  1L4A C;  3M0D C;  4I6M C;  3HTK A;  3BVH A;  3MIW A;  1KZU B;  4GIF A;  2FFD C;  3EFG A;  3HRN A;  1JO5 A;  2WSC H;  3HD7 D;  3NMD A;  3T97 A;  1CI6 A;  1FU1 A;  5BVZ A;  1NH4 A;  5CHX A;  5KJ7 D;  3V2Q A;  1GL2 D;  2HLO A;  1VPC A;  2IFN A;  2FYZ A;  3VN0 A;  3LW5 H;  3V2P A;  3WMM 0;  1LTJ A;  3L35 A;  1FOS E;  1URQ C;  1A02 J;  3C9I A;  1JTH A;  1GL2 A;  1FZA A;  1NTM K;  1RE4 C;  1X8Y A;  1JNM A;  2KB7 P;  1FAV A;  1N73 B;  2Q5U A;  3H6P A;  3HUS B;  2W27 A;  1GK4 A;  5KLV K;  2CPS A;  4AUW A;  1JCC A;  1T8Z A;  1LTT C;  2Z5I A;  1JTH B;  1LTJ B;  3B8E B;  4W80 A;  3N7N A;  4N6J A;  2HPC B;  3IR9 A;  3RK2 B;  4IFF A;  1ZV8 A;  2WSF H;  3GHG C;  3M9H A;  4LC1 A;  1HVV A;  1DH3 A;  2Q7C A;  1RE3 C;  3RL0 B;  1SVF A;  2R5D A;  3HE5 A;  2WPQ A;  1FOS F;  3SWF A;  3HTK B;  3TYY A;  4M3L A;  3P8M C;  5CCH A;  2FYU K;  1NHL A;  1GD2 E;  1IFJ A;  2HOD B;  1PFI A;  1J1E B;  1JY3 N;  2WZ7 A;  2NPS D;  1E5W A;  1N7S B;  4C46 A;  1JY2 N;  2VRS A;  5AVV B;  3A5T A;  1T3U A;  5CCH C;  3HE4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...