1N7SB

High resolution structure of a truncated neuronal snare complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
68
structure length
68
Chain Sequence
GSALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords vesicle-associated membrane protein 2
publication title High Resolution Structure, Stability, and Synaptotagmin Binding of a Truncated Neuronal SNARE Complex
pubmed doi rcsb
source organism Rattus norvegicus
total genus 31
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2002-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n7sB00
5CCGD 1URQC 1SFCD 5KJ7D 2M8RA 2NPSC 4N78E 1L4AC 3RK2C 3RL0B 3RK3D 3RL0D 2PP6A 3TSIA 1GL2C 3B5ND 3HD7C 5CCHA 3HD7A 1N7SC 1KILC 1URQA 3HD7B 5CCHD 4LGDE 2YMYA 1SFCC 1URQB 1XTGB 2NPSA 1L4AA 1NHLA 1URQD 3M0DC 1HVVA 3VOPA 2NPSB 4WY4C 1L4AB 3RK2B 2KOGA 2N1TC 2NPSD 1GL2A 2HFED 3KYQA 2WZ7A 4W7YA 3B5NC 1GL2B 1N7SA 4W7ZA 1KILA 1GL2D 5CCGC 4W80A 2XDJA 3HD7D 5KJ7C 1N7SB 1KILB 1SFCA 1N7SD 1T3JA 3RK3C 3P8CE 1SFCB 1JTHA 3RL0C 4WY4A 1L4AD 3RK2D 2N1TA 4JF7A 1JTHB 4WY4B 3RK3B 2N1TB 4WY4D 3B5NA 2H8PD 2N1TD 4OH8B 5CCGA 3HTKB 3B5NB 3PP5A 5CCHC 2HG5D 5KJ7A 1KILD
chains in the Genus database with same CATH superfamily
2MJZA 2XV5A 4PJ0E 1QVGO 3L72J 1K05A 1DD4A 1EXJA 4IOIH 1HF9A 3RL0B 4K35A 1N73A 1L0LG 2WWWA 3VMXA 1SQPE 1N73B 1GL2C 3L72D 1H88A 1L0LE 2D2CC 2FYUJ 4IL6E 3B4SA 2FYNC 1YHQP 1OX3A 2M3EA 1MFTA 3VMAA 1U7MA 1AVYA 3UIAA 2HODA 4H44B 2FYUD 1GD2E 2HODB 1URQD 1G2CB 2E75D 1LGHB 2R5DA 2W6BA 1VQOP 1Q86Q 5AVRB 3A0BE 3V4QA 2OYIC 1R5LA 2O3JA 4NPEA 5CCGC 2E74B 5E79H 3D6ZA 1SFCA 1KB9H 4ZMDA 1SFCB 1KB9D 1L4AD 4I7ZC 2Y0DA 3AEEC 2H89C 3AE3C 1T3UA 3G9RA 3V6IA 3VMZA 2N1TD 3S4RA 3LIDA 2BCCG 5GTHE 2H43A 4H0LB 3R2PA 4IFFA 1TU3F 1NTKJ 1HGVA 1J1EC 1OXZA 1FOSF 1ZR4A 3RK2C 3RK3D 3L73D 2GM4A 1E5WA 1KQFB 3L70G 1LT1A 1SQVD 3QWOC 3AEGC 3CL3D 1NTZE 5BVZA 3L70E 3GHGC 4EI2A 2JWDA 1RE4A 1SQBJ 1Q82Q 1YQ3C 2RN0A 2WT7A 4Y99C 1FBMA 1KZUB 1JOCA 2WT7B 2M0BA 2KOGA 1SQQE 2R5BA 1G1IA 3JSVC 2KLVA 1M1KQ 2FBWC 2YO3A 1OWAA 4HH2A 1QGKB 5DJTB 2QSIA 2HYNA 4JPZB 1CI6A 1YBKA 1KYOH 3JC22 1NAYA 1RE3A 1CI6B 1NU1K 1KYOD 1NOHA 3TF5A 2YIUB 1FZGA 2E5YA 3CCEP 3L74G 3CD6P 5AVXB 3L35A 1Y9BA 1NTMJ 1X79B 5H2FE 3IFMA 3CWBG 2E43A 2N9YB 1PIXA 1ZRTD 3L74E 1LTTC 1EQ7A 3CWBE 1GU5A 1Y8AA 4XA4A 5EFWB 4R4LA 1NJIQ 2P2UA 2A06D 1KFMA 1HUCA 5AVSB 3P8MC 1FZFA 4ZKPA 4N78E 3HUSC 1BGYG 1YIJP 1G1JA 3EFFK 1IO4A 4UB6H 1SQBK 2HR3A 2YMKA 1BGYE 1HJ0A 4YTPC 2IZ0A 2IBZE 4DOJA 1OVRA 3H1IG 3KZIH 3CCSP 4O9BA 2M5AA 3H1KJ 3H1IE 1L4AA 2M5AB 1JUNA 4WY4C 3FWNA 1L4AB 2ZT9C 3L71J 1K73Q 1VQ4P 3CC7P 1SLQA 4KT0J 1JM0A 3H1KD 1FC2C 4W7ZA 3VP8A 3A2AA 4JYCA 4DCKA 3L71D 1NTMK 3ITKA 1S5LE 1JMMA 2IBZI 1EDKA 1OW6A 4M3LA 1M90Q 3L75G 1FJPA 3RK3B 1W2EA 3HTKA 3GLMA 4JBZA 3AE9C 3HTKB 1NU1G 1CW5A 2PAJA 3H1HE 2I1JA 1NU1E 3AE4C 3NFQA 1PPJG 1AA0A 2WSEJ 3G71P 3F89A 1PPJE 5KAIE 3H1LD 3U1AA 1HWTC 5KLIB 1SQXJ 4H13C 1LTSC 1BCCE 2QE7H 5CCHA 2O01J 4N3YB 1W2BO 3KHUA 2O01H 3U59A 4LC1A 3A0HE 3TGUJ 1RF1C 2CPSA 2NPSA 1JO5A 3CC4P 4GT1A 1SQBG 2YXQB 2NPSB 1SQPJ 1EZVG 1SVFA 5AVZB 4PD4E 2ZVNB 3C8VA 4Z1MH 2ZYGA 1FZBA 5M1BA 3WUVA 3HD7D 2HPCA 1SQPD 2K9JA 2HPCB 1U7JA 3M91A 2K9JB 1J1DB 5B5EH 4C46A 1EDJA 5KTBA 4BWNA 1FZCC 3E1IA 2QM8A 4U3FG 1P84I 2Q3IA 1M8OB 4NPDA 5KJ7A 1RQVA 2B89A 4U3FE 2J58A 1PP9G 1SQXK 2VRSA 3H1JE 3BCCG 2Y9ZA 1NYHA 2M8RA 3GW6A 1VL2A 2OQQA 2WSFJ 3CX5E 1FOSE 1LP1A 2A45I 1OW7A 1LP1B 2WSFH 5CJ0A 5KLVJ 1BE3E 2LXBA 2WSSH 1BSHA 3FXEA 3KPEA 4Y28J 3K5BA 2E76C 3M0DC 2Y9YA 1PGOA 1VQ6P 2ZAEB 5AW4B 3CI9A 1DD3A 3CCQP 5APWA 3CX5I 5AW7B 5BU8B 1NTZJ 2FY8A 1IFPA 2PRRA 1GL2D 1T2KC 2D2CD 1QEXA 3Q3DA 3ABVC 2ZYDA 1UIXA 3CCLP 1NTZD 1MUUA 3RL0C 1R8EA 4YXDC 2ZVOB 1N73C 3NXSA 2Q9IA 1USEA 3WU2H 1VQ7P 1BSNA 4MN4C 1S4XA 1SQQD 3CLQA 4PV1D 1S5LX 3SWKA 5CCGD 4H44C 4XE5B 2QJKB 2WSCJ 1X22A 4DZOA 5KLVK 1GMJA 3M9BA 1SS1A 2WSCH 4JYBA 1YJ9P 2OYHC 1YTZT 5AVVB 2E74C 1SQXG 1D7MA 3HD7A 3TNUB 1MV8A 1VQ8P 3AEAC 5KAFH 1IFMA 3EWKA 3HD7B 5AW8B 1FZAA 1ZOYC 1SFCC 2YKPA 2R32A 3CWBD 5GTIE 1SP4A 1LTAC 3G6EP 1KORA 1LWUB 2W6AA 4W80A 1G2CA 4D6TG 2IFMA 1Q81Q 3SSUA 1KQSO 1ZV8A 2KUBA 3M06A 1LTIC 4D6TE 1JNMA 2IBZD 4ASWA 2KS1B 5KKZB 1WRGA 2KZJA 3H1ID 1IFJA 4OH8B 1AV1A 1KILD 3RBXA 3VYIA 3GF7A 4KHXA 1K04A 1PZQA 1RE4C 1FDIA 1IC2A 2B87A 1NWQA 1JB0J 2QJPB 2B87B 2QIWA 2AXTE 2W90A 3A7OA 2FXMA 3B5ND 2RKLA 3L73J 3MGNA 4UB8H 2KYVA 2BCCE 4GIFA 3H1HJ 1W5CE 3IN6A 1IZNB 1IK7A 3MZWB 5KLVG 1SQVJ 2FYUK 2QRXA 4B86A 3BRTB 2GA1A 1T8ZA 1RE3C 2YIUC 1HVVA 1GW4A 3H1HD 2QJYB 3AEBC 2KSJA 1L2PA 1KTMA 1VQLP 3CXHE 1N7SA 3CCMP 1H8AA 1PPJD 1EDIA 1N7SB 4PV1B 1BCCD 2K37A 4RO0A 1YJWP 3MHVA 1EDLA 3Q5RA 3A0HH 4L75A 2XZRA 3L36A 1S9KE 4KJMA 3PRJA 4WY4D 3I55P 1P84H 2C9NY 4TT3H 1P84D 1JMBA 1YQ4C 1GZLA 2QEXP 4EYYQ 4PD4D 1RY3A 1YYCA 3WUUA 1PGQA 1AJYA 1MZ9A 4BRYA 2OARA 3KQGA 1PGJA 1DX7A 1L4AC 1NTKK 4BRYB 3QH9A 2IYOA 3TSIA 3B71A 5AVQB 1ZP0C 1OFCX 2NZ2A 3P32A 2ZJSE 2YXRB 3O6QA 2ZXEB 3JCUE 1URQA 1KN7A 4GODA 3H6PA 3H1JJ 1OVUA 2JJLA 3GHGA 3O6QB 1URQB 5TISH 3N7NA 4XFJA 2E75B 3L72G 4HYTB 3W67A 3GHGB 4U3FD 3L72E 3C1LA 3H1JD 5B66H 1HGZA 4WWIA 3PLNA 2FYUG 1WT6A 4H13D 1KILA 1M1JC 3CX5D 1GK4A 5AVUB 2WITA 1RHZB 4A7PA 1KILB 2FYUE 1L0NJ 3MP7B 4BXLA 1T6AA 1BE3D 4OVNF 4IFDK 2N1TA 4IL6X 1QL1A 3WMM0 3SFEC 1S72P 2KSEA 5KLIC 5CBOA 2E42A 1L0ND 5AW5B 2N1TB 3B5NA 1R5SA 2L5GB 1OVVA 2JWAA 3B5NB 1FU1A 5CCHC 5E79E 2OYOA 5CHXA 1KB9E 2W27A 2NPSC 4OGQD 2KZIA 1K8AQ 3AEFC 3HUSA 3L75E 1H0TA 1QL2A 2KP8A 3EFGA 3HUSB 1KC8Q 1H0TB 3H1LJ 2LKMA 4GDOA 2QVAA 3MIWA 3TK1A 4RKUJ 1IFNA 2NRGA 2V7QJ 1NTKG 3WUTA 1J1DC 4K3AA 1RF0A 2V7QH 1NTKE 4ASVA 2K3RA 2WSEH 2FFDA 4RESB 1RQUA 2OTKE 3FX0A 2FFDB 4ZKUA 5AW0B 1JY3P 1FZEA 2FXPA 5KJ7C 3VMYA 2BEZF 4PJ0H 3P8CE 1VF5C 3T97A 1L0LJ 2KLUA 2E76D 1SQBE 2HLOA 1PFIA 1N7LA 1EZVE 3T97B 1VQ9P 2JR8A 2OGUA 1VDFA 4IL6H 3RL0g 2WQYC 3BRVB 1PL5A 2HG5D 1NH4A 1L0LD 3SWFA 5APVA 1KYOE 4GKGA 2W8ZA 1T2KD 3G4SP 4GOEA 3PJSK 1IFIA 2YO2A 1Y47A 3RL0D 3A0BH 1NTMG 2PP6A 4D6TD 2G8YA 2XU6A 4I6MC 2A06G 4PD4I 1BDCA 2KK7A 5CJ4A 1EZVI 1NTME 1USDA 4H13B 2A06E 3CPWO 1PP9E 4LGDE 5AVTB 3BCCE 4H44D 2YNYA 1M56D 2POHA 2IPPA 3AE1C 4UB6E 3KXDA 1RH5B 5TJHA 2BCCJ 2QA4P 5GTHH 1SQPK 2YKOA 3FWLA 1NKZB 2WPVB 3KZIE 5CMZA 1S2EA 2QJKC 3I5CA 1OIPA 2BCCD 3V2NA 1M7LA 3H1KG 1JTHA 5AW1B 1JTHB 3AE5C 4OGQB 2FKWB 2XNXA 3KDPB 1X0TA 3L71G 3OW2O 2OTLP 4LLHA 3L70J 1ZW0A 1LT9A 1LT9B 1FZCB 3MUDA 5C39A 3AE8C 3A5TA 2KI7B 3L70D 3CXHD 1SQQJ 2CK3H 2WVRA 2Q6QA 2GUVA 2ITAA 3LIEA 2IFNA 1E79H 3AE2C 1QVFO 1DIPA 1S9KD 2AEMA 3SWYA 2O1KA 1K9MQ 2C0XA 3H1LG 1LTJA 2RMZA 1ZMEC 2C0WA 2ZYAA 1LTJB 1JY2P 5APSA 3TNUA 3L74J 2E76B 1OZHA 2WPRA 5H2FH 3CWBJ 2K88A 1LTBC 4W7YA 4L73A 3CC2P 1KD1Q 1NKNA 1SQXE 1FDOA 3L74D 1ZXGA 1NTZK 1EXIA 1ZR2A 2Q1KA 1T3JA 1VQ5P 3TGUG 1VQPP 3PH0A 3L4FA 4N6JA 3RK2D 1BGYJ 2QJPC 4JF7A 1LWUA 3TGUE 2W83C 1SQPG 4N78D 1A02J 4H0LC 3G3ZA 2I8DA 1SQQK 3GF3A 3AE7C 1NGMB 1BGYD 4IFMA 3H1IJ 2KS1A 4EDFA 4YPCA 2QJYC 2KNCA 1X9VA 2C9LY 5B5EE 3E7KA 1ZLLA 1FS0E 3F5HA 2KNCB 2P67A 3AECC 1M57D 3H32A 4C7RA 4AQRD 2OYHA 1N7SC 3H32B 1NAFA 3A3YB 4HB1A 3IR9A 3NTNA 2ZFCA 4PV1C 3FXDA 2OYHB 2P1JA 1S5LH 2BASA 1BDDA 1MFZA 1VQKP 2QM7A 3L75J 2WPSA 2FXOA 2KXPB 1GL2A 2I1KA 1GL2B 3VTPC 1NU1J 2W6JH 2D2CB 2FYNB 1IFDA 5APYA 3S1KA 5CBNA 3L75D 4L74A 2P58A 2SPZA 5APXA 5KLVE 1NU1D 3HRNA 1BCCJ 3CMAP 4RJTA 5KAIH 2OYIA 4HJGH 2M3BA 2R3SA 1DEEG 2OYIB 1NTKD 5CCGA 1NTZG 4L76A 3BVHA 3IF4A 1JEKA 3CCVP 2Z5IA 2Z4EA 1URQC 2E75C 3I56P 2Q7CA 1U57A 4GOFA 3V2RA 2Y0CA 1SQQG 3V5BA 1IJDB 2LR2A 4I7ZB 2ZT9D 4QMAA 1UIIA 1N86A 3P8CD 4PD4H 3S9OA 3WU2E 1JY3O 1SQBD 3CXHI 1KILC 4U7JA 5AW3B 1VQNP 3RGUA 1EZVD 4NPFX 5CCHD 1LTGC 1QLED 4ZNCA 2Q5UA 3BASA 4WB4A 1J1EB 2A45H 2CPBA 3RBZA 1SQVK 2N9BA 1NO4A 3RK2B 2N1TC 2NPSD 3KYQA 1OW8A 2R3CA 4U3FJ 2FYZA 3B5NC 2KB7P 1JY3N 2IDBA 3VN0A 1PP9J 1CSBA 5KAFE 3TYYA 3D70A 4R4MA 3HE5A 3BCCJ 3RK3C 2ZXXA 1NTMD 2B88A 2H7HA 1X8YA 3HE5B 3HE4A 1FDMA 1PP9D 1OMIA 3CX5H 4Y99B 1BE3J 3HE4B 3U1CA 3BCCD 3MTUE 3LW5J 2O1JA 2WMMA 2IBZG 1N8RQ 2P10A 2G3AA 2Q3EA 3LW5H 2JDIH 2L91A 5L8RJ 2O01N 5KJ7D 2K9YA 1DH3A 4TLFA 1GDTA 4AYCA 3SFDC 5AW2B 3CCUP 1RF0C 1VF5D 3VP9A 2FFDC 1GU4A 2LXCB 3EQ2A 1KILE 3PTZA 1AFOA 3MD0A 5AVWB 4C7NA 2JKVA 3E1RA 5APUA 3M9QA 2AXCA 4C7NB 3OAKA 1YITP 3AE6C 1XTGB 3W68A 3VOPA 1N2DC 2IX7C 1JCDA 1DEBA 1Q90D 4WBAA 2UWJE 3GMAA 3L73G 3D71A 4UB8E 2JEEA 1KFNA 1HTLC 2PFXA 3H1HG 3TDKA 5AVYB 1LNQA 1M1JA 1AQ5A 1FJKA 3RK3E 4CPGA 3L73E 1SQVG 1M1JB 1KB9I 2J5UA 4I2LC 2IZ1A 3II6A 2H88C 4WY4A 2YKQA 1SQVE 3B8EB 3V4WA 1QX8A 1L0NK 4WY4B 1YI2P 2ZT9B 3FGAD 1BCCG 5K5GB 3USSA 3ZDMA 1FE6A 1NVOA 3BATA 1Z56A 3H25A 1J2JB 2WTYA 1ZN5A 1VPCA 1SQXD 1JY2O 5GTIH 4DT0A 1GK6A 3OJAB 3Q1MA 4AUWA 1P84E 3GG2A 2V4HA 3O8ZA 3TGUD 3CCJP 4D6TJ 2J59M 3R4YA 4OWFA 1XTCC 1JY2N 2A45G 5AW9B 1ZRTE 3Q2YA 2OTJP 3P7KA 4OGQC 4DJGA 5APTA 1S3JA 2HFED 1VQMP 3IAOA 3M9HA 2WZ7A 1S1CX 1H89A 4EOTA 1LT9C 3V2PA 1KYOI 3Q5PA 3NMDA 1AQTA 3MUDC 1RF1A 1LJ2A 1YTZI 3H1JG 2MKVA 2PGDA 5TISE 2Y0EA 1RF1B 2XNDH 5APQA 1MKMA 2AEFA 1HJBA 1HBWA 4I1LA 1KV4A 3OA7A 1WMKA 1JCCA 2AXTH 3M0AA 1VF5B 3CCRP 3PHLA 5AW6B 5B66E 1L0LK 3L37A 1BE3G 4EIJA 2E74D 1KQGB 2KIKA 1CZQA 1L0NG 1SFCD 1EC5A 2DW3A 1KQLA 1LTJC 3H1KE 3D6YA 3Q5SA 3AEDC 1L0NE 5KLVD 1FZCA 4HKZH 2K1AA 1PGPA 3L71E 1HH0A 1A02F 2R44A 3HD7C 3CXHH 4H0LD 1AVOA 2XKMA 4JQ0D 1GW3A 2YMYA 2E5TA 2Z5HA 1YJNP 1PV3A 1NHLA 3C9IA 2P7JA 1IK9A 1LWUC 2JP3A 2JO1A 1KMIZ 2RH0A 1GTWA 1FAVA 2GUSA 2XDJA 3V2QA 2AEJA 5KKZC 2B9BA 1N7SD 3H1LE 3M0DA 2WPQA 2IYPA 4YXWH 2BEQD 5BU5A 4WVZA 3N4XA 2H8PD 1Q7YQ 2QG4A 3CMEP 3PP5A 5DJUB 1Q2NA 3JCUH
chains in the Genus database with same CATH topology
2MJZA 5CHXA 2XV5A 1URQC 1SQXK 2VRSA 2M8RA 2W27A 2Q7CA 2NPSC 3V2RA 3RL0B 1N73A 3V5BA 1IJDB 2WWWA 1FOSE 3VMXA 3HUSA 1N86A 2A45I 1N73B 1QL2A 3P8CD 1GL2C 2KP8A 1H88A 3EFGA 3HUSB 2WSFH 5CJ0A 1JY3O 2LKMA 3MIWA 3TK1A 1KILC 5AW3B 3UIAA 1IFNA 5CCHD 2HODA 1LTGC 3KPEA 2Q5UA 3BASA 4WB4A 1J1DC 2HODB 1J1EB 1GD2E 1URQD 2A45H 2CPBA 3M0DC 1G2CB 1LGHB 1RF0A 2R5DA 1SQVK 2W6BA 2N9BA 2WSEH 1NO4A 2FFDA 3RK2B 4RESB 2N1TC 2NPSD 5AVRB 3V4QA 3KYQA 5AW4B 3CI9A 2FFDB 2OYIC 2R3CA 5APWA 2FYZA 3B5NC 2KB7P 1JY3N 5AW7B 4ZKUA 5BU8B 5AW0B 1GL2D 5CCGC 1T2KC 1JY3P 1FZEA 3VN0A 5KJ7C 1CSBA 3TYYA 3VMYA 1SFCA 3HE5A 3RK3C 3P8CE 1SFCB 1MUUA 3RL0C 2H7HA 1X8YA 1L4AD 3HE5B 3HE4A 3T97A 2HLOA 1PFIA 1FDMA 4Y99B 1N7LA 1N73C 3NXSA 2Q9IA 1T3UA 3HE4B 3U1CA 3VMZA 3MTUE 1VDFA 2N1TD 3LIDA 3BRVB 2O1JA 2H43A 2HG5D 1NH4A 3R2PA 4IFFA 3SWFA 5APVA 3CLQA 3LW5H 4GKGA 5CCGD 1T2KD 1HGVA 5KJ7D 1J1EC 4XE5B 1DH3A 4DZOA 1OXZA 1GDTA 4AYCA 1FOSF 1ZR4A 5KLVK 3RK2C 5AW2B 3M9BA 1IFIA 2YO2A 3RK3D 1RF0C 2GM4A 1E5WA 3RL0D 2WSCH 4JYBA 3VP9A 2FFDC 2PP6A 1GU4A 2XU6A 4I6MC 3EQ2A 5CJ4A 3MD0A 5AVWB 2OYHC 4C7NA 1AFOA 1YTZT 5AVVB 3CL3D 3HD7A 3TNUB 1MV8A 5APUA 3M9QA 5BVZA 4C7NB 1IFMA 3GHGC 3HD7B 3OAKA 4LGDE 5AW8B 1FZAA 1RE4A 1SFCC 1XTGB 5AVTB 2YKPA 2R32A 2WT7A 3VOPA 4Y99C 1FBMA 1KZUB 1N2DC 2IX7C 2YNYA 1JOCA 2WT7B 1JCDA 2R5BA 2KOGA 1DEBA 1G1IA 2POHA 1SP4A 2IPPA 1LTAC 2KLVA 2YO3A 1OWAA 4HH2A 4WBAA 2JEEA 1KFNA 1SQPK 1LWUB 1HTLC 2W6AA 2YKOA 2HYNA 4W80A 1G2CA 1CI6A 1NKZB 5AVYB 1M1JA 2IFMA 1AQ5A 1FJKA 1ZV8A 5CMZA 1RE3A 1CI6B 1NU1K 3M06A 1M1JB 3I5CA 4I2LC 1NOHA 1LTIC 3V2NA 1M7LA 3II6A 1JTHA 1JNMA 4WY4A 5AW1B 1FZGA 2YKQA 3B8EB 3V4WA 1L0NK 1JTHB 1WRGA 4WY4B 5AVXB 3L35A 2FKWB 2XNXA 3KDPB 1X79B 3IFMA 2E43A 4LLHA 1IFJA 1LT9A 4OH8B 1LTTC 1EQ7A 1GU5A 1KILD 1LT9B 4XA4A 1FZCB 3MUDA 3BATA 3VYIA 1Z56A 4KHXA 1J2JB 2P2UA 2WTYA 1ZN5A 3A5TA 1KFMA 1RE4C 1IC2A 1VPCA 1HUCA 5AVSB 3P8MC 1FZFA 4ZKPA 1JY2O 4N78E 1NWQA 2GUVA 3HUSC 1GK6A 1G1JA 3LIEA 3OJAB 2IFNA 4AUWA 3A7OA 1IO4A 2FXMA 1SQBK 3B5ND 3MGNA 2KYVA 3O8ZA 4GIFA 2J59M 4DOJA 1S9KD 3SWYA 2O1KA 2C0XA 2FYUK 4O9BA 4B86A 3BRTB 1LTJA 1T8ZA 1RE3C 1XTCC 1JY2N 2A45G 1L4AA 1HVVA 1GW4A 5AW9B 2C0WA 3P7KA 1LTJB 1JUNA 4WY4C 1JY2P 5APSA 1L4AB 3TNUA 5APTA 2KSJA 2HFED 2WPRA 1SLQA 3M9HA 2WZ7A 1LTBC 4W7YA 1H89A 4EOTA 1N7SA 4W7ZA 3VP8A 1NKNA 3A2AA 1LT9C 1H8AA 3V2PA 1N7SB 4JYCA 3NMDA 1RF1A 1NTMK 1NTZK 1ZR2A 1YTZI 1T3JA 1JMMA 1RF1B 5APQA 3L4FA 4N6JA 1HJBA 1HBWA 3RK2D 4JF7A 4I1LA 1LWUA 4M3LA 3OA7A 2XZRA 3RK3B 1FJPA 1JCCA 4N78D 3L36A 1W2EA 1S9KE 1A02J 3M0AA 3G3ZA 3HTKA 4WY4D 2C9NY 5AW6B 1L0LK 1SQQK 3L37A 4EIJA 3HTKB 1CW5A 2PAJA 4IFMA 1GZLA 2I1JA 1CZQA 1RY3A 1YYCA 1SFCD 3NFQA 1KQLA 1MZ9A 2OARA 3KQGA 1LTJC 1DX7A 1L4AC 1NTKK 1X9VA 2C9LY 1FZCA 3U1AA 1HWTC 1ZLLA 3TSIA 1HH0A 2P67A 1LTSC 1A02F 3H32A 3HD7C 5CCHA 5AVQB 2XKMA 4C7RA 3P32A 4AQRD 4N3YB 2OYHA 1N7SC 3H32B 1NAFA 3A3YB 2ZXEB 1URQA 3IR9A 3NTNA 2ZFCA 2O01H 3H6PA 3U59A 2OYHB 2P1JA 1GW3A 2YMYA 4LC1A 2JJLA 3GHGA 1RF1C 2Z5HA 1URQB 3N7NA 2CPSA 2NPSA 1JO5A 1NHLA 2BASA 4HYTB 3GHGB 4GT1A 1MFZA 3C9IA 2NPSB 2QM7A 2WPSA 1SVFA 2P7JA 1IK9A 1LWUC 1GL2A 5AVZB 2I1KA 1HGZA 1GL2B 1GTWA 3VTPC 1FAVA 1WT6A 1FZBA 1KILA 2GUSA 1M1JC 1IFDA 5APYA 1GK4A 5AVUB 2XDJA 2WITA 3HD7D 3V2QA 2HPCA 1KILB 5APXA 1N7SD 2HPCB 3M91A 3M0DA 2WPQA 3HRNA 1J1DB 4IFDK 2N1TA 1QL1A 3WMM0 2OYIA 2E42A 5BU5A 5AW5B 2M3BA 4C46A 2N1TB 3B5NA 5KTBA 1FZCC 3E1IA 2QM8A 2L5GB 3N4XA 2Q3IA 2OYIB 2H8PD 5CCGA 3B5NB 3BVHA 3PP5A 1FU1A 5CCHC 5KJ7A 2Z5IA 2J58A 2Z4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCG D;  1URQ C;  1SFC D;  5KJ7 D;  2M8R A;  2NPS C;  4N78 E;  1L4A C;  3RK2 C;  3RL0 B;  3RK3 D;  3RL0 D;  2PP6 A;  3TSI A;  1GL2 C;  3B5N D;  3HD7 C;  5CCH A;  3HD7 A;  1N7S C;  1KIL C;  1URQ A;  3HD7 B;  5CCH D;  4LGD E;  2YMY A;  1SFC C;  1URQ B;  1XTG B;  2NPS A;  1L4A A;  1NHL A;  1URQ D;  3M0D C;  1HVV A;  3VOP A;  2NPS B;  4WY4 C;  1L4A B;  3RK2 B;  2KOG A;  2N1T C;  2NPS D;  1GL2 A;  2HFE D;  3KYQ A;  2WZ7 A;  4W7Y A;  3B5N C;  1GL2 B;  1N7S A;  4W7Z A;  1KIL A;  1GL2 D;  5CCG C;  4W80 A;  2XDJ A;  3HD7 D;  5KJ7 C;  1N7S B;  1KIL B;  1SFC A;  1N7S D;  1T3J A;  3RK3 C;  3P8C E;  1SFC B;  1JTH A;  3RL0 C;  4WY4 A;  1L4A D;  3RK2 D;  2N1T A;  4JF7 A;  1JTH B;  4WY4 B;  3RK3 B;  2N1T B;  4WY4 D;  3B5N A;  2H8P D;  2N1T D;  4OH8 B;  5CCG A;  3HTK B;  3B5N B;  3PP5 A;  5CCH C;  2HG5 D;  5KJ7 A;  1KIL D; 
#chains in the Genus database with same CATH topology
 2MJZ A;  2XV5 A;  4PJ0 E;  1QVG O;  3L72 J;  1K05 A;  1DD4 A;  1EXJ A;  4IOI H;  1HF9 A;  3RL0 B;  4K35 A;  1N73 A;  1L0L G;  2WWW A;  3VMX A;  1SQP E;  1N73 B;  1GL2 C;  3L72 D;  1H88 A;  1L0L E;  2D2C C;  2FYU J;  4IL6 E;  3B4S A;  2FYN C;  1YHQ P;  1OX3 A;  2M3E A;  1MFT A;  3VMA A;  1U7M A;  1AVY A;  3UIA A;  2HOD A;  4H44 B;  2FYU D;  1GD2 E;  2HOD B;  1URQ D;  1G2C B;  2E75 D;  1LGH B;  2R5D A;  2W6B A;  1VQO P;  1Q86 Q;  5AVR B;  3A0B E;  3V4Q A;  2OYI C;  1R5L A;  2O3J A;  4NPE A;  5CCG C;  2E74 B;  5E79 H;  3D6Z A;  1SFC A;  1KB9 H;  4ZMD A;  1SFC B;  1KB9 D;  1L4A D;  4I7Z C;  2Y0D A;  3AEE C;  2H89 C;  3AE3 C;  1T3U A;  3G9R A;  3V6I A;  3VMZ A;  2N1T D;  3S4R A;  3LID A;  2BCC G;  5GTH E;  2H43 A;  4H0L B;  3R2P A;  4IFF A;  1TU3 F;  1NTK J;  1HGV A;  1J1E C;  1OXZ A;  1FOS F;  1ZR4 A;  3RK2 C;  3RK3 D;  3L73 D;  2GM4 A;  1E5W A;  1KQF B;  3L70 G;  1LT1 A;  1SQV D;  3QWO C;  3AEG C;  3CL3 D;  1NTZ E;  5BVZ A;  3L70 E;  3GHG C;  4EI2 A;  2JWD A;  1RE4 A;  1SQB J;  1Q82 Q;  1YQ3 C;  2RN0 A;  2WT7 A;  4Y99 C;  1FBM A;  1KZU B;  1JOC A;  2WT7 B;  2M0B A;  2KOG A;  1SQQ E;  2R5B A;  1G1I A;  3JSV C;  2KLV A;  1M1K Q;  2FBW C;  2YO3 A;  1OWA A;  4HH2 A;  1QGK B;  5DJT B;  2QSI A;  2HYN A;  4JPZ B;  1CI6 A;  1YBK A;  1KYO H;  3JC2 2;  1NAY A;  1RE3 A;  1CI6 B;  1NU1 K;  1KYO D;  1NOH A;  3TF5 A;  2YIU B;  1FZG A;  2E5Y A;  3CCE P;  3L74 G;  3CD6 P;  5AVX B;  3L35 A;  1Y9B A;  1NTM J;  1X79 B;  5H2F E;  3IFM A;  3CWB G;  2E43 A;  2N9Y B;  1PIX A;  1ZRT D;  3L74 E;  1LTT C;  1EQ7 A;  3CWB E;  1GU5 A;  1Y8A A;  4XA4 A;  5EFW B;  4R4L A;  1NJI Q;  2P2U A;  2A06 D;  1KFM A;  1HUC A;  5AVS B;  3P8M C;  1FZF A;  4ZKP A;  4N78 E;  3HUS C;  1BGY G;  1YIJ P;  1G1J A;  3EFF K;  1IO4 A;  4UB6 H;  1SQB K;  2HR3 A;  2YMK A;  1BGY E;  1HJ0 A;  4YTP C;  2IZ0 A;  2IBZ E;  4DOJ A;  1OVR A;  3H1I G;  3KZI H;  3CCS P;  4O9B A;  2M5A A;  3H1K J;  3H1I E;  1L4A A;  2M5A B;  1JUN A;  4WY4 C;  3FWN A;  1L4A B;  2ZT9 C;  3L71 J;  1K73 Q;  1VQ4 P;  3CC7 P;  1SLQ A;  4KT0 J;  1JM0 A;  3H1K D;  1FC2 C;  4W7Z A;  3VP8 A;  3A2A A;  4JYC A;  4DCK A;  3L71 D;  1NTM K;  3ITK A;  1S5L E;  1JMM A;  2IBZ I;  1EDK A;  1OW6 A;  4M3L A;  1M90 Q;  3L75 G;  1FJP A;  3RK3 B;  1W2E A;  3HTK A;  3GLM A;  4JBZ A;  3AE9 C;  3HTK B;  1NU1 G;  1CW5 A;  2PAJ A;  3H1H E;  2I1J A;  1NU1 E;  3AE4 C;  3NFQ A;  1PPJ G;  1AA0 A;  2WSE J;  3G71 P;  3F89 A;  1PPJ E;  5KAI E;  3H1L D;  3U1A A;  1HWT C;  5KLI B;  1SQX J;  4H13 C;  1LTS C;  1BCC E;  2QE7 H;  5CCH A;  2O01 J;  4N3Y B;  1W2B O;  3KHU A;  2O01 H;  3U59 A;  4LC1 A;  3A0H E;  3TGU J;  1RF1 C;  2CPS A;  2NPS A;  1JO5 A;  3CC4 P;  4GT1 A;  1SQB G;  2YXQ B;  2NPS B;  1SQP J;  1EZV G;  1SVF A;  5AVZ B;  4PD4 E;  2ZVN B;  3C8V A;  4Z1M H;  2ZYG A;  1FZB A;  5M1B A;  3WUV A;  3HD7 D;  2HPC A;  1SQP D;  2K9J A;  2HPC B;  1U7J A;  3M91 A;  2K9J B;  1J1D B;  5B5E H;  4C46 A;  1EDJ A;  5KTB A;  4BWN A;  1FZC C;  3E1I A;  2QM8 A;  4U3F G;  1P84 I;  2Q3I A;  1M8O B;  4NPD A;  5KJ7 A;  1RQV A;  2B89 A;  4U3F E;  2J58 A;  1PP9 G;  1SQX K;  2VRS A;  3H1J E;  3BCC G;  2Y9Z A;  1NYH A;  2M8R A;  3GW6 A;  1VL2 A;  2OQQ A;  2WSF J;  3CX5 E;  1FOS E;  1LP1 A;  2A45 I;  1OW7 A;  1LP1 B;  2WSF H;  5CJ0 A;  5KLV J;  1BE3 E;  2LXB A;  2WSS H;  1BSH A;  3FXE A;  3KPE A;  4Y28 J;  3K5B A;  2E76 C;  3M0D C;  2Y9Y A;  1PGO A;  1VQ6 P;  2ZAE B;  5AW4 B;  3CI9 A;  1DD3 A;  3CCQ P;  5APW A;  3CX5 I;  5AW7 B;  5BU8 B;  1NTZ J;  2FY8 A;  1IFP A;  2PRR A;  1GL2 D;  1T2K C;  2D2C D;  1QEX A;  3Q3D A;  3ABV C;  2ZYD A;  1UIX A;  3CCL P;  1NTZ D;  1MUU A;  3RL0 C;  1R8E A;  4YXD C;  2ZVO B;  1N73 C;  3NXS A;  2Q9I A;  1USE A;  3WU2 H;  1VQ7 P;  1BSN A;  4MN4 C;  1S4X A;  1SQQ D;  3CLQ A;  4PV1 D;  1S5L X;  3SWK A;  5CCG D;  4H44 C;  4XE5 B;  2QJK B;  2WSC J;  1X22 A;  4DZO A;  5KLV K;  1GMJ A;  3M9B A;  1SS1 A;  2WSC H;  4JYB A;  1YJ9 P;  2OYH C;  1YTZ T;  5AVV B;  2E74 C;  1SQX G;  1D7M A;  3HD7 A;  3TNU B;  1MV8 A;  1VQ8 P;  3AEA C;  5KAF H;  1IFM A;  3EWK A;  3HD7 B;  5AW8 B;  1FZA A;  1ZOY C;  1SFC C;  2YKP A;  2R32 A;  3CWB D;  5GTI E;  1SP4 A;  1LTA C;  3G6E P;  1KOR A;  1LWU B;  2W6A A;  4W80 A;  1G2C A;  4D6T G;  2IFM A;  1Q81 Q;  3SSU A;  1KQS O;  1ZV8 A;  2KUB A;  3M06 A;  1LTI C;  4D6T E;  1JNM A;  2IBZ D;  4ASW A;  2KS1 B;  5KKZ B;  1WRG A;  2KZJ A;  3H1I D;  1IFJ A;  4OH8 B;  1AV1 A;  1KIL D;  3RBX A;  3VYI A;  3GF7 A;  4KHX A;  1K04 A;  1PZQ A;  1RE4 C;  1FDI A;  1IC2 A;  2B87 A;  1NWQ A;  1JB0 J;  2QJP B;  2B87 B;  2QIW A;  2AXT E;  2W90 A;  3A7O A;  2FXM A;  3B5N D;  2RKL A;  3L73 J;  3MGN A;  4UB8 H;  2KYV A;  2BCC E;  4GIF A;  3H1H J;  1W5C E;  3IN6 A;  1IZN B;  1IK7 A;  3MZW B;  5KLV G;  1SQV J;  2FYU K;  2QRX A;  4B86 A;  3BRT B;  2GA1 A;  1T8Z A;  1RE3 C;  2YIU C;  1HVV A;  1GW4 A;  3H1H D;  2QJY B;  3AEB C;  2KSJ A;  1L2P A;  1KTM A;  1VQL P;  3CXH E;  1N7S A;  3CCM P;  1H8A A;  1PPJ D;  1EDI A;  1N7S B;  4PV1 B;  1BCC D;  2K37 A;  4RO0 A;  1YJW P;  3MHV A;  1EDL A;  3Q5R A;  3A0H H;  4L75 A;  2XZR A;  3L36 A;  1S9K E;  4KJM A;  3PRJ A;  4WY4 D;  3I55 P;  1P84 H;  2C9N Y;  4TT3 H;  1P84 D;  1JMB A;  1YQ4 C;  1GZL A;  2QEX P;  4EYY Q;  4PD4 D;  1RY3 A;  1YYC A;  3WUU A;  1PGQ A;  1AJY A;  1MZ9 A;  4BRY A;  2OAR A;  3KQG A;  1PGJ A;  1DX7 A;  1L4A C;  1NTK K;  4BRY B;  3QH9 A;  2IYO A;  3TSI A;  3B71 A;  5AVQ B;  1ZP0 C;  1OFC X;  2NZ2 A;  3P32 A;  2ZJS E;  2YXR B;  3O6Q A;  2ZXE B;  3JCU E;  1URQ A;  1KN7 A;  4GOD A;  3H6P A;  3H1J J;  1OVU A;  2JJL A;  3GHG A;  3O6Q B;  1URQ B;  5TIS H;  3N7N A;  4XFJ A;  2E75 B;  3L72 G;  4HYT B;  3W67 A;  3GHG B;  4U3F D;  3L72 E;  3C1L A;  3H1J D;  5B66 H;  1HGZ A;  4WWI A;  3PLN A;  2FYU G;  1WT6 A;  4H13 D;  1KIL A;  1M1J C;  3CX5 D;  1GK4 A;  5AVU B;  2WIT A;  1RHZ B;  4A7P A;  1KIL B;  2FYU E;  1L0N J;  3MP7 B;  4BXL A;  1T6A A;  1BE3 D;  4OVN F;  4IFD K;  2N1T A;  4IL6 X;  1QL1 A;  3WMM 0;  3SFE C;  1S72 P;  2KSE A;  5KLI C;  5CBO A;  2E42 A;  1L0N D;  5AW5 B;  2N1T B;  3B5N A;  1R5S A;  2L5G B;  1OVV A;  2JWA A;  3B5N B;  1FU1 A;  5CCH C;  5E79 E;  2OYO A;  5CHX A;  1KB9 E;  2W27 A;  2NPS C;  4OGQ D;  2KZI A;  1K8A Q;  3AEF C;  3HUS A;  3L75 E;  1H0T A;  1QL2 A;  2KP8 A;  3EFG A;  3HUS B;  1KC8 Q;  1H0T B;  3H1L J;  2LKM A;  4GDO A;  2QVA A;  3MIW A;  3TK1 A;  4RKU J;  1IFN A;  2NRG A;  2V7Q J;  1NTK G;  3WUT A;  1J1D C;  4K3A A;  1RF0 A;  2V7Q H;  1NTK E;  4ASV A;  2K3R A;  2WSE H;  2FFD A;  4RES B;  1RQU A;  2OTK E;  3FX0 A;  2FFD B;  4ZKU A;  5AW0 B;  1JY3 P;  1FZE A;  2FXP A;  5KJ7 C;  3VMY A;  2BEZ F;  4PJ0 H;  3P8C E;  1VF5 C;  3T97 A;  1L0L J;  2KLU A;  2E76 D;  1SQB E;  2HLO A;  1PFI A;  1N7L A;  1EZV E;  3T97 B;  1VQ9 P;  2JR8 A;  2OGU A;  1VDF A;  4IL6 H;  3RL0 g;  2WQY C;  3BRV B;  1PL5 A;  2HG5 D;  1NH4 A;  1L0L D;  3SWF A;  5APV A;  1KYO E;  4GKG A;  2W8Z A;  1T2K D;  3G4S P;  4GOE A;  3PJS K;  1IFI A;  2YO2 A;  1Y47 A;  3RL0 D;  3A0B H;  1NTM G;  2PP6 A;  4D6T D;  2G8Y A;  2XU6 A;  4I6M C;  2A06 G;  4PD4 I;  1BDC A;  2KK7 A;  5CJ4 A;  1EZV I;  1NTM E;  1USD A;  4H13 B;  2A06 E;  3CPW O;  1PP9 E;  4LGD E;  5AVT B;  3BCC E;  4H44 D;  2YNY A;  1M56 D;  2POH A;  2IPP A;  3AE1 C;  4UB6 E;  3KXD A;  1RH5 B;  5TJH A;  2BCC J;  2QA4 P;  5GTH H;  1SQP K;  2YKO A;  3FWL A;  1NKZ B;  2WPV B;  3KZI E;  5CMZ A;  1S2E A;  2QJK C;  3I5C A;  1OIP A;  2BCC D;  3V2N A;  1M7L A;  3H1K G;  1JTH A;  5AW1 B;  1JTH B;  3AE5 C;  4OGQ B;  2FKW B;  2XNX A;  3KDP B;  1X0T A;  3L71 G;  3OW2 O;  2OTL P;  4LLH A;  3L70 J;  1ZW0 A;  1LT9 A;  1LT9 B;  1FZC B;  3MUD A;  5C39 A;  3AE8 C;  3A5T A;  2KI7 B;  3L70 D;  3CXH D;  1SQQ J;  2CK3 H;  2WVR A;  2Q6Q A;  2GUV A;  2ITA A;  3LIE A;  2IFN A;  1E79 H;  3AE2 C;  1QVF O;  1DIP A;  1S9K D;  2AEM A;  3SWY A;  2O1K A;  1K9M Q;  2C0X A;  3H1L G;  1LTJ A;  2RMZ A;  1ZME C;  2C0W A;  2ZYA A;  1LTJ B;  1JY2 P;  5APS A;  3TNU A;  3L74 J;  2E76 B;  1OZH A;  2WPR A;  5H2F H;  3CWB J;  2K88 A;  1LTB C;  4W7Y A;  4L73 A;  3CC2 P;  1KD1 Q;  1NKN A;  1SQX E;  1FDO A;  3L74 D;  1ZXG A;  1NTZ K;  1EXI A;  1ZR2 A;  2Q1K A;  1T3J A;  1VQ5 P;  3TGU G;  1VQP P;  3PH0 A;  3L4F A;  4N6J A;  3RK2 D;  1BGY J;  2QJP C;  4JF7 A;  1LWU A;  3TGU E;  2W83 C;  1SQP G;  4N78 D;  1A02 J;  4H0L C;  3G3Z A;  2I8D A;  1SQQ K;  3GF3 A;  3AE7 C;  1NGM B;  1BGY D;  4IFM A;  3H1I J;  2KS1 A;  4EDF A;  4YPC A;  2QJY C;  2KNC A;  1X9V A;  2C9L Y;  5B5E E;  3E7K A;  1ZLL A;  1FS0 E;  3F5H A;  2KNC B;  2P67 A;  3AEC C;  1M57 D;  3H32 A;  4C7R A;  4AQR D;  2OYH A;  1N7S C;  3H32 B;  1NAF A;  3A3Y B;  4HB1 A;  3IR9 A;  3NTN A;  2ZFC A;  4PV1 C;  3FXD A;  2OYH B;  2P1J A;  1S5L H;  2BAS A;  1BDD A;  1MFZ A;  1VQK P;  2QM7 A;  3L75 J;  2WPS A;  2FXO A;  2KXP B;  1GL2 A;  2I1K A;  1GL2 B;  3VTP C;  1NU1 J;  2W6J H;  2D2C B;  2FYN B;  1IFD A;  5APY A;  3S1K A;  5CBN A;  3L75 D;  4L74 A;  2P58 A;  2SPZ A;  5APX A;  5KLV E;  1NU1 D;  3HRN A;  1BCC J;  3CMA P;  4RJT A;  5KAI H;  2OYI A;  4HJG H;  2M3B A;  2R3S A;  1DEE G;  2OYI B;  1NTK D;  5CCG A;  1NTZ G;  4L76 A;  3BVH A;  3IF4 A;  1JEK A;  3CCV P;  2Z5I A;  2Z4E A;  1URQ C;  2E75 C;  3I56 P;  2Q7C A;  1U57 A;  4GOF A;  3V2R A;  2Y0C A;  1SQQ G;  3V5B A;  1IJD B;  2LR2 A;  4I7Z B;  2ZT9 D;  4QMA A;  1UII A;  1N86 A;  3P8C D;  4PD4 H;  3S9O A;  3WU2 E;  1JY3 O;  1SQB D;  3CXH I;  1KIL C;  4U7J A;  5AW3 B;  1VQN P;  3RGU A;  1EZV D;  4NPF X;  5CCH D;  1LTG C;  1QLE D;  4ZNC A;  2Q5U A;  3BAS A;  4WB4 A;  1J1E B;  2A45 H;  2CPB A;  3RBZ A;  1SQV K;  2N9B A;  1NO4 A;  3RK2 B;  2N1T C;  2NPS D;  3KYQ A;  1OW8 A;  2R3C A;  4U3F J;  2FYZ A;  3B5N C;  2KB7 P;  1JY3 N;  2IDB A;  3VN0 A;  1PP9 J;  1CSB A;  5KAF E;  3TYY A;  3D70 A;  4R4M A;  3HE5 A;  3BCC J;  3RK3 C;  2ZXX A;  1NTM D;  2B88 A;  2H7H A;  1X8Y A;  3HE5 B;  3HE4 A;  1FDM A;  1PP9 D;  1OMI A;  3CX5 H;  4Y99 B;  1BE3 J;  3HE4 B;  3U1C A;  3BCC D;  3MTU E;  3LW5 J;  2O1J A;  2WMM A;  2IBZ G;  1N8R Q;  2P10 A;  2G3A A;  2Q3E A;  3LW5 H;  2JDI H;  2L91 A;  5L8R J;  2O01 N;  5KJ7 D;  2K9Y A;  1DH3 A;  4TLF A;  1GDT A;  4AYC A;  3SFD C;  5AW2 B;  3CCU P;  1RF0 C;  1VF5 D;  3VP9 A;  2FFD C;  1GU4 A;  2LXC B;  3EQ2 A;  1KIL E;  3PTZ A;  1AFO A;  3MD0 A;  5AVW B;  4C7N A;  2JKV A;  3E1R A;  5APU A;  3M9Q A;  2AXC A;  4C7N B;  3OAK A;  1YIT P;  3AE6 C;  1XTG B;  3W68 A;  3VOP A;  1N2D C;  2IX7 C;  1JCD A;  1DEB A;  1Q90 D;  4WBA A;  2UWJ E;  3GMA A;  3L73 G;  3D71 A;  4UB8 E;  2JEE A;  1KFN A;  1HTL C;  2PFX A;  3H1H G;  3TDK A;  5AVY B;  1LNQ A;  1M1J A;  1AQ5 A;  1FJK A;  3RK3 E;  4CPG A;  3L73 E;  1SQV G;  1M1J B;  1KB9 I;  2J5U A;  4I2L C;  2IZ1 A;  3II6 A;  2H88 C;  4WY4 A;  2YKQ A;  1SQV E;  3B8E B;  3V4W A;  1QX8 A;  1L0N K;  4WY4 B;  1YI2 P;  2ZT9 B;  3FGA D;  1BCC G;  5K5G B;  3USS A;  3ZDM A;  1FE6 A;  1NVO A;  3BAT A;  1Z56 A;  3H25 A;  1J2J B;  2WTY A;  1ZN5 A;  1VPC A;  1SQX D;  1JY2 O;  5GTI H;  4DT0 A;  1GK6 A;  3OJA B;  3Q1M A;  4AUW A;  1P84 E;  3GG2 A;  2V4H A;  3O8Z A;  3TGU D;  3CCJ P;  4D6T J;  2J59 M;  3R4Y A;  4OWF A;  1XTC C;  1JY2 N;  2A45 G;  5AW9 B;  1ZRT E;  3Q2Y A;  2OTJ P;  3P7K A;  4OGQ C;  4DJG A;  5APT A;  1S3J A;  2HFE D;  1VQM P;  3IAO A;  3M9H A;  2WZ7 A;  1S1C X;  1H89 A;  4EOT A;  1LT9 C;  3V2P A;  1KYO I;  3Q5P A;  3NMD A;  1AQT A;  3MUD C;  1RF1 A;  1LJ2 A;  1YTZ I;  3H1J G;  2MKV A;  2PGD A;  5TIS E;  2Y0E A;  1RF1 B;  2XND H;  5APQ A;  1MKM A;  2AEF A;  1HJB A;  1HBW A;  4I1L A;  1KV4 A;  3OA7 A;  1WMK A;  1JCC A;  2AXT H;  3M0A A;  1VF5 B;  3CCR P;  3PHL A;  5AW6 B;  5B66 E;  1L0L K;  3L37 A;  1BE3 G;  4EIJ A;  2E74 D;  1KQG B;  2KIK A;  1CZQ A;  1L0N G;  1SFC D;  1EC5 A;  2DW3 A;  1KQL A;  1LTJ C;  3H1K E;  3D6Y A;  3Q5S A;  3AED C;  1L0N E;  5KLV D;  1FZC A;  4HKZ H;  2K1A A;  1PGP A;  3L71 E;  1HH0 A;  1A02 F;  2R44 A;  3HD7 C;  3CXH H;  4H0L D;  1AVO A;  2XKM A;  4JQ0 D;  1GW3 A;  2YMY A;  2E5T A;  2Z5H A;  1YJN P;  1PV3 A;  1NHL A;  3C9I A;  2P7J A;  1IK9 A;  1LWU C;  2JP3 A;  2JO1 A;  1KMI Z;  2RH0 A;  1GTW A;  1FAV A;  2GUS A;  2XDJ A;  3V2Q A;  2AEJ A;  5KKZ C;  2B9B A;  1N7S D;  3H1L E;  3M0D A;  2WPQ A;  2IYP A;  4YXW H;  2BEQ D;  5BU5 A;  4WVZ A;  3N4X A;  2H8P D;  1Q7Y Q;  2QG4 A;  3CME P;  3PP5 A;  5DJU B;  1Q2N A;  3JCU H; 
#chains in the Genus database with same CATH homology
 2MJZ A;  5CHX A;  2XV5 A;  1URQ C;  1SQX K;  2VRS A;  2M8R A;  2W27 A;  2Q7C A;  2NPS C;  3V2R A;  3RL0 B;  1N73 A;  3V5B A;  1IJD B;  2WWW A;  1FOS E;  3VMX A;  3HUS A;  1N86 A;  2A45 I;  1N73 B;  1QL2 A;  3P8C D;  1GL2 C;  2KP8 A;  1H88 A;  3EFG A;  3HUS B;  2WSF H;  5CJ0 A;  1JY3 O;  2LKM A;  3MIW A;  3TK1 A;  1KIL C;  5AW3 B;  3UIA A;  1IFN A;  5CCH D;  2HOD A;  1LTG C;  3KPE A;  2Q5U A;  3BAS A;  4WB4 A;  1J1D C;  2HOD B;  1J1E B;  1GD2 E;  1URQ D;  2A45 H;  2CPB A;  3M0D C;  1G2C B;  1LGH B;  1RF0 A;  2R5D A;  1SQV K;  2W6B A;  2N9B A;  2WSE H;  1NO4 A;  2FFD A;  3RK2 B;  4RES B;  2N1T C;  2NPS D;  5AVR B;  3V4Q A;  3KYQ A;  5AW4 B;  3CI9 A;  2FFD B;  2OYI C;  2R3C A;  5APW A;  2FYZ A;  3B5N C;  2KB7 P;  1JY3 N;  5AW7 B;  4ZKU A;  5BU8 B;  5AW0 B;  1GL2 D;  5CCG C;  1T2K C;  1JY3 P;  1FZE A;  3VN0 A;  5KJ7 C;  1CSB A;  3TYY A;  3VMY A;  1SFC A;  3HE5 A;  3RK3 C;  3P8C E;  1SFC B;  1MUU A;  3RL0 C;  2H7H A;  1X8Y A;  1L4A D;  3HE5 B;  3HE4 A;  3T97 A;  2HLO A;  1PFI A;  1FDM A;  4Y99 B;  1N7L A;  1N73 C;  3NXS A;  2Q9I A;  1T3U A;  3HE4 B;  3U1C A;  3VMZ A;  3MTU E;  1VDF A;  2N1T D;  3LID A;  3BRV B;  2O1J A;  2H43 A;  2HG5 D;  1NH4 A;  3R2P A;  4IFF A;  3SWF A;  5APV A;  3CLQ A;  3LW5 H;  4GKG A;  5CCG D;  1T2K D;  1HGV A;  5KJ7 D;  1J1E C;  4XE5 B;  1DH3 A;  4DZO A;  1OXZ A;  1GDT A;  4AYC A;  1FOS F;  1ZR4 A;  5KLV K;  3RK2 C;  5AW2 B;  3M9B A;  1IFI A;  2YO2 A;  3RK3 D;  1RF0 C;  2GM4 A;  1E5W A;  3RL0 D;  2WSC H;  4JYB A;  3VP9 A;  2FFD C;  2PP6 A;  1GU4 A;  2XU6 A;  4I6M C;  3EQ2 A;  5CJ4 A;  3MD0 A;  5AVW B;  2OYH C;  4C7N A;  1AFO A;  1YTZ T;  5AVV B;  3CL3 D;  3HD7 A;  3TNU B;  1MV8 A;  5APU A;  3M9Q A;  5BVZ A;  4C7N B;  1IFM A;  3GHG C;  3HD7 B;  3OAK A;  4LGD E;  5AW8 B;  1FZA A;  1RE4 A;  1SFC C;  1XTG B;  5AVT B;  2YKP A;  2R32 A;  2WT7 A;  3VOP A;  4Y99 C;  1FBM A;  1KZU B;  1N2D C;  2IX7 C;  2YNY A;  1JOC A;  2WT7 B;  1JCD A;  2R5B A;  2KOG A;  1DEB A;  1G1I A;  2POH A;  1SP4 A;  2IPP A;  1LTA C;  2KLV A;  2YO3 A;  1OWA A;  4HH2 A;  4WBA A;  2JEE A;  1KFN A;  1SQP K;  1LWU B;  1HTL C;  2W6A A;  2YKO A;  2HYN A;  4W80 A;  1G2C A;  1CI6 A;  1NKZ B;  5AVY B;  1M1J A;  2IFM A;  1AQ5 A;  1FJK A;  1ZV8 A;  5CMZ A;  1RE3 A;  1CI6 B;  1NU1 K;  3M06 A;  1M1J B;  3I5C A;  4I2L C;  1NOH A;  1LTI C;  3V2N A;  1M7L A;  3II6 A;  1JTH A;  1JNM A;  4WY4 A;  5AW1 B;  1FZG A;  2YKQ A;  3B8E B;  3V4W A;  1L0N K;  1JTH B;  1WRG A;  4WY4 B;  5AVX B;  3L35 A;  2FKW B;  2XNX A;  3KDP B;  1X79 B;  3IFM A;  2E43 A;  4LLH A;  1IFJ A;  1LT9 A;  4OH8 B;  1LTT C;  1EQ7 A;  1GU5 A;  1KIL D;  1LT9 B;  4XA4 A;  1FZC B;  3MUD A;  3BAT A;  3VYI A;  1Z56 A;  4KHX A;  1J2J B;  2P2U A;  2WTY A;  1ZN5 A;  3A5T A;  1KFM A;  1RE4 C;  1IC2 A;  1VPC A;  1HUC A;  5AVS B;  3P8M C;  1FZF A;  4ZKP A;  1JY2 O;  4N78 E;  1NWQ A;  2GUV A;  3HUS C;  1GK6 A;  1G1J A;  3LIE A;  3OJA B;  2IFN A;  4AUW A;  3A7O A;  1IO4 A;  2FXM A;  1SQB K;  3B5N D;  3MGN A;  2KYV A;  3O8Z A;  4GIF A;  2J59 M;  4DOJ A;  1S9K D;  3SWY A;  2O1K A;  2C0X A;  2FYU K;  4O9B A;  4B86 A;  3BRT B;  1LTJ A;  1T8Z A;  1RE3 C;  1XTC C;  1JY2 N;  2A45 G;  1L4A A;  1HVV A;  1GW4 A;  5AW9 B;  2C0W A;  3P7K A;  1LTJ B;  1JUN A;  4WY4 C;  1JY2 P;  5APS A;  1L4A B;  3TNU A;  5APT A;  2KSJ A;  2HFE D;  2WPR A;  1SLQ A;  3M9H A;  2WZ7 A;  1LTB C;  4W7Y A;  1H89 A;  4EOT A;  1N7S A;  4W7Z A;  3VP8 A;  1NKN A;  3A2A A;  1LT9 C;  1H8A A;  3V2P A;  1N7S B;  4JYC A;  3NMD A;  1RF1 A;  1NTM K;  1NTZ K;  1ZR2 A;  1YTZ I;  1T3J A;  1JMM A;  1RF1 B;  5APQ A;  3L4F A;  4N6J A;  1HJB A;  1HBW A;  3RK2 D;  4JF7 A;  4I1L A;  1LWU A;  4M3L A;  3OA7 A;  2XZR A;  3RK3 B;  1FJP A;  1JCC A;  4N78 D;  3L36 A;  1W2E A;  1S9K E;  1A02 J;  3M0A A;  3G3Z A;  3HTK A;  4WY4 D;  2C9N Y;  5AW6 B;  1L0L K;  1SQQ K;  3L37 A;  4EIJ A;  3HTK B;  1CW5 A;  2PAJ A;  4IFM A;  1GZL A;  2I1J A;  1CZQ A;  1RY3 A;  1YYC A;  1SFC D;  3NFQ A;  1KQL A;  1MZ9 A;  2OAR A;  3KQG A;  1LTJ C;  1DX7 A;  1L4A C;  1NTK K;  1X9V A;  2C9L Y;  1FZC A;  3U1A A;  1HWT C;  1ZLL A;  3TSI A;  1HH0 A;  2P67 A;  1LTS C;  1A02 F;  3H32 A;  3HD7 C;  5CCH A;  5AVQ B;  2XKM A;  4C7R A;  3P32 A;  4AQR D;  4N3Y B;  2OYH A;  1N7S C;  3H32 B;  1NAF A;  3A3Y B;  2ZXE B;  1URQ A;  3IR9 A;  3NTN A;  2ZFC A;  2O01 H;  3H6P A;  3U59 A;  2OYH B;  2P1J A;  1GW3 A;  2YMY A;  4LC1 A;  2JJL A;  3GHG A;  1RF1 C;  2Z5H A;  1URQ B;  3N7N A;  2CPS A;  2NPS A;  1JO5 A;  1NHL A;  2BAS A;  4HYT B;  3GHG B;  4GT1 A;  1MFZ A;  3C9I A;  2NPS B;  2QM7 A;  2WPS A;  1SVF A;  2P7J A;  1IK9 A;  1LWU C;  1GL2 A;  5AVZ B;  2I1K A;  1HGZ A;  1GL2 B;  1GTW A;  3VTP C;  1FAV A;  1WT6 A;  1FZB A;  1KIL A;  2GUS A;  1M1J C;  1IFD A;  5APY A;  1GK4 A;  5AVU B;  2XDJ A;  2WIT A;  3HD7 D;  3V2Q A;  2HPC A;  1KIL B;  5APX A;  1N7S D;  2HPC B;  3M91 A;  3M0D A;  2WPQ A;  3HRN A;  1J1D B;  4IFD K;  2N1T A;  1QL1 A;  3WMM 0;  2OYI A;  2E42 A;  5BU5 A;  5AW5 B;  2M3B A;  4C46 A;  2N1T B;  3B5N A;  5KTB A;  1FZC C;  3E1I A;  2QM8 A;  2L5G B;  3N4X A;  2Q3I A;  2OYI B;  2H8P D;  5CCG A;  3B5N B;  3BVH A;  3PP5 A;  1FU1 A;  5CCH C;  5KJ7 A;  2Z5I A;  2J58 A;  2Z4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...