2Z5IA

Crystal structure of the head-to-tail junction of tropomyosin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
49
structure length
49
Chain Sequence
GELLSKNYHLENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for tropomyosin overlap in thin (actin) filaments and the generation of a molecular swivel by troponin-T
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
molecule keywords General control protein GCN4 and Tropomyosin alpha-1 chain
total genus 22
structure length 49
sequence length 49
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2z5iA00
1DH3A 5AVRB 1HWTC 5AW2B 3P8MC 1OXZA 3HE5A 3OAKA 1CI6A 3M0DA 2P7JA 4XE5B 3VMYA 3MD0A 2E43A 5AW7B 1GK6A 2XZRA 3NXSA 2R3CA 1GK4A 2WPSA 2Z5IA 3TK1A 2ZFCA 3M91A 1JUNA 2WPQA 3A7OA 1H8AA 1NWQA 1NAFA 1S9KD 2QM7A 4JYCA 4EOTA 4M3LA 1HUCA 5AVSB 3V5BA 3A2AA 3P7KA 4RESB 3B8EB 4B86A 5AVUB 2VRSA 5AVZB 4DZOA 4JYBA 1CSBA 2Q7CA 5AW0B 5APVA 1MUUA 2P67A 2BASA 3V4QA 3TNUB 2Q5UA 2XV5A 1FAVA 1KQLA 1GD2E 5APTA 2YO2A 1GTWA 1A02F 1CZQA 3O8ZA 1SP4A 1T2KD 2WT7A 1G2CB 3A3YB 3KDPB 3LIDA 2H7HA 2WWWA 2C9LY 1GU5A 5AVTB 4KHXA 5APSA 1YYCA 2Q3IA 3M9HA 5AVWB 3M9BA 1HJBA 5AW8B 2W27A 1H89A 3VMXA 5AVXB 4C7NB 1SLQA 4C7NA 3MGNA 2E42A 5APWA 3NTNA 3P32A 5AW5B 3M0AA 4GT1A 2C9NY 2QM8A 1T2KC 1S9KE 3NMDA 2R32A 2ZXEB 4I6MC 3TNUA 3HE4A 3KQGA 2R5BA 4AUWA 5AVYB 4GKGA 1FOSF 5AVVB 3L35A 3M06A 2XU6A 5AVQB 3HE4B 3A5TA 3V4WA 2WT7B 1H88A 4AQRD 1FOSE 3LIEA 2WPRA 3UIAA 3I5CA 5APYA 2YO3A 3VYIA 2YNYA 1IO4A 4I2LC 1X8YA 5APQA 3T97A 3HTKA 5CMZA 1GU4A 3TYYA 1MFZA 1CI6B 2Z5HA 2KP8A 5AW9B 1A02J 1HBWA 3L37A 2R5DA 3NFQA 1JNMA 3VMZA 2W6AA 5APXA 3SWFA 5APUA 3VTPC 5AW1B 4LC1A 4C46A 3L36A 3IR9A 2P2UA 4AYCA 2IPPA 1GZLA 1J2JB 2JJLA 4HYTB 1MV8A 5AW6B 2WTYA 5AW3B 3VN0A 1OWAA 3HE5B 5AW4B 2N9BA
chains in the Genus database with same CATH superfamily
1DH3A 4KT0J 1NTZG 3CCVP 3D6ZA 3CXHD 3Q5RA 1URQD 3HE5A 1NTKE 2LXCB 3AE1C 1FZCC 1NAYA 3AEFC 3OAKA 1NGMB 2PAJA 3RBXA 3HD7D 4DOJA 1AQ5A 2POHA 1SQVE 4XE5B 1YJ9P 3AEAC 1OVVA 2JDIH 2PP6A 2AEMA 1QVFO 2B87B 5AW7B 3BATA 3F89A 3G6EP 1DEEG 3H1LE 2R3CA 4N6JA 5M1BA 1S3JA 2ZFCA 5B5EE 1KB9I 3CX5I 2RN0A 3FWLA 1NAFA 3MTUE 4JYCA 1Y47A 1Q7YQ 4M3LA 1LWUA 3OW2O 3JSVC 1T8ZA 3L74D 2H8PD 1PZQA 2OTLP 1JCCA 3IAOA 1HF9A 1L2PA 4XFJA 1IFMA 1Q81Q 3D70A 1M8OB 2QJPC 3T97B 2HPCB 2VRSA 2R44A 4OH8B 1BE3J 2IFMA 4TLFA 1CSBA 1PL5A 1IFJA 2O1JA 1RE4A 2W83C 3EFFK 4Y99C 5AW0B 2Q7CA 4N78E 1X0TA 3L72E 3SFEC 5CCHC 2E76B 1PP9G 2P67A 5KAIE 1NJIQ 2BASA 3RK2B 3V4QA 2E75D 3BCCE 1JY3P 1FAVA 3HUSB 1MKMA 1JMBA 1K73Q 1KTMA 5TJHA 3L70E 2K9YA 2QJYC 4IFMA 4PD4I 5H2FH 1S5LH 3U1CA 3EFGA 3H1JJ 1SP4A 2RH0A 1QLED 1G2CB 1X22A 3GLMA 4R4LA 3A0HH 3BCCJ 1VQLP 5EFWB 1GU5A 1NHLA 3N7NA 3C1LA 3O6QA 2YMYA 3PP5A 3GF7A 1U7MA 4KHXA 3A0BH 3GHGB 3I56P 5APSA 2Y0CA 3TGUJ 3FGAD 3M9HA 5CCHD 5AVWB 2WZ7A 3CCUP 2WSFJ 1HJ0A 1L0LK 1XTGB 2E74B 1Q2NA 1OIPA 1NO4A 2SPZA 1MFTA 1GW3A 1SQQJ 2OARA 1ZN5A 2FXOA 2OTKE 3CXHI 5AVXB 4C7NA 2ZJSE 3MGNA 1JMMA 5APWA 3NTNA 3VP9A 3P32A 2FBWC 5KLVJ 3L73E 4L74A 1FDMA 3IF4A 1VQMP 3AE2C 2C9NY 1L4AA 2QM8A 2FYUG 4PV1C 3V2NA 4C7RA 2YIUB 5KLVG 3S4RA 4ASVA 1S9KE 2BEZF 1W2BO 5KJ7D 4YTPC 3RL0g 1UIXA 4KJMA 3IN6A 3B5NA 1LTJB 2HLOA 4W7YA 5CBNA 1URQB 4D6TG 2KYVA 2XU6A 5AVQB 1SQBK 4EYYQ 3AE9C 1EC5A 1KZUB 1LP1A 1N7SC 2CPSA 2ZYGA 4UB6H 1YTZI 1GW4A 2E74D 2KK7A 2QJPB 4HH2A 1ZV8A 2WPRA 4AQRD 2KNCA 1FOSE 2ZYDA 1RQVA 3TGUG 5APYA 3ABVC 1Q82Q 2K88A 2M3BA 3G4SP 3PH0A 5APQA 3T97A 2FYZA 1JB0J 1G1JA 1KYOI 1HGVA 1LNQA 3LW5J 1SFCB 1JOCA 1L0ND 2KS1B 1BE3D 2QIWA 3L75J 3NFQA 1JNMA 4H13C 2OYHB 1FC2C 5APXA 1VF5D 5KAFH 2P58A 5KTBA 1KN7A 5APUA 2E76D 1EXJA 1LT1A 1SQQG 3PJSK 4LC1A 1L4AD 2W90A 3L36A 1EZVE 1QL2A 3CCQP 1M1KQ 4BXLA 1FJPA 2FYUD 1N73A 2P2UA 1P84H 2IPPA 2M3EA 2QRXA 2JJLA 2ZXXA 3U1AA 1N7SA 4AYCA 1VDFA 1MZ9A 3H1HE 2WTYA 4H0LB 1GL2D 4CPGA 2LR2A 5AW3B 3RGUA 1KQGB 2FXMA 1NKNA 2M5AA 3CMEP 2Q1KA 4I2LC 1VQPP 1YITP 3GG2A 4ZNCA 1ZOYC 2A45I 2O1KA 1DD4A 2E75C 1AA0A 2OGUA 5CCGC 3CPWO 1R5LA 2WVRA 3W68A 3BVHA 1OZHA 3KHUA 1L0LG 3AE3C 1Y9BA 1JTHB 2L5GB 3FWNA 1L0NK 1SQBG 3L74J 1GMJA 4RO0A 3TGUD 3CCSP 1NTMK 2C0WA 3MUDA 3WU2E 3AE5C 1KILD 2XZRA 3L70G 4RKUJ 4IL6E 2YMKA 2KLVA 1JO5A 1SQQD 3H6PA 1GK4A 2WPSA 2AEFA 2I1KA 3JCUE 3M91A 1SQPG 1H0TA 3V2RA 3TGUE 2GA1A 1E79H 1M56D 3MZWB 1EZVG 1T6AA 1M57D 1VQNP 1SQQE 4Y28J 3L72J 3CLQA 1LT9A 3H1KJ 2W6BA 2KUBA 3KZIH 5AVSB 3S9OA 3V5BA 1FDOA 4RESB 5CHXA 4ZKUA 1Z56A 3B8EB 4B86A 3EWKA 2GUSA 4BRYA 1AVYA 3FX0A 1JCDA 1P84I 1SQQK 1T3JA 4L75A 1AV1A 4OGQB 1KILC 3CWBD 3VP8A 2IZ0A 4UB8H 1P84D 1RHZB 3H1LG 1KQLA 3CC7P 2QJKB 1K9MQ 2YO2A 3K5BA 1U7JA 2QG4A 2ZT9D 3B71A 2XKMA 2XNDH 3KPEA 1RE4C 3E7KA 4GIFA 3AE4C 4IL6X 2HR3A 3TSIA 2IYOA 4JQ0D 2H88C 1L0LE 2KI7B 3O8ZA 2WT7A 2OYHA 3E1RA 2NPSB 2WSSH 4K3AA 3VMAA 1BGYD 1NTKG 1SQBJ 1SQVJ 1KYOE 1UIIA 3LIDA 3USSA 2H7HA 5AVTB 1LWUB 2ZYAA 4UB8E 3L70J 3P8CD 3CXHE 1JY2O 3H1KG 3N4XA 3EQ2A 2NPSC 3RBZA 4BRYB 2Q3IA 3PHLA 3Q2YA 1EDLA 4EI2A 4OGQD 1USDA 1SQPK 3M9BA 1KB9H 3CX5H 1Q90D 5AW8B 2W27A 4ZKPA 1H89A 1HJBA 1ZP0C 1KILE 1LTTC 4H13D 1KORA 5KJ7A 2ZT9C 1ZR4A 1NU1D 1HVVA 2YXQB 1K04A 4DJGA 1PV3A 3M9QA 4JPZB 4GDOA 5GTIH 2IBZE 1G2CA 2Q3EA 2IZ1A 2NPSA 3B5NC 2R32A 3NMDA 3WUVA 3WUUA 2ZXEB 5BU8B 1YJWP 2KXPB 2KOGA 1BGYJ 1SQVD 3V2QA 2BEQD 3Q5SA 1SQXK 1IK9A 2M0BA 3ITKA 1HTLC 4WBAA 5AVYB 4AUWA 1FOSF 1NTZK 2NPSD 5AVVB 5K5GB 3M06A 2FXPA 3A5TA 3HE4B 4A7PA 3CCLP 2IYPA 1LTGC 2AXTH 1PP9D 2O3JA 3L75G 5KAFE 3I55P 1RF0C 2Z4EA 3UIAA 2P1JA 5CCGD 4IFFA 1VQ8P 3I5CA 1L0NE 3IFMA 3H25A 3BCCD 1X8YA 4D6TE 1M1JB 2W8ZA 4N3YB 1SQPJ 2KIKA 1J1DC 3G3ZA 5BU5A 3L75D 3H1KE 1MFZA 1CI6B 1NTZD 2KP8A 2Y0DA 2Z5HA 1EZVI 3B5ND 1SQBE 1YI2P 1A02J 1LTAC 1GDTA 2HYNA 2MJZA 3VMZA 1S4XA 1PIXA 2FYUE 4IOIH 1K8AQ 1QX8A 1FZAA 2FKWB 3CWBE 4N78D 1P84E 4XA4A 4C46A 1FZFA 2QSIA 1AJYA 3H32B 2LXBA 2JP3A 1GZLA 2WSEJ 1FDIA 1NU1G 3W67A 1NH4A 3WMM0 1LTJA 1MV8A 1PPJD 2D2CB 2NZ2A 3TDKA 5CCHA 1OWAA 2H89C 1YQ3C 3H1LJ 3HE5B 1OX3A 2B9BA 1S72P 1J2JB 3H1JE 4HYTB 2N1TA 2YKQA 3SWKA 1HWTC 5AW2B 3CWBG 1OXZA 2B88A 2JO1A 2FYUK 5CCGA 1QL1A 3WU2H 4I7ZB 5KKZC 3M0DA 2P7JA 1FZGA 1VQ7P 3VMYA 1VQKP 2K9JA 1DD3A 2C0XA 1AFOA 4YXDC 1H0TB 2B89A 3D71A 3II6A 1RF0A 1WT6A 1X79B 1NTKK 2WSEH 2GUVA 2Q6QA 3NXSA 1QVGO 2Z5IA 3TK1A 2O01H 2A45H 1RE3A 3L73D 1LT9B 2CPBA 3A0HE 1PP9E 2B87A 2J5UA 2WPQA 1L0NJ 3QWOC 3L72G 3R4YA 1H8AA 1S9KD 2QM7A 2WQYC 3C9IA 4EOTA 1EXIA 1URQA 3H1LD 1E5WA 1YBKA 1HUCA 2DW3A 5KLIB 1SS1A 1JM0A 1WRGA 4Y99B 2O01N 1VQ4P 1JY3N 4DZOA 3AECC 4JBZA 1KD1Q 4JYBA 2FFDC 1RF1C 3CCRP 3BASA 1N86A 2R3SA 3H1JG 1KYOH 2JWAA 3CWBJ 5KAIH 1LGHB 4OVNF 3VOPA 1PGOA 5APVA 4W7ZA 3AEGC 3S1KA 2K1AA 3TNUB 2Q5UA 1M1JA 2XV5A 4I7ZC 1EZVD 2M8RA 3A0BE 4H44B 5APTA 2PGDA 1DX7A 1A02F 1SQPD 2J58A 2E5YA 3H1HD 1NTKJ 1SQVG 2ZVNB 1BCCE 2V7QJ 1M7LA 1KILA 1NKZB 2I8DA 3HUSA 4WB4A 3GHGC 3FXEA 3L70D 1BDCA 1N73B 4NPFX 4UB6E 1PGQA 2WWWA 1VQ5P 1T2KC 2OYIB 2JWDA 2IDBA 1USEA 1JUNA 5TISE 1L0LD 3CD6P 3L71E 2BCCE 3E1IA 2QJYB 1NYHA 1W5CE 2PRRA 2WPVB 3KZIE 2KZJA 2OQQA 3LW5H 1OW6A 4WVZA 3D6YA 1L0NG 2IFNA 1JY3O 4GOFA 2N9YB 3WUTA 1FE6A 1OMIA 2JR8A 2ZAEB 4C7NB 5E79E 1BDDA 4GOEA 3MIWA 1M1JC 4U3FE 1JTHA 1ZMEC 1OFCX 1QEXA 2HFED 3CL3D 3M0AA 3MHVA 3H1HJ 4GODA 1BGYG 1NTKD 4GT1A 1YJNP 1VQ6P 1IFPA 2AXTE 3L71G 3AEBC 2YKOA 3CXHH 3CI9A 1NU1K 3H1ID 1JY2P 1ZXGA 3KQGA 2R5BA 1FS0E 3RL0C 1VF5C 2IBZD 4QMAA 1RH5B 2IBZG 4GKGA 4H0LD 3SWYA 1LTSC 1IK7A 1BCCG 1VPCA 1SFCC 2KLUA 3OJAB 4PD4H 1IZNB 5GTHE 1KILB 3V4WA 2WT7B 1VQOP 1H88A 3L73J 5B5EH 1LJ2A 1NTMG 3LIEA 5CJ0A 4WY4A 4U7JA 2FY8A 1RF1B 3GMAA 1SQVK 1SQBD 1S5LE 2YO3A 1GL2C 4K35A 3VYIA 1VL2A 2MKVA 3GF3A 3L4FA 1K05A 1NTMD 2ITAA 1YTZT 1J1EC 2RKLA 2WSFH 1IFNA 5CMZA 5KLIC 1GU4A 3CC4P 1CW5A 1HBWA 2KS1A 4WY4D 3CCMP 1SFCA 3MP7B 5CBOA 1BCCD 1ZRTE 2XDJA 4D6TD 2KSEA 2R5DA 3M0DC 4EDFA 3H1IJ 2W6AA 2KSJA 3H1IG 4U3FG 5AW1B 3VTPC 1SFCD 2V7QH 4LLHA 5KKZB 2QEXP 3HD7A 3IR9A 1NU1J 2O01J 3L71D 3ZDMA 4U3FJ 2WSCH 1N73C 2OYIC 2E74C 1EDJA 2G8YA 2ZVOB 3JCUH 1Y8AA 3H1HG 3G71P 4MN4C 1RQUA 4ASWA 4IL6H 4LGDE 1N7LA 1BSNA 2HODA 2WMMA 5AW6B 3VN0A 2BCCG 4ZMDA 2H43A 4R4MA 4YXWH 1DEBA 1BE3G 1NTMJ 2D2CC 1U57A 2QE7H 2LKMA 2NRGA 3R2PA 4H44C 5AVRB 4HJGH 3P8MC 2XNXA 2K9JB 4BWNA 2BCCD 1BCCJ 1PP9J 1PGPA 1CI6A 3H1JD 1AVOA 4DT0A 3G9RA 3FXDA 2RMZA 1D7MA 3MD0A 5C39A 2E76C 1S1CX 2FFDB 2E43A 2I1JA 1J1EB 1GK6A 1IFDA 1L4AC 1NOHA 3F5HA 3HD7B 1IFIA 3PRJA 3Q3DA 1ZR2A 3HUSC 1FBMA 1SQXJ 2E5TA 1S2EA 4L76A 1T3UA 2JEEA 4U3FD 1KB9E 3AEEC 3CX5E 3RK2C 1NTZJ 3U59A 3CMAP 2KB7P 3A7OA 3JC22 4H13B 2Y0EA 1FZBA 1J1DB 1NWQA 3GW6A 2L91A 1S5LX 1X9VA 1GD2E 2D2CD 1VQ9P 3H1IE 4H44D 1QGKB 3A2AA 3P7KA 3KXDA 5KLVD 3GHGA 5AVUB 5AVZB 1NTZE 1ZLLA 2K3RA 1HH0A 1YIJP 3O6QB 1RF1A 2WITA 1ZRTD 1SQXE 1KQSO 3HRNA 1KFNA 1KFMA 4O9BA 2YXRB 3CC2P 2N1TD 4PV1D 1MUUA 2E75B 2JKVA 3RL0B 2QA4P 3Q1MA 3CCEP 5H2FE 5DJUB 1URQC 3TF5A 1Q86Q 1SQXD 3AE7C 2J59M 3BRVB 5KJ7C 4DCKA 1NTME 4HB1A 5L8RJ 3B5NB 3RK3D 1L4AB 3HD7C 3PTZA 1OW8A 3MUDC 1KYOD 1PPJG 3QH9A 2WSCJ 1N2DC 2Y9YA 1CZQA 4H0LC 4TT3H 2A06E 1GTWA 2YIUC 2FFDA 1T2KD 2AEJA 1LP1B 1G1IA 1NVOA 1TU3F 1N7SD 4PD4D 1KQFB 3A3YB 3KDPB 3RK3E 2KZIA 3H32A 4D6TJ 1JEKA 2C9LY 4RJTA 1IC2A 2ZT9B 1IJDB 1EDKA 3KYQA 2GM4A 2UWJE 1HGZA 3B4SA 5KLVK 1BGYE 1YYCA 2CK3H 1GL2A 2OYHC 4WWIA 2KNCB 1FU1A 2N1TC 1RE3C 1LWUC 1NU1E 1EDIA 2A45G 4WY4C 2HODB 3CCJP 1PPJE 1PFIA 1OVRA 1ZW0A 1SVFA 3SSUA 3VMXA 1KV4A 1LTIC 2Q9IA 2FYNB 3HTKB 1SLQA 2V4HA 3AE8C 4PJ0H 3BCCG 3RK3C 1LTBC 2E42A 3TYYA 1YQ4C 1KB9D 3CX5D 5AW5B 2YKPA 2G3AA 4PJ0E 5CJ4A 2QJKC 5E79H 1DIPA 2BCCJ 4W80A 4I6MC 3TNUA 3L74G 3L74E 1R8EA 3HE4A 3AE6C 4NPDA 1YHQP 2HG5D 4EIJA 1FZCA 3V2PA 5KLVE 1M90Q 1N8RQ 2OYIA 1N7SB 3OA7A 1LTJC 2IBZI 3L35A 1RY3A 3L73G 5GTIE 1LT9C 4OGQC 3V6IA 1OVUA 2HPCA 4HKZH 2M5AB 1GL2B 3L75E 2P10A 5TISH 1JY2N 1KMIZ 3BRTB 5DJTB 5BVZA 2IX7C 1KC8Q 2YNYA 4L73A 1FZEA 1PGJA 1IO4A 3Q5PA 4PV1B 4Z1MH 3HTKA 5B66H 4JF7A 1L0LJ 1EQ7A 3PLNA 4OWFA 4YPCA 2OYOA 3SFDC 5AW9B 2QVAA 1BSHA 2AXCA 3L37A 5GTHH 3RK3B 3C8VA 3RK2D 4PD4E 1VF5B 1WMKA 4I1LA 3L72D 3H1KD 3L71J 3SWFA 2A06G 1OW7A 3P8CE 1BE3E 2PFXA 2OTJP 4NPEA 2Y9ZA 5B66E 1XTCC 1R5SA 2W6JH 1SQPE 1FJKA 3AEDC 2A06D 4IFDK 2N1TB 3RL0D 2FYUJ 2FYNC 1AQTA 1FZCB 5AW4B 4WY4B 1W2EA 2K37A 1SQXG 2N9BA
chains in the Genus database with same CATH topology
1DH3A 1URQD 3HE5A 1FZCC 3OAKA 2PAJA 4DOJA 3HD7D 1AQ5A 2POHA 4XE5B 2PP6A 5AW7B 3BATA 2R3CA 4N6JA 2ZFCA 1NAFA 3MTUE 4JYCA 4M3LA 1LWUA 1T8ZA 2H8PD 1JCCA 1IFMA 2HPCB 2VRSA 4OH8B 2IFMA 1CSBA 2O1JA 1IFJA 1RE4A 2Q7CA 5AW0B 4Y99C 4N78E 5CCHC 2P67A 2BASA 3RK2B 3V4QA 1JY3P 1FAVA 3HUSB 4IFMA 3U1CA 3EFGA 1SP4A 1G2CB 1GU5A 1NHLA 3N7NA 2YMYA 3PP5A 4KHXA 3GHGB 5APSA 3M9HA 5CCHD 5AVWB 2WZ7A 1L0LK 1XTGB 1NO4A 2OARA 1GW3A 1ZN5A 5AVXB 4C7NA 3MGNA 1JMMA 5APWA 3NTNA 3VP9A 3P32A 1FDMA 2C9NY 1L4AA 2QM8A 3V2NA 1S9KE 4C7RA 5KJ7D 3B5NA 1LTJB 2HLOA 4W7YA 1URQB 2KYVA 2XU6A 5AVQB 1SQBK 1KZUB 1N7SC 2CPSA 1YTZI 1GW4A 4AQRD 4HH2A 1ZV8A 2WPRA 1FOSE 5APYA 2M3BA 5APQA 3T97A 2FYZA 1G1JA 1HGVA 1SFCB 1JOCA 3NFQA 1JNMA 2OYHB 5KTBA 5APXA 5APUA 4LC1A 1L4AD 3L36A 1QL2A 1FJPA 1N73A 2P2UA 4AYCA 2IPPA 3U1AA 2JJLA 1N7SA 1VDFA 1MZ9A 2WTYA 1GL2D 5AW3B 2FXMA 1NKNA 4I2LC 2A45I 2O1KA 5CCGC 3BVHA 2L5GB 1JTHB 1JO5A 1L0NK 1NTMK 2C0WA 3MUDA 1KILD 2XZRA 2KLVA 3H6PA 1GK4A 2WPSA 2I1KA 3M91A 3V2RA 3CLQA 1LT9A 2W6BA 5AVSB 3V5BA 4RESB 5CHXA 4ZKUA 1Z56A 3B8EB 4B86A 2GUSA 1JCDA 1SQQK 1T3JA 1KILC 3VP8A 1KQLA 2YO2A 2XKMA 3KPEA 4GIFA 1RE4C 3TSIA 3O8ZA 2OYHA 2WT7A 2NPSB 3LIDA 2H7HA 5AVTB 1LWUB 3P8CD 1JY2O 3N4XA 3EQ2A 2NPSC 2Q3IA 1SQPK 3M9BA 1HJBA 5AW8B 4ZKPA 2W27A 1H89A 1LTTC 5KJ7A 1ZR4A 1HVVA 3M9QA 1G2CA 1T2KC 3B5NC 2NPSA 3NMDA 2R32A 2ZXEB 5BU8B 2KOGA 3V2QA 1SQXK 1IK9A 4AUWA 1HTLC 4WBAA 5AVYB 1FOSF 1NTZK 2NPSD 5AVVB 3M06A 3A5TA 3HE4B 1LTGC 1RF0C 2Z4EA 3UIAA 2P1JA 5CCGD 4IFFA 3I5CA 3IFMA 1X8YA 1M1JB 4N3YB 3G3ZA 1J1DC 5BU5A 3TYYA 1MFZA 1CI6B 2Z5HA 2KP8A 3B5ND 1A02J 1LTAC 1GDTA 2HYNA 2MJZA 3VMZA 1FZAA 2FKWB 4XA4A 4C46A 1FZFA 3H32B 1GZLA 1NH4A 3WMM0 1LTJA 1MV8A 5CCHA 1OWAA 3HE5B 1J2JB 4HYTB 1HWTC 2N1TA 2YKQA 5AW2B 1OXZA 2FYUK 5CCGA 1QL1A 3M0DA 2P7JA 1FZGA 3VMYA 2C0XA 1AFOA 3II6A 1RF0A 1WT6A 1X79B 1NTKK 2WSEH 2GUVA 3NXSA 2Z5IA 3TK1A 2O01H 2A45H 1RE3A 1LT9B 2CPBA 2WPQA 1H8AA 1S9KD 2QM7A 3C9IA 4EOTA 1URQA 1E5WA 1HUCA 1WRGA 4Y99B 1JY3N 4DZOA 2FFDC 4JYBA 1RF1C 3BASA 1N86A 1LGHB 3VOPA 5APVA 4W7ZA 3TNUB 2Q5UA 1M1JA 2XV5A 2M8RA 5APTA 1DX7A 1A02F 2J58A 3HUSA 1M7LA 1KILA 1NKZB 4WB4A 3GHGC 1N73B 2WWWA 2OYIB 3E1IA 3LW5H 2IFNA 1JY3O 4C7NB 3MIWA 1M1JC 1JTHA 2HFED 3M0AA 3CL3D 4GT1A 2YKOA 3CI9A 1NU1K 1JY2P 3KQGA 2R5BA 3RL0C 4GKGA 3SWYA 1LTSC 1VPCA 3OJAB 1SFCC 1KILB 3V4WA 2WT7B 1H88A 3LIEA 5CJ0A 4WY4A 1RF1B 1SQVK 5BVZA 2YO3A 1GL2C 3VYIA 3L4FA 2WSFH 1YTZT 1J1EC 5CMZA 1CW5A 1IFNA 1GU4A 1HBWA 4WY4D 1SFCA 2XDJA 3M0DC 2R5DA 2W6AA 2KSJA 3VTPC 5AW1B 1SFCD 4LLHA 3HD7A 3IR9A 1N73C 2WSCH 4LGDE 5AW6B 1N7LA 2HODA 2H43A 3VN0A 1DEBA 3R2PA 2LKMA 5AVRB 3P8MC 2XNXA 1CI6A 3MD0A 2E43A 2FFDB 2I1JA 1J1EB 1GK6A 1IFDA 1L4AC 1NOHA 3HD7B 1IFIA 1ZR2A 3HUSC 1FBMA 1T3UA 2JEEA 3RK2C 1JUNA 2KB7P 3A7OA 1NWQA 1FZBA 1J1DB 1X9VA 3A2AA 3P7KA 3GHGA 5AVUB 5AVZB 1ZLLA 1HH0A 1RF1A 2WITA 3HRNA 1KFNA 1KFMA 4O9BA 2N1TD 3RL0B 1MUUA 1URQC 3BRVB 2J59M 5KJ7C 1GD2E 3B5NB 3RK3D 1L4AB 3HD7C 4N78D 1GTWA 1N2DC 1CZQA 2FFDA 1T2KD 1G1IA 3U59A 2OYIC 1N7SD 3A3YB 3KDPB 3H32A 2C9LY 1IC2A 1IJDB 3KYQA 2GM4A 1HGZA 5KLVK 1YYCA 1GL2A 2OYHC 1FU1A 2N1TC 1RE3C 1LWUC 2A45G 4WY4C 2HODB 1PFIA 1SVFA 3VMXA 1LTIC 2Q9IA 3HTKB 1SLQA 3RK3C 2E42A 1LTBC 5AW5B 2YKPA 5CJ4A 4W80A 4I6MC 3TNUA 3HE4A 2HG5D 4EIJA 1FZCA 3V2PA 2OYIA 1N7SB 3OA7A 1LTJC 3L35A 1RY3A 1LT9C 2HPCA 1GL2B 1JY2N 3BRTB 2IX7C 1IO4A 2YNYA 1FZEA 3HTKA 4JF7A 1EQ7A 5AW9B 3L37A 3RK3B 3RK2D 4I1LA 3SWFA 3P8CE 1XTCC 1FJKA 4IFDK 2N1TB 3RL0D 1FZCB 5AW4B 4WY4B 1W2EA 2N9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DH3 A;  5AVR B;  1HWT C;  5AW2 B;  3P8M C;  1OXZ A;  3HE5 A;  3OAK A;  1CI6 A;  3M0D A;  2P7J A;  4XE5 B;  3VMY A;  3MD0 A;  2E43 A;  5AW7 B;  1GK6 A;  2XZR A;  3NXS A;  2R3C A;  1GK4 A;  2WPS A;  2Z5I A;  3TK1 A;  2ZFC A;  3M91 A;  1JUN A;  2WPQ A;  3A7O A;  1H8A A;  1NWQ A;  1NAF A;  1S9K D;  2QM7 A;  4JYC A;  4EOT A;  4M3L A;  1HUC A;  5AVS B;  3V5B A;  3A2A A;  3P7K A;  4RES B;  3B8E B;  4B86 A;  5AVU B;  2VRS A;  5AVZ B;  4DZO A;  4JYB A;  1CSB A;  2Q7C A;  5AW0 B;  5APV A;  1MUU A;  2P67 A;  2BAS A;  3V4Q A;  3TNU B;  2Q5U A;  2XV5 A;  1FAV A;  1KQL A;  1GD2 E;  5APT A;  2YO2 A;  1GTW A;  1A02 F;  1CZQ A;  3O8Z A;  1SP4 A;  1T2K D;  2WT7 A;  1G2C B;  3A3Y B;  3KDP B;  3LID A;  2H7H A;  2WWW A;  2C9L Y;  1GU5 A;  5AVT B;  4KHX A;  5APS A;  1YYC A;  2Q3I A;  3M9H A;  5AVW B;  3M9B A;  1HJB A;  5AW8 B;  2W27 A;  1H89 A;  3VMX A;  5AVX B;  4C7N B;  1SLQ A;  4C7N A;  3MGN A;  2E42 A;  5APW A;  3NTN A;  3P32 A;  5AW5 B;  3M0A A;  4GT1 A;  2C9N Y;  2QM8 A;  1T2K C;  1S9K E;  3NMD A;  2R32 A;  2ZXE B;  4I6M C;  3TNU A;  3HE4 A;  3KQG A;  2R5B A;  4AUW A;  5AVY B;  4GKG A;  1FOS F;  5AVV B;  3L35 A;  3M06 A;  2XU6 A;  5AVQ B;  3HE4 B;  3A5T A;  3V4W A;  2WT7 B;  1H88 A;  4AQR D;  1FOS E;  3LIE A;  2WPR A;  3UIA A;  3I5C A;  5APY A;  2YO3 A;  3VYI A;  2YNY A;  1IO4 A;  4I2L C;  1X8Y A;  5APQ A;  3T97 A;  3HTK A;  5CMZ A;  1GU4 A;  3TYY A;  1MFZ A;  1CI6 B;  2Z5H A;  2KP8 A;  5AW9 B;  1A02 J;  1HBW A;  3L37 A;  2R5D A;  3NFQ A;  1JNM A;  3VMZ A;  2W6A A;  5APX A;  3SWF A;  5APU A;  3VTP C;  5AW1 B;  4LC1 A;  4C46 A;  3L36 A;  3IR9 A;  2P2U A;  4AYC A;  2IPP A;  1GZL A;  1J2J B;  2JJL A;  4HYT B;  1MV8 A;  5AW6 B;  2WTY A;  5AW3 B;  3VN0 A;  1OWA A;  3HE5 B;  5AW4 B;  2N9B A; 
#chains in the Genus database with same CATH topology
 1DH3 A;  4KT0 J;  1NTZ G;  3CCV P;  3D6Z A;  3CXH D;  3Q5R A;  1URQ D;  3HE5 A;  1NTK E;  2LXC B;  3AE1 C;  1FZC C;  1NAY A;  3AEF C;  3OAK A;  1NGM B;  2PAJ A;  3RBX A;  3HD7 D;  4DOJ A;  1AQ5 A;  2POH A;  1SQV E;  4XE5 B;  1YJ9 P;  3AEA C;  1OVV A;  2JDI H;  2PP6 A;  2AEM A;  1QVF O;  2B87 B;  5AW7 B;  3BAT A;  3F89 A;  3G6E P;  1DEE G;  3H1L E;  2R3C A;  4N6J A;  5M1B A;  1S3J A;  2ZFC A;  5B5E E;  1KB9 I;  3CX5 I;  2RN0 A;  3FWL A;  1NAF A;  3MTU E;  4JYC A;  1Y47 A;  1Q7Y Q;  4M3L A;  1LWU A;  3OW2 O;  3JSV C;  1T8Z A;  3L74 D;  2H8P D;  1PZQ A;  2OTL P;  1JCC A;  3IAO A;  1HF9 A;  1L2P A;  4XFJ A;  1IFM A;  1Q81 Q;  3D70 A;  1M8O B;  2QJP C;  3T97 B;  2HPC B;  2VRS A;  2R44 A;  4OH8 B;  1BE3 J;  2IFM A;  4TLF A;  1CSB A;  1PL5 A;  1IFJ A;  2O1J A;  1RE4 A;  2W83 C;  3EFF K;  4Y99 C;  5AW0 B;  2Q7C A;  4N78 E;  1X0T A;  3L72 E;  3SFE C;  5CCH C;  2E76 B;  1PP9 G;  2P67 A;  5KAI E;  1NJI Q;  2BAS A;  3RK2 B;  3V4Q A;  2E75 D;  3BCC E;  1JY3 P;  1FAV A;  3HUS B;  1MKM A;  1JMB A;  1K73 Q;  1KTM A;  5TJH A;  3L70 E;  2K9Y A;  2QJY C;  4IFM A;  4PD4 I;  5H2F H;  1S5L H;  3U1C A;  3EFG A;  3H1J J;  1SP4 A;  2RH0 A;  1QLE D;  1G2C B;  1X22 A;  3GLM A;  4R4L A;  3A0H H;  3BCC J;  1VQL P;  5EFW B;  1GU5 A;  1NHL A;  3N7N A;  3C1L A;  3O6Q A;  2YMY A;  3PP5 A;  3GF7 A;  1U7M A;  4KHX A;  3A0B H;  3GHG B;  3I56 P;  5APS A;  2Y0C A;  3TGU J;  3FGA D;  3M9H A;  5CCH D;  5AVW B;  2WZ7 A;  3CCU P;  2WSF J;  1HJ0 A;  1L0L K;  1XTG B;  2E74 B;  1Q2N A;  1OIP A;  1NO4 A;  2SPZ A;  1MFT A;  1GW3 A;  1SQQ J;  2OAR A;  1ZN5 A;  2FXO A;  2OTK E;  3CXH I;  5AVX B;  4C7N A;  2ZJS E;  3MGN A;  1JMM A;  5APW A;  3NTN A;  3VP9 A;  3P32 A;  2FBW C;  5KLV J;  3L73 E;  4L74 A;  1FDM A;  3IF4 A;  1VQM P;  3AE2 C;  2C9N Y;  1L4A A;  2QM8 A;  2FYU G;  4PV1 C;  3V2N A;  4C7R A;  2YIU B;  5KLV G;  3S4R A;  4ASV A;  1S9K E;  2BEZ F;  1W2B O;  5KJ7 D;  4YTP C;  3RL0 g;  1UIX A;  4KJM A;  3IN6 A;  3B5N A;  1LTJ B;  2HLO A;  4W7Y A;  5CBN A;  1URQ B;  4D6T G;  2KYV A;  2XU6 A;  5AVQ B;  1SQB K;  4EYY Q;  3AE9 C;  1EC5 A;  1KZU B;  1LP1 A;  1N7S C;  2CPS A;  2ZYG A;  4UB6 H;  1YTZ I;  1GW4 A;  2E74 D;  2KK7 A;  2QJP B;  4HH2 A;  1ZV8 A;  2WPR A;  4AQR D;  2KNC A;  1FOS E;  2ZYD A;  1RQV A;  3TGU G;  5APY A;  3ABV C;  1Q82 Q;  2K88 A;  2M3B A;  3G4S P;  3PH0 A;  5APQ A;  3T97 A;  2FYZ A;  1JB0 J;  1G1J A;  1KYO I;  1HGV A;  1LNQ A;  3LW5 J;  1SFC B;  1JOC A;  1L0N D;  2KS1 B;  1BE3 D;  2QIW A;  3L75 J;  3NFQ A;  1JNM A;  4H13 C;  2OYH B;  1FC2 C;  5APX A;  1VF5 D;  5KAF H;  2P58 A;  5KTB A;  1KN7 A;  5APU A;  2E76 D;  1EXJ A;  1LT1 A;  1SQQ G;  3PJS K;  4LC1 A;  1L4A D;  2W90 A;  3L36 A;  1EZV E;  1QL2 A;  3CCQ P;  1M1K Q;  4BXL A;  1FJP A;  2FYU D;  1N73 A;  2P2U A;  1P84 H;  2IPP A;  2M3E A;  2QRX A;  2JJL A;  2ZXX A;  3U1A A;  1N7S A;  4AYC A;  1VDF A;  1MZ9 A;  3H1H E;  2WTY A;  4H0L B;  1GL2 D;  4CPG A;  2LR2 A;  5AW3 B;  3RGU A;  1KQG B;  2FXM A;  1NKN A;  2M5A A;  3CME P;  2Q1K A;  4I2L C;  1VQP P;  1YIT P;  3GG2 A;  4ZNC A;  1ZOY C;  2A45 I;  2O1K A;  1DD4 A;  2E75 C;  1AA0 A;  2OGU A;  5CCG C;  3CPW O;  1R5L A;  2WVR A;  3W68 A;  3BVH A;  1OZH A;  3KHU A;  1L0L G;  3AE3 C;  1Y9B A;  1JTH B;  2L5G B;  3FWN A;  1L0N K;  1SQB G;  3L74 J;  1GMJ A;  4RO0 A;  3TGU D;  3CCS P;  1NTM K;  2C0W A;  3MUD A;  3WU2 E;  3AE5 C;  1KIL D;  2XZR A;  3L70 G;  4RKU J;  4IL6 E;  2YMK A;  2KLV A;  1JO5 A;  1SQQ D;  3H6P A;  1GK4 A;  2WPS A;  2AEF A;  2I1K A;  3JCU E;  3M91 A;  1SQP G;  1H0T A;  3V2R A;  3TGU E;  2GA1 A;  1E79 H;  1M56 D;  3MZW B;  1EZV G;  1T6A A;  1M57 D;  1VQN P;  1SQQ E;  4Y28 J;  3L72 J;  3CLQ A;  1LT9 A;  3H1K J;  2W6B A;  2KUB A;  3KZI H;  5AVS B;  3S9O A;  3V5B A;  1FDO A;  4RES B;  5CHX A;  4ZKU A;  1Z56 A;  3B8E B;  4B86 A;  3EWK A;  2GUS A;  4BRY A;  1AVY A;  3FX0 A;  1JCD A;  1P84 I;  1SQQ K;  1T3J A;  4L75 A;  1AV1 A;  4OGQ B;  1KIL C;  3CWB D;  3VP8 A;  2IZ0 A;  4UB8 H;  1P84 D;  1RHZ B;  3H1L G;  1KQL A;  3CC7 P;  2QJK B;  1K9M Q;  2YO2 A;  3K5B A;  1U7J A;  2QG4 A;  2ZT9 D;  3B71 A;  2XKM A;  2XND H;  3KPE A;  1RE4 C;  3E7K A;  4GIF A;  3AE4 C;  4IL6 X;  2HR3 A;  3TSI A;  2IYO A;  4JQ0 D;  2H88 C;  1L0L E;  2KI7 B;  3O8Z A;  2WT7 A;  2OYH A;  3E1R A;  2NPS B;  2WSS H;  4K3A A;  3VMA A;  1BGY D;  1NTK G;  1SQB J;  1SQV J;  1KYO E;  1UII A;  3LID A;  3USS A;  2H7H A;  5AVT B;  1LWU B;  2ZYA A;  4UB8 E;  3L70 J;  3P8C D;  3CXH E;  1JY2 O;  3H1K G;  3N4X A;  3EQ2 A;  2NPS C;  3RBZ A;  4BRY B;  2Q3I A;  3PHL A;  3Q2Y A;  1EDL A;  4EI2 A;  4OGQ D;  1USD A;  1SQP K;  3M9B A;  1KB9 H;  3CX5 H;  1Q90 D;  5AW8 B;  2W27 A;  4ZKP A;  1H89 A;  1HJB A;  1ZP0 C;  1KIL E;  1LTT C;  4H13 D;  1KOR A;  5KJ7 A;  2ZT9 C;  1ZR4 A;  1NU1 D;  1HVV A;  2YXQ B;  1K04 A;  4DJG A;  1PV3 A;  3M9Q A;  4JPZ B;  4GDO A;  5GTI H;  2IBZ E;  1G2C A;  2Q3E A;  2IZ1 A;  2NPS A;  3B5N C;  2R32 A;  3NMD A;  3WUV A;  3WUU A;  2ZXE B;  5BU8 B;  1YJW P;  2KXP B;  2KOG A;  1BGY J;  1SQV D;  3V2Q A;  2BEQ D;  3Q5S A;  1SQX K;  1IK9 A;  2M0B A;  3ITK A;  1HTL C;  4WBA A;  5AVY B;  4AUW A;  1FOS F;  1NTZ K;  2NPS D;  5AVV B;  5K5G B;  3M06 A;  2FXP A;  3A5T A;  3HE4 B;  4A7P A;  3CCL P;  2IYP A;  1LTG C;  2AXT H;  1PP9 D;  2O3J A;  3L75 G;  5KAF E;  3I55 P;  1RF0 C;  2Z4E A;  3UIA A;  2P1J A;  5CCG D;  4IFF A;  1VQ8 P;  3I5C A;  1L0N E;  3IFM A;  3H25 A;  3BCC D;  1X8Y A;  4D6T E;  1M1J B;  2W8Z A;  4N3Y B;  1SQP J;  2KIK A;  1J1D C;  3G3Z A;  5BU5 A;  3L75 D;  3H1K E;  1MFZ A;  1CI6 B;  1NTZ D;  2KP8 A;  2Y0D A;  2Z5H A;  1EZV I;  3B5N D;  1SQB E;  1YI2 P;  1A02 J;  1LTA C;  1GDT A;  2HYN A;  2MJZ A;  3VMZ A;  1S4X A;  1PIX A;  2FYU E;  4IOI H;  1K8A Q;  1QX8 A;  1FZA A;  2FKW B;  3CWB E;  4N78 D;  1P84 E;  4XA4 A;  4C46 A;  1FZF A;  2QSI A;  1AJY A;  3H32 B;  2LXB A;  2JP3 A;  1GZL A;  2WSE J;  1FDI A;  1NU1 G;  3W67 A;  1NH4 A;  3WMM 0;  1LTJ A;  1MV8 A;  1PPJ D;  2D2C B;  2NZ2 A;  3TDK A;  5CCH A;  1OWA A;  2H89 C;  1YQ3 C;  3H1L J;  3HE5 B;  1OX3 A;  2B9B A;  1S72 P;  1J2J B;  3H1J E;  4HYT B;  2N1T A;  2YKQ A;  3SWK A;  1HWT C;  5AW2 B;  3CWB G;  1OXZ A;  2B88 A;  2JO1 A;  2FYU K;  5CCG A;  1QL1 A;  3WU2 H;  4I7Z B;  5KKZ C;  3M0D A;  2P7J A;  1FZG A;  1VQ7 P;  3VMY A;  1VQK P;  2K9J A;  1DD3 A;  2C0X A;  1AFO A;  4YXD C;  1H0T B;  2B89 A;  3D71 A;  3II6 A;  1RF0 A;  1WT6 A;  1X79 B;  1NTK K;  2WSE H;  2GUV A;  2Q6Q A;  3NXS A;  1QVG O;  2Z5I A;  3TK1 A;  2O01 H;  2A45 H;  1RE3 A;  3L73 D;  1LT9 B;  2CPB A;  3A0H E;  1PP9 E;  2B87 A;  2J5U A;  2WPQ A;  1L0N J;  3QWO C;  3L72 G;  3R4Y A;  1H8A A;  1S9K D;  2QM7 A;  2WQY C;  3C9I A;  4EOT A;  1EXI A;  1URQ A;  3H1L D;  1E5W A;  1YBK A;  1HUC A;  2DW3 A;  5KLI B;  1SS1 A;  1JM0 A;  1WRG A;  4Y99 B;  2O01 N;  1VQ4 P;  1JY3 N;  4DZO A;  3AEC C;  4JBZ A;  1KD1 Q;  4JYB A;  2FFD C;  1RF1 C;  3CCR P;  3BAS A;  1N86 A;  2R3S A;  3H1J G;  1KYO H;  2JWA A;  3CWB J;  5KAI H;  1LGH B;  4OVN F;  3VOP A;  1PGO A;  5APV A;  4W7Z A;  3AEG C;  3S1K A;  2K1A A;  3TNU B;  2Q5U A;  1M1J A;  2XV5 A;  4I7Z C;  1EZV D;  2M8R A;  3A0B E;  4H44 B;  5APT A;  2PGD A;  1DX7 A;  1A02 F;  1SQP D;  2J58 A;  2E5Y A;  3H1H D;  1NTK J;  1SQV G;  2ZVN B;  1BCC E;  2V7Q J;  1M7L A;  1KIL A;  1NKZ B;  2I8D A;  3HUS A;  4WB4 A;  3GHG C;  3FXE A;  3L70 D;  1BDC A;  1N73 B;  4NPF X;  4UB6 E;  1PGQ A;  2WWW A;  1VQ5 P;  1T2K C;  2OYI B;  2JWD A;  2IDB A;  1USE A;  1JUN A;  5TIS E;  1L0L D;  3CD6 P;  3L71 E;  2BCC E;  3E1I A;  2QJY B;  1NYH A;  1W5C E;  2PRR A;  2WPV B;  3KZI E;  2KZJ A;  2OQQ A;  3LW5 H;  1OW6 A;  4WVZ A;  3D6Y A;  1L0N G;  2IFN A;  1JY3 O;  4GOF A;  2N9Y B;  3WUT A;  1FE6 A;  1OMI A;  2JR8 A;  2ZAE B;  4C7N B;  5E79 E;  1BDD A;  4GOE A;  3MIW A;  1M1J C;  4U3F E;  1JTH A;  1ZME C;  1OFC X;  1QEX A;  2HFE D;  3CL3 D;  3M0A A;  3MHV A;  3H1H J;  4GOD A;  1BGY G;  1NTK D;  4GT1 A;  1YJN P;  1VQ6 P;  1IFP A;  2AXT E;  3L71 G;  3AEB C;  2YKO A;  3CXH H;  3CI9 A;  1NU1 K;  3H1I D;  1JY2 P;  1ZXG A;  3KQG A;  2R5B A;  1FS0 E;  3RL0 C;  1VF5 C;  2IBZ D;  4QMA A;  1RH5 B;  2IBZ G;  4GKG A;  4H0L D;  3SWY A;  1LTS C;  1IK7 A;  1BCC G;  1VPC A;  1SFC C;  2KLU A;  3OJA B;  4PD4 H;  1IZN B;  5GTH E;  1KIL B;  3V4W A;  2WT7 B;  1VQO P;  1H88 A;  3L73 J;  5B5E H;  1LJ2 A;  1NTM G;  3LIE A;  5CJ0 A;  4WY4 A;  4U7J A;  2FY8 A;  1RF1 B;  3GMA A;  1SQV K;  1SQB D;  1S5L E;  2YO3 A;  1GL2 C;  4K35 A;  3VYI A;  1VL2 A;  2MKV A;  3GF3 A;  3L4F A;  1K05 A;  1NTM D;  2ITA A;  1YTZ T;  1J1E C;  2RKL A;  2WSF H;  1IFN A;  5CMZ A;  5KLI C;  1GU4 A;  3CC4 P;  1CW5 A;  1HBW A;  2KS1 A;  4WY4 D;  3CCM P;  1SFC A;  3MP7 B;  5CBO A;  1BCC D;  1ZRT E;  2XDJ A;  4D6T D;  2KSE A;  2R5D A;  3M0D C;  4EDF A;  3H1I J;  2W6A A;  2KSJ A;  3H1I G;  4U3F G;  5AW1 B;  3VTP C;  1SFC D;  2V7Q H;  4LLH A;  5KKZ B;  2QEX P;  3HD7 A;  3IR9 A;  1NU1 J;  2O01 J;  3L71 D;  3ZDM A;  4U3F J;  2WSC H;  1N73 C;  2OYI C;  2E74 C;  1EDJ A;  2G8Y A;  2ZVO B;  3JCU H;  1Y8A A;  3H1H G;  3G71 P;  4MN4 C;  1RQU A;  4ASW A;  4IL6 H;  4LGD E;  1N7L A;  1BSN A;  2HOD A;  2WMM A;  5AW6 B;  3VN0 A;  2BCC G;  4ZMD A;  2H43 A;  4R4M A;  4YXW H;  1DEB A;  1BE3 G;  1NTM J;  2D2C C;  1U57 A;  2QE7 H;  2LKM A;  2NRG A;  3R2P A;  4H44 C;  5AVR B;  4HJG H;  3P8M C;  2XNX A;  2K9J B;  4BWN A;  2BCC D;  1BCC J;  1PP9 J;  1PGP A;  1CI6 A;  3H1J D;  1AVO A;  4DT0 A;  3G9R A;  3FXD A;  2RMZ A;  1D7M A;  3MD0 A;  5C39 A;  2E76 C;  1S1C X;  2FFD B;  2E43 A;  2I1J A;  1J1E B;  1GK6 A;  1IFD A;  1L4A C;  1NOH A;  3F5H A;  3HD7 B;  1IFI A;  3PRJ A;  3Q3D A;  1ZR2 A;  3HUS C;  1FBM A;  1SQX J;  2E5T A;  1S2E A;  4L76 A;  1T3U A;  2JEE A;  4U3F D;  1KB9 E;  3AEE C;  3CX5 E;  3RK2 C;  1NTZ J;  3U59 A;  3CMA P;  2KB7 P;  3A7O A;  3JC2 2;  4H13 B;  2Y0E A;  1FZB A;  1J1D B;  1NWQ A;  3GW6 A;  2L91 A;  1S5L X;  1X9V A;  1GD2 E;  2D2C D;  1VQ9 P;  3H1I E;  4H44 D;  1QGK B;  3A2A A;  3P7K A;  3KXD A;  5KLV D;  3GHG A;  5AVU B;  5AVZ B;  1NTZ E;  1ZLL A;  2K3R A;  1HH0 A;  1YIJ P;  3O6Q B;  1RF1 A;  2WIT A;  1ZRT D;  1SQX E;  1KQS O;  3HRN A;  1KFN A;  1KFM A;  4O9B A;  2YXR B;  3CC2 P;  2N1T D;  4PV1 D;  1MUU A;  2E75 B;  2JKV A;  3RL0 B;  2QA4 P;  3Q1M A;  3CCE P;  5H2F E;  5DJU B;  1URQ C;  3TF5 A;  1Q86 Q;  1SQX D;  3AE7 C;  2J59 M;  3BRV B;  5KJ7 C;  4DCK A;  1NTM E;  4HB1 A;  5L8R J;  3B5N B;  3RK3 D;  1L4A B;  3HD7 C;  3PTZ A;  1OW8 A;  3MUD C;  1KYO D;  1PPJ G;  3QH9 A;  2WSC J;  1N2D C;  2Y9Y A;  1CZQ A;  4H0L C;  4TT3 H;  2A06 E;  1GTW A;  2YIU C;  2FFD A;  1T2K D;  2AEJ A;  1LP1 B;  1G1I A;  1NVO A;  1TU3 F;  1N7S D;  4PD4 D;  1KQF B;  3A3Y B;  3KDP B;  3RK3 E;  2KZI A;  3H32 A;  4D6T J;  1JEK A;  2C9L Y;  4RJT A;  1IC2 A;  2ZT9 B;  1IJD B;  1EDK A;  3KYQ A;  2GM4 A;  2UWJ E;  1HGZ A;  3B4S A;  5KLV K;  1BGY E;  1YYC A;  2CK3 H;  1GL2 A;  2OYH C;  4WWI A;  2KNC B;  1FU1 A;  2N1T C;  1RE3 C;  1LWU C;  1NU1 E;  1EDI A;  2A45 G;  4WY4 C;  2HOD B;  3CCJ P;  1PPJ E;  1PFI A;  1OVR A;  1ZW0 A;  1SVF A;  3SSU A;  3VMX A;  1KV4 A;  1LTI C;  2Q9I A;  2FYN B;  3HTK B;  1SLQ A;  2V4H A;  3AE8 C;  4PJ0 H;  3BCC G;  3RK3 C;  1LTB C;  2E42 A;  3TYY A;  1YQ4 C;  1KB9 D;  3CX5 D;  5AW5 B;  2YKP A;  2G3A A;  4PJ0 E;  5CJ4 A;  2QJK C;  5E79 H;  1DIP A;  2BCC J;  4W80 A;  4I6M C;  3TNU A;  3L74 G;  3L74 E;  1R8E A;  3HE4 A;  3AE6 C;  4NPD A;  1YHQ P;  2HG5 D;  4EIJ A;  1FZC A;  3V2P A;  5KLV E;  1M90 Q;  1N8R Q;  2OYI A;  1N7S B;  3OA7 A;  1LTJ C;  2IBZ I;  3L35 A;  1RY3 A;  3L73 G;  5GTI E;  1LT9 C;  4OGQ C;  3V6I A;  1OVU A;  2HPC A;  4HKZ H;  2M5A B;  1GL2 B;  3L75 E;  2P10 A;  5TIS H;  1JY2 N;  1KMI Z;  3BRT B;  5DJT B;  5BVZ A;  2IX7 C;  1KC8 Q;  2YNY A;  4L73 A;  1FZE A;  1PGJ A;  1IO4 A;  3Q5P A;  4PV1 B;  4Z1M H;  3HTK A;  5B66 H;  4JF7 A;  1L0L J;  1EQ7 A;  3PLN A;  4OWF A;  4YPC A;  2OYO A;  3SFD C;  5AW9 B;  2QVA A;  1BSH A;  2AXC A;  3L37 A;  5GTH H;  3RK3 B;  3C8V A;  3RK2 D;  4PD4 E;  1VF5 B;  1WMK A;  4I1L A;  3L72 D;  3H1K D;  3L71 J;  3SWF A;  2A06 G;  1OW7 A;  3P8C E;  1BE3 E;  2PFX A;  2OTJ P;  4NPE A;  2Y9Z A;  5B66 E;  1XTC C;  1R5S A;  2W6J H;  1SQP E;  1FJK A;  3AED C;  2A06 D;  4IFD K;  2N1T B;  3RL0 D;  2FYU J;  2FYN C;  1AQT A;  1FZC B;  5AW4 B;  4WY4 B;  1W2E A;  2K37 A;  1SQX G;  2N9B A; 
#chains in the Genus database with same CATH homology
 1DH3 A;  1URQ D;  3HE5 A;  1FZC C;  3OAK A;  2PAJ A;  4DOJ A;  3HD7 D;  1AQ5 A;  2POH A;  4XE5 B;  2PP6 A;  5AW7 B;  3BAT A;  2R3C A;  4N6J A;  2ZFC A;  1NAF A;  3MTU E;  4JYC A;  4M3L A;  1LWU A;  1T8Z A;  2H8P D;  1JCC A;  1IFM A;  2HPC B;  2VRS A;  4OH8 B;  2IFM A;  1CSB A;  2O1J A;  1IFJ A;  1RE4 A;  2Q7C A;  5AW0 B;  4Y99 C;  4N78 E;  5CCH C;  2P67 A;  2BAS A;  3RK2 B;  3V4Q A;  1JY3 P;  1FAV A;  3HUS B;  4IFM A;  3U1C A;  3EFG A;  1SP4 A;  1G2C B;  1GU5 A;  1NHL A;  3N7N A;  2YMY A;  3PP5 A;  4KHX A;  3GHG B;  5APS A;  3M9H A;  5CCH D;  5AVW B;  2WZ7 A;  1L0L K;  1XTG B;  1NO4 A;  2OAR A;  1GW3 A;  1ZN5 A;  5AVX B;  4C7N A;  3MGN A;  1JMM A;  5APW A;  3NTN A;  3VP9 A;  3P32 A;  1FDM A;  2C9N Y;  1L4A A;  2QM8 A;  3V2N A;  1S9K E;  4C7R A;  5KJ7 D;  3B5N A;  1LTJ B;  2HLO A;  4W7Y A;  1URQ B;  2KYV A;  2XU6 A;  5AVQ B;  1SQB K;  1KZU B;  1N7S C;  2CPS A;  1YTZ I;  1GW4 A;  4AQR D;  4HH2 A;  1ZV8 A;  2WPR A;  1FOS E;  5APY A;  2M3B A;  5APQ A;  3T97 A;  2FYZ A;  1G1J A;  1HGV A;  1SFC B;  1JOC A;  3NFQ A;  1JNM A;  2OYH B;  5KTB A;  5APX A;  5APU A;  4LC1 A;  1L4A D;  3L36 A;  1QL2 A;  1FJP A;  1N73 A;  2P2U A;  4AYC A;  2IPP A;  3U1A A;  2JJL A;  1N7S A;  1VDF A;  1MZ9 A;  2WTY A;  1GL2 D;  5AW3 B;  2FXM A;  1NKN A;  4I2L C;  2A45 I;  2O1K A;  5CCG C;  3BVH A;  2L5G B;  1JTH B;  1JO5 A;  1L0N K;  1NTM K;  2C0W A;  3MUD A;  1KIL D;  2XZR A;  2KLV A;  3H6P A;  1GK4 A;  2WPS A;  2I1K A;  3M91 A;  3V2R A;  3CLQ A;  1LT9 A;  2W6B A;  5AVS B;  3V5B A;  4RES B;  5CHX A;  4ZKU A;  1Z56 A;  3B8E B;  4B86 A;  2GUS A;  1JCD A;  1SQQ K;  1T3J A;  1KIL C;  3VP8 A;  1KQL A;  2YO2 A;  2XKM A;  3KPE A;  4GIF A;  1RE4 C;  3TSI A;  3O8Z A;  2OYH A;  2WT7 A;  2NPS B;  3LID A;  2H7H A;  5AVT B;  1LWU B;  3P8C D;  1JY2 O;  3N4X A;  3EQ2 A;  2NPS C;  2Q3I A;  1SQP K;  3M9B A;  1HJB A;  5AW8 B;  4ZKP A;  2W27 A;  1H89 A;  1LTT C;  5KJ7 A;  1ZR4 A;  1HVV A;  3M9Q A;  1G2C A;  1T2K C;  3B5N C;  2NPS A;  3NMD A;  2R32 A;  2ZXE B;  5BU8 B;  2KOG A;  3V2Q A;  1SQX K;  1IK9 A;  4AUW A;  1HTL C;  4WBA A;  5AVY B;  1FOS F;  1NTZ K;  2NPS D;  5AVV B;  3M06 A;  3A5T A;  3HE4 B;  1LTG C;  1RF0 C;  2Z4E A;  3UIA A;  2P1J A;  5CCG D;  4IFF A;  3I5C A;  3IFM A;  1X8Y A;  1M1J B;  4N3Y B;  3G3Z A;  1J1D C;  5BU5 A;  3TYY A;  1MFZ A;  1CI6 B;  2Z5H A;  2KP8 A;  3B5N D;  1A02 J;  1LTA C;  1GDT A;  2HYN A;  2MJZ A;  3VMZ A;  1FZA A;  2FKW B;  4XA4 A;  4C46 A;  1FZF A;  3H32 B;  1GZL A;  1NH4 A;  3WMM 0;  1LTJ A;  1MV8 A;  5CCH A;  1OWA A;  3HE5 B;  1J2J B;  4HYT B;  1HWT C;  2N1T A;  2YKQ A;  5AW2 B;  1OXZ A;  2FYU K;  5CCG A;  1QL1 A;  3M0D A;  2P7J A;  1FZG A;  3VMY A;  2C0X A;  1AFO A;  3II6 A;  1RF0 A;  1WT6 A;  1X79 B;  1NTK K;  2WSE H;  2GUV A;  3NXS A;  2Z5I A;  3TK1 A;  2O01 H;  2A45 H;  1RE3 A;  1LT9 B;  2CPB A;  2WPQ A;  1H8A A;  1S9K D;  2QM7 A;  3C9I A;  4EOT A;  1URQ A;  1E5W A;  1HUC A;  1WRG A;  4Y99 B;  1JY3 N;  4DZO A;  2FFD C;  4JYB A;  1RF1 C;  3BAS A;  1N86 A;  1LGH B;  3VOP A;  5APV A;  4W7Z A;  3TNU B;  2Q5U A;  1M1J A;  2XV5 A;  2M8R A;  5APT A;  1DX7 A;  1A02 F;  2J58 A;  3HUS A;  1M7L A;  1KIL A;  1NKZ B;  4WB4 A;  3GHG C;  1N73 B;  2WWW A;  2OYI B;  3E1I A;  3LW5 H;  2IFN A;  1JY3 O;  4C7N B;  3MIW A;  1M1J C;  1JTH A;  2HFE D;  3M0A A;  3CL3 D;  4GT1 A;  2YKO A;  3CI9 A;  1NU1 K;  1JY2 P;  3KQG A;  2R5B A;  3RL0 C;  4GKG A;  3SWY A;  1LTS C;  1VPC A;  3OJA B;  1SFC C;  1KIL B;  3V4W A;  2WT7 B;  1H88 A;  3LIE A;  5CJ0 A;  4WY4 A;  1RF1 B;  1SQV K;  5BVZ A;  2YO3 A;  1GL2 C;  3VYI A;  3L4F A;  2WSF H;  1YTZ T;  1J1E C;  5CMZ A;  1CW5 A;  1IFN A;  1GU4 A;  1HBW A;  4WY4 D;  1SFC A;  2XDJ A;  3M0D C;  2R5D A;  2W6A A;  2KSJ A;  3VTP C;  5AW1 B;  1SFC D;  4LLH A;  3HD7 A;  3IR9 A;  1N73 C;  2WSC H;  4LGD E;  5AW6 B;  1N7L A;  2HOD A;  2H43 A;  3VN0 A;  1DEB A;  3R2P A;  2LKM A;  5AVR B;  3P8M C;  2XNX A;  1CI6 A;  3MD0 A;  2E43 A;  2FFD B;  2I1J A;  1J1E B;  1GK6 A;  1IFD A;  1L4A C;  1NOH A;  3HD7 B;  1IFI A;  1ZR2 A;  3HUS C;  1FBM A;  1T3U A;  2JEE A;  3RK2 C;  1JUN A;  2KB7 P;  3A7O A;  1NWQ A;  1FZB A;  1J1D B;  1X9V A;  3A2A A;  3P7K A;  3GHG A;  5AVU B;  5AVZ B;  1ZLL A;  1HH0 A;  1RF1 A;  2WIT A;  3HRN A;  1KFN A;  1KFM A;  4O9B A;  2N1T D;  3RL0 B;  1MUU A;  1URQ C;  3BRV B;  2J59 M;  5KJ7 C;  1GD2 E;  3B5N B;  3RK3 D;  1L4A B;  3HD7 C;  4N78 D;  1GTW A;  1N2D C;  1CZQ A;  2FFD A;  1T2K D;  1G1I A;  3U59 A;  2OYI C;  1N7S D;  3A3Y B;  3KDP B;  3H32 A;  2C9L Y;  1IC2 A;  1IJD B;  3KYQ A;  2GM4 A;  1HGZ A;  5KLV K;  1YYC A;  1GL2 A;  2OYH C;  1FU1 A;  2N1T C;  1RE3 C;  1LWU C;  2A45 G;  4WY4 C;  2HOD B;  1PFI A;  1SVF A;  3VMX A;  1LTI C;  2Q9I A;  3HTK B;  1SLQ A;  3RK3 C;  2E42 A;  1LTB C;  5AW5 B;  2YKP A;  5CJ4 A;  4W80 A;  4I6M C;  3TNU A;  3HE4 A;  2HG5 D;  4EIJ A;  1FZC A;  3V2P A;  2OYI A;  1N7S B;  3OA7 A;  1LTJ C;  3L35 A;  1RY3 A;  1LT9 C;  2HPC A;  1GL2 B;  1JY2 N;  3BRT B;  2IX7 C;  1IO4 A;  2YNY A;  1FZE A;  3HTK A;  4JF7 A;  1EQ7 A;  5AW9 B;  3L37 A;  3RK3 B;  3RK2 D;  4I1L A;  3SWF A;  3P8C E;  1XTC C;  1FJK A;  4IFD K;  2N1T B;  3RL0 D;  1FZC B;  5AW4 B;  4WY4 B;  1W2E A;  2N9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...