2Z5IA

Crystal structure of the head-to-tail junction of tropomyosin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
49
structure length
49
Chain Sequence
b'GELLSKNYHLENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords General control protein GCN4 and Tropomyosin alpha-1 chain
publication title Structural basis for tropomyosin overlap in thin (actin) filaments and the generation of a molecular swivel by troponin-T
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 22
structure length 49
sequence length 49
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2z5iA00
3KDPB 5AW9B 2R3CA 2R32A 2WT7A 4I2LC 3T97A 1NWQA 1SP4A 1GK4A 4AUWA 1SLQA 5AW4B 5AW3B 1GU5A 1HUCA 3O8ZA 3M0DA 2ZXEB 2BASA 3V5BA 1FOSE 3LIDA 4KHXA 1X8YA 3TK1A 5APXA 1OXZA 4HYTB 1CI6A 5AVYB 2Z5HA 4LC1A 1JUNA 4RESB 3SWFA 1DH3A 3M06A 3V4QA 5AVVB 1MV8A 3HE5A 1T2KD 1FAVA 2WWWA 3MD0A 3TNUB 2C9NY 1H8AA 2WPRA 3NTNA 5CMZA 2Q7CA 4JYCA 3A7OA 1S9KD 1YYCA 2ZFCA 2R5DA 1MUUA 1NAFA 1J2JB 5AVRB 3OAKA 4C7NA 3LIEA 4DZOA 2H7HA 2WT7B 5AW8B 5AW0B 3A5TA 2W27A 2P2UA 5AW2B 2Q3IA 2XV5A 4AYCA 1HBWA 4JYBA 3L35A 1IO4A 5AVTB 3VMYA 1GK6A 3B8EB 2WPQA 1CI6B 4AQRD 3M9BA 5APUA 5AW1B 2YO3A 3L36A 1GU4A 2Q5UA 2P67A 3HE5B 3MGNA 1FOSF 2QM8A 1S9KE 5AVZB 3VN0A 4EOTA 3L37A 1CZQA 1G2CB 3HE4A 3NXSA 4GKGA 5APWA 1H89A 4I6MC 3V4WA 4XE5B 5AVSB 3IR9A 5APTA 3NFQA 1A02J 1HWTC 2E43A 3P8MC 2E42A 5AW5B 3HE4B 1GZLA 1GD2E 5APSA 4C7NB 2VRSA 2YO2A 1GTWA 5AVUB 1H88A 2WPSA 5AVWB 3VTPC 5AVQB 3M9HA 4C46A 3VMZA 1JNMA 3M91A 1T2KC 3KQGA 5APQA 4B86A 5APVA 3VMXA 3P7KA 2N9BA 1KQLA 2P7JA 3HTKA 2XU6A 1CSBA 2R5BA 2Z5IA 2JJLA 2XZRA 1OWAA 1MFZA 4M3LA 3M0AA 1HJBA 3NMDA 2QM7A 3P32A 3TNUA 2C9LY 1A02F 2W6AA 5AW6B 3VYIA 5APYA 2YNYA 3UIAA 3A2AA 3TYYA 5AVXB 5AW7B 2KP8A 3A3YB 4GT1A 3I5CA 2WTYA 2IPPA
chains in the Genus database with same CATH superfamily
3V2NA 2R32A 3A0HE 1DD3A 1NJIQ 3O8ZA 3P8CE 3USSA 4W80A 1U57A 1VQPP 2W83C 5APXA 3FGAD 5AVYB 2YKOA 1OMIA 1Q81Q 2N1TB 4DOJA 1H8AA 1NH4A 2ZT9B 2FYUD 2FFDA 5CMZA 1Z56A 3Q5PA 2ZFCA 2RMZA 3GLMA 3IF4A 1FZBA 3OAKA 3SFEC 1LTJA 2KSEA 1JOCA 1L0NG 4BWNA 1NU1G 3H1JD 4ZNCA 3V2QA 2OYOA 4UB6E 1N8RQ 1FJPA 2IBZD 1EZVE 2AXTH 1LNQA 3E7KA 1S9KE 5B5EE 2HLOA 1RE4A 3L37A 5KJ7A 1KQGB 2FFDB 3L70E 2IYPA 3A0BE 3L70G 1LTJB 2NPSC 1E5WA 1JY2P 3H1HG 2E74B 3KYQA 1KB9E 4H13C 1GW3A 4JPZB 1L0LK 2OGUA 3RGUA 1L2PA 2C0XA 4DCKA 5CJ4A 5AVXB 3BCCE 2WT7A 1NTZG 1KILB 4EI2A 1T3UA 1BE3E 3MP7B 1T3JA 1JUNA 4RESB 3SWFA 1RE3A 2KUBA 2WITA 1BCCD 2JWDA 3MD0A 2KYVA 3V2PA 3E1RA 4PV1B 2FYUG 4K35A 2WT7B 3B5NC 2Y0CA 3G71P 1X0TA 1SFCD 2NRGA 1IO4A 4HH2A 5K5GB 3D71A 2I1KA 4AQRD 5GTHE 1DX7A 1G2CA 3H1JG 3L72E 1AQTA 2IBZG 4OVNF 3VN0A 3TGUD 3FWNA 2K37A 3L72G 2QSIA 2QJKC 5AVSB 1LTSC 3L75D 1GZLA 4WY4D 3GF7A 1QGKB 5APVA 1SQPD 1NU1J 1X22A 1JMMA 3H32A 4OGQB 2ZVOB 3CCRP 2QJPC 3K5BA 5KKZB 1NTMD 4I7ZB 1QLED 1GMJA 3H6PA 3AE4C 4GDOA 2I8DA 3L70J 1T6AA 1SQQE 1SQXK 3CX5E 2CPBA 3H1HJ 3W67A 1BDCA 4W7YA 2Z5HA 2E76D 3M06A 1YTZT 2MJZA 2ZJSE 3AEFC 3WUTA 1ZR2A 3S9OA 1AQ5A 2IFNA 1BCCG 4WBAA 4WB4A 3W68A 1QEXA 2Y0EA 1N7LA 2HODA 4DZOA 1OVRA 3CCUP 1M8OB 3PHLA 1YITP 3BCCJ 2J58A 3I55P 2O1JA 3MTUE 1P84E 2QVAA 3BRTB 3MGNA 1JTHA 5KLVE 2V4HA 3HD7D 1IZNB 3CLQA 1UIXA 2HG5D 1HWTC 1N86A 2WVRA 3TGUG 2NPSA 2HODB 2IZ1A 2FYUJ 3Q1MA 4WVZA 3L75G 2Y0DA 1LGHB 3WMM0 1S5LH 2V7QJ 3EWKA 4GODA 1PL5A 2XZRA 1SQPG 4M3LA 3H1JJ 3BRVB 1JTHB 2H8PD 3B4SA 3L72J 3UIAA 4H44B 1HTLC 3CCSP 2A06D 3KZIH 1LWUC 1NTMG 2NPSB 4H0LC 1ZW0A 1GU5A 1NTKD 1G1IA 3IFMA 3D6YA 2BASA 4EYYQ 2WSEH 3TK1A 4H13B 2LXCB 3TF5A 2H89C 2Q6QA 1AV1A 3HUSC 2WSFH 3JSVC 1MUUA 1EXJA 3B5NA 3A0HH 3IN6A 1ZLLA 1JO5A 1EXIA 2JKVA 3WU2H 3L35A 3VMYA 1PZQA 4LGDE 4MN4C 1KYOI 1NHLA 4IOIH 2P10A 2BEQD 1EQ7A 1VPCA 3G6EP 1URQC 2GUSA 2E74D 1BCCJ 2O01N 1FZCC 3B5NB 1HVVA 1R8EA 3L71E 2YMKA 3PTZA 1KTMA 3OJAB 1L4AA 2ZAEB 3L73D 3SWYA 2WPVB 2XU6A 3II6A 4TT3H 3PJSK 2M5AA 5E79H 5CCGC 3KHUA 2QJKB 1OX3A 1USEA 3FX0A 3SSUA 3TGUJ 4PD4E 4GOFA 3T97A 1MZ9A 5B66H 2OYIC 2E5TA 1KB9H 2A06G 3L75J 2OARA 2Q9IA 1NTKG 2GUVA 1VQOP 1RQVA 3CCMP 1AA0A 2KSJA 1FDOA 1FAVA 4PV1D 1SQPJ 2M5AB 2QJPB 3NTNA 3C9IA 5TJHA 2D2CD 1UIIA 2GA1A 5AW0B 4YXWH 1G1JA 1VL2A 1JY2N 1VQNP 2A45I 2QRXA 2LXBA 5APUA 2M8RA 2OQQA 5CHXA 3IAOA 5KAIE 3ABVC 4Z1MH 3P8MC 3RBZA 1JY2O 3F89A 1GD2E 1ZRTD 3AEGC 3ITKA 1DEEG 2WPSA 2W6BA 1KFNA 3CMAP 4C46A 3VMZA 4LLHA 1DIPA 1LTAC 1W5CE 1N2DC 1K8AQ 5C39A 3L73G 1GL2C 1E79H 3CD6P 3QWOC 3BVHA 1JY3N 3FXEA 1PGOA 1OVUA 1LWUA 3MUDC 2R3CA 2JP3A 2ZYAA 4HYTB 1SQVD 5GTIE 4NPFX 2FYNC 1JY3O 1MV8A 3HUSA 1IFJA 1N73C 3JCUE 4ASVA 2B89A 1NAYA 2WPRA 3JC22 2JWAA 1QVFO 1RY3A 1J2JB 4H0LB 1LWUB 1FJKA 5BU8B 3AE9C 1Q82Q 3A5TA 5AW2B 3CX5H 4IL6E 2WQYC 1Q86Q 3GG2A 1R5LA 1VF5C 3CL3D 2W8ZA 1NTKJ 2M0BA 4K3AA 2Q5UA 2P67A 1NOHA 3HUSB 1M90Q 1L0NE 1URQA 1NO4A 1NU1E 1FZCA 5APTA 1VQMP 1SQBK 1RQUA 3PLNA 2PRRA 1FBMA 3KQGA 3Q2YA 5APQA 5BU5A 3VMXA 1K9MQ 1M1JC 3HTKA 1HGZA 1KQSO 1IFMA 2XKMA 2JJLA 5CCHC 2IDBA 4ZKUA 4ZMDA 5KAFE 3L74D 3H1HE 1URQB 1EZVI 1KILA 2P58A 1FZCB 4H44C 5AW7B 1VQ6P 2KB7P 5EFWB 2OYIA 1OW7A 3RK3D 1ZV8A 1OW8A 1X8YA 2K9JA 3AEEC 3V2RA 2IYOA 3HTKB 2UWJE 3EFGA 1NTZE 1KB9I 3L73J 2C9NY 1VQLP 4IFMA 1L0LD 2FKWB 3VP8A 3CWBD 1PV3A 1WRGA 2CPSA 2OYIB 4BXLA 2XNXA 1SQQK 2K9JB 1LT9B 2FYUE 1SVFA 4JQ0D 1CZQA 5APWA 1R5SA 3NFQA 2WSCH 4TLFA 1KYOH 3H1ID 4PJ0E 2VRSA 3GW6A 3H1JE 1RHZB 3AE7C 1Y9BA 2IBZE 2M3EA 1GL2A 2R44A 2WSFJ 3AE3C 2BEZF 3M0AA 3NMDA 3FWLA 1A02F 2W6AA 1PFIA 5KLVK 2YNYA 4Y28J 3MUDA 1XTCC 2KP8A 3L74G 1L4AD 3KDPB 1L0NJ 1YBKA 3AEDC 3M0DA 1YQ3C 4KHXA 2HFED 4U3FD 3C1LA 1OFCX 3O6QA 1GL2B 1N73A 3EQ2A 3GF3A 4WY4C 3RL0B 2AXCA 2DW3A 3MIWA 3RK2D 4N3YB 5AVRB 1L0LG 2QA4P 5M1BA 1RH5B 1N7SC 2KK7A 1SQXD 2PGDA 2FYNB 3M9QA 1BCCE 1ZN5A 2K9YA 3N7NA 3O6QB 1FDIA 1N73B 3CX5I 2E75D 4EOTA 2A45H 4N78D 4GKGA 2L5GB 1YTZI 2BCCD 3MHVA 1NTZJ 1RF0C 1S72P 1PGQA 4EIJA 3AEAC 3H1IG 1M1JA 3CCJP 4DJGA 3CCQP 1ZMEC 1VF5B 2K1AA 2YXQB 3EFFK 1KYOD 5CCHA 1IFPA 1CSBA 3TGUE 4U7JA 1Q2NA 1OWAA 3RBXA 3KXDA 3LW5J 2AXTE 3WUUA 3L75E 1S2EA 1KV4A 3H1LD 2L91A 2YKPA 2O1KA 1SLQA 1SQPE 2PAJA 2Q1KA 2K88A 2H43A 1S4XA 2ZXEB 1M1JB 1CI6A 3BASA 4LC1A 1K04A 1KQFB 2WMMA 1VQ9P 4JBZA 1VQ7P 4U3FG 1NTME 1PP9D 5H2FH 2KLUA 5DJUB 3H1KD 1JM0A 4C7NA 2H7HA 2N1TD 3L74J 4OWFA 3RL0g 2W27A 5KTBA 2ZT9D 3CXHH 4XFJA 1PPJD 2R3SA 1EC5A 1CI6B 1H0TA 2KLVA 1SQXG 1GU4A 1Q7YQ 2XDJA 2K3RA 2RH0A 1SS1A 4C7NB 1PGJA 2BCCG 1GTWA 2JEEA 1QL2A 1L0LJ 1OIPA 2SPZA 1LTTC 1FZAA 2OYHB 1LTBC 2H88C 4YTPC 1H0TB 1W2EA 1KZUB 3AE8C 1Q90D 3A2AA 3BATA 3CMEP 1FZFA 1X79B 2P1JA 4AUWA 4UB6H 3H1LG 1VQ5P 2Y9YA 3R4YA 3G4SP 5KJ7D 3H1IJ 5B5EH 1IFDA 1KILD 4WY4A 1EDIA 1AJYA 2AEMA 3GMAA 2YMYA 3A0BH 2LKMA 2A06E 4QMAA 1PP9G 1NAFA 1NTKE 2O01H 3H1KE 1NKNA 1JB0J 2YXRB 1EDLA 1N7SA 2J59M 3U1AA 5BVZA 3H1KG 4XA4A 1PPJE 1LT9C 4PD4I 2QJYB 3M9BA 2KZIA 1PPJG 1LT1A 1M7LA 2PP6A 4WY4B 4C7RA 3CXHD 4U3FJ 3SFDC 1RF0A 4I6MC 1WMKA 2E43A 2HR3A 1NTMJ 4BRYA 1N7SB 1RF1C 1LTIC 3VOPA 1U7JA 3P8CD 1W2BO 2A45G 2Z5IA 1S1CX 1HJBA 3P32A 2D2CC 1SQXJ 5CBOA 4ASWA 1ZP0C 1PIXA 3AECC 3ZDMA 2V7QH 1L0NK 3B71A 4OGQD 1NU1K 1EDJA 3A3YB 2WTYA 5KLIC 4BRYB 1GK4A 3PP5A 2BCCJ 3L73E 5GTHH 1GL2D 1FOSE 2QEXP 1FDMA 2KZJA 1BGYD 3RL0C 2KXPB 1T2KD 4IL6X 1EZVD 2WSCJ 2PFXA 4JYCA 2RN0A 1S9KD 4YXDC 1KORA 1DEBA 4AYCA 2WZ7A 3KZIE 5DJTB 1GK6A 3VMAA 4IFDK 1J1DC 2ZYDA 1QVGO 1TU3F 1KB9D 3N4XA 2Z4EA 1YIJP 4JF7A 3CXHI 2QM8A 1PGPA 3CC7P 1NTZK 1KC8Q 3IR9A 5L8RJ 1IK9A 2E42A 5AW5B 3HE4B 4Y99C 4L74A 2B87B 1H88A 2QIWA 3BCCD 2XNDH 1JNMA 4NPEA 3H1KJ 1NGMB 3PRJA 4KT0J 1BE3D 4L73A 3WU2E 4HB1A 1YJWP 3TNUA 2FYUK 1NVOA 2Y9ZA 2O3JA 5AW6B 1KN7A 1ZRTE 5APYA 4GT1A 1KQLA 1SP4A 1VQ8P 5CCHD 1SQBD 1M57D 2M3BA 1P84H 3Q3DA 1M1KQ 5CCGA 1BGYE 3V4QA 4H44D 2NPSD 2YKQA 3R2PA 4GIFA 1LJ2A 1BGYG 3TNUB 3L72D 4H13D 1JCCA 1YYCA 1EZVG 5E79E 2J5UA 1JEKA 3LIEA 1YJ9P 4IFFA 5AW8B 1LT9A 1SQVE 3C8VA 4ZKPA 1JCDA 2W6JH 3B8EB 5TISE 3GHGC 5B66E 1SQVG 4OH8B 3TSIA 3TDKA 3L36A 2CK3H 3SWKA 3F5HA 1AVYA 1H89A 1T8ZA 3FXDA 3AE6C 1IC2A 3RK3C 3CC4P 4O9BA 5APSA 5AVUB 2OYHC 1RF1A 3D6ZA 4HKZH 1QL1A 1S3JA 3V6IA 3BCCG 1SQQD 3CX5D 3B5ND 2B88A 2QM7A 2YIUC 1Y8AA 1VQKP 1OW6A 1BE3G 3S4RA 2WSEJ 3QH9A 1AFOA 1JY3P 2IPPA 2W90A 1SQBE 1RF1B 4UB8E 2C0WA 2AEJA 3V5BA 3LIDA 4L75A 1SQBG 1DH3A 2JO1A 3L74E 2D2CB 3HE5A 2IBZI 1DD4A 1SFCC 1P84D 3Q5RA 2ITAA 3G9RA 5CBNA 3A7OA 4EDFA 5CJ0A 5KLVD 2R5DA 1Y47A 1VDFA 4N6JA 5KLIB 3PH0A 3H25A 2E5YA 3RK3E 3D70A 3KPEA 1M56D 1CW5A 1J1EB 1SQPK 2QJYC 5AVTB 1HJ0A 1L0LE 2LR2A 3HE5B 1L4AC 5AVZB 3HRNA 3CWBE 1BGYJ 1G2CB 1NTMK 3NXSA 4PD4H 1N7SD 3CWBG 3G3ZA 2HYNA 5AVQB 3OA7A 3CC2P 1HGVA 2AEFA 1J1DB 3P7KA 3I56P 2P7JA 4D6TD 2WSSH 1SQVJ 2FYZA 3RK2C 1MFZA 4WWIA 1SQQG 2JR8A 2KS1A 3H32B 3U1CA 2O01J 3VYIA 2E76C 3H1IE 4Y99B 2Q3EA 2C9LY 4I2LC 1NWQA 1OZHA 5AW3B 1EDKA 2E75C 1MFTA 4HJGH 2IZ0A 1NKZB 1YHQP 3AE1C 1LP1A 5KAIH 1P84I 1FZEA 2MKVA 2KS1B 2ZXXA 1BE3J 2Q7CA 2IX7C 4RJTA 1YQ4C 1BSNA 1HH0A 1FS0E 5KLVG 3CCEP 4U3FE 2N9YB 3HD7C 2XV5A 4RKUJ 3GHGA 4JYBA 2HPCA 3L71D 2G8YA 4H0LD 1SQBJ 2YO3A 2OTLP 1LP1B 1FOSF 1U7MA 1FU1A 1NYHA 1IFIA 3E1IA 2OYHA 1NTKK 1SQXE 5GTIH 2OTKE 4PD4D 3GHGB 2HPCB 1FE6A 4D6TE 3JCUH 3CI9A 4N78E 3WUVA 2BCCE 4D6TG 2KIKA 3U59A 2N1TC 3RK3B 2QG4A 1X9VA 2ZT9C 4GOEA 1ZOYC 4IL6H 3I5CA 3CWBJ 2NZ2A 3MZWB 1KYOE 2FXMA 1URQD 1IK7A 3AE2C 1MKMA 2FXPA 5AVVB 2YIUB 1SFCA 3L4FA 3H1LE 1SQQJ 2ZYGA 2ZVNB 4KJMA 2FFDC 1GDTA 5CCGD 1LTJC 2Q3IA 2E74C 2WPQA 1GW4A 5KAFH 1AVOA 1PP9E 5AW1B 1ZR4A 1FC2C 3L71G 1SFCB 1VQ4P 3CCVP 2POHA 3VP9A 4XE5B 1RE4C 1LTGC 2FBWC 5KJ7C 2JDIH 2YO2A 5AVWB 1YJNP 3CCLP 4RO0A 1KILC 2QE7H 5KLVJ 3AE5C 3M91A 5TISH 2N9BA 2IFMA 2R5BA 3OW2O 1KMIZ 1JMBA 1K05A 1L4AB 4DT0A 4NPDA 1USDA 4W7ZA 2RKLA 2KI7B 5AW9B 1BDDA 1S5LX 2OTJP 3LW5H 1ZXGA 4PV1C 5AW4B 1HUCA 2KNCA 3T97B 1OXZA 1XTGB 2G3AA 3RK2B 2GM4A 1IFNA 1RE3C 2WWWA 4D6TJ 2I1JA 2E76B 1HF9A 4PJ0H 2B9BA 2FY8A 1OVVA 1WT6A 1L0ND 1KFMA 1J1EC 1NU1D 4CPGA 3HD7A 4UB8H 3RL0D 2E75B 2P2UA 4L76A 2KNCB 1HBWA 1KILE 1S5LE 1KD1Q 3Q5SA 1IJDB 3AEBC 4OGQC 2FXOA 3CPWO 3HE4A 4I1LA 1YI2P 3V4WA 2B87A 3L70D 1A02J 5KKZC 3H1HD 4I7ZC 5H2FE 3H1LJ 3HD7B 4R4LA 3VTPC 3M9HA 1T2KC 4B86A 1QX8A 1SQVK 1K73Q 3CXHE 3M0DC 4YPCA 2N1TA 1FZGA 3L71J 1PP9J 1VF5D 3S1KA 1NTZD 1BSHA 4A7PA 4R4MA 3TYYA 1D7MA 2KOGA
chains in the Genus database with same CATH topology
2YKPA 3V2NA 2R32A 2O1KA 3T97A 1MZ9A 1SLQA 2PAJA 1RF1B 3O8ZA 3P8CE 2H43A 2OYIC 2ZXEB 2C0WA 3V5BA 3LIDA 4W80A 1M1JB 2OARA 5APXA 2Q9IA 1CI6A 5AVYB 3BASA 4LC1A 2GUVA 2YKOA 1DH3A 2KSJA 3HE5A 2N1TB 4DOJA 1FAVA 1SFCC 1H8AA 1NH4A 3NTNA 2FFDA 3C9IA 5CMZA 1Z56A 3A7OA 5CJ0A 2ZFCA 2R5DA 1FZBA 1VDFA 4N6JA 3OAKA 4C7NA 3KPEA 2N1TD 2H7HA 1LTJA 1CW5A 5AW0B 1J1EB 1JOCA 1G1JA 2W27A 5KTBA 1SQPK 1JY2N 5AVTB 3V2QA 2A45I 1CI6B 1FJPA 5APUA 2KLVA 1GU4A 3HE5B 2M8RA 1L4AC 1S9KE 5AVZB 5CHXA 2HLOA 3HRNA 1RE4A 3L37A 1G2CB 1NTMK 2XDJA 3NXSA 1N7SD 5KJ7A 2FFDB 3P8MC 1JY2O 3G3ZA 1GD2E 2HYNA 4C7NB 1GTWA 2JEEA 2WPSA 1QL2A 1LTJB 1LTTC 1KFNA 2W6BA 2NPSC 1E5WA 5AVQB 1FZAA 4C46A 1JY2P 3OA7A 3VMZA 4LLHA 2OYHB 1LTBC 3KYQA 1HGVA 1J1DB 3P7KA 1LTAC 2P7JA 1N2DC 2FYZA 3RK2C 1MFZA 1GL2C 1GW3A 1W2EA 3U1CA 3H32B 1L0LK 1KZUB 3BVHA 3VYIA 2C0XA 1JY3N 3A2AA 5CJ4A 5AVXB 4Y99B 1LWUA 3BATA 2C9LY 1FZFA 1X79B 2R3CA 2WT7A 4I2LC 1KILB 2P1JA 1NWQA 4AUWA 5AW3B 1T3UA 5KJ7D 4HYTB 1T3JA 1NKZB 1JUNA 4RESB 3SWFA 1IFDA 1RE3A 1JY3O 1KILD 2WITA 1MV8A 4WY4A 3HUSA 1IFJA 1N73C 3MD0A 1FZEA 2KYVA 2WPRA 2YMYA 2LKMA 2Q7CA 3V2PA 1NAFA 1RY3A 2O01H 1J2JB 2IX7C 1LWUB 1NKNA 1FJKA 1HH0A 2WT7B 5BU8B 1N7SA 3B5NC 3A5TA 2J59M 3U1AA 5BVZA 5AW2B 3HD7C 4XA4A 2XV5A 1SFCD 3GHGA 4JYBA 1LT9C 1IO4A 2HPCA 4HH2A 2I1KA 3CL3D 4AQRD 3M9BA 2YO3A 1DX7A 1G2CA 2Q5UA 1M7LA 2PP6A 2P67A 4WY4B 1NOHA 3HUSB 1FOSF 4C7RA 3VN0A 1FU1A 1URQA 1NO4A 1RF0A 4I6MC 1FZCA 5AVSB 5APTA 1IFIA 3E1IA 1LTSC 2E43A 2OYHA 1GZLA 4WY4D 1SQBK 1NTKK 1N7SB 1FBMA 1RF1C 3KQGA 1LTIC 5APQA 5BU5A 5APVA 3VMXA 3GHGB 3VOPA 2HPCB 3P8CD 1M1JC 3HTKA 1JMMA 1HGZA 3H32A 3CI9A 2A45G 1IFMA 2XKMA 2Z5IA 2JJLA 4N78E 5CCHC 4ZKUA 1HJBA 3P32A 3U59A 2N1TC 3RK3B 1URQB 1L0NK 1KILA 1X9VA 1FZCB 5AW7B 1NU1K 3A3YB 3I5CA 2WTYA 2KB7P 2OYIA 3H6PA 1GK4A 3PP5A 1GL2D 3RK3D 1SQXK 2FXMA 1URQD 1ZV8A 1FOSE 2CPBA 1X8YA 1FDMA 3V2RA 4W7YA 2Z5HA 3HTKB 3M06A 1YTZT 5AVVB 1SFCA 3RL0C 2MJZA 3EFGA 1T2KD 3L4FA 1ZR2A 2C9NY 1AQ5A 4IFMA 2IFNA 2FKWB 4JYCA 4WBAA 4WB4A 3VP8A 1S9KD 2FFDC 1N7LA 1WRGA 2CPSA 2HODA 4DZOA 1GDTA 5CCGD 2OYIB 1DEBA 1LTJC 2Q3IA 4AYCA 2WZ7A 2J58A 2XNXA 1GK6A 1SQQK 2WPQA 1GW4A 4IFDK 2O1JA 1LT9B 1J1DC 3MTUE 5AW1B 3N4XA 2Z4EA 1ZR4A 3BRTB 1SFCB 4JF7A 3MGNA 2QM8A 1JTHA 1SVFA 2POHA 1CZQA 1NTZK 5APWA 3HD7D 3VP9A 3CLQA 1RE4C 2HG5D 3IR9A 4XE5B 3NFQA 1HWTC 1LTGC 1N86A 5KJ7C 2WSCH 1IK9A 2E42A 5AW5B 3HE4B 4Y99C 2NPSA 2HODB 2VRSA 2YO2A 1H88A 5AVWB 1KILC 1JNMA 3M91A 1LGHB 3WMM0 2N9BA 2IFMA 2R5BA 1GL2A 2XZRA 1L4AB 4M3LA 3M0AA 3NMDA 3BRVB 3TNUA 2FYUK 1JTHB 2H8PD 1A02F 2W6AA 5AW6B 1PFIA 5KLVK 5APYA 2YNYA 3MUDA 3UIAA 1XTCC 2KP8A 4GT1A 4W7ZA 1KQLA 1L4AD 3KDPB 1HTLC 5AW9B 3LW5H 1LWUC 2NPSB 1SP4A 5AW4B 5CCHD 1GU5A 1HUCA 3IFMA 1G1IA 2M3BA 3M0DA 2BASA 4KHXA 2HFED 2WSEH 3TK1A 1OXZA 5CCGA 1XTGB 3V4QA 3RK2B 2NPSD 1GL2B 2YKQA 1IFNA 3R2PA 1N73A 2GM4A 4GIFA 1RE3C 3EQ2A 2WWWA 4WY4C 3RL0B 3HUSC 3TNUB 2WSFH 2I1JA 1JCCA 1WT6A 1YYCA 3MIWA 3RK2D 4N3YB 1MUUA 1KFMA 5AVRB 3B5NA 1J1EC 3LIEA 4IFFA 3HD7A 5AW8B 3RL0D 1LT9A 2P2UA 4ZKPA 1ZLLA 1N7SC 1JO5A 1HBWA 3L35A 1JCDA 3VMYA 3B8EB 4LGDE 3M9QA 1ZN5A 3GHGC 4OH8B 3TSIA 3N7NA 1IJDB 3L36A 1N73B 1NHLA 4EOTA 3HE4A 2A45H 4N78D 1T8ZA 1EQ7A 4GKGA 4I1LA 1H89A 2L5GB 1VPCA 1YTZI 3V4WA 1IC2A 3RK3C 1URQC 1A02J 2GUSA 1RF0C 1FZCC 4O9BA 3B5NB 5APSA 5AVUB 1HVVA 2OYHC 1RF1A 3HD7B 3VTPC 3M9HA 4EIJA 1T2KC 4B86A 1M1JA 1QL1A 3OJAB 1L4AA 1SQVK 3SWYA 5CCHA 2XU6A 3II6A 1CSBA 3B5ND 3M0DC 1OWAA 2N1TA 1FZGA 2QM7A 5CCGC 3TYYA 1AFOA 1JY3P 2KOGA 2IPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KDP B;  5AW9 B;  2R3C A;  2R32 A;  2WT7 A;  4I2L C;  3T97 A;  1NWQ A;  1SP4 A;  1GK4 A;  4AUW A;  1SLQ A;  5AW4 B;  5AW3 B;  1GU5 A;  1HUC A;  3O8Z A;  3M0D A;  2ZXE B;  2BAS A;  3V5B A;  1FOS E;  3LID A;  4KHX A;  1X8Y A;  3TK1 A;  5APX A;  1OXZ A;  4HYT B;  1CI6 A;  5AVY B;  2Z5H A;  4LC1 A;  1JUN A;  4RES B;  3SWF A;  1DH3 A;  3M06 A;  3V4Q A;  5AVV B;  1MV8 A;  3HE5 A;  1T2K D;  1FAV A;  2WWW A;  3MD0 A;  3TNU B;  2C9N Y;  1H8A A;  2WPR A;  3NTN A;  5CMZ A;  2Q7C A;  4JYC A;  3A7O A;  1S9K D;  1YYC A;  2ZFC A;  2R5D A;  1MUU A;  1NAF A;  1J2J B;  5AVR B;  3OAK A;  4C7N A;  3LIE A;  4DZO A;  2H7H A;  2WT7 B;  5AW8 B;  5AW0 B;  3A5T A;  2W27 A;  2P2U A;  5AW2 B;  2Q3I A;  2XV5 A;  4AYC A;  1HBW A;  4JYB A;  3L35 A;  1IO4 A;  5AVT B;  3VMY A;  1GK6 A;  3B8E B;  2WPQ A;  1CI6 B;  4AQR D;  3M9B A;  5APU A;  5AW1 B;  2YO3 A;  3L36 A;  1GU4 A;  2Q5U A;  2P67 A;  3HE5 B;  3MGN A;  1FOS F;  2QM8 A;  1S9K E;  5AVZ B;  3VN0 A;  4EOT A;  3L37 A;  1CZQ A;  1G2C B;  3HE4 A;  3NXS A;  4GKG A;  5APW A;  1H89 A;  4I6M C;  3V4W A;  4XE5 B;  5AVS B;  3IR9 A;  5APT A;  3NFQ A;  1A02 J;  1HWT C;  2E43 A;  3P8M C;  2E42 A;  5AW5 B;  3HE4 B;  1GZL A;  1GD2 E;  5APS A;  4C7N B;  2VRS A;  2YO2 A;  1GTW A;  5AVU B;  1H88 A;  2WPS A;  5AVW B;  3VTP C;  5AVQ B;  3M9H A;  4C46 A;  3VMZ A;  1JNM A;  3M91 A;  1T2K C;  3KQG A;  5APQ A;  4B86 A;  5APV A;  3VMX A;  3P7K A;  2N9B A;  1KQL A;  2P7J A;  3HTK A;  2XU6 A;  1CSB A;  2R5B A;  2Z5I A;  2JJL A;  2XZR A;  1OWA A;  1MFZ A;  4M3L A;  3M0A A;  1HJB A;  3NMD A;  2QM7 A;  3P32 A;  3TNU A;  2C9L Y;  1A02 F;  2W6A A;  5AW6 B;  3VYI A;  5APY A;  2YNY A;  3UIA A;  3A2A A;  3TYY A;  5AVX B;  5AW7 B;  2KP8 A;  3A3Y B;  4GT1 A;  3I5C A;  2WTY A;  2IPP A; 
#chains in the Genus database with same CATH topology
 3V2N A;  2R32 A;  3A0H E;  1DD3 A;  1NJI Q;  3O8Z A;  3P8C E;  3USS A;  4W80 A;  1U57 A;  1VQP P;  2W83 C;  5APX A;  3FGA D;  5AVY B;  2YKO A;  1OMI A;  1Q81 Q;  2N1T B;  4DOJ A;  1H8A A;  1NH4 A;  2ZT9 B;  2FYU D;  2FFD A;  5CMZ A;  1Z56 A;  3Q5P A;  2ZFC A;  2RMZ A;  3GLM A;  3IF4 A;  1FZB A;  3OAK A;  3SFE C;  1LTJ A;  2KSE A;  1JOC A;  1L0N G;  4BWN A;  1NU1 G;  3H1J D;  4ZNC A;  3V2Q A;  2OYO A;  4UB6 E;  1N8R Q;  1FJP A;  2IBZ D;  1EZV E;  2AXT H;  1LNQ A;  3E7K A;  1S9K E;  5B5E E;  2HLO A;  1RE4 A;  3L37 A;  5KJ7 A;  1KQG B;  2FFD B;  3L70 E;  2IYP A;  3A0B E;  3L70 G;  1LTJ B;  2NPS C;  1E5W A;  1JY2 P;  3H1H G;  2E74 B;  3KYQ A;  1KB9 E;  4H13 C;  1GW3 A;  4JPZ B;  1L0L K;  2OGU A;  3RGU A;  1L2P A;  2C0X A;  4DCK A;  5CJ4 A;  5AVX B;  3BCC E;  2WT7 A;  1NTZ G;  1KIL B;  4EI2 A;  1T3U A;  1BE3 E;  3MP7 B;  1T3J A;  1JUN A;  4RES B;  3SWF A;  1RE3 A;  2KUB A;  2WIT A;  1BCC D;  2JWD A;  3MD0 A;  2KYV A;  3V2P A;  3E1R A;  4PV1 B;  2FYU G;  4K35 A;  2WT7 B;  3B5N C;  2Y0C A;  3G71 P;  1X0T A;  1SFC D;  2NRG A;  1IO4 A;  4HH2 A;  5K5G B;  3D71 A;  2I1K A;  4AQR D;  5GTH E;  1DX7 A;  1G2C A;  3H1J G;  3L72 E;  1AQT A;  2IBZ G;  4OVN F;  3VN0 A;  3TGU D;  3FWN A;  2K37 A;  3L72 G;  2QSI A;  2QJK C;  5AVS B;  1LTS C;  3L75 D;  1GZL A;  4WY4 D;  3GF7 A;  1QGK B;  5APV A;  1SQP D;  1NU1 J;  1X22 A;  1JMM A;  3H32 A;  4OGQ B;  2ZVO B;  3CCR P;  2QJP C;  3K5B A;  5KKZ B;  1NTM D;  4I7Z B;  1QLE D;  1GMJ A;  3H6P A;  3AE4 C;  4GDO A;  2I8D A;  3L70 J;  1T6A A;  1SQQ E;  1SQX K;  3CX5 E;  2CPB A;  3H1H J;  3W67 A;  1BDC A;  4W7Y A;  2Z5H A;  2E76 D;  3M06 A;  1YTZ T;  2MJZ A;  2ZJS E;  3AEF C;  3WUT A;  1ZR2 A;  3S9O A;  1AQ5 A;  2IFN A;  1BCC G;  4WBA A;  4WB4 A;  3W68 A;  1QEX A;  2Y0E A;  1N7L A;  2HOD A;  4DZO A;  1OVR A;  3CCU P;  1M8O B;  3PHL A;  1YIT P;  3BCC J;  2J58 A;  3I55 P;  2O1J A;  3MTU E;  1P84 E;  2QVA A;  3BRT B;  3MGN A;  1JTH A;  5KLV E;  2V4H A;  3HD7 D;  1IZN B;  3CLQ A;  1UIX A;  2HG5 D;  1HWT C;  1N86 A;  2WVR A;  3TGU G;  2NPS A;  2HOD B;  2IZ1 A;  2FYU J;  3Q1M A;  4WVZ A;  3L75 G;  2Y0D A;  1LGH B;  3WMM 0;  1S5L H;  2V7Q J;  3EWK A;  4GOD A;  1PL5 A;  2XZR A;  1SQP G;  4M3L A;  3H1J J;  3BRV B;  1JTH B;  2H8P D;  3B4S A;  3L72 J;  3UIA A;  4H44 B;  1HTL C;  3CCS P;  2A06 D;  3KZI H;  1LWU C;  1NTM G;  2NPS B;  4H0L C;  1ZW0 A;  1GU5 A;  1NTK D;  1G1I A;  3IFM A;  3D6Y A;  2BAS A;  4EYY Q;  2WSE H;  3TK1 A;  4H13 B;  2LXC B;  3TF5 A;  2H89 C;  2Q6Q A;  1AV1 A;  3HUS C;  2WSF H;  3JSV C;  1MUU A;  1EXJ A;  3B5N A;  3A0H H;  3IN6 A;  1ZLL A;  1JO5 A;  1EXI A;  2JKV A;  3WU2 H;  3L35 A;  3VMY A;  1PZQ A;  4LGD E;  4MN4 C;  1KYO I;  1NHL A;  4IOI H;  2P10 A;  2BEQ D;  1EQ7 A;  1VPC A;  3G6E P;  1URQ C;  2GUS A;  2E74 D;  1BCC J;  2O01 N;  1FZC C;  3B5N B;  1HVV A;  1R8E A;  3L71 E;  2YMK A;  3PTZ A;  1KTM A;  3OJA B;  1L4A A;  2ZAE B;  3L73 D;  3SWY A;  2WPV B;  2XU6 A;  3II6 A;  4TT3 H;  3PJS K;  2M5A A;  5E79 H;  5CCG C;  3KHU A;  2QJK B;  1OX3 A;  1USE A;  3FX0 A;  3SSU A;  3TGU J;  4PD4 E;  4GOF A;  3T97 A;  1MZ9 A;  5B66 H;  2OYI C;  2E5T A;  1KB9 H;  2A06 G;  3L75 J;  2OAR A;  2Q9I A;  1NTK G;  2GUV A;  1VQO P;  1RQV A;  3CCM P;  1AA0 A;  2KSJ A;  1FDO A;  1FAV A;  4PV1 D;  1SQP J;  2M5A B;  2QJP B;  3NTN A;  3C9I A;  5TJH A;  2D2C D;  1UII A;  2GA1 A;  5AW0 B;  4YXW H;  1G1J A;  1VL2 A;  1JY2 N;  1VQN P;  2A45 I;  2QRX A;  2LXB A;  5APU A;  2M8R A;  2OQQ A;  5CHX A;  3IAO A;  5KAI E;  3ABV C;  4Z1M H;  3P8M C;  3RBZ A;  1JY2 O;  3F89 A;  1GD2 E;  1ZRT D;  3AEG C;  3ITK A;  1DEE G;  2WPS A;  2W6B A;  1KFN A;  3CMA P;  4C46 A;  3VMZ A;  4LLH A;  1DIP A;  1LTA C;  1W5C E;  1N2D C;  1K8A Q;  5C39 A;  3L73 G;  1GL2 C;  1E79 H;  3CD6 P;  3QWO C;  3BVH A;  1JY3 N;  3FXE A;  1PGO A;  1OVU A;  1LWU A;  3MUD C;  2R3C A;  2JP3 A;  2ZYA A;  4HYT B;  1SQV D;  5GTI E;  4NPF X;  2FYN C;  1JY3 O;  1MV8 A;  3HUS A;  1IFJ A;  1N73 C;  3JCU E;  4ASV A;  2B89 A;  1NAY A;  2WPR A;  3JC2 2;  2JWA A;  1QVF O;  1RY3 A;  1J2J B;  4H0L B;  1LWU B;  1FJK A;  5BU8 B;  3AE9 C;  1Q82 Q;  3A5T A;  5AW2 B;  3CX5 H;  4IL6 E;  2WQY C;  1Q86 Q;  3GG2 A;  1R5L A;  1VF5 C;  3CL3 D;  2W8Z A;  1NTK J;  2M0B A;  4K3A A;  2Q5U A;  2P67 A;  1NOH A;  3HUS B;  1M90 Q;  1L0N E;  1URQ A;  1NO4 A;  1NU1 E;  1FZC A;  5APT A;  1VQM P;  1SQB K;  1RQU A;  3PLN A;  2PRR A;  1FBM A;  3KQG A;  3Q2Y A;  5APQ A;  5BU5 A;  3VMX A;  1K9M Q;  1M1J C;  3HTK A;  1HGZ A;  1KQS O;  1IFM A;  2XKM A;  2JJL A;  5CCH C;  2IDB A;  4ZKU A;  4ZMD A;  5KAF E;  3L74 D;  3H1H E;  1URQ B;  1EZV I;  1KIL A;  2P58 A;  1FZC B;  4H44 C;  5AW7 B;  1VQ6 P;  2KB7 P;  5EFW B;  2OYI A;  1OW7 A;  3RK3 D;  1ZV8 A;  1OW8 A;  1X8Y A;  2K9J A;  3AEE C;  3V2R A;  2IYO A;  3HTK B;  2UWJ E;  3EFG A;  1NTZ E;  1KB9 I;  3L73 J;  2C9N Y;  1VQL P;  4IFM A;  1L0L D;  2FKW B;  3VP8 A;  3CWB D;  1PV3 A;  1WRG A;  2CPS A;  2OYI B;  4BXL A;  2XNX A;  1SQQ K;  2K9J B;  1LT9 B;  2FYU E;  1SVF A;  4JQ0 D;  1CZQ A;  5APW A;  1R5S A;  3NFQ A;  2WSC H;  4TLF A;  1KYO H;  3H1I D;  4PJ0 E;  2VRS A;  3GW6 A;  3H1J E;  1RHZ B;  3AE7 C;  1Y9B A;  2IBZ E;  2M3E A;  1GL2 A;  2R44 A;  2WSF J;  3AE3 C;  2BEZ F;  3M0A A;  3NMD A;  3FWL A;  1A02 F;  2W6A A;  1PFI A;  5KLV K;  2YNY A;  4Y28 J;  3MUD A;  1XTC C;  2KP8 A;  3L74 G;  1L4A D;  3KDP B;  1L0N J;  1YBK A;  3AED C;  3M0D A;  1YQ3 C;  4KHX A;  2HFE D;  4U3F D;  3C1L A;  1OFC X;  3O6Q A;  1GL2 B;  1N73 A;  3EQ2 A;  3GF3 A;  4WY4 C;  3RL0 B;  2AXC A;  2DW3 A;  3MIW A;  3RK2 D;  4N3Y B;  5AVR B;  1L0L G;  2QA4 P;  5M1B A;  1RH5 B;  1N7S C;  2KK7 A;  1SQX D;  2PGD A;  2FYN B;  3M9Q A;  1BCC E;  1ZN5 A;  2K9Y A;  3N7N A;  3O6Q B;  1FDI A;  1N73 B;  3CX5 I;  2E75 D;  4EOT A;  2A45 H;  4N78 D;  4GKG A;  2L5G B;  1YTZ I;  2BCC D;  3MHV A;  1NTZ J;  1RF0 C;  1S72 P;  1PGQ A;  4EIJ A;  3AEA C;  3H1I G;  1M1J A;  3CCJ P;  4DJG A;  3CCQ P;  1ZME C;  1VF5 B;  2K1A A;  2YXQ B;  3EFF K;  1KYO D;  5CCH A;  1IFP A;  1CSB A;  3TGU E;  4U7J A;  1Q2N A;  1OWA A;  3RBX A;  3KXD A;  3LW5 J;  2AXT E;  3WUU A;  3L75 E;  1S2E A;  1KV4 A;  3H1L D;  2L91 A;  2YKP A;  2O1K A;  1SLQ A;  1SQP E;  2PAJ A;  2Q1K A;  2K88 A;  2H43 A;  1S4X A;  2ZXE B;  1M1J B;  1CI6 A;  3BAS A;  4LC1 A;  1K04 A;  1KQF B;  2WMM A;  1VQ9 P;  4JBZ A;  1VQ7 P;  4U3F G;  1NTM E;  1PP9 D;  5H2F H;  2KLU A;  5DJU B;  3H1K D;  1JM0 A;  4C7N A;  2H7H A;  2N1T D;  3L74 J;  4OWF A;  3RL0 g;  2W27 A;  5KTB A;  2ZT9 D;  3CXH H;  4XFJ A;  1PPJ D;  2R3S A;  1EC5 A;  1CI6 B;  1H0T A;  2KLV A;  1SQX G;  1GU4 A;  1Q7Y Q;  2XDJ A;  2K3R A;  2RH0 A;  1SS1 A;  4C7N B;  1PGJ A;  2BCC G;  1GTW A;  2JEE A;  1QL2 A;  1L0L J;  1OIP A;  2SPZ A;  1LTT C;  1FZA A;  2OYH B;  1LTB C;  2H88 C;  4YTP C;  1H0T B;  1W2E A;  1KZU B;  3AE8 C;  1Q90 D;  3A2A A;  3BAT A;  3CME P;  1FZF A;  1X79 B;  2P1J A;  4AUW A;  4UB6 H;  3H1L G;  1VQ5 P;  2Y9Y A;  3R4Y A;  3G4S P;  5KJ7 D;  3H1I J;  5B5E H;  1IFD A;  1KIL D;  4WY4 A;  1EDI A;  1AJY A;  2AEM A;  3GMA A;  2YMY A;  3A0B H;  2LKM A;  2A06 E;  4QMA A;  1PP9 G;  1NAF A;  1NTK E;  2O01 H;  3H1K E;  1NKN A;  1JB0 J;  2YXR B;  1EDL A;  1N7S A;  2J59 M;  3U1A A;  5BVZ A;  3H1K G;  4XA4 A;  1PPJ E;  1LT9 C;  4PD4 I;  2QJY B;  3M9B A;  2KZI A;  1PPJ G;  1LT1 A;  1M7L A;  2PP6 A;  4WY4 B;  4C7R A;  3CXH D;  4U3F J;  3SFD C;  1RF0 A;  4I6M C;  1WMK A;  2E43 A;  2HR3 A;  1NTM J;  4BRY A;  1N7S B;  1RF1 C;  1LTI C;  3VOP A;  1U7J A;  3P8C D;  1W2B O;  2A45 G;  2Z5I A;  1S1C X;  1HJB A;  3P32 A;  2D2C C;  1SQX J;  5CBO A;  4ASW A;  1ZP0 C;  1PIX A;  3AEC C;  3ZDM A;  2V7Q H;  1L0N K;  3B71 A;  4OGQ D;  1NU1 K;  1EDJ A;  3A3Y B;  2WTY A;  5KLI C;  4BRY B;  1GK4 A;  3PP5 A;  2BCC J;  3L73 E;  5GTH H;  1GL2 D;  1FOS E;  2QEX P;  1FDM A;  2KZJ A;  1BGY D;  3RL0 C;  2KXP B;  1T2K D;  4IL6 X;  1EZV D;  2WSC J;  2PFX A;  4JYC A;  2RN0 A;  1S9K D;  4YXD C;  1KOR A;  1DEB A;  4AYC A;  2WZ7 A;  3KZI E;  5DJT B;  1GK6 A;  3VMA A;  4IFD K;  1J1D C;  2ZYD A;  1QVG O;  1TU3 F;  1KB9 D;  3N4X A;  2Z4E A;  1YIJ P;  4JF7 A;  3CXH I;  2QM8 A;  1PGP A;  3CC7 P;  1NTZ K;  1KC8 Q;  3IR9 A;  5L8R J;  1IK9 A;  2E42 A;  5AW5 B;  3HE4 B;  4Y99 C;  4L74 A;  2B87 B;  1H88 A;  2QIW A;  3BCC D;  2XND H;  1JNM A;  4NPE A;  3H1K J;  1NGM B;  3PRJ A;  4KT0 J;  1BE3 D;  4L73 A;  3WU2 E;  4HB1 A;  1YJW P;  3TNU A;  2FYU K;  1NVO A;  2Y9Z A;  2O3J A;  5AW6 B;  1KN7 A;  1ZRT E;  5APY A;  4GT1 A;  1KQL A;  1SP4 A;  1VQ8 P;  5CCH D;  1SQB D;  1M57 D;  2M3B A;  1P84 H;  3Q3D A;  1M1K Q;  5CCG A;  1BGY E;  3V4Q A;  4H44 D;  2NPS D;  2YKQ A;  3R2P A;  4GIF A;  1LJ2 A;  1BGY G;  3TNU B;  3L72 D;  4H13 D;  1JCC A;  1YYC A;  1EZV G;  5E79 E;  2J5U A;  1JEK A;  3LIE A;  1YJ9 P;  4IFF A;  5AW8 B;  1LT9 A;  1SQV E;  3C8V A;  4ZKP A;  1JCD A;  2W6J H;  3B8E B;  5TIS E;  3GHG C;  5B66 E;  1SQV G;  4OH8 B;  3TSI A;  3TDK A;  3L36 A;  2CK3 H;  3SWK A;  3F5H A;  1AVY A;  1H89 A;  1T8Z A;  3FXD A;  3AE6 C;  1IC2 A;  3RK3 C;  3CC4 P;  4O9B A;  5APS A;  5AVU B;  2OYH C;  1RF1 A;  3D6Z A;  4HKZ H;  1QL1 A;  1S3J A;  3V6I A;  3BCC G;  1SQQ D;  3CX5 D;  3B5N D;  2B88 A;  2QM7 A;  2YIU C;  1Y8A A;  1VQK P;  1OW6 A;  1BE3 G;  3S4R A;  2WSE J;  3QH9 A;  1AFO A;  1JY3 P;  2IPP A;  2W90 A;  1SQB E;  1RF1 B;  4UB8 E;  2C0W A;  2AEJ A;  3V5B A;  3LID A;  4L75 A;  1SQB G;  1DH3 A;  2JO1 A;  3L74 E;  2D2C B;  3HE5 A;  2IBZ I;  1DD4 A;  1SFC C;  1P84 D;  3Q5R A;  2ITA A;  3G9R A;  5CBN A;  3A7O A;  4EDF A;  5CJ0 A;  5KLV D;  2R5D A;  1Y47 A;  1VDF A;  4N6J A;  5KLI B;  3PH0 A;  3H25 A;  2E5Y A;  3RK3 E;  3D70 A;  3KPE A;  1M56 D;  1CW5 A;  1J1E B;  1SQP K;  2QJY C;  5AVT B;  1HJ0 A;  1L0L E;  2LR2 A;  3HE5 B;  1L4A C;  5AVZ B;  3HRN A;  3CWB E;  1BGY J;  1G2C B;  1NTM K;  3NXS A;  4PD4 H;  1N7S D;  3CWB G;  3G3Z A;  2HYN A;  5AVQ B;  3OA7 A;  3CC2 P;  1HGV A;  2AEF A;  1J1D B;  3P7K A;  3I56 P;  2P7J A;  4D6T D;  2WSS H;  1SQV J;  2FYZ A;  3RK2 C;  1MFZ A;  4WWI A;  1SQQ G;  2JR8 A;  2KS1 A;  3H32 B;  3U1C A;  2O01 J;  3VYI A;  2E76 C;  3H1I E;  4Y99 B;  2Q3E A;  2C9L Y;  4I2L C;  1NWQ A;  1OZH A;  5AW3 B;  1EDK A;  2E75 C;  1MFT A;  4HJG H;  2IZ0 A;  1NKZ B;  1YHQ P;  3AE1 C;  1LP1 A;  5KAI H;  1P84 I;  1FZE A;  2MKV A;  2KS1 B;  2ZXX A;  1BE3 J;  2Q7C A;  2IX7 C;  4RJT A;  1YQ4 C;  1BSN A;  1HH0 A;  1FS0 E;  5KLV G;  3CCE P;  4U3F E;  2N9Y B;  3HD7 C;  2XV5 A;  4RKU J;  3GHG A;  4JYB A;  2HPC A;  3L71 D;  2G8Y A;  4H0L D;  1SQB J;  2YO3 A;  2OTL P;  1LP1 B;  1FOS F;  1U7M A;  1FU1 A;  1NYH A;  1IFI A;  3E1I A;  2OYH A;  1NTK K;  1SQX E;  5GTI H;  2OTK E;  4PD4 D;  3GHG B;  2HPC B;  1FE6 A;  4D6T E;  3JCU H;  3CI9 A;  4N78 E;  3WUV A;  2BCC E;  4D6T G;  2KIK A;  3U59 A;  2N1T C;  3RK3 B;  2QG4 A;  1X9V A;  2ZT9 C;  4GOE A;  1ZOY C;  4IL6 H;  3I5C A;  3CWB J;  2NZ2 A;  3MZW B;  1KYO E;  2FXM A;  1URQ D;  1IK7 A;  3AE2 C;  1MKM A;  2FXP A;  5AVV B;  2YIU B;  1SFC A;  3L4F A;  3H1L E;  1SQQ J;  2ZYG A;  2ZVN B;  4KJM A;  2FFD C;  1GDT A;  5CCG D;  1LTJ C;  2Q3I A;  2E74 C;  2WPQ A;  1GW4 A;  5KAF H;  1AVO A;  1PP9 E;  5AW1 B;  1ZR4 A;  1FC2 C;  3L71 G;  1SFC B;  1VQ4 P;  3CCV P;  2POH A;  3VP9 A;  4XE5 B;  1RE4 C;  1LTG C;  2FBW C;  5KJ7 C;  2JDI H;  2YO2 A;  5AVW B;  1YJN P;  3CCL P;  4RO0 A;  1KIL C;  2QE7 H;  5KLV J;  3AE5 C;  3M91 A;  5TIS H;  2N9B A;  2IFM A;  2R5B A;  3OW2 O;  1KMI Z;  1JMB A;  1K05 A;  1L4A B;  4DT0 A;  4NPD A;  1USD A;  4W7Z A;  2RKL A;  2KI7 B;  5AW9 B;  1BDD A;  1S5L X;  2OTJ P;  3LW5 H;  1ZXG A;  4PV1 C;  5AW4 B;  1HUC A;  2KNC A;  3T97 B;  1OXZ A;  1XTG B;  2G3A A;  3RK2 B;  2GM4 A;  1IFN A;  1RE3 C;  2WWW A;  4D6T J;  2I1J A;  2E76 B;  1HF9 A;  4PJ0 H;  2B9B A;  2FY8 A;  1OVV A;  1WT6 A;  1L0N D;  1KFM A;  1J1E C;  1NU1 D;  4CPG A;  3HD7 A;  4UB8 H;  3RL0 D;  2E75 B;  2P2U A;  4L76 A;  2KNC B;  1HBW A;  1KIL E;  1S5L E;  1KD1 Q;  3Q5S A;  1IJD B;  3AEB C;  4OGQ C;  2FXO A;  3CPW O;  3HE4 A;  4I1L A;  1YI2 P;  3V4W A;  2B87 A;  3L70 D;  1A02 J;  5KKZ C;  3H1H D;  4I7Z C;  5H2F E;  3H1L J;  3HD7 B;  4R4L A;  3VTP C;  3M9H A;  1T2K C;  4B86 A;  1QX8 A;  1SQV K;  1K73 Q;  3CXH E;  3M0D C;  4YPC A;  2N1T A;  1FZG A;  3L71 J;  1PP9 J;  1VF5 D;  3S1K A;  1NTZ D;  1BSH A;  4A7P A;  4R4M A;  3TYY A;  1D7M A;  2KOG A; 
#chains in the Genus database with same CATH homology
 2YKP A;  3V2N A;  2R32 A;  2O1K A;  3T97 A;  1MZ9 A;  1SLQ A;  2PAJ A;  1RF1 B;  3O8Z A;  3P8C E;  2H43 A;  2OYI C;  2ZXE B;  2C0W A;  3V5B A;  3LID A;  4W80 A;  1M1J B;  2OAR A;  5APX A;  2Q9I A;  1CI6 A;  5AVY B;  3BAS A;  4LC1 A;  2GUV A;  2YKO A;  1DH3 A;  2KSJ A;  3HE5 A;  2N1T B;  4DOJ A;  1FAV A;  1SFC C;  1H8A A;  1NH4 A;  3NTN A;  2FFD A;  3C9I A;  5CMZ A;  1Z56 A;  3A7O A;  5CJ0 A;  2ZFC A;  2R5D A;  1FZB A;  1VDF A;  4N6J A;  3OAK A;  4C7N A;  3KPE A;  2N1T D;  2H7H A;  1LTJ A;  1CW5 A;  5AW0 B;  1J1E B;  1JOC A;  1G1J A;  2W27 A;  5KTB A;  1SQP K;  1JY2 N;  5AVT B;  3V2Q A;  2A45 I;  1CI6 B;  1FJP A;  5APU A;  2KLV A;  1GU4 A;  3HE5 B;  2M8R A;  1L4A C;  1S9K E;  5AVZ B;  5CHX A;  2HLO A;  3HRN A;  1RE4 A;  3L37 A;  1G2C B;  1NTM K;  2XDJ A;  3NXS A;  1N7S D;  5KJ7 A;  2FFD B;  3P8M C;  1JY2 O;  3G3Z A;  1GD2 E;  2HYN A;  4C7N B;  1GTW A;  2JEE A;  2WPS A;  1QL2 A;  1LTJ B;  1LTT C;  1KFN A;  2W6B A;  2NPS C;  1E5W A;  5AVQ B;  1FZA A;  4C46 A;  1JY2 P;  3OA7 A;  3VMZ A;  4LLH A;  2OYH B;  1LTB C;  3KYQ A;  1HGV A;  1J1D B;  3P7K A;  1LTA C;  2P7J A;  1N2D C;  2FYZ A;  3RK2 C;  1MFZ A;  1GL2 C;  1GW3 A;  1W2E A;  3U1C A;  3H32 B;  1L0L K;  1KZU B;  3BVH A;  3VYI A;  2C0X A;  1JY3 N;  3A2A A;  5CJ4 A;  5AVX B;  4Y99 B;  1LWU A;  3BAT A;  2C9L Y;  1FZF A;  1X79 B;  2R3C A;  2WT7 A;  4I2L C;  1KIL B;  2P1J A;  1NWQ A;  4AUW A;  5AW3 B;  1T3U A;  5KJ7 D;  4HYT B;  1T3J A;  1NKZ B;  1JUN A;  4RES B;  3SWF A;  1IFD A;  1RE3 A;  1JY3 O;  1KIL D;  2WIT A;  1MV8 A;  4WY4 A;  3HUS A;  1IFJ A;  1N73 C;  3MD0 A;  1FZE A;  2KYV A;  2WPR A;  2YMY A;  2LKM A;  2Q7C A;  3V2P A;  1NAF A;  1RY3 A;  2O01 H;  1J2J B;  2IX7 C;  1LWU B;  1NKN A;  1FJK A;  1HH0 A;  2WT7 B;  5BU8 B;  1N7S A;  3B5N C;  3A5T A;  2J59 M;  3U1A A;  5BVZ A;  5AW2 B;  3HD7 C;  4XA4 A;  2XV5 A;  1SFC D;  3GHG A;  4JYB A;  1LT9 C;  1IO4 A;  2HPC A;  4HH2 A;  2I1K A;  3CL3 D;  4AQR D;  3M9B A;  2YO3 A;  1DX7 A;  1G2C A;  2Q5U A;  1M7L A;  2PP6 A;  2P67 A;  4WY4 B;  1NOH A;  3HUS B;  1FOS F;  4C7R A;  3VN0 A;  1FU1 A;  1URQ A;  1NO4 A;  1RF0 A;  4I6M C;  1FZC A;  5AVS B;  5APT A;  1IFI A;  3E1I A;  1LTS C;  2E43 A;  2OYH A;  1GZL A;  4WY4 D;  1SQB K;  1NTK K;  1N7S B;  1FBM A;  1RF1 C;  3KQG A;  1LTI C;  5APQ A;  5BU5 A;  5APV A;  3VMX A;  3GHG B;  3VOP A;  2HPC B;  3P8C D;  1M1J C;  3HTK A;  1JMM A;  1HGZ A;  3H32 A;  3CI9 A;  2A45 G;  1IFM A;  2XKM A;  2Z5I A;  2JJL A;  4N78 E;  5CCH C;  4ZKU A;  1HJB A;  3P32 A;  3U59 A;  2N1T C;  3RK3 B;  1URQ B;  1L0N K;  1KIL A;  1X9V A;  1FZC B;  5AW7 B;  1NU1 K;  3A3Y B;  3I5C A;  2WTY A;  2KB7 P;  2OYI A;  3H6P A;  1GK4 A;  3PP5 A;  1GL2 D;  3RK3 D;  1SQX K;  2FXM A;  1URQ D;  1ZV8 A;  1FOS E;  2CPB A;  1X8Y A;  1FDM A;  3V2R A;  4W7Y A;  2Z5H A;  3HTK B;  3M06 A;  1YTZ T;  5AVV B;  1SFC A;  3RL0 C;  2MJZ A;  3EFG A;  1T2K D;  3L4F A;  1ZR2 A;  2C9N Y;  1AQ5 A;  4IFM A;  2IFN A;  2FKW B;  4JYC A;  4WBA A;  4WB4 A;  3VP8 A;  1S9K D;  2FFD C;  1N7L A;  1WRG A;  2CPS A;  2HOD A;  4DZO A;  1GDT A;  5CCG D;  2OYI B;  1DEB A;  1LTJ C;  2Q3I A;  4AYC A;  2WZ7 A;  2J58 A;  2XNX A;  1GK6 A;  1SQQ K;  2WPQ A;  1GW4 A;  4IFD K;  2O1J A;  1LT9 B;  1J1D C;  3MTU E;  5AW1 B;  3N4X A;  2Z4E A;  1ZR4 A;  3BRT B;  1SFC B;  4JF7 A;  3MGN A;  2QM8 A;  1JTH A;  1SVF A;  2POH A;  1CZQ A;  1NTZ K;  5APW A;  3HD7 D;  3VP9 A;  3CLQ A;  1RE4 C;  2HG5 D;  3IR9 A;  4XE5 B;  3NFQ A;  1HWT C;  1LTG C;  1N86 A;  5KJ7 C;  2WSC H;  1IK9 A;  2E42 A;  5AW5 B;  3HE4 B;  4Y99 C;  2NPS A;  2HOD B;  2VRS A;  2YO2 A;  1H88 A;  5AVW B;  1KIL C;  1JNM A;  3M91 A;  1LGH B;  3WMM 0;  2N9B A;  2IFM A;  2R5B A;  1GL2 A;  2XZR A;  1L4A B;  4M3L A;  3M0A A;  3NMD A;  3BRV B;  3TNU A;  2FYU K;  1JTH B;  2H8P D;  1A02 F;  2W6A A;  5AW6 B;  1PFI A;  5KLV K;  5APY A;  2YNY A;  3MUD A;  3UIA A;  1XTC C;  2KP8 A;  4GT1 A;  4W7Z A;  1KQL A;  1L4A D;  3KDP B;  1HTL C;  5AW9 B;  3LW5 H;  1LWU C;  2NPS B;  1SP4 A;  5AW4 B;  5CCH D;  1GU5 A;  1HUC A;  3IFM A;  1G1I A;  2M3B A;  3M0D A;  2BAS A;  4KHX A;  2HFE D;  2WSE H;  3TK1 A;  1OXZ A;  5CCG A;  1XTG B;  3V4Q A;  3RK2 B;  2NPS D;  1GL2 B;  2YKQ A;  1IFN A;  3R2P A;  1N73 A;  2GM4 A;  4GIF A;  1RE3 C;  3EQ2 A;  2WWW A;  4WY4 C;  3RL0 B;  3HUS C;  3TNU B;  2WSF H;  2I1J A;  1JCC A;  1WT6 A;  1YYC A;  3MIW A;  3RK2 D;  4N3Y B;  1MUU A;  1KFM A;  5AVR B;  3B5N A;  1J1E C;  3LIE A;  4IFF A;  3HD7 A;  5AW8 B;  3RL0 D;  1LT9 A;  2P2U A;  4ZKP A;  1ZLL A;  1N7S C;  1JO5 A;  1HBW A;  3L35 A;  1JCD A;  3VMY A;  3B8E B;  4LGD E;  3M9Q A;  1ZN5 A;  3GHG C;  4OH8 B;  3TSI A;  3N7N A;  1IJD B;  3L36 A;  1N73 B;  1NHL A;  4EOT A;  3HE4 A;  2A45 H;  4N78 D;  1T8Z A;  1EQ7 A;  4GKG A;  4I1L A;  1H89 A;  2L5G B;  1VPC A;  1YTZ I;  3V4W A;  1IC2 A;  3RK3 C;  1URQ C;  1A02 J;  2GUS A;  1RF0 C;  1FZC C;  4O9B A;  3B5N B;  5APS A;  5AVU B;  1HVV A;  2OYH C;  1RF1 A;  3HD7 B;  3VTP C;  3M9H A;  4EIJ A;  1T2K C;  4B86 A;  1M1J A;  1QL1 A;  3OJA B;  1L4A A;  1SQV K;  3SWY A;  5CCH A;  2XU6 A;  3II6 A;  1CSB A;  3B5N D;  3M0D C;  1OWA A;  2N1T A;  1FZG A;  2QM7 A;  5CCG C;  3TYY A;  1AFO A;  1JY3 P;  2KOG A;  2IPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...