2Z5IA

Crystal structure of the head-to-tail junction of tropomyosin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
49
structure length
49
Chain Sequence
GELLSKNYHLENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Contractile protein
molecule keywords General control protein GCN4 and Tropomyosin alpha-1 chain
publication title Structural basis for tropomyosin overlap in thin (actin) filaments and the generation of a molecular swivel by troponin-T
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 22
structure length 49
sequence length 49
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2z5iA00
4C46A 3SWFA 3MD0A 3T97A 1FOSF 1OXZA 3NTNA 5AVZB 3MGNA 1DH3A 4HYTB 3M9HA 1GK6A 4KHXA 5AVWB 3HTKA 5CMZA 4RESB 5APQA 5AW4B 3VMZA 4DZOA 5APTA 1YYCA 5AVUB 2JJLA 2WPSA 5APYA 3TYYA 1NWQA 1A02F 2P7JA 1GZLA 3VN0A 2C9LY 4GKGA 4JYCA 2W27A 3I5CA 5APXA 3V4WA 2WT7A 1GU5A 1JUNA 3B8EB 3A5TA 4LC1A 1SP4A 1X8YA 4C7NB 1HJBA 3HE4A 2YO2A 3IR9A 1GK4A 1J2JB 2VRSA 3HE5B 5AW9B 1NAFA 1SLQA 1A02J 5AW5B 3UIAA 3TNUA 1CI6A 3NFQA 4AQRD 4AYCA 3VYIA 2Z5IA 2ZXEB 5AW6B 1CSBA 4JYBA 5APSA 3M0AA 5AVSB 2XZRA 5APUA 1GTWA 2WPQA 1GD2E 4AUWA 2KP8A 3M06A 2N9BA 2R3CA 3L35A 2C9NY 1CZQA 2Q7CA 5APWA 4I6MC 2YNYA 3M91A 3V5BA 1MUUA 3L36A 2QM8A 1G2CB 1HUCA 5AW3B 5AW2B 4GT1A 4I2LC 3KQGA 2Z5HA 3KDPB 1H88A 3VMXA 3VMYA 3NMDA 1OWAA 1S9KD 1HBWA 1KQLA 5AW8B 4C7NA 2BASA 5AVTB 4EOTA 1JNMA 1MV8A 4M3LA 2P2UA 2WPRA 5AVQB 3A7OA 1GU4A 3P8MC 2IPPA 3HE5A 3NXSA 1T2KC 3P32A 1IO4A 2R5BA 2YO3A 2WT7B 2E43A 5AVXB 3A2AA 3M9BA 5AVVB 1FOSE 3P7KA 2R5DA 2ZFCA 5AVRB 3O8ZA 5AW0B 3HE4B 1FAVA 5APVA 1T2KD 2R32A 2E42A 3V4QA 2W6AA 2XU6A 2WWWA 1HWTC 3LIDA 3L37A 2QM7A 3VTPC 3M0DA 3LIEA 3OAKA 5AW1B 1MFZA 3TNUB 1S9KE 1CI6B 1H89A 2Q3IA 5AW7B 5AVYB 3TK1A 2WTYA 2Q5UA 4XE5B 2H7HA 2P67A 1H8AA 3A3YB 4B86A 2XV5A
chains in the Genus database with same CATH superfamily
2FYUE 3ABVC 3B5ND 3I55P 1SQVG 1SQQE 5L8RJ 3HUSB 5AVUB 1J1EB 1FZCA 1A02F 3VN0A 1QVFO 2K88A 1JUNA 1FDIA 4BXLA 3CX5D 4Z1MH 3HE5B 5AW5B 1X9VA 3RGUA 4DT0A 3FWLA 1M1KQ 4AYCA 3U1AA 2QJKC 2PAJA 1RF0C 3C1LA 3MUDC 2O01J 4R4LA 5KKZC 1YI2P 5DJUB 1CZQA 4I7ZB 1E5WA 5H2FH 1LTIC 1M56D 3A0BH 3CX5E 3GG2A 2Z4EA 3RK2C 3CCMP 5KJ7D 1SFCB 3KDPB 2AXCA 4HH2A 1VPCA 1U7MA 1FDMA 2IDBA 1OVVA 4U7JA 1G1IA 1P84H 2Q3EA 3MIWA 3GW6A 1VQ6P 4LLHA 1FZCB 3NXSA 1LP1A 2QVAA 3A2AA 1S4XA 1PPJD 2OYOA 1NTZD 3RL0D 4OGQB 1SQXG 1JEKA 5TJHA 2M3EA 3LW5H 2BEQD 1WRGA 3A0HH 3G71P 1NTKK 2Q5UA 4XE5B 2JDIH 1NTZJ 3S1KA 3MD0A 1PPJE 1SQBD 1T3UA 1YYCA 1KYOH 3GHGC 1EDLA 5KJ7C 2WSSH 1SP4A 3CWBG 3GLMA 3H1HG 3HE4A 3PTZA 3AE5C 1J2JB 4GDOA 3CCVP 5CJ0A 1SLQA 1L4AB 1NTMG 2MKVA 4ASVA 5M1BA 1LP1B 2KYVA 1S3JA 1SQBE 2K37A 1H0TA 1LTBC 1GD2E 4EI2A 4EYYQ 5DJTB 3IN6A 3H1ID 1FBMA 1KMIZ 2LR2A 4I2LC 2AEJA 1UIIA 3AECC 1FJKA 4C7NA 4M3LA 3BVHA 2K3RA 2ZVOB 1L0LJ 2KLUA 2N1TD 3N4XA 3H1IE 2IZ0A 4Y99C 1URQB 3HE4B 4N78D 3IFMA 1N2DC 3LIDA 2OARA 3VTPC 3AE7C 1WT6A 1BCCJ 2ZYAA 4H44B 3AEGC 3KZIH 4U3FD 1EZVD 2XV5A 1H0TB 1NKNA 2E74B 1AV1A 1P84I 3CCJP 2YKPA 4UB8E 4I1LA 2D2CC 4N78E 2JJLA 1S1CX 1Q2NA 3L70J 1GZLA 3RL0g 1SS1A 2CPSA 2OTKE 4C7NB 4U3FE 1OX3A 1EZVE 3IR9A 4JQ0D 3CCUP 1Y9BA 1FZEA 3G4SP 3NFQA 2NPSA 4RJTA 2N1TC 2ZXXA 5AW6B 2WPQA 1JY2P 1KYOI 4AUWA 3G9RA 2R3CA 5BVZA 3SWKA 1X22A 1RE3C 2WPVB 2E5TA 3RK3B 4PD4D 1FJPA 2W90A 3U59A 1K73Q 3KPEA 4QMAA 2JKVA 2YXRB 2WSEJ 3P8MC 2IPPA 2OTJP 3A0BE 2KXPB 2PFXA 1VQ4P 1L0NJ 3O8ZA 3H1JD 3WUVA 2HYNA 2Q1KA 1SQPK 1ZW0A 1KTMA 1KILB 3IF4A 2P1JA 1U57A 1ZXGA 3H1JJ 2I1JA 3TGUD 3NTNA 1DH3A 3M9QA 5CMZA 1MFTA 5APTA 3MP7B 4GKGA 3H1KG 3PLNA 1OW7A 2QSIA 3W67A 1OMIA 3TGUE 1A02J 1FC2C 1PV3A 2QEXP 1NJIQ 1EXJA 1L0LG 1MKMA 2KOGA 2Z5IA 2ZXEB 1NU1D 4GOEA 1ZLLA 1CSBA 1JCDA 3CCQP 4ZNCA 1GTWA 2ZAEB 2ITAA 4D6TG 2YNYA 5B5EH 3M91A 2HLOA 1RF1A 1BCCG 2WZ7A 3H32A 4GT1A 3H1LJ 5KLIC 1GL2C 3BCCJ 3Q1MA 5B66H 1HBWA 4IFFA 1NU1E 2ZT9C 3L73G 1IFJA 1LTAC 1M57D 1UIXA 2BCCD 5KKZB 4NPFX 1SQVD 2O01H 3P7KA 3Q2YA 3VOPA 3CC4P 3V4QA 3RK2B 2WWWA 2JEEA 1JY3P 1KD1Q 2JP3A 3EFGA 3MHVA 4C46A 2BCCE 4PV1D 1NO4A 5CHXA 1SQVE 2A06D 5AVWB 3HTKA 1RF1B 1AA0A 2O3JA 1DEBA 1LWUC 1OIPA 3H32B 1DIPA 4LGDE 3II6A 4JYCA 5APXA 4LC1A 1QGKB 1BE3D 1T6AA 2FY8A 2RN0A 2AEFA 3AE1C 3CXHD 3TF5A 2AXTH 2E75D 1BE3J 3H25A 1EQ7A 1AVYA 4GODA 2NZ2A 2NPSD 1ZMEC 1RQUA 4EDFA 3L74G 2ZYGA 3BRVB 1K9MQ 2KZJA 3PP5A 1D7MA 1Q90D 1OWAA 2PRRA 5CCHA 3HTKB 2E76C 1IFNA 4H0LD 5AVQB 3CCLP 3P32A 3G3ZA 1FOSE 1QVGO 5AVRB 2ZFCA 3HUSA 1AJYA 1LT1A 1M7LA 1SQXE 2IBZG 1VF5B 1ZP0C 2FXPA 1SQXK 3H1HD 2Q3IA 5KLVJ 1IFIA 4OWFA 4C7RA 3SWYA 2E75C 3SFDC 1HF9A 3AEEC 2A45G 1NHLA 4Y99B 2W8ZA 1KV4A 3E1IA 5E79H 3CWBE 2FYUJ 1GU5A 3A5TA 3H1HE 1N7SD 1SFCA 1SQQJ 1NTME 2CPBA 3CMAP 2J58A 3GF7A 2KUBA 2D2CB 2J5UA 1NTMK 1XTGB 2KLVA 2N9YB 5TISH 1YJWP 1LT9C 3L72D 2XKMA 2GUSA 3HD7A 5CCGC 1AVOA 1BGYD 2LXBA 1OW6A 1FDOA 3G6EP 1M90Q 1J1DB 1EDKA 2HFED 1N8RQ 1JB0J 1K04A 3FXEA 3L72J 3AE2C 1BGYJ 4H13B 1HTLC 5GTIH 2KS1A 3L75G 3JCUE 3L72E 4JPZB 1BGYE 4N3YB 1N86A 1R5SA 1KB9D 4ASWA 2IZ1A 3WUTA 1T2KD 1NTKD 5B66E 2W6AA 2LXCB 1N7SC 1IC2A 1HWTC 2C0WA 4KJMA 3RBXA 3B5NC 2WSCJ 2YMYA 1L4AA 3HD7B 2B9BA 2YIUB 1L2PA 2WSEH 3WU2E 4HYTB 4JF7A 1KB9E 4DZOA 1FZFA 1NTKE 2QJPC 4EIJA 3D71A 4PD4H 1S72P 4K3AA 2Y0DA 2KS1B 1PGQA 1DX7A 3AEFC 1GL2A 1PIXA 3T97B 1PGOA 1T3JA 5BU8B 3VYIA 4WBAA 3L4FA 4R4MA 1URQA 2C9NY 2R44A 1W2BO 1SQBJ 5AW3B 3BATA 4WB4A 3V2QA 5KLVG 2B89A 1LTSC 3NMDA 3KXDA 1KQLA 1S5LH 2OYIA 3A7OA 3RL0C 2FFDA 3CCSP 2RMZA 4BWNA 2A45H 1K8AQ 1NAYA 1HH0A 3H1KD 1KFMA 3L71D 3AE6C 3M0DA 3LIEA 3OAKA 3H1IJ 1GL2B 5KAFH 2XDJA 1H8AA 3PH0A 2ZT9B 2M5AB 3PJSK 3PRJA 1N7LA 2IFMA 4RESB 5APQA 3VMZA 1NWQA 5APYA 3H1KE 3TYYA 3L71E 3ZDMA 3AE8C 2ZJSE 1X8YA 1LTJC 4TT3H 2YO2A 2IYOA 2OYIB 5K5GB 5GTHE 2OYHC 2FFDB 1FZAA 1SFCD 3L73D 1Q82Q 1L0LK 4U3FJ 4PJ0E 2FKWB 1M8OB 4D6TE 4IL6H 2N9BA 3L35A 5APWA 2MJZA 1SVFA 1HUCA 2KI7B 3OJAB 1J1EC 3CC2P 4WY4A 1KILA 2Q9IA 3VMYA 2M8RA 4OGQD 3L73E 2QJYC 2WPRA 1M1JA 3FX0A 4TLFA 2KIKA 1SQPD 1U7JA 2Y9ZA 2YKQA 1X79B 1ZN5A 1RE4A 1LTTC 2FYZA 1P84D 1NTZG 2QM7A 3FXDA 4I7ZC 3AEBC 2IBZI 1PP9D 1OVRA 3K5BA 5H2FE 2E76B 3OA7A 3E1RA 1SQPE 1QL1A 3R2PA 1VDFA 1KC8Q 2XNDH 1L4AD 2WPSA 2GM4A 2A45I 1FZCC 1P84E 2C9LY 4WY4B 3B8EB 1PP9E 2WQYC 3L74D 4ZKPA 1PFIA 1M1JB 3CCRP 2OGUA 1KYOD 1JTHB 2YXQB 4UB6H 2G3AA 1RF0A 3MUDA 2HODA 2R3SA 3A0HE 3H6PA 1YJ9P 2JWAA 3TGUJ 2IYPA 1L0NK 4BRYA 1IK7A 1G1JA 3L74E 2H8PD 3O6QA 3H1IG 1JMMA 2JR8A 2O1KA 2Z5HA 1URQD 4W7YA 1KYOE 3CLQA 3RBZA 3CC7P 2RKLA 1HVVA 2FBWC 1DEEG 1VQ7P 2IX7C 4H44D 2W6BA 2KNCA 1OVUA 4GOFA 2R5DA 2E74D 2IBZE 2CK3H 1NU1J 1Q86Q 2HPCA 4YPCA 4OVNF 4ZMDA 1ZOYC 1FZGA 5AW7B 5C39A 4OH8B 3AE4C 4JBZA 2QJKB 2H7HA 2P58A 3GMAA 2HODB 2ZYDA 3L70G 1EZVG 3CX5H 4BRYB 5BU5A 3I56P 2K9YA 3O6QB 3WUUA 3D6YA 3GHGA 5KAFE 2QRXA 2B87A 1EDJA 2BCCJ 5KJ7A 1SQVJ 3B5NB 2KZIA 2V7QJ 2VRSA 2WSCH 2KNCB 3L75D 1IJDB 4H44C 1IFMA 3JSVC 5AVSB 3RK3D 2HPCB 2QJPB 3KZIE 3AE9C 3M06A 2Q7CA 2QM8A 5AW2B 1PZQA 1VQOP 3GF3A 1JY2O 1H88A 1KQFB 3L75E 5KAIH 5EFWB 3V2RA 1L0NG 1GW3A 1KILD 3GHGB 3RK3E 3VP8A 3QH9A 2B87B 1Q81Q 1IO4A 5CBOA 3M9BA 1YQ4C 4IFMA 1SQXD 5APVA 2E42A 2XU6A 3H1JG 2QE7H 2JO1A 2AEMA 1BSNA 4PV1C 1QL2A 2PGDA 2P67A 1KILE 2Y0EA 1VQNP 1SQXJ 1ZV8A 3OW2O 3KHUA 4DCKA 3SWFA 3RL0B 1CW5A 3RK3C 3Q3DA 3TGUG 3SFEC 5AW4B 3WMM0 1HGZA 1NOHA 2P7JA 3CWBD 2W27A 4A7PA 4YTPC 2G8YA 1KORA 3HRNA 1LTGC 4K35A 1NTMD 2GUVA 3CWBJ 2NPSC 2N1TA 3H1HJ 3V6IA 3MZWB 3CCEP 5APSA 3AEAC 1W5CE 1NTMJ 2LKMA 2KP8A 3H1LG 2K9JB 3W68A 2Q6QA 3BCCG 2WSFJ 3N7NA 1RE3A 4UB8H 3KQGA 4H0LC 2NRGA 2L91A 5KLVK 1VQPP 3RK2D 2P2UA 1FE6A 3B71A 2WVRA 2SPZA 4WVZA 1LGHB 4KT0J 2BCCG 3B4SA 2FYUK 3CMEP 4DOJA 4HKZH 5AW1B 1K05A 2N1TB 1SQQK 2HR3A 1KQSO 2QG4A 5B5EE 2QJYB 5KTBA 1GMJA 3T97A 1EXIA 1JY3O 5AVZB 4HJGH 4N6JA 3M9HA 1GK6A 3PHLA 2WITA 1OZHA 2A06G 2JWDA 3IAOA 3C9IA 1DD3A 2WT7A 3P8CD 3CI9A 1AFOA 1R5LA 1Z56A 3EFFK 1BE3G 4ZKUA 1NTKJ 1YTZT 1OFCX 3UIAA 1GDTA 2L5GB 1DD4A 2ZVNB 3AE3C 3F89A 3P8CE 5CBNA 3F5HA 1KFNA 3VMAA 1VQKP 4I6MC 3V5BA 4Y28J 3D70A 1RF1C 1HGVA 2V4HA 2P10A 5AW8B 4IOIH 1VF5D 1MV8A 2M5AA 1T2KC 2R5BA 2WT7B 5AVXB 3CD6P 2H88C 1NTZE 1IFPA 3FGAD 3KYQA 2AXTE 5KAIE 1QLED 2PP6A 1RQVA 1X0TA 1H89A 2FYNC 1NTZK 5AVYB 1JMBA 2WTYA 1FOSF 5CCHD 1USEA 3MGNA 4DJGA 2FYUG 1IFDA 1LWUA 1EZVI 2OQQA 3V2NA 1SQQG 1YIJP 5KLIB 2D2CD 2Y9YA 2XNXA 1R8EA 2UWJE 1SQBK 1NVOA 1BDCA 3H1KJ 2O01N 1VF5C 1L0LD 3L71J 1KQGB 2E5YA 3TNUA 4RKUJ 3MTUE 4AQRD 2I8DA 3Q5RA 1BSHA 2I1KA 2XZRA 4H13D 4D6TD 2HG5D 3L72G 1BCCD 1BGYG 2FXMA 1ZR4A 1YBKA 3AEDC 1L0LE 4HB1A 4YXWH 3VMXA 4D6TJ 1N73C 1AQ5A 5E79E 5CCHC 2V7QH 5AVTB 3Q5PA 2O1JA 3Q5SA 2KSEA 1LWUB 1NH4A 1YTZI 3L70D 1GU4A 3TDKA 2KSJA 1WMKA 2YO3A 4PD4I 1BCCE 5AVVB 1YITP 1JY2N 3HUSC 3L73J 3HD7D 1EC5A 3S4RA 1FAVA 1OW8A 1FZBA 5TISE 1NTKG 3TNUB 1W2EA 4WWIA 3TK1A 1NGMB 1J1DC 4YXDC 3A3YB 3L70E 2Y0CA 2RH0A 1JTHA 1OXZA 4H13C 2FXOA 1VQ9P 1VL2A 3CXHH 1PPJG 5GTIE 2W6JH 3I5CA 2H43A 1SQPJ 1JOCA 3U1CA 4PV1B 2YMKA 2QA4P 1SFCC 4MN4C 1NAFA 1L0ND 1RHZB 1PGJA 4GIFA 1PP9J 1LT9A 1SQBG 1KZUB 5CCGA 3HD7C 2YIUC 3D6ZA 2KK7A 1PGPA 4OGQC 1EDIA 3LW5J 2E75B 2OTLP 1FS0E 1L0NE 4PD4E 2BEZF 2BASA 3C8VA 4EOTA 2NPSB 3L74J 1GL2D 1MZ9A 4XA4A 1VQMP 2E43A 2POHA 1VQ5P 2IBZD 2ZT9D 4W80A 3H1JE 1QX8A 1N7SA 2WSFH 4H0LB 3L71G 3B5NA 4B86A 1LT9B 1L4AC 1LJ2A 2B88A 1YJNP 1S5LX 1JM0A 4KHXA 1Y47A 2K1AA 2M3BA 1JCCA 3H1LD 1S5LE 3JC22 3BCCD 3JCUH 1JY3N 2DW3A 1E79H 1GK4A 4U3FG 5AW9B 1LNQA 4JYBA 3H1LE 5APUA 1N7SB 4NPDA 1NKZB 3BCCE 1ZR2A 3CXHI 1URQC 4L75A 1NU1K 1MUUA 3L36A 3R4YA 1NYHA 5CJ4A 3WU2H 1KB9H 1S9KD 3USSA 2E74C 2OYIC 3SSUA 1TU3F 1IZNB 2FFDC 2WMMA 3L75J 2E76D 1SQPG 1YHQP 3CL3D 1RY3A 4IL6X 2R32A 4L73A 3ITKA 2W83C 1SQVK 3EQ2A 3L37A 1ZRTD 4NPEA 3M0DC 1S9KE 1AQTA 2YKOA 4IL6E 1G2CA 4WY4D 4L74A 1PP9G 3V2PA 2A06E 1QEXA 3CPWO 3TSIA 3E7KA 1USDA 2M0BA 1XTCC 2K9JA 1ZRTE 3V4WA 2FYNB 1LTJA 1BE3E 1RH5B 1HJBA 4IFDK 2OYHA 1VQLP 1CI6A 1N73A 3CXHE 4W7ZA 1FU1A 1JO5A 3M0AA 2GA1A 3BASA 3QWOC 2KB7P 1T8ZA 3FWNA 1VQ8P 1PL5A 5KLVD 1G2CB 5CCGD 1BDDA 4WY4C 1KILC 1Y8AA 2H89C 1IK9A 3BRTB 3CX5I 1JNMA 1S2EA 4CPGA 2C0XA 4RO0A 1M1JC 3HE5A 1NU1G 3S9OA 2FYUD 1KN7A 1Q7YQ 4XFJA 4O9BA 1YQ3C 5GTHH 5KLVE 1LTJB 5AW0B 1SQQD 3VP9A 4UB6E 2J59M 2OYHB 1RE4C 3EWKA 1HJ0A 1MFZA 1CI6B 1N73B 1KB9I 4PJ0H 4L76A 2IFNA 1GW4A 2QIWA
chains in the Genus database with same CATH topology
3OA7A 4C46A 1FOSF 5CCHD 1NO4A 3MGNA 1QL1A 3B5ND 3R2PA 5CHXA 1IFDA 5AVWB 3HTKA 1VDFA 1RF1B 1LWUA 1DEBA 1LWUC 3HUSB 1L4AD 5AVUB 2WPSA 1J1EB 2GM4A 3H32B 1FZCA 2A45I 1FZCC 1A02F 3V2NA 3VN0A 4LGDE 2C9LY 3II6A 4WY4B 4JYCA 5APXA 1JUNA 2XNXA 3B8EB 4LC1A 1SQBK 4ZKPA 1PFIA 1M1JB 3HE5B 5AW5B 1X9VA 3TNUA 1JTHB 3MTUE 4AQRD 4AYCA 3U1AA 2PAJA 1RF0A 3MUDA 1RF0C 2HODA 2I1KA 1EQ7A 2XZRA 3H6PA 2HG5D 1L0NK 2NPSD 1CZQA 1G1JA 1E5WA 1LTIC 2FXMA 1ZR4A 2H8PD 1JMMA 2Z4EA 3RK2C 5KJ7D 1SFCB 2O1KA 2Z5HA 3BRVB 1URQD 4W7YA 3KDPB 3CLQA 4HH2A 1VPCA 3VMXA 3PP5A 1N73C 1OWAA 1AQ5A 1FDMA 5CCHA 1HVVA 5CCHC 3HTKB 1G1IA 5AVTB 2O1JA 1IFNA 1LWUB 3MIWA 5AVQB 1NH4A 1YTZI 1GU4A 2IX7C 4LLHA 1FZCB 2KSJA 3NXSA 3P32A 2W6BA 3G3ZA 2YO3A 3A2AA 5AVVB 1FOSE 1JY2N 2R5DA 2ZFCA 5AVRB 3HUSA 3HUSC 1M7LA 3HD7D 3RL0D 1FAVA 2HPCA 1FZBA 3TNUB 1W2EA 1FZGA 1SQXK 2Q3IA 3LW5H 5AW7B 4OH8B 3TK1A 1WRGA 1NTKK 2Q5UA 4XE5B 1J1DC 2H7HA 1IFIA 3A3YB 4C7RA 3SWYA 2HODB 3MD0A 1JTHA 1OXZA 2A45G 1NHLA 5BU5A 4Y99B 1T3UA 1YYCA 3GHGA 3E1IA 3GHGC 3I5CA 2H43A 1GU5A 5KJ7A 5KJ7C 3A5TA 1SP4A 1JOCA 3U1CA 1N7SD 3HE4A 3B5NB 1SFCA 1SFCC 1J2JB 2CPBA 2VRSA 5CJ0A 2WSCH 1NAFA 1L4AB 1SLQA 2J58A 1IJDB 2KYVA 1NTMK 4GIFA 1IFMA 1XTGB 2KLVA 1LT9A 1KZUB 1LT9C 5AVSB 2XKMA 3RK3D 2HPCB 2GUSA 5CCGA 3HD7A 5CCGC 3HD7C 1LTBC 1GD2E 3M06A 2Q7CA 1FBMA 2QM8A 1J1DB 5AW2B 2HFED 4I2LC 1JY2O 1H88A 1HTLC 1FJKA 4C7NA 2BASA 3V2RA 4EOTA 2NPSB 4M3LA 1GW3A 3BVHA 1KILD 3GHGB 1GL2D 3VP8A 4N3YB 1MZ9A 2N1TD 1N86A 3N4XA 4XA4A 1IO4A 2E43A 4Y99C 3M9BA 2POHA 1URQB 4IFMA 4W80A 3HE4B 4N78D 3IFMA 5APVA 1T2KD 2E42A 1N2DC 2XU6A 1N7SA 2W6AA 1N7SC 2WSFH 1IC2A 1HWTC 3LIDA 2C0WA 2OARA 3VTPC 1WT6A 1QL2A 3B5NA 3B5NC 2P67A 1ZV8A 4B86A 1LT9B 2XV5A 2YMYA 1NKNA 1L4AA 1L4AC 3SWFA 3HD7B 2YKPA 3RL0B 1CW5A 4I1LA 3RK3C 2WSEH 4HYTB 4KHXA 4JF7A 4DZOA 4N78E 5AW4B 1HGZA 3WMM0 1NOHA 2M3BA 1FZFA 2JJLA 4EIJA 1JCCA 2P7JA 1GZLA 2W27A 2CPSA 3HRNA 1JY3N 4C7NB 1DX7A 1LTGC 3IR9A 1GK4A 2GUVA 5AW9B 1FZEA 1GL2A 3NFQA 2NPSA 1T3JA 2N1TA 2NPSC 2N1TC 5BU8B 3VYIA 4WBAA 3L4FA 5AW6B 4JYBA 5APSA 5APUA 2WPQA 1N7SB 2LKMA 1JY2P 1NKZB 4AUWA 2KP8A 1URQA 1ZR2A 1URQC 2R3CA 2C9NY 5BVZA 1NU1K 1MUUA 3L36A 3N7NA 5AW3B 3BATA 1RE3A 1RE3C 5CJ4A 4WB4A 3KQGA 3V2QA 1LTSC 3RK3B 3NMDA 1FJPA 1S9KD 5KLVK 3U59A 1KQLA 3KPEA 3RK2D 2P2UA 2OYIA 2OYIC 3A7OA 3P8MC 2IPPA 3RL0C 2FFDA 2FFDC 1LGHB 2A45H 3O8ZA 3CL3D 1RY3A 1HH0A 2R32A 1KFMA 2FYUK 2HYNA 4DOJA 1SQPK 1SQVK 3EQ2A 3L37A 1KILB 3M0DA 3LIEA 3OAKA 3M0DC 1GL2B 5AW1B 1S9KE 2YKOA 2N1TB 2P1JA 1SQQK 2XDJA 1G2CA 4WY4D 1H8AA 5KTBA 2I1JA 3T97A 1JY3O 3NTNA 5AVZB 1DH3A 3V2PA 4N6JA 3M9HA 1GK6A 1N7LA 2IFMA 3TSIA 3M9QA 5CMZA 2WITA 4RESB 5APQA 3VMZA 5APTA 5APYA 3TYYA 1NWQA 3C9IA 4GKGA 1XTCC 3V4WA 2WT7A 3P8CD 3CI9A 1AFOA 1X8YA 1LTJA 1LTJC 1HJBA 1Z56A 2YO2A 4IFDK 2OYIB 4ZKUA 2OYHA 1YTZT 2OYHC 1A02J 2FFDB 1FZAA 3UIAA 1CI6A 1N73A 4W7ZA 2KOGA 1SFCD 1FU1A 2Z5IA 2ZXEB 1GDTA 1L0LK 2L5GB 1ZLLA 1CSBA 1JCDA 1JO5A 3M0AA 2FKWB 1GTWA 3BASA 3P8CE 1KFNA 2N9BA 3L35A 5APWA 2KB7P 4I6MC 1T8ZA 2YNYA 2MJZA 3M91A 3V5BA 2HLOA 1RF1A 1RF1C 1SVFA 1G2CB 1HUCA 3OJAB 2WZ7A 1J1EC 3H32A 4GT1A 5CCGD 4WY4A 1HGVA 1KILA 4WY4C 1KILC 2Q9IA 1GL2C 3VMYA 1IK9A 3BRTB 2M8RA 1HBWA 4IFFA 5AW8B 1JNMA 1MV8A 2C0XA 2WPRA 1M1JA 1M1JC 1IFJA 3HE5A 1LTAC 1T2KC 2R5BA 2WT7B 5AVXB 4O9BA 2O01H 3P7KA 1LTJB 3VOPA 5AW0B 2YKQA 1X79B 3VP9A 3KYQA 1ZN5A 2J59M 3V4QA 1RE4A 3RK2B 2WWWA 1LTTC 1RE4C 2FYZA 2OYHB 2JEEA 2PP6A 1JY3P 2QM7A 1H89A 1MFZA 1CI6B 1N73B 1NTZK 5AVYB 2WTYA 2IFNA 1GW4A 3EFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C46 A;  3SWF A;  3MD0 A;  3T97 A;  1FOS F;  1OXZ A;  3NTN A;  5AVZ B;  3MGN A;  1DH3 A;  4HYT B;  3M9H A;  1GK6 A;  4KHX A;  5AVW B;  3HTK A;  5CMZ A;  4RES B;  5APQ A;  5AW4 B;  3VMZ A;  4DZO A;  5APT A;  1YYC A;  5AVU B;  2JJL A;  2WPS A;  5APY A;  3TYY A;  1NWQ A;  1A02 F;  2P7J A;  1GZL A;  3VN0 A;  2C9L Y;  4GKG A;  4JYC A;  2W27 A;  3I5C A;  5APX A;  3V4W A;  2WT7 A;  1GU5 A;  1JUN A;  3B8E B;  3A5T A;  4LC1 A;  1SP4 A;  1X8Y A;  4C7N B;  1HJB A;  3HE4 A;  2YO2 A;  3IR9 A;  1GK4 A;  1J2J B;  2VRS A;  3HE5 B;  5AW9 B;  1NAF A;  1SLQ A;  1A02 J;  5AW5 B;  3UIA A;  3TNU A;  1CI6 A;  3NFQ A;  4AQR D;  4AYC A;  3VYI A;  2Z5I A;  2ZXE B;  5AW6 B;  1CSB A;  4JYB A;  5APS A;  3M0A A;  5AVS B;  2XZR A;  5APU A;  1GTW A;  2WPQ A;  1GD2 E;  4AUW A;  2KP8 A;  3M06 A;  2N9B A;  2R3C A;  3L35 A;  2C9N Y;  1CZQ A;  2Q7C A;  5APW A;  4I6M C;  2YNY A;  3M91 A;  3V5B A;  1MUU A;  3L36 A;  2QM8 A;  1G2C B;  1HUC A;  5AW3 B;  5AW2 B;  4GT1 A;  4I2L C;  3KQG A;  2Z5H A;  3KDP B;  1H88 A;  3VMX A;  3VMY A;  3NMD A;  1OWA A;  1S9K D;  1HBW A;  1KQL A;  5AW8 B;  4C7N A;  2BAS A;  5AVT B;  4EOT A;  1JNM A;  1MV8 A;  4M3L A;  2P2U A;  2WPR A;  5AVQ B;  3A7O A;  1GU4 A;  3P8M C;  2IPP A;  3HE5 A;  3NXS A;  1T2K C;  3P32 A;  1IO4 A;  2R5B A;  2YO3 A;  2WT7 B;  2E43 A;  5AVX B;  3A2A A;  3M9B A;  5AVV B;  1FOS E;  3P7K A;  2R5D A;  2ZFC A;  5AVR B;  3O8Z A;  5AW0 B;  3HE4 B;  1FAV A;  5APV A;  1T2K D;  2R32 A;  2E42 A;  3V4Q A;  2W6A A;  2XU6 A;  2WWW A;  1HWT C;  3LID A;  3L37 A;  2QM7 A;  3VTP C;  3M0D A;  3LIE A;  3OAK A;  5AW1 B;  1MFZ A;  3TNU B;  1S9K E;  1CI6 B;  1H89 A;  2Q3I A;  5AW7 B;  5AVY B;  3TK1 A;  2WTY A;  2Q5U A;  4XE5 B;  2H7H A;  2P67 A;  1H8A A;  3A3Y B;  4B86 A;  2XV5 A; 
#chains in the Genus database with same CATH topology
 2FYU E;  3ABV C;  3B5N D;  3I55 P;  1SQV G;  1SQQ E;  5L8R J;  3HUS B;  5AVU B;  1J1E B;  1FZC A;  1A02 F;  3VN0 A;  1QVF O;  2K88 A;  1JUN A;  1FDI A;  4BXL A;  3CX5 D;  4Z1M H;  3HE5 B;  5AW5 B;  1X9V A;  3RGU A;  4DT0 A;  3FWL A;  1M1K Q;  4AYC A;  3U1A A;  2QJK C;  2PAJ A;  1RF0 C;  3C1L A;  3MUD C;  2O01 J;  4R4L A;  5KKZ C;  1YI2 P;  5DJU B;  1CZQ A;  4I7Z B;  1E5W A;  5H2F H;  1LTI C;  1M56 D;  3A0B H;  3CX5 E;  3GG2 A;  2Z4E A;  3RK2 C;  3CCM P;  5KJ7 D;  1SFC B;  3KDP B;  2AXC A;  4HH2 A;  1VPC A;  1U7M A;  1FDM A;  2IDB A;  1OVV A;  4U7J A;  1G1I A;  1P84 H;  2Q3E A;  3MIW A;  3GW6 A;  1VQ6 P;  4LLH A;  1FZC B;  3NXS A;  1LP1 A;  2QVA A;  3A2A A;  1S4X A;  1PPJ D;  2OYO A;  1NTZ D;  3RL0 D;  4OGQ B;  1SQX G;  1JEK A;  5TJH A;  2M3E A;  3LW5 H;  2BEQ D;  1WRG A;  3A0H H;  3G71 P;  1NTK K;  2Q5U A;  4XE5 B;  2JDI H;  1NTZ J;  3S1K A;  3MD0 A;  1PPJ E;  1SQB D;  1T3U A;  1YYC A;  1KYO H;  3GHG C;  1EDL A;  5KJ7 C;  2WSS H;  1SP4 A;  3CWB G;  3GLM A;  3H1H G;  3HE4 A;  3PTZ A;  3AE5 C;  1J2J B;  4GDO A;  3CCV P;  5CJ0 A;  1SLQ A;  1L4A B;  1NTM G;  2MKV A;  4ASV A;  5M1B A;  1LP1 B;  2KYV A;  1S3J A;  1SQB E;  2K37 A;  1H0T A;  1LTB C;  1GD2 E;  4EI2 A;  4EYY Q;  5DJT B;  3IN6 A;  3H1I D;  1FBM A;  1KMI Z;  2LR2 A;  4I2L C;  2AEJ A;  1UII A;  3AEC C;  1FJK A;  4C7N A;  4M3L A;  3BVH A;  2K3R A;  2ZVO B;  1L0L J;  2KLU A;  2N1T D;  3N4X A;  3H1I E;  2IZ0 A;  4Y99 C;  1URQ B;  3HE4 B;  4N78 D;  3IFM A;  1N2D C;  3LID A;  2OAR A;  3VTP C;  3AE7 C;  1WT6 A;  1BCC J;  2ZYA A;  4H44 B;  3AEG C;  3KZI H;  4U3F D;  1EZV D;  2XV5 A;  1H0T B;  1NKN A;  2E74 B;  1AV1 A;  1P84 I;  3CCJ P;  2YKP A;  4UB8 E;  4I1L A;  2D2C C;  4N78 E;  2JJL A;  1S1C X;  1Q2N A;  3L70 J;  1GZL A;  3RL0 g;  1SS1 A;  2CPS A;  2OTK E;  4C7N B;  4U3F E;  1OX3 A;  1EZV E;  3IR9 A;  4JQ0 D;  3CCU P;  1Y9B A;  1FZE A;  3G4S P;  3NFQ A;  2NPS A;  4RJT A;  2N1T C;  2ZXX A;  5AW6 B;  2WPQ A;  1JY2 P;  1KYO I;  4AUW A;  3G9R A;  2R3C A;  5BVZ A;  3SWK A;  1X22 A;  1RE3 C;  2WPV B;  2E5T A;  3RK3 B;  4PD4 D;  1FJP A;  2W90 A;  3U59 A;  1K73 Q;  3KPE A;  4QMA A;  2JKV A;  2YXR B;  2WSE J;  3P8M C;  2IPP A;  2OTJ P;  3A0B E;  2KXP B;  2PFX A;  1VQ4 P;  1L0N J;  3O8Z A;  3H1J D;  3WUV A;  2HYN A;  2Q1K A;  1SQP K;  1ZW0 A;  1KTM A;  1KIL B;  3IF4 A;  2P1J A;  1U57 A;  1ZXG A;  3H1J J;  2I1J A;  3TGU D;  3NTN A;  1DH3 A;  3M9Q A;  5CMZ A;  1MFT A;  5APT A;  3MP7 B;  4GKG A;  3H1K G;  3PLN A;  1OW7 A;  2QSI A;  3W67 A;  1OMI A;  3TGU E;  1A02 J;  1FC2 C;  1PV3 A;  2QEX P;  1NJI Q;  1EXJ A;  1L0L G;  1MKM A;  2KOG A;  2Z5I A;  2ZXE B;  1NU1 D;  4GOE A;  1ZLL A;  1CSB A;  1JCD A;  3CCQ P;  4ZNC A;  1GTW A;  2ZAE B;  2ITA A;  4D6T G;  2YNY A;  5B5E H;  3M91 A;  2HLO A;  1RF1 A;  1BCC G;  2WZ7 A;  3H32 A;  4GT1 A;  3H1L J;  5KLI C;  1GL2 C;  3BCC J;  3Q1M A;  5B66 H;  1HBW A;  4IFF A;  1NU1 E;  2ZT9 C;  3L73 G;  1IFJ A;  1LTA C;  1M57 D;  1UIX A;  2BCC D;  5KKZ B;  4NPF X;  1SQV D;  2O01 H;  3P7K A;  3Q2Y A;  3VOP A;  3CC4 P;  3V4Q A;  3RK2 B;  2WWW A;  2JEE A;  1JY3 P;  1KD1 Q;  2JP3 A;  3EFG A;  3MHV A;  4C46 A;  2BCC E;  4PV1 D;  1NO4 A;  5CHX A;  1SQV E;  2A06 D;  5AVW B;  3HTK A;  1RF1 B;  1AA0 A;  2O3J A;  1DEB A;  1LWU C;  1OIP A;  3H32 B;  1DIP A;  4LGD E;  3II6 A;  4JYC A;  5APX A;  4LC1 A;  1QGK B;  1BE3 D;  1T6A A;  2FY8 A;  2RN0 A;  2AEF A;  3AE1 C;  3CXH D;  3TF5 A;  2AXT H;  2E75 D;  1BE3 J;  3H25 A;  1EQ7 A;  1AVY A;  4GOD A;  2NZ2 A;  2NPS D;  1ZME C;  1RQU A;  4EDF A;  3L74 G;  2ZYG A;  3BRV B;  1K9M Q;  2KZJ A;  3PP5 A;  1D7M A;  1Q90 D;  1OWA A;  2PRR A;  5CCH A;  3HTK B;  2E76 C;  1IFN A;  4H0L D;  5AVQ B;  3CCL P;  3P32 A;  3G3Z A;  1FOS E;  1QVG O;  5AVR B;  2ZFC A;  3HUS A;  1AJY A;  1LT1 A;  1M7L A;  1SQX E;  2IBZ G;  1VF5 B;  1ZP0 C;  2FXP A;  1SQX K;  3H1H D;  2Q3I A;  5KLV J;  1IFI A;  4OWF A;  4C7R A;  3SWY A;  2E75 C;  3SFD C;  1HF9 A;  3AEE C;  2A45 G;  1NHL A;  4Y99 B;  2W8Z A;  1KV4 A;  3E1I A;  5E79 H;  3CWB E;  2FYU J;  1GU5 A;  3A5T A;  3H1H E;  1N7S D;  1SFC A;  1SQQ J;  1NTM E;  2CPB A;  3CMA P;  2J58 A;  3GF7 A;  2KUB A;  2D2C B;  2J5U A;  1NTM K;  1XTG B;  2KLV A;  2N9Y B;  5TIS H;  1YJW P;  1LT9 C;  3L72 D;  2XKM A;  2GUS A;  3HD7 A;  5CCG C;  1AVO A;  1BGY D;  2LXB A;  1OW6 A;  1FDO A;  3G6E P;  1M90 Q;  1J1D B;  1EDK A;  2HFE D;  1N8R Q;  1JB0 J;  1K04 A;  3FXE A;  3L72 J;  3AE2 C;  1BGY J;  4H13 B;  1HTL C;  5GTI H;  2KS1 A;  3L75 G;  3JCU E;  3L72 E;  4JPZ B;  1BGY E;  4N3Y B;  1N86 A;  1R5S A;  1KB9 D;  4ASW A;  2IZ1 A;  3WUT A;  1T2K D;  1NTK D;  5B66 E;  2W6A A;  2LXC B;  1N7S C;  1IC2 A;  1HWT C;  2C0W A;  4KJM A;  3RBX A;  3B5N C;  2WSC J;  2YMY A;  1L4A A;  3HD7 B;  2B9B A;  2YIU B;  1L2P A;  2WSE H;  3WU2 E;  4HYT B;  4JF7 A;  1KB9 E;  4DZO A;  1FZF A;  1NTK E;  2QJP C;  4EIJ A;  3D71 A;  4PD4 H;  1S72 P;  4K3A A;  2Y0D A;  2KS1 B;  1PGQ A;  1DX7 A;  3AEF C;  1GL2 A;  1PIX A;  3T97 B;  1PGO A;  1T3J A;  5BU8 B;  3VYI A;  4WBA A;  3L4F A;  4R4M A;  1URQ A;  2C9N Y;  2R44 A;  1W2B O;  1SQB J;  5AW3 B;  3BAT A;  4WB4 A;  3V2Q A;  5KLV G;  2B89 A;  1LTS C;  3NMD A;  3KXD A;  1KQL A;  1S5L H;  2OYI A;  3A7O A;  3RL0 C;  2FFD A;  3CCS P;  2RMZ A;  4BWN A;  2A45 H;  1K8A Q;  1NAY A;  1HH0 A;  3H1K D;  1KFM A;  3L71 D;  3AE6 C;  3M0D A;  3LIE A;  3OAK A;  3H1I J;  1GL2 B;  5KAF H;  2XDJ A;  1H8A A;  3PH0 A;  2ZT9 B;  2M5A B;  3PJS K;  3PRJ A;  1N7L A;  2IFM A;  4RES B;  5APQ A;  3VMZ A;  1NWQ A;  5APY A;  3H1K E;  3TYY A;  3L71 E;  3ZDM A;  3AE8 C;  2ZJS E;  1X8Y A;  1LTJ C;  4TT3 H;  2YO2 A;  2IYO A;  2OYI B;  5K5G B;  5GTH E;  2OYH C;  2FFD B;  1FZA A;  1SFC D;  3L73 D;  1Q82 Q;  1L0L K;  4U3F J;  4PJ0 E;  2FKW B;  1M8O B;  4D6T E;  4IL6 H;  2N9B A;  3L35 A;  5APW A;  2MJZ A;  1SVF A;  1HUC A;  2KI7 B;  3OJA B;  1J1E C;  3CC2 P;  4WY4 A;  1KIL A;  2Q9I A;  3VMY A;  2M8R A;  4OGQ D;  3L73 E;  2QJY C;  2WPR A;  1M1J A;  3FX0 A;  4TLF A;  2KIK A;  1SQP D;  1U7J A;  2Y9Z A;  2YKQ A;  1X79 B;  1ZN5 A;  1RE4 A;  1LTT C;  2FYZ A;  1P84 D;  1NTZ G;  2QM7 A;  3FXD A;  4I7Z C;  3AEB C;  2IBZ I;  1PP9 D;  1OVR A;  3K5B A;  5H2F E;  2E76 B;  3OA7 A;  3E1R A;  1SQP E;  1QL1 A;  3R2P A;  1VDF A;  1KC8 Q;  2XND H;  1L4A D;  2WPS A;  2GM4 A;  2A45 I;  1FZC C;  1P84 E;  2C9L Y;  4WY4 B;  3B8E B;  1PP9 E;  2WQY C;  3L74 D;  4ZKP A;  1PFI A;  1M1J B;  3CCR P;  2OGU A;  1KYO D;  1JTH B;  2YXQ B;  4UB6 H;  2G3A A;  1RF0 A;  3MUD A;  2HOD A;  2R3S A;  3A0H E;  3H6P A;  1YJ9 P;  2JWA A;  3TGU J;  2IYP A;  1L0N K;  4BRY A;  1IK7 A;  1G1J A;  3L74 E;  2H8P D;  3O6Q A;  3H1I G;  1JMM A;  2JR8 A;  2O1K A;  2Z5H A;  1URQ D;  4W7Y A;  1KYO E;  3CLQ A;  3RBZ A;  3CC7 P;  2RKL A;  1HVV A;  2FBW C;  1DEE G;  1VQ7 P;  2IX7 C;  4H44 D;  2W6B A;  2KNC A;  1OVU A;  4GOF A;  2R5D A;  2E74 D;  2IBZ E;  2CK3 H;  1NU1 J;  1Q86 Q;  2HPC A;  4YPC A;  4OVN F;  4ZMD A;  1ZOY C;  1FZG A;  5AW7 B;  5C39 A;  4OH8 B;  3AE4 C;  4JBZ A;  2QJK B;  2H7H A;  2P58 A;  3GMA A;  2HOD B;  2ZYD A;  3L70 G;  1EZV G;  3CX5 H;  4BRY B;  5BU5 A;  3I56 P;  2K9Y A;  3O6Q B;  3WUU A;  3D6Y A;  3GHG A;  5KAF E;  2QRX A;  2B87 A;  1EDJ A;  2BCC J;  5KJ7 A;  1SQV J;  3B5N B;  2KZI A;  2V7Q J;  2VRS A;  2WSC H;  2KNC B;  3L75 D;  1IJD B;  4H44 C;  1IFM A;  3JSV C;  5AVS B;  3RK3 D;  2HPC B;  2QJP B;  3KZI E;  3AE9 C;  3M06 A;  2Q7C A;  2QM8 A;  5AW2 B;  1PZQ A;  1VQO P;  3GF3 A;  1JY2 O;  1H88 A;  1KQF B;  3L75 E;  5KAI H;  5EFW B;  3V2R A;  1L0N G;  1GW3 A;  1KIL D;  3GHG B;  3RK3 E;  3VP8 A;  3QH9 A;  2B87 B;  1Q81 Q;  1IO4 A;  5CBO A;  3M9B A;  1YQ4 C;  4IFM A;  1SQX D;  5APV A;  2E42 A;  2XU6 A;  3H1J G;  2QE7 H;  2JO1 A;  2AEM A;  1BSN A;  4PV1 C;  1QL2 A;  2PGD A;  2P67 A;  1KIL E;  2Y0E A;  1VQN P;  1SQX J;  1ZV8 A;  3OW2 O;  3KHU A;  4DCK A;  3SWF A;  3RL0 B;  1CW5 A;  3RK3 C;  3Q3D A;  3TGU G;  3SFE C;  5AW4 B;  3WMM 0;  1HGZ A;  1NOH A;  2P7J A;  3CWB D;  2W27 A;  4A7P A;  4YTP C;  2G8Y A;  1KOR A;  3HRN A;  1LTG C;  4K35 A;  1NTM D;  2GUV A;  3CWB J;  2NPS C;  2N1T A;  3H1H J;  3V6I A;  3MZW B;  3CCE P;  5APS A;  3AEA C;  1W5C E;  1NTM J;  2LKM A;  2KP8 A;  3H1L G;  2K9J B;  3W68 A;  2Q6Q A;  3BCC G;  2WSF J;  3N7N A;  1RE3 A;  4UB8 H;  3KQG A;  4H0L C;  2NRG A;  2L91 A;  5KLV K;  1VQP P;  3RK2 D;  2P2U A;  1FE6 A;  3B71 A;  2WVR A;  2SPZ A;  4WVZ A;  1LGH B;  4KT0 J;  2BCC G;  3B4S A;  2FYU K;  3CME P;  4DOJ A;  4HKZ H;  5AW1 B;  1K05 A;  2N1T B;  1SQQ K;  2HR3 A;  1KQS O;  2QG4 A;  5B5E E;  2QJY B;  5KTB A;  1GMJ A;  3T97 A;  1EXI A;  1JY3 O;  5AVZ B;  4HJG H;  4N6J A;  3M9H A;  1GK6 A;  3PHL A;  2WIT A;  1OZH A;  2A06 G;  2JWD A;  3IAO A;  3C9I A;  1DD3 A;  2WT7 A;  3P8C D;  3CI9 A;  1AFO A;  1R5L A;  1Z56 A;  3EFF K;  1BE3 G;  4ZKU A;  1NTK J;  1YTZ T;  1OFC X;  3UIA A;  1GDT A;  2L5G B;  1DD4 A;  2ZVN B;  3AE3 C;  3F89 A;  3P8C E;  5CBN A;  3F5H A;  1KFN A;  3VMA A;  1VQK P;  4I6M C;  3V5B A;  4Y28 J;  3D70 A;  1RF1 C;  1HGV A;  2V4H A;  2P10 A;  5AW8 B;  4IOI H;  1VF5 D;  1MV8 A;  2M5A A;  1T2K C;  2R5B A;  2WT7 B;  5AVX B;  3CD6 P;  2H88 C;  1NTZ E;  1IFP A;  3FGA D;  3KYQ A;  2AXT E;  5KAI E;  1QLE D;  2PP6 A;  1RQV A;  1X0T A;  1H89 A;  2FYN C;  1NTZ K;  5AVY B;  1JMB A;  2WTY A;  1FOS F;  5CCH D;  1USE A;  3MGN A;  4DJG A;  2FYU G;  1IFD A;  1LWU A;  1EZV I;  2OQQ A;  3V2N A;  1SQQ G;  1YIJ P;  5KLI B;  2D2C D;  2Y9Y A;  2XNX A;  1R8E A;  2UWJ E;  1SQB K;  1NVO A;  1BDC A;  3H1K J;  2O01 N;  1VF5 C;  1L0L D;  3L71 J;  1KQG B;  2E5Y A;  3TNU A;  4RKU J;  3MTU E;  4AQR D;  2I8D A;  3Q5R A;  1BSH A;  2I1K A;  2XZR A;  4H13 D;  4D6T D;  2HG5 D;  3L72 G;  1BCC D;  1BGY G;  2FXM A;  1ZR4 A;  1YBK A;  3AED C;  1L0L E;  4HB1 A;  4YXW H;  3VMX A;  4D6T J;  1N73 C;  1AQ5 A;  5E79 E;  5CCH C;  2V7Q H;  5AVT B;  3Q5P A;  2O1J A;  3Q5S A;  2KSE A;  1LWU B;  1NH4 A;  1YTZ I;  3L70 D;  1GU4 A;  3TDK A;  2KSJ A;  1WMK A;  2YO3 A;  4PD4 I;  1BCC E;  5AVV B;  1YIT P;  1JY2 N;  3HUS C;  3L73 J;  3HD7 D;  1EC5 A;  3S4R A;  1FAV A;  1OW8 A;  1FZB A;  5TIS E;  1NTK G;  3TNU B;  1W2E A;  4WWI A;  3TK1 A;  1NGM B;  1J1D C;  4YXD C;  3A3Y B;  3L70 E;  2Y0C A;  2RH0 A;  1JTH A;  1OXZ A;  4H13 C;  2FXO A;  1VQ9 P;  1VL2 A;  3CXH H;  1PPJ G;  5GTI E;  2W6J H;  3I5C A;  2H43 A;  1SQP J;  1JOC A;  3U1C A;  4PV1 B;  2YMK A;  2QA4 P;  1SFC C;  4MN4 C;  1NAF A;  1L0N D;  1RHZ B;  1PGJ A;  4GIF A;  1PP9 J;  1LT9 A;  1SQB G;  1KZU B;  5CCG A;  3HD7 C;  2YIU C;  3D6Z A;  2KK7 A;  1PGP A;  4OGQ C;  1EDI A;  3LW5 J;  2E75 B;  2OTL P;  1FS0 E;  1L0N E;  4PD4 E;  2BEZ F;  2BAS A;  3C8V A;  4EOT A;  2NPS B;  3L74 J;  1GL2 D;  1MZ9 A;  4XA4 A;  1VQM P;  2E43 A;  2POH A;  1VQ5 P;  2IBZ D;  2ZT9 D;  4W80 A;  3H1J E;  1QX8 A;  1N7S A;  2WSF H;  4H0L B;  3L71 G;  3B5N A;  4B86 A;  1LT9 B;  1L4A C;  1LJ2 A;  2B88 A;  1YJN P;  1S5L X;  1JM0 A;  4KHX A;  1Y47 A;  2K1A A;  2M3B A;  1JCC A;  3H1L D;  1S5L E;  3JC2 2;  3BCC D;  3JCU H;  1JY3 N;  2DW3 A;  1E79 H;  1GK4 A;  4U3F G;  5AW9 B;  1LNQ A;  4JYB A;  3H1L E;  5APU A;  1N7S B;  4NPD A;  1NKZ B;  3BCC E;  1ZR2 A;  3CXH I;  1URQ C;  4L75 A;  1NU1 K;  1MUU A;  3L36 A;  3R4Y A;  1NYH A;  5CJ4 A;  3WU2 H;  1KB9 H;  1S9K D;  3USS A;  2E74 C;  2OYI C;  3SSU A;  1TU3 F;  1IZN B;  2FFD C;  2WMM A;  3L75 J;  2E76 D;  1SQP G;  1YHQ P;  3CL3 D;  1RY3 A;  4IL6 X;  2R32 A;  4L73 A;  3ITK A;  2W83 C;  1SQV K;  3EQ2 A;  3L37 A;  1ZRT D;  4NPE A;  3M0D C;  1S9K E;  1AQT A;  2YKO A;  4IL6 E;  1G2C A;  4WY4 D;  4L74 A;  1PP9 G;  3V2P A;  2A06 E;  1QEX A;  3CPW O;  3TSI A;  3E7K A;  1USD A;  2M0B A;  1XTC C;  2K9J A;  1ZRT E;  3V4W A;  2FYN B;  1LTJ A;  1BE3 E;  1RH5 B;  1HJB A;  4IFD K;  2OYH A;  1VQL P;  1CI6 A;  1N73 A;  3CXH E;  4W7Z A;  1FU1 A;  1JO5 A;  3M0A A;  2GA1 A;  3BAS A;  3QWO C;  2KB7 P;  1T8Z A;  3FWN A;  1VQ8 P;  1PL5 A;  5KLV D;  1G2C B;  5CCG D;  1BDD A;  4WY4 C;  1KIL C;  1Y8A A;  2H89 C;  1IK9 A;  3BRT B;  3CX5 I;  1JNM A;  1S2E A;  4CPG A;  2C0X A;  4RO0 A;  1M1J C;  3HE5 A;  1NU1 G;  3S9O A;  2FYU D;  1KN7 A;  1Q7Y Q;  4XFJ A;  4O9B A;  1YQ3 C;  5GTH H;  5KLV E;  1LTJ B;  5AW0 B;  1SQQ D;  3VP9 A;  4UB6 E;  2J59 M;  2OYH B;  1RE4 C;  3EWK A;  1HJ0 A;  1MFZ A;  1CI6 B;  1N73 B;  1KB9 I;  4PJ0 H;  4L76 A;  2IFN A;  1GW4 A;  2QIW A; 
#chains in the Genus database with same CATH homology
 3OA7 A;  4C46 A;  1FOS F;  5CCH D;  1NO4 A;  3MGN A;  1QL1 A;  3B5N D;  3R2P A;  5CHX A;  1IFD A;  5AVW B;  3HTK A;  1VDF A;  1RF1 B;  1LWU A;  1DEB A;  1LWU C;  3HUS B;  1L4A D;  5AVU B;  2WPS A;  1J1E B;  2GM4 A;  3H32 B;  1FZC A;  2A45 I;  1FZC C;  1A02 F;  3V2N A;  3VN0 A;  4LGD E;  2C9L Y;  3II6 A;  4WY4 B;  4JYC A;  5APX A;  1JUN A;  2XNX A;  3B8E B;  4LC1 A;  1SQB K;  4ZKP A;  1PFI A;  1M1J B;  3HE5 B;  5AW5 B;  1X9V A;  3TNU A;  1JTH B;  3MTU E;  4AQR D;  4AYC A;  3U1A A;  2PAJ A;  1RF0 A;  3MUD A;  1RF0 C;  2HOD A;  2I1K A;  1EQ7 A;  2XZR A;  3H6P A;  2HG5 D;  1L0N K;  2NPS D;  1CZQ A;  1G1J A;  1E5W A;  1LTI C;  2FXM A;  1ZR4 A;  2H8P D;  1JMM A;  2Z4E A;  3RK2 C;  5KJ7 D;  1SFC B;  2O1K A;  2Z5H A;  3BRV B;  1URQ D;  4W7Y A;  3KDP B;  3CLQ A;  4HH2 A;  1VPC A;  3VMX A;  3PP5 A;  1N73 C;  1OWA A;  1AQ5 A;  1FDM A;  5CCH A;  1HVV A;  5CCH C;  3HTK B;  1G1I A;  5AVT B;  2O1J A;  1IFN A;  1LWU B;  3MIW A;  5AVQ B;  1NH4 A;  1YTZ I;  1GU4 A;  2IX7 C;  4LLH A;  1FZC B;  2KSJ A;  3NXS A;  3P32 A;  2W6B A;  3G3Z A;  2YO3 A;  3A2A A;  5AVV B;  1FOS E;  1JY2 N;  2R5D A;  2ZFC A;  5AVR B;  3HUS A;  3HUS C;  1M7L A;  3HD7 D;  3RL0 D;  1FAV A;  2HPC A;  1FZB A;  3TNU B;  1W2E A;  1FZG A;  1SQX K;  2Q3I A;  3LW5 H;  5AW7 B;  4OH8 B;  3TK1 A;  1WRG A;  1NTK K;  2Q5U A;  4XE5 B;  1J1D C;  2H7H A;  1IFI A;  3A3Y B;  4C7R A;  3SWY A;  2HOD B;  3MD0 A;  1JTH A;  1OXZ A;  2A45 G;  1NHL A;  5BU5 A;  4Y99 B;  1T3U A;  1YYC A;  3GHG A;  3E1I A;  3GHG C;  3I5C A;  2H43 A;  1GU5 A;  5KJ7 A;  5KJ7 C;  3A5T A;  1SP4 A;  1JOC A;  3U1C A;  1N7S D;  3HE4 A;  3B5N B;  1SFC A;  1SFC C;  1J2J B;  2CPB A;  2VRS A;  5CJ0 A;  2WSC H;  1NAF A;  1L4A B;  1SLQ A;  2J58 A;  1IJD B;  2KYV A;  1NTM K;  4GIF A;  1IFM A;  1XTG B;  2KLV A;  1LT9 A;  1KZU B;  1LT9 C;  5AVS B;  2XKM A;  3RK3 D;  2HPC B;  2GUS A;  5CCG A;  3HD7 A;  5CCG C;  3HD7 C;  1LTB C;  1GD2 E;  3M06 A;  2Q7C A;  1FBM A;  2QM8 A;  1J1D B;  5AW2 B;  2HFE D;  4I2L C;  1JY2 O;  1H88 A;  1HTL C;  1FJK A;  4C7N A;  2BAS A;  3V2R A;  4EOT A;  2NPS B;  4M3L A;  1GW3 A;  3BVH A;  1KIL D;  3GHG B;  1GL2 D;  3VP8 A;  4N3Y B;  1MZ9 A;  2N1T D;  1N86 A;  3N4X A;  4XA4 A;  1IO4 A;  2E43 A;  4Y99 C;  3M9B A;  2POH A;  1URQ B;  4IFM A;  4W80 A;  3HE4 B;  4N78 D;  3IFM A;  5APV A;  1T2K D;  2E42 A;  1N2D C;  2XU6 A;  1N7S A;  2W6A A;  1N7S C;  2WSF H;  1IC2 A;  1HWT C;  3LID A;  2C0W A;  2OAR A;  3VTP C;  1WT6 A;  1QL2 A;  3B5N A;  3B5N C;  2P67 A;  1ZV8 A;  4B86 A;  1LT9 B;  2XV5 A;  2YMY A;  1NKN A;  1L4A A;  1L4A C;  3SWF A;  3HD7 B;  2YKP A;  3RL0 B;  1CW5 A;  4I1L A;  3RK3 C;  2WSE H;  4HYT B;  4KHX A;  4JF7 A;  4DZO A;  4N78 E;  5AW4 B;  1HGZ A;  3WMM 0;  1NOH A;  2M3B A;  1FZF A;  2JJL A;  4EIJ A;  1JCC A;  2P7J A;  1GZL A;  2W27 A;  2CPS A;  3HRN A;  1JY3 N;  4C7N B;  1DX7 A;  1LTG C;  3IR9 A;  1GK4 A;  2GUV A;  5AW9 B;  1FZE A;  1GL2 A;  3NFQ A;  2NPS A;  1T3J A;  2N1T A;  2NPS C;  2N1T C;  5BU8 B;  3VYI A;  4WBA A;  3L4F A;  5AW6 B;  4JYB A;  5APS A;  5APU A;  2WPQ A;  1N7S B;  2LKM A;  1JY2 P;  1NKZ B;  4AUW A;  2KP8 A;  1URQ A;  1ZR2 A;  1URQ C;  2R3C A;  2C9N Y;  5BVZ A;  1NU1 K;  1MUU A;  3L36 A;  3N7N A;  5AW3 B;  3BAT A;  1RE3 A;  1RE3 C;  5CJ4 A;  4WB4 A;  3KQG A;  3V2Q A;  1LTS C;  3RK3 B;  3NMD A;  1FJP A;  1S9K D;  5KLV K;  3U59 A;  1KQL A;  3KPE A;  3RK2 D;  2P2U A;  2OYI A;  2OYI C;  3A7O A;  3P8M C;  2IPP A;  3RL0 C;  2FFD A;  2FFD C;  1LGH B;  2A45 H;  3O8Z A;  3CL3 D;  1RY3 A;  1HH0 A;  2R32 A;  1KFM A;  2FYU K;  2HYN A;  4DOJ A;  1SQP K;  1SQV K;  3EQ2 A;  3L37 A;  1KIL B;  3M0D A;  3LIE A;  3OAK A;  3M0D C;  1GL2 B;  5AW1 B;  1S9K E;  2YKO A;  2N1T B;  2P1J A;  1SQQ K;  2XDJ A;  1G2C A;  4WY4 D;  1H8A A;  5KTB A;  2I1J A;  3T97 A;  1JY3 O;  3NTN A;  5AVZ B;  1DH3 A;  3V2P A;  4N6J A;  3M9H A;  1GK6 A;  1N7L A;  2IFM A;  3TSI A;  3M9Q A;  5CMZ A;  2WIT A;  4RES B;  5APQ A;  3VMZ A;  5APT A;  5APY A;  3TYY A;  1NWQ A;  3C9I A;  4GKG A;  1XTC C;  3V4W A;  2WT7 A;  3P8C D;  3CI9 A;  1AFO A;  1X8Y A;  1LTJ A;  1LTJ C;  1HJB A;  1Z56 A;  2YO2 A;  4IFD K;  2OYI B;  4ZKU A;  2OYH A;  1YTZ T;  2OYH C;  1A02 J;  2FFD B;  1FZA A;  3UIA A;  1CI6 A;  1N73 A;  4W7Z A;  2KOG A;  1SFC D;  1FU1 A;  2Z5I A;  2ZXE B;  1GDT A;  1L0L K;  2L5G B;  1ZLL A;  1CSB A;  1JCD A;  1JO5 A;  3M0A A;  2FKW B;  1GTW A;  3BAS A;  3P8C E;  1KFN A;  2N9B A;  3L35 A;  5APW A;  2KB7 P;  4I6M C;  1T8Z A;  2YNY A;  2MJZ A;  3M91 A;  3V5B A;  2HLO A;  1RF1 A;  1RF1 C;  1SVF A;  1G2C B;  1HUC A;  3OJA B;  2WZ7 A;  1J1E C;  3H32 A;  4GT1 A;  5CCG D;  4WY4 A;  1HGV A;  1KIL A;  4WY4 C;  1KIL C;  2Q9I A;  1GL2 C;  3VMY A;  1IK9 A;  3BRT B;  2M8R A;  1HBW A;  4IFF A;  5AW8 B;  1JNM A;  1MV8 A;  2C0X A;  2WPR A;  1M1J A;  1M1J C;  1IFJ A;  3HE5 A;  1LTA C;  1T2K C;  2R5B A;  2WT7 B;  5AVX B;  4O9B A;  2O01 H;  3P7K A;  1LTJ B;  3VOP A;  5AW0 B;  2YKQ A;  1X79 B;  3VP9 A;  3KYQ A;  1ZN5 A;  2J59 M;  3V4Q A;  1RE4 A;  3RK2 B;  2WWW A;  1LTT C;  1RE4 C;  2FYZ A;  2OYH B;  2JEE A;  2PP6 A;  1JY3 P;  2QM7 A;  1H89 A;  1MFZ A;  1CI6 B;  1N73 B;  1NTZ K;  5AVY B;  2WTY A;  2IFN A;  1GW4 A;  3EFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...