2Z5IA

Crystal structure of the head-to-tail junction of tropomyosin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
49
structure length
49
Chain Sequence
b'GELLSKNYHLENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords General control protein GCN4 and Tropomyosin alpha-1 chain
publication title Structural basis for tropomyosin overlap in thin (actin) filaments and the generation of a molecular swivel by troponin-T
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 22
structure length 49
sequence length 49
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2z5iA00
3HE5A 3VMXA 3P32A 2W6AA 5AW7B 5AW0B 1OXZA 2WPRA 5AVSB 3HTKA 3M06A 5AW3B 1S9KD 5AW4B 3TNUB 5AW2B 1FOSE 1X8YA 3KDPB 5AVVB 3TK1A 1GD2E 2IPPA 3A2AA 3TNUA 2H7HA 3VN0A 3HE4B 1T2KD 3L35A 5AW1B 1J2JB 4XE5B 5AVXB 2R32A 2E43A 3NFQA 1MUUA 1KQLA 4C46A 2YNYA 5APQA 1GTWA 2JJLA 3T97A 4M3LA 1GK6A 2KP8A 4EOTA 1CSBA 3KQGA 1HUCA 1GK4A 1H89A 3O8ZA 2R5DA 3L37A 3LIEA 3NMDA 1FAVA 3M0AA 1MFZA 3V5BA 2YO3A 5APSA 4AYCA 5APWA 1GU5A 3M0DA 5CMZA 3TYYA 5AW8B 5APUA 2Q7CA 3L36A 1S9KE 2WT7B 5APVA 2R3CA 1NAFA 2WPSA 4LC1A 2E42A 1H8AA 5AVUB 1DH3A 3A7OA 5AW6B 2WWWA 3NTNA 2W27A 3VTPC 4AUWA 2Z5HA 5AVRB 2R5BA 2WT7A 4GKGA 1GU4A 5APYA 5AVZB 1OWAA 2XV5A 1JUNA 5AVYB 1HBWA 2C9NY 2BASA 3VMYA 4HYTB 4B86A 1YYCA 4DZOA 1NWQA 3M91A 3MGNA 3P8MC 1CI6A 3A5TA 1FOSF 4JYCA 3VMZA 4C7NB 2QM8A 1SLQA 2P2UA 4AQRD 1H88A 5AVTB 5APTA 1T2KC 4I2LC 3MD0A 1G2CB 2ZXEB 2XU6A 2P67A 3M9HA 4C7NA 3A3YB 4JYBA 3M9BA 1HJBA 2Z5IA 2VRSA 3OAKA 1CZQA 4I6MC 1JNMA 5AVQB 2Q5UA 3B8EB 2Q3IA 2YO2A 5APXA 4GT1A 2C9LY 1IO4A 3UIAA 5AVWB 1MV8A 4RESB 4KHXA 5AW9B 3IR9A 3LIDA 2XZRA 3VYIA 3P7KA 1A02F 5AW5B 2WTYA 1CI6B 1GZLA 3HE5B 3I5CA 3V4WA 1A02J 2P7JA 2ZFCA 1SP4A 3V4QA 1HWTC 2N9BA 2WPQA 3SWFA 3HE4A 2QM7A 3NXSA
chains in the Genus database with same CATH superfamily
2W6AA 5AW7B 4PV1D 1KFMA 1WMKA 2OARA 3TNUB 4DCKA 2Y9YA 3AEAC 5TISH 3EWKA 3RBZA 5CBOA 4XE5B 2M0BA 2I8DA 5APQA 1DD4A 3KQGA 5CCHA 1RF1A 1VF5D 3IF4A 2W6BA 1LP1A 2FYUK 1HH0A 1L4AC 5CMZA 4N78D 1PIXA 1S9KE 2WT7B 4ASWA 3JC22 3BCCG 1LTIC 3H1KD 1JY3O 2C9NY 4N6JA 3Q5RA 1DEBA 1YTZT 1IJDB 1IFNA 3I55P 3RK3B 3L71D 1J1EC 3AE7C 2E74D 1JMMA 1NTZE 2WSSH 2W8ZA 1H0TA 3BRVB 5AVWB 1MV8A 4Y28J 3CX5H 1BCCD 2DW3A 1GZLA 1ZRTE 1VQ6P 3CI9A 1TU3F 3U59A 2Y9ZA 3WU2E 3CXHH 2ZAEB 3WMM0 5KLVE 1OW6A 2YIUB 2E75D 1GD2E 2LXCB 3H1HD 5B5EE 4C46A 3RK3C 1JB0J 2D2CD 2ZYDA 1EXJA 1RY3A 5KLVG 3D6ZA 3GHGB 1AV1A 4IL6H 1NO4A 1SQVD 2O3JA 2IFMA 4AYCA 5APWA 3H1LE 1AJYA 1UIIA 3D6YA 2W83C 2Y0EA 1KILA 3CMAP 4KT0J 3EQ2A 2QG4A 5AVZB 1AVOA 1FDIA 1SQVK 5CCGA 3AE6C 1CW5A 1DD3A 2YXQB 3GG2A 4I2LC 1AFOA 1PFIA 2BEZF 3H1JE 3AEEC 1LTTC 3GHGC 5AVQB 2WQYC 1R8EA 1SQXE 2OTLP 3IR9A 4JBZA 1X79B 1JY3N 2E76C 3CCEP 3H1JG 3HE5A 1PPJD 5CHXA 4WWIA 2BCCG 1NU1E 3L70J 1SQXG 1YITP 5TISE 3HUSB 3A0BH 1E79H 2QJPB 2FYUJ 1NTMD 1EC5A 1L4AA 1SQQK 3L73J 5B66H 3CWBJ 2AEJA 3GF7A 1IFJA 1KZUB 2IYPA 3SSUA 1SQBD 2MKVA 2JDIH 2ZYGA 4YXDC 5GTHH 1USEA 2M5AB 3MHVA 2OYIB 3H1KJ 1M1JB 1U57A 1M57D 3N7NA 1IC2A 1PP9D 1M90Q 3JSVC 2XNXA 3IFMA 1N7SB 3A5TA 3P8MC 3HUSC 3V2RA 3L75D 3B4SA 2QJPC 4YPCA 3CCMP 2QIWA 3L71J 1U7MA 3N4XA 2VRSA 4GDOA 4JF7A 2PP6A 4WY4C 3L72D 3A0HH 1L0LG 3L74E 1NKZB 2I1KA 3HD7C 3CX5E 1SFCA 1BE3E 4K35A 3RBXA 3V2PA 2FFDC 1S1CX 3AEDC 2OYIC 3CXHE 1J1DB 1FJPA 2JEEA 3L74G 1M1JC 3TGUD 1N7LA 1SQPG 5CJ4A 4I1LA 3TK1A 3VN0A 2KUBA 3H1HJ 3ABVC 4ZNCA 5AW1B 1USDA 1RF1B 3MIWA 2KP8A 1CSBA 4IL6E 2O01H 1LP1B 1FZGA 1SQVJ 1E5WA 1NGMB 5BU8B 4R4LA 3AEGC 1N7SD 4L73A 4XFJA 3M0DA 1EZVG 3PLNA 2Q6QA 2O01N 1YQ4C 3H1IG 1OWAA 4TLFA 5AVYB 4DOJA 4N78E 4HYTB 3Q5PA 3Q1MA 4GOEA 1GL2C 5BU5A 4ZKPA 3PRJA 1R5SA 4H0LD 2Z5IA 1KFNA 1RF1C 1KB9H 3MUDA 3OAKA 1H0TB 1N86A 1L2PA 2HLOA 4O9BA 2GM4A 4XA4A 4LGDE 4IFDK 2O1JA 3I56P 1SQQJ 3C9IA 2WSFH 2ZVOB 5CCHD 1DEEG 2KS1A 2A06G 3ZDMA 1BCCE 1MKMA 1OMIA 3CPWO 1LTAC 3A0BE 2BCCD 2B87A 5GTIH 1EDJA 3LW5H 2Z4EA 1P84D 2QJKB 1J2JB 3PHLA 5B66E 1XTGB 2L5GB 4ZMDA 1IZNB 3RK2B 2IYOA 1OVUA 2KB7P 2P58A 2UWJE 1JY2P 5GTHE 1NVOA 3CCVP 2KK7A 4D6TG 1FDMA 1KILB 5AVUB 2ZT9B 1M1KQ 2NPSD 1JUNA 1PP9J 2LKMA 3BCCJ 2Y0CA 3BATA 3HD7A 4ASVA 2HPCA 3L75J 2JKVA 1T3UA 1Q81Q 1PGQA 3M9BA 1Q86Q 4CPGA 3A0HE 3K5BA 2KNCA 3L72J 1KD1Q 2Q3IA 1QL1A 4H44D 1OW7A 2POHA 4C7RA 4PJ0H 1URQD 3HE5B 3I5CA 1A02J 1KILC 1HF9A 2N9BA 2WPQA 3NXSA 1KC8Q 5KKZB 3RK2D 5AVSB 3GLMA 5CCGC 3TGUJ 1L0LK 4RKUJ 2OQQA 1L4AB 3AE3C 1BDCA 1PPJE 1VQ7P 1NTKD 1WT6A 4U3FE 2A45G 2ZT9D 2FXOA 1HUCA 2GUVA 3EFFK 4HB1A 5CCGD 3AE4C 3L70D 1VQKP 3LIEA 1VQMP 1RF0C 1NTME 3JCUH 3B5NA 3HRNA 3CL3D 4PD4H 1BSHA 3FXDA 1NTKK 1HGVA 4Y99C 1GL2A 2FYUD 2Y0DA 2PGDA 3F5HA 1J1EB 4U3FG 4LC1A 1H8AA 3L73D 1HTLC 5KKZC 1SQBE 2R5BA 3CWBD 2OYHC 1VL2A 2XKMA 3MGNA 1SLQA 3RL0g 4WVZA 1LNQA 4KJMA 1KB9E 1LTBC 1QLED 1GW4A 1SFCB 3VP8A 5APXA 2JR8A 1IO4A 4RO0A 2ITAA 1NOHA 2QA4P 1K04A 2ZVNB 3G9RA 1L4AD 3CCLP 4GODA 1SP4A 1Q82Q 2HODA 3HE4A 3M9QA 3HTKA 2HYNA 5AW3B 1YTZI 2M8RA 2C0XA 1P84I 5GTIE 2BCCJ 1BGYE 4H13C 1LT9A 2IZ1A 2IBZE 2WSEJ 2OGUA 3AE8C 1NTZG 2QE7H 4OGQC 3CC2P 1SFCC 1QEXA 1S3JA 2KI7B 1BGYG 4RJTA 1KQSO 3R2PA 1GU5A 2IBZG 2M3EA 1S5LX 5KJ7A 3FWNA 3FGAD 2AXTH 2ZJSE 1VQ8P 4D6TD 5AVRB 4GKGA 5APYA 1L0ND 1EDIA 2WITA 2JO1A 1YYCA 4WBAA 3M91A 2E76B 2XU6A 3A3YB 3RK3D 4W7YA 1L0NK 1W2BO 3UIAA 3FX0A 3G6EP 1AQTA 4PJ0E 2K88A 3H1LG 3M0DC 3SFEC 1NHLA 1YIJP 1L0LJ 3Q3DA 2P7JA 2YMYA 2KS1B 3SWFA 1CI6A 3PJSK 3IN6A 1JY2O 1KORA 3KZIH 5BVZA 1LGHB 1WRGA 2B87B 1RF0A 2IPPA 2H7HA 4MN4C 1G1JA 1NTKJ 1SQPJ 4GOFA 3PP5A 1KYOI 1GTWA 2JJLA 3MUDC 3CXHI 3MP7B 4EYYQ 1FDOA 1SQQD 4EOTA 1OVVA 3O6QA 1PGOA 3E1RA 3JCUE 1MFTA 1FC2C 4PD4E 2OYHA 4IFMA 3CD6P 1FZAA 3KYQA 2Q7CA 2E76D 1EZVI 1NAFA 2KSEA 2NZ2A 2O1KA 1NU1G 2Z5HA 2QSIA 2FBWC 2G8YA 2KIKA 4WY4B 1Q90D 3TF5A 4BXLA 3HD7B 1G1IA 2HPCB 3H1IJ 2H88C 1T6AA 1T2KC 1JCCA 2FFDB 1YBKA 4C7NA 1FZFA 2KNCB 2KOGA 2GUSA 1Q2NA 1Q7YQ 4JQ0D 1JOCA 2CK3H 1D7MA 3BCCD 4EI2A 1FE6A 4W7ZA 1VQOP 3P7KA 3V4WA 3AE1C 3AE5C 3CCQP 2Q9IA 1OFCX 1S9KD 1YJ9P 3TDKA 2IX7C 2P10A 2K9JB 1RE3A 3S9OA 2K3RA 3L35A 1NKNA 2V4HA 2E43A 3SFDC 3G3ZA 3B5NB 4WY4D 3U1CA 1YJNP 3HD7D 1BE3G 3P8CE 2IFNA 1GL2B 1JY2N 1U7JA 4BWNA 1VDFA 2KLUA 1JO5A 5APUA 2QEXP 4HJGH 2AXTE 3L70E 1Z56A 4R4MA 1Y8AA 3NTNA 4D6TJ 2WSCJ 1L0NJ 2FYUE 1PV3A 5KLVD 3VMZA 2PRRA 3L73E 5APTA 3CWBE 1ZR2A 2ZXEB 3USSA 4YXWH 1VQ5P 3TSIA 1ZOYC 3B5NC 4IOIH 4BRYA 5KLVK 2JWDA 1OX3A 2XZRA 1FS0E 5KLIB 3FWLA 2HODB 1M8OB 3H1KE 4UB6H 1FZCA 3GMAA 3G4SP 4NPFX 2P67A 2QM7A 4A7PA 3HTKB 3P32A 3KZIE 1YI2P 1N8RQ 3OA7A 3B5ND 1IFPA 2I1JA 1NYHA 3L71E 3C1LA 1GL2D 3H1KG 4HKZH 1X0TA 1VQLP 1BDDA 2YNYA 1LTJA 1GK6A 2R5DA 2A45I 1EQ7A 2CPSA 3L71G 2V7QJ 3H1JD 3SWKA 3V5BA 1FZBA 1PZQA 5KLIC 2RH0A 3L36A 1SQXD 2KZJA 3GW6A 3VTPC 1BCCG 3FXEA 3PTZA 1LJ2A 3H1HE 2BASA 3VMYA 1AVYA 1NWQA 1NU1D 1PGPA 1LT9C 1SQXK 2P2UA 2RMZA 3M9HA 3L4FA 4JYBA 4DT0A 1XTCC 3CC4P 1G2CA 1JM0A 1SQVE 1NU1K 4GT1A 4OVNF 2K1AA 1Y47A 3CCJP 3RK3E 1FBMA 1CI6B 5KJ7C 5KAFH 3V4QA 3H25A 3D71A 2YXRB 3VMXA 2OYOA 1KB9I 1SQVG 4PV1B 2W6JH 1OXZA 2WPRA 3MZWB 3Q5SA 4IFFA 3VP9A 1GMJA 4JPZB 2YKPA 1K73Q 2R44A 1RQVA 4Y99B 3CCRP 3II6A 2HFED 1L0LD 4Z1MH 1R5LA 3O6QB 2OYHB 3F89A 1YQ3C 3O8ZA 1NH4A 1VF5B 3L37A 2WZ7A 5APSA 1NTZJ 5M1BA 3L74D 1SQQE 2B89A 3CX5D 1KILD 1SQPD 2N1TA 3CCSP 1QL2A 1SVFA 1KN7A 3E1IA 5AW6B 4AUWA 1DIPA 4PV1C 2E5YA 1KYOD 3CXHD 2QVAA 1P84H 1PPJG 2K37A 5KLVJ 4C7NB 1SQPK 3MD0A 2WSEH 1S2EA 2E74B 3C8VA 1RE4A 3CC7P 4UB8H 1CZQA 1EZVD 1YJWP 3B8EB 1NTMG 1VF5C 2FYZA 4H13B 1A02F 3H1ID 4UB6E 2WTYA 4QMAA 3H1LJ 1PP9E 1SQBG 1OIPA 3BCCE 4OGQB 2AEFA 3M06A 2G3AA 5AW4B 3V6IA 1KQGB 1KQFB 1PL5A 3L75E 2E75B 1X8YA 2OTKE 1LWUA 2WMMA 3SWYA 2OTJP 5CBNA 1LTSC 1PP9G 5AVXB 2R32A 2D2CB 1IFIA 3L72E 3T97A 4M3LA 2E74C 3L75G 1W5CE 3H1JJ 2FKWB 3GF3A 1GW3A 2A06D 5TJHA 3L72G 1SQXJ 1T8ZA 5K5GB 3TGUE 1ZMEC 2R3CA 2JP3A 3A7OA 5KTBA 1GU4A 3QH9A 2NPSA 4PD4I 4DZOA 1NU1J 1RE3C 2E75C 1K9MQ 4JYCA 4H13D 1RQUA 4AQRD 1H88A 4EIJA 3TGUG 3CLQA 2H89C 2D2CC 1KYOH 4IL6X 2J5UA 1JTHA 3KXDA 4OGQD 4BRYB 1OW8A 1SFCD 4RESB 3LIDA 1FJKA 1FZCB 1T3JA 3V2QA 5KAFE 3H32A 1URQA 1HWTC 2ZYAA 3R4YA 1S5LH 5AW0B 1KTMA 1RH5B 5KAIH 2KSJA 3S4RA 4I7ZB 5AVVB 1AA0A 3RGUA 3QWOC 4NPEA 1N2DC 3BASA 1LTJB 2IZ0A 1N73A 1GK4A 1LTGC 1H89A 3KHUA 4N3YB 2YIUC 3M0AA 2YO3A 3CX5I 4EDFA 1M56D 2KZIA 2P1JA 3L74J 1FZCC 1M7LA 1BE3J 1QVGO 2WPVB 1K05A 2W27A 2QJYB 1X9VA 1UIXA 2BCCE 1HBWA 1P84E 4I7ZC 2E5TA 3BRTB 1EXIA 2HR3A 1HJ0A 5L8RJ 2C0WA 3B71A 1G2CB 3WUUA 1LTJC 4UB8E 4L76A 4YTPC 4GIFA 3E7KA 5C39A 1VQPP 3WUTA 4U3FD 3S1KA 5AW9B 1SS1A 4L74A 5AW5B 1VQNP 1EDKA 4TT3H 4W80A 2QRXA 2WSCH 2PAJA 2QJYC 1ZXGA 1IFMA 1KMIZ 2AXCA 2K9YA 3TNUA 3A2AA 1NTMK 3Q2YA 3RL0B 4NPDA 1T2KD 3VOPA 3G71P 1BSNA 3NFQA 5CJ0A 5DJUB 3EFGA 4K3AA 1W2EA 4U7JA 3PH0A 1KB9D 1SQBK 1FAVA 1L0LE 2J58A 1MFZA 4WB4A 1OZHA 2L91A 3W68A 2Q3EA 2N1TB 1K8AQ 1LT1A 3AEFC 5H2FH 2FY8A 1ZV8A 1DX7A 2YMKA 2WT7A 1HVVA 1JMBA 2R3SA 2XV5A 1KILE 1NTKE 1SQPE 1BCCJ 1NTZD 1IFDA 1EDLA 4H0LB 3RL0C 1KYOE 2CPBA 1VPCA 2NRGA 1FU1A 1BGYD 1JEKA 2MJZA 2W90A 1ZRTD 4I6MC 2SPZA 2IBZD 2V7QH 1NTKG 2Q5UA 1ZP0C 2YO2A 2A45H 5E79H 1NTZK 2YKOA 1IK7A 1JY3P 1N7SC 3VYIA 4L75A 4ZKUA 2M3BA 2N1TC 1OVRA 3L70G 3RL0D 1EZVE 2ZFCA 1S5LE 2B9BA 1S72P 5KAIE 2XDJA 1ZW0A 2KXPB 3H1IE 2FYUG 1YHQP 1LWUB 3OW2O 3KDPB 3VMAA 3L73G 3CWBG 2N1TD 3HE4B 3CMEP 3T97B 3V2NA 1QGKB 4H0LC 1MUUA 1RE4C 1PGJA 3H1LD 1J1DC 2RKLA 3D70A 2HG5D 3NMDA 3WUVA 3GHGA 3OJAB 1KV4A 2N9YB 1LT9B 5DJTB 2XNDH 3BVHA 1MZ9A 3TYYA 5AW8B 2LR2A 1S4XA 2WPSA 2E42A 1DH3A 5CCHC 2WWWA 1ZR4A 2NPSB 2A06E 3U1AA 4B86A 1QVFO 1GDTA 1LWUC 1FOSF 2KYVA 2QM8A 5AVTB 2FXMA 3AECC 5EFWB 1JTHB 4OH8B 1QX8A 3IAOA 2C9LY 4H44B 2B88A 2O01J 4U3FJ 4KHXA 1NJIQ 3H32B 1URQB 2H43A 4PD4D 2LXBA 1NTMJ 4D6TE 2KLVA 1L0NE 2J59M 2WVRA 1NAYA 2NPSC 1X22A 3H1HG 3WU2H 5AW2B 1HGZA 1FOSE 1SQBJ 4HH2A 1L0NG 3HUSA 1IK9A 1N73B 5B5EH 1KQLA 1FZEA 2PFXA 2RN0A 2Q1KA 2FYNB 4WY4A 2JWAA 3AEBC 3AE2C 4H44C 3AE9C 1URQC 5H2FE 5KJ7D 2QJKC 2FXPA 5APVA 2FFDA 4DJGA 2M5AA 2OYIA 3RK2C 3H6PA 2ZXXA 2WSFJ 2YKQA 1M1JA 3W67A 3KPEA 1ZLLA 1VQ9P 1N7SA 1AQ5A 3MTUE 2BEQD 3LW5J 1BE3D 1N73C 1BGYJ 1HJBA 2IBZI 2H8PD 3ITKA 2ZT9C 2IDBA 3CCUP 1Y9BA 1JNMA 2FYNC 4OWFA 5E79E 1RHZB 4LLHA 1VQ4P 1SQQG 2GA1A 2AEMA 2K9JA 3P8CD 1ZN5A 1JCDA
chains in the Genus database with same CATH topology
2W6AA 2WSFH 3C9IA 5AW7B 5CCHD 2Q9IA 5AW0B 2KSJA 1KFMA 1S9KD 2OARA 3TNUB 2IX7C 1LTAC 5AVVB 1RE3A 3LW5H 1N2DC 2Z4EA 3BASA 3L35A 1J2JB 1NKNA 4XE5B 1LTJB 2E43A 1XTGB 2L5GB 5APQA 1N73A 3RK2B 3G3ZA 2KB7P 3KQGA 1GK4A 1LTGC 1H89A 5CCHA 3B5NB 4WY4D 1RF1A 3U1CA 4N3YB 3HD7D 3M0AA 1JY2P 3P8CE 2YO3A 2IFNA 2W6BA 1GL2B 1JY2N 2FYUK 2P1JA 1HH0A 1VDFA 1L4AC 1FZCC 1FDMA 5CMZA 1KILB 1M7LA 4N78D 1JO5A 5APUA 1S9KE 2WT7B 1Z56A 5AVUB 1LTIC 3NTNA 2W27A 1X9VA 1JY3O 2NPSD 1JUNA 1HBWA 2C9NY 4N6JA 1DEBA 2LKMA 1YTZT 3BRTB 3BATA 3HD7A 1IJDB 3VMZA 2HPCA 5APTA 2C0WA 1ZR2A 1G2CB 2ZXEB 1IFNA 1T3UA 3RK3B 3TSIA 1LTJC 3M9BA 1J1EC 4GIFA 1JMMA 2Q3IA 3B5NC 3BRVB 5AVWB 1MV8A 1QL1A 5KLVK 5AW9B 2XZRA 2POHA 4C7RA 2HODB 5AW5B 1URQD 1GZLA 3HE5B 3I5CA 3CI9A 1FZCA 1KILC 1A02J 4W80A 2N9BA 2WPQA 2QM7A 2P67A 3NXSA 3U59A 3HTKB 2WSCH 3P32A 3RK2D 5AVSB 2PAJA 3OA7A 5CCGC 3WMM0 3B5ND 1IFMA 2I1JA 1GD2E 1L0LK 3A2AA 3TNUA 1NTMK 1GL2D 1L4AB 3RL0B 1T2KD 3VOPA 1WT6A 3NFQA 5CJ0A 4C46A 2YNYA 3EFGA 3RK3C 1LTJA 1RY3A 1GK6A 2A45G 3GHGB 1HUCA 2GUVA 5CCGD 2R5DA 1W2EA 3LIEA 2A45I 1EQ7A 1SQBK 1NO4A 2CPSA 1FAVA 1RF0C 2J58A 1MFZA 3B5NA 4WB4A 3HRNA 3V5BA 3CL3D 1FZBA 2IFMA 4AYCA 1NTKK 5APWA 2N1TB 1HGVA 4Y99C 1GL2A 3L36A 1ZV8A 1KILA 1DX7A 1J1EB 4LC1A 1H8AA 3EQ2A 3VTPC 1HTLC 2R5BA 2WT7A 2OYHC 5AVZB 1HVVA 2XV5A 2BASA 1SQVK 3VMYA 5CCGA 1NWQA 2XKMA 3MGNA 1CW5A 1LT9C 1SQXK 1IFDA 1SLQA 2P2UA 4I2LC 3RL0C 3M9HA 1AFOA 2CPBA 1VPCA 3L4FA 4JYBA 1PFIA 1FU1A 1LTBC 1XTCC 1G2CA 2MJZA 1GW4A 4I6MC 1LTTC 1SFCB 3GHGC 2Q5UA 5AVQB 3VP8A 2YO2A 5APXA 1NU1K 4GT1A 1IO4A 2A45H 1NTZK 2YKOA 1NOHA 3IR9A 1JY3P 1N7SC 3VYIA 1FBMA 1X79B 1CI6B 1JY3N 1L4AD 4ZKUA 2M3BA 2N1TC 3RL0D 5KJ7C 3V4QA 2ZFCA 1SP4A 2HODA 3HE4A 3M9QA 3HE5A 3VMXA 5CHXA 1OXZA 2WPRA 2XDJA 3HTKA 2HYNA 5AW3B 1YTZI 1LWUB 4IFFA 3VP9A 2M8RA 2YKPA 2C0XA 3KDPB 3HUSB 4Y99B 2N1TD 1LT9A 3II6A 3HE4B 2HFED 3V2NA 1L4AA 1SQQK 1MUUA 1RE4C 1J1DC 2OYHB 3O8ZA 1NH4A 3L37A 1SFCC 1IFJA 2HG5D 1KZUB 3GHGA 3NMDA 3OJAB 2WZ7A 5APSA 1LT9B 3BVHA 3R2PA 1GU5A 1MZ9A 3TYYA 5AW8B 1KILD 2N1TA 2OYIB 5KJ7A 1QL2A 1SVFA 2WPSA 2E42A 3E1IA 1DH3A 5CCHC 5AW6B 2WWWA 1ZR4A 4AUWA 2NPSB 5AVRB 1M1JB 4GKGA 5APYA 3N7NA 1IC2A 3U1AA 2XNXA 2WITA 4B86A 3IFMA 1YYCA 4WBAA 1GDTA 1LWUC 3M91A 1N7SB 3A5TA 3P8MC 1FOSF 2KYVA 3HUSC 3V2RA 4C7NB 2QM8A 1SQPK 5AVTB 2FXMA 3MD0A 2WSEH 2XU6A 3A3YB 1JTHB 3N4XA 3RK3D 4OH8B 4W7YA 1L0NK 2VRSA 1RE4A 4JF7A 1CZQA 2PP6A 4WY4C 3B8EB 1NKZB 2C9LY 2FYZA 3UIAA 2I1KA 3HD7C 1SFCA 4KHXA 3H32B 1URQB 3M0DC 1A02F 1NHLA 2WTYA 2H43A 2P7JA 2YMYA 3V2PA 2KLVA 2FFDC 3SWFA 1CI6A 2OYIC 2J59M 1J1DB 1JY2O 1FJPA 2JEEA 2NPSC 1M1JC 3M06A 5AW4B 5BVZA 1N7LA 5AW2B 1LGHB 5CJ4A 4I1LA 1WRGA 1HGZA 1FOSE 1X8YA 3TK1A 1RF0A 2IPPA 2H7HA 1LWUA 3VN0A 4HH2A 1G1JA 3SWYA 3HUSA 1LTSC 1IK9A 5AW1B 5AVXB 1N73B 2R32A 1IFIA 1KQLA 3PP5A 1GTWA 1FZEA 2JJLA 1RF1B 3MIWA 3T97A 4M3LA 2KP8A 4EOTA 1CSBA 2O01H 4WY4A 2OYHA 4IFMA 1FZGA 1E5WA 2FKWB 5BU8B 1N7SD 1GW3A 1FZAA 1URQC 3M0DA 3KYQA 5KJ7D 2Q7CA 1T8ZA 5APVA 2R3CA 1NAFA 2FFDA 2O1KA 3A7OA 5KTBA 2OYIA 2Z5HA 3H6PA 3RK2C 4WY4B 1GU4A 1OWAA 5AVYB 4DOJA 2YKQA 2NPSA 4N78E 3HD7B 1M1JA 4HYTB 4DZOA 1G1IA 2HPCB 1RE3C 3KPEA 1GL2C 1ZLLA 5BU5A 4JYCA 4ZKPA 4AQRD 1H88A 1T2KC 1N7SA 1JCCA 4EIJA 1AQ5A 2FFDB 3MTUE 3CLQA 4C7NA 1FZFA 1N73C 1HJBA 2H8PD 2Z5IA 1KFNA 2KOGA 1RF1C 3MUDA 3OAKA 2GUSA 1JTHA 1N86A 1JNMA 1SFCD 1JOCA 4LLHA 4RESB 2HLOA 3LIDA 1FJKA 4W7ZA 1FZCB 4O9BA 3P7KA 1T3JA 2GM4A 3V2QA 4XA4A 4LGDE 4IFDK 3V4WA 2O1JA 3H32A 3P8CD 1URQA 1ZN5A 1JCDA 1HWTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HE5 A;  3VMX A;  3P32 A;  2W6A A;  5AW7 B;  5AW0 B;  1OXZ A;  2WPR A;  5AVS B;  3HTK A;  3M06 A;  5AW3 B;  1S9K D;  5AW4 B;  3TNU B;  5AW2 B;  1FOS E;  1X8Y A;  3KDP B;  5AVV B;  3TK1 A;  1GD2 E;  2IPP A;  3A2A A;  3TNU A;  2H7H A;  3VN0 A;  3HE4 B;  1T2K D;  3L35 A;  5AW1 B;  1J2J B;  4XE5 B;  5AVX B;  2R32 A;  2E43 A;  3NFQ A;  1MUU A;  1KQL A;  4C46 A;  2YNY A;  5APQ A;  1GTW A;  2JJL A;  3T97 A;  4M3L A;  1GK6 A;  2KP8 A;  4EOT A;  1CSB A;  3KQG A;  1HUC A;  1GK4 A;  1H89 A;  3O8Z A;  2R5D A;  3L37 A;  3LIE A;  3NMD A;  1FAV A;  3M0A A;  1MFZ A;  3V5B A;  2YO3 A;  5APS A;  4AYC A;  5APW A;  1GU5 A;  3M0D A;  5CMZ A;  3TYY A;  5AW8 B;  5APU A;  2Q7C A;  3L36 A;  1S9K E;  2WT7 B;  5APV A;  2R3C A;  1NAF A;  2WPS A;  4LC1 A;  2E42 A;  1H8A A;  5AVU B;  1DH3 A;  3A7O A;  5AW6 B;  2WWW A;  3NTN A;  2W27 A;  3VTP C;  4AUW A;  2Z5H A;  5AVR B;  2R5B A;  2WT7 A;  4GKG A;  1GU4 A;  5APY A;  5AVZ B;  1OWA A;  2XV5 A;  1JUN A;  5AVY B;  1HBW A;  2C9N Y;  2BAS A;  3VMY A;  4HYT B;  4B86 A;  1YYC A;  4DZO A;  1NWQ A;  3M91 A;  3MGN A;  3P8M C;  1CI6 A;  3A5T A;  1FOS F;  4JYC A;  3VMZ A;  4C7N B;  2QM8 A;  1SLQ A;  2P2U A;  4AQR D;  1H88 A;  5AVT B;  5APT A;  1T2K C;  4I2L C;  3MD0 A;  1G2C B;  2ZXE B;  2XU6 A;  2P67 A;  3M9H A;  4C7N A;  3A3Y B;  4JYB A;  3M9B A;  1HJB A;  2Z5I A;  2VRS A;  3OAK A;  1CZQ A;  4I6M C;  1JNM A;  5AVQ B;  2Q5U A;  3B8E B;  2Q3I A;  2YO2 A;  5APX A;  4GT1 A;  2C9L Y;  1IO4 A;  3UIA A;  5AVW B;  1MV8 A;  4RES B;  4KHX A;  5AW9 B;  3IR9 A;  3LID A;  2XZR A;  3VYI A;  3P7K A;  1A02 F;  5AW5 B;  2WTY A;  1CI6 B;  1GZL A;  3HE5 B;  3I5C A;  3V4W A;  1A02 J;  2P7J A;  2ZFC A;  1SP4 A;  3V4Q A;  1HWT C;  2N9B A;  2WPQ A;  3SWF A;  3HE4 A;  2QM7 A;  3NXS A; 
#chains in the Genus database with same CATH topology
 2W6A A;  5AW7 B;  4PV1 D;  1KFM A;  1WMK A;  2OAR A;  3TNU B;  4DCK A;  2Y9Y A;  3AEA C;  5TIS H;  3EWK A;  3RBZ A;  5CBO A;  4XE5 B;  2M0B A;  2I8D A;  5APQ A;  1DD4 A;  3KQG A;  5CCH A;  1RF1 A;  1VF5 D;  3IF4 A;  2W6B A;  1LP1 A;  2FYU K;  1HH0 A;  1L4A C;  5CMZ A;  4N78 D;  1PIX A;  1S9K E;  2WT7 B;  4ASW A;  3JC2 2;  3BCC G;  1LTI C;  3H1K D;  1JY3 O;  2C9N Y;  4N6J A;  3Q5R A;  1DEB A;  1YTZ T;  1IJD B;  1IFN A;  3I55 P;  3RK3 B;  3L71 D;  1J1E C;  3AE7 C;  2E74 D;  1JMM A;  1NTZ E;  2WSS H;  2W8Z A;  1H0T A;  3BRV B;  5AVW B;  1MV8 A;  4Y28 J;  3CX5 H;  1BCC D;  2DW3 A;  1GZL A;  1ZRT E;  1VQ6 P;  3CI9 A;  1TU3 F;  3U59 A;  2Y9Z A;  3WU2 E;  3CXH H;  2ZAE B;  3WMM 0;  5KLV E;  1OW6 A;  2YIU B;  2E75 D;  1GD2 E;  2LXC B;  3H1H D;  5B5E E;  4C46 A;  3RK3 C;  1JB0 J;  2D2C D;  2ZYD A;  1EXJ A;  1RY3 A;  5KLV G;  3D6Z A;  3GHG B;  1AV1 A;  4IL6 H;  1NO4 A;  1SQV D;  2O3J A;  2IFM A;  4AYC A;  5APW A;  3H1L E;  1AJY A;  1UII A;  3D6Y A;  2W83 C;  2Y0E A;  1KIL A;  3CMA P;  4KT0 J;  3EQ2 A;  2QG4 A;  5AVZ B;  1AVO A;  1FDI A;  1SQV K;  5CCG A;  3AE6 C;  1CW5 A;  1DD3 A;  2YXQ B;  3GG2 A;  4I2L C;  1AFO A;  1PFI A;  2BEZ F;  3H1J E;  3AEE C;  1LTT C;  3GHG C;  5AVQ B;  2WQY C;  1R8E A;  1SQX E;  2OTL P;  3IR9 A;  4JBZ A;  1X79 B;  1JY3 N;  2E76 C;  3CCE P;  3H1J G;  3HE5 A;  1PPJ D;  5CHX A;  4WWI A;  2BCC G;  1NU1 E;  3L70 J;  1SQX G;  1YIT P;  5TIS E;  3HUS B;  3A0B H;  1E79 H;  2QJP B;  2FYU J;  1NTM D;  1EC5 A;  1L4A A;  1SQQ K;  3L73 J;  5B66 H;  3CWB J;  2AEJ A;  3GF7 A;  1IFJ A;  1KZU B;  2IYP A;  3SSU A;  1SQB D;  2MKV A;  2JDI H;  2ZYG A;  4YXD C;  5GTH H;  1USE A;  2M5A B;  3MHV A;  2OYI B;  3H1K J;  1M1J B;  1U57 A;  1M57 D;  3N7N A;  1IC2 A;  1PP9 D;  1M90 Q;  3JSV C;  2XNX A;  3IFM A;  1N7S B;  3A5T A;  3P8M C;  3HUS C;  3V2R A;  3L75 D;  3B4S A;  2QJP C;  4YPC A;  3CCM P;  2QIW A;  3L71 J;  1U7M A;  3N4X A;  2VRS A;  4GDO A;  4JF7 A;  2PP6 A;  4WY4 C;  3L72 D;  3A0H H;  1L0L G;  3L74 E;  1NKZ B;  2I1K A;  3HD7 C;  3CX5 E;  1SFC A;  1BE3 E;  4K35 A;  3RBX A;  3V2P A;  2FFD C;  1S1C X;  3AED C;  2OYI C;  3CXH E;  1J1D B;  1FJP A;  2JEE A;  3L74 G;  1M1J C;  3TGU D;  1N7L A;  1SQP G;  5CJ4 A;  4I1L A;  3TK1 A;  3VN0 A;  2KUB A;  3H1H J;  3ABV C;  4ZNC A;  5AW1 B;  1USD A;  1RF1 B;  3MIW A;  2KP8 A;  1CSB A;  4IL6 E;  2O01 H;  1LP1 B;  1FZG A;  1SQV J;  1E5W A;  1NGM B;  5BU8 B;  4R4L A;  3AEG C;  1N7S D;  4L73 A;  4XFJ A;  3M0D A;  1EZV G;  3PLN A;  2Q6Q A;  2O01 N;  1YQ4 C;  3H1I G;  1OWA A;  4TLF A;  5AVY B;  4DOJ A;  4N78 E;  4HYT B;  3Q5P A;  3Q1M A;  4GOE A;  1GL2 C;  5BU5 A;  4ZKP A;  3PRJ A;  1R5S A;  4H0L D;  2Z5I A;  1KFN A;  1RF1 C;  1KB9 H;  3MUD A;  3OAK A;  1H0T B;  1N86 A;  1L2P A;  2HLO A;  4O9B A;  2GM4 A;  4XA4 A;  4LGD E;  4IFD K;  2O1J A;  3I56 P;  1SQQ J;  3C9I A;  2WSF H;  2ZVO B;  5CCH D;  1DEE G;  2KS1 A;  2A06 G;  3ZDM A;  1BCC E;  1MKM A;  1OMI A;  3CPW O;  1LTA C;  3A0B E;  2BCC D;  2B87 A;  5GTI H;  1EDJ A;  3LW5 H;  2Z4E A;  1P84 D;  2QJK B;  1J2J B;  3PHL A;  5B66 E;  1XTG B;  2L5G B;  4ZMD A;  1IZN B;  3RK2 B;  2IYO A;  1OVU A;  2KB7 P;  2P58 A;  2UWJ E;  1JY2 P;  5GTH E;  1NVO A;  3CCV P;  2KK7 A;  4D6T G;  1FDM A;  1KIL B;  5AVU B;  2ZT9 B;  1M1K Q;  2NPS D;  1JUN A;  1PP9 J;  2LKM A;  3BCC J;  2Y0C A;  3BAT A;  3HD7 A;  4ASV A;  2HPC A;  3L75 J;  2JKV A;  1T3U A;  1Q81 Q;  1PGQ A;  3M9B A;  1Q86 Q;  4CPG A;  3A0H E;  3K5B A;  2KNC A;  3L72 J;  1KD1 Q;  2Q3I A;  1QL1 A;  4H44 D;  1OW7 A;  2POH A;  4C7R A;  4PJ0 H;  1URQ D;  3HE5 B;  3I5C A;  1A02 J;  1KIL C;  1HF9 A;  2N9B A;  2WPQ A;  3NXS A;  1KC8 Q;  5KKZ B;  3RK2 D;  5AVS B;  3GLM A;  5CCG C;  3TGU J;  1L0L K;  4RKU J;  2OQQ A;  1L4A B;  3AE3 C;  1BDC A;  1PPJ E;  1VQ7 P;  1NTK D;  1WT6 A;  4U3F E;  2A45 G;  2ZT9 D;  2FXO A;  1HUC A;  2GUV A;  3EFF K;  4HB1 A;  5CCG D;  3AE4 C;  3L70 D;  1VQK P;  3LIE A;  1VQM P;  1RF0 C;  1NTM E;  3JCU H;  3B5N A;  3HRN A;  3CL3 D;  4PD4 H;  1BSH A;  3FXD A;  1NTK K;  1HGV A;  4Y99 C;  1GL2 A;  2FYU D;  2Y0D A;  2PGD A;  3F5H A;  1J1E B;  4U3F G;  4LC1 A;  1H8A A;  3L73 D;  1HTL C;  5KKZ C;  1SQB E;  2R5B A;  3CWB D;  2OYH C;  1VL2 A;  2XKM A;  3MGN A;  1SLQ A;  3RL0 g;  4WVZ A;  1LNQ A;  4KJM A;  1KB9 E;  1LTB C;  1QLE D;  1GW4 A;  1SFC B;  3VP8 A;  5APX A;  2JR8 A;  1IO4 A;  4RO0 A;  2ITA A;  1NOH A;  2QA4 P;  1K04 A;  2ZVN B;  3G9R A;  1L4A D;  3CCL P;  4GOD A;  1SP4 A;  1Q82 Q;  2HOD A;  3HE4 A;  3M9Q A;  3HTK A;  2HYN A;  5AW3 B;  1YTZ I;  2M8R A;  2C0X A;  1P84 I;  5GTI E;  2BCC J;  1BGY E;  4H13 C;  1LT9 A;  2IZ1 A;  2IBZ E;  2WSE J;  2OGU A;  3AE8 C;  1NTZ G;  2QE7 H;  4OGQ C;  3CC2 P;  1SFC C;  1QEX A;  1S3J A;  2KI7 B;  1BGY G;  4RJT A;  1KQS O;  3R2P A;  1GU5 A;  2IBZ G;  2M3E A;  1S5L X;  5KJ7 A;  3FWN A;  3FGA D;  2AXT H;  2ZJS E;  1VQ8 P;  4D6T D;  5AVR B;  4GKG A;  5APY A;  1L0N D;  1EDI A;  2WIT A;  2JO1 A;  1YYC A;  4WBA A;  3M91 A;  2E76 B;  2XU6 A;  3A3Y B;  3RK3 D;  4W7Y A;  1L0N K;  1W2B O;  3UIA A;  3FX0 A;  3G6E P;  1AQT A;  4PJ0 E;  2K88 A;  3H1L G;  3M0D C;  3SFE C;  1NHL A;  1YIJ P;  1L0L J;  3Q3D A;  2P7J A;  2YMY A;  2KS1 B;  3SWF A;  1CI6 A;  3PJS K;  3IN6 A;  1JY2 O;  1KOR A;  3KZI H;  5BVZ A;  1LGH B;  1WRG A;  2B87 B;  1RF0 A;  2IPP A;  2H7H A;  4MN4 C;  1G1J A;  1NTK J;  1SQP J;  4GOF A;  3PP5 A;  1KYO I;  1GTW A;  2JJL A;  3MUD C;  3CXH I;  3MP7 B;  4EYY Q;  1FDO A;  1SQQ D;  4EOT A;  1OVV A;  3O6Q A;  1PGO A;  3E1R A;  3JCU E;  1MFT A;  1FC2 C;  4PD4 E;  2OYH A;  4IFM A;  3CD6 P;  1FZA A;  3KYQ A;  2Q7C A;  2E76 D;  1EZV I;  1NAF A;  2KSE A;  2NZ2 A;  2O1K A;  1NU1 G;  2Z5H A;  2QSI A;  2FBW C;  2G8Y A;  2KIK A;  4WY4 B;  1Q90 D;  3TF5 A;  4BXL A;  3HD7 B;  1G1I A;  2HPC B;  3H1I J;  2H88 C;  1T6A A;  1T2K C;  1JCC A;  2FFD B;  1YBK A;  4C7N A;  1FZF A;  2KNC B;  2KOG A;  2GUS A;  1Q2N A;  1Q7Y Q;  4JQ0 D;  1JOC A;  2CK3 H;  1D7M A;  3BCC D;  4EI2 A;  1FE6 A;  4W7Z A;  1VQO P;  3P7K A;  3V4W A;  3AE1 C;  3AE5 C;  3CCQ P;  2Q9I A;  1OFC X;  1S9K D;  1YJ9 P;  3TDK A;  2IX7 C;  2P10 A;  2K9J B;  1RE3 A;  3S9O A;  2K3R A;  3L35 A;  1NKN A;  2V4H A;  2E43 A;  3SFD C;  3G3Z A;  3B5N B;  4WY4 D;  3U1C A;  1YJN P;  3HD7 D;  1BE3 G;  3P8C E;  2IFN A;  1GL2 B;  1JY2 N;  1U7J A;  4BWN A;  1VDF A;  2KLU A;  1JO5 A;  5APU A;  2QEX P;  4HJG H;  2AXT E;  3L70 E;  1Z56 A;  4R4M A;  1Y8A A;  3NTN A;  4D6T J;  2WSC J;  1L0N J;  2FYU E;  1PV3 A;  5KLV D;  3VMZ A;  2PRR A;  3L73 E;  5APT A;  3CWB E;  1ZR2 A;  2ZXE B;  3USS A;  4YXW H;  1VQ5 P;  3TSI A;  1ZOY C;  3B5N C;  4IOI H;  4BRY A;  5KLV K;  2JWD A;  1OX3 A;  2XZR A;  1FS0 E;  5KLI B;  3FWL A;  2HOD B;  1M8O B;  3H1K E;  4UB6 H;  1FZC A;  3GMA A;  3G4S P;  4NPF X;  2P67 A;  2QM7 A;  4A7P A;  3HTK B;  3P32 A;  3KZI E;  1YI2 P;  1N8R Q;  3OA7 A;  3B5N D;  1IFP A;  2I1J A;  1NYH A;  3L71 E;  3C1L A;  1GL2 D;  3H1K G;  4HKZ H;  1X0T A;  1VQL P;  1BDD A;  2YNY A;  1LTJ A;  1GK6 A;  2R5D A;  2A45 I;  1EQ7 A;  2CPS A;  3L71 G;  2V7Q J;  3H1J D;  3SWK A;  3V5B A;  1FZB A;  1PZQ A;  5KLI C;  2RH0 A;  3L36 A;  1SQX D;  2KZJ A;  3GW6 A;  3VTP C;  1BCC G;  3FXE A;  3PTZ A;  1LJ2 A;  3H1H E;  2BAS A;  3VMY A;  1AVY A;  1NWQ A;  1NU1 D;  1PGP A;  1LT9 C;  1SQX K;  2P2U A;  2RMZ A;  3M9H A;  3L4F A;  4JYB A;  4DT0 A;  1XTC C;  3CC4 P;  1G2C A;  1JM0 A;  1SQV E;  1NU1 K;  4GT1 A;  4OVN F;  2K1A A;  1Y47 A;  3CCJ P;  3RK3 E;  1FBM A;  1CI6 B;  5KJ7 C;  5KAF H;  3V4Q A;  3H25 A;  3D71 A;  2YXR B;  3VMX A;  2OYO A;  1KB9 I;  1SQV G;  4PV1 B;  2W6J H;  1OXZ A;  2WPR A;  3MZW B;  3Q5S A;  4IFF A;  3VP9 A;  1GMJ A;  4JPZ B;  2YKP A;  1K73 Q;  2R44 A;  1RQV A;  4Y99 B;  3CCR P;  3II6 A;  2HFE D;  1L0L D;  4Z1M H;  1R5L A;  3O6Q B;  2OYH B;  3F89 A;  1YQ3 C;  3O8Z A;  1NH4 A;  1VF5 B;  3L37 A;  2WZ7 A;  5APS A;  1NTZ J;  5M1B A;  3L74 D;  1SQQ E;  2B89 A;  3CX5 D;  1KIL D;  1SQP D;  2N1T A;  3CCS P;  1QL2 A;  1SVF A;  1KN7 A;  3E1I A;  5AW6 B;  4AUW A;  1DIP A;  4PV1 C;  2E5Y A;  1KYO D;  3CXH D;  2QVA A;  1P84 H;  1PPJ G;  2K37 A;  5KLV J;  4C7N B;  1SQP K;  3MD0 A;  2WSE H;  1S2E A;  2E74 B;  3C8V A;  1RE4 A;  3CC7 P;  4UB8 H;  1CZQ A;  1EZV D;  1YJW P;  3B8E B;  1NTM G;  1VF5 C;  2FYZ A;  4H13 B;  1A02 F;  3H1I D;  4UB6 E;  2WTY A;  4QMA A;  3H1L J;  1PP9 E;  1SQB G;  1OIP A;  3BCC E;  4OGQ B;  2AEF A;  3M06 A;  2G3A A;  5AW4 B;  3V6I A;  1KQG B;  1KQF B;  1PL5 A;  3L75 E;  2E75 B;  1X8Y A;  2OTK E;  1LWU A;  2WMM A;  3SWY A;  2OTJ P;  5CBN A;  1LTS C;  1PP9 G;  5AVX B;  2R32 A;  2D2C B;  1IFI A;  3L72 E;  3T97 A;  4M3L A;  2E74 C;  3L75 G;  1W5C E;  3H1J J;  2FKW B;  3GF3 A;  1GW3 A;  2A06 D;  5TJH A;  3L72 G;  1SQX J;  1T8Z A;  5K5G B;  3TGU E;  1ZME C;  2R3C A;  2JP3 A;  3A7O A;  5KTB A;  1GU4 A;  3QH9 A;  2NPS A;  4PD4 I;  4DZO A;  1NU1 J;  1RE3 C;  2E75 C;  1K9M Q;  4JYC A;  4H13 D;  1RQU A;  4AQR D;  1H88 A;  4EIJ A;  3TGU G;  3CLQ A;  2H89 C;  2D2C C;  1KYO H;  4IL6 X;  2J5U A;  1JTH A;  3KXD A;  4OGQ D;  4BRY B;  1OW8 A;  1SFC D;  4RES B;  3LID A;  1FJK A;  1FZC B;  1T3J A;  3V2Q A;  5KAF E;  3H32 A;  1URQ A;  1HWT C;  2ZYA A;  3R4Y A;  1S5L H;  5AW0 B;  1KTM A;  1RH5 B;  5KAI H;  2KSJ A;  3S4R A;  4I7Z B;  5AVV B;  1AA0 A;  3RGU A;  3QWO C;  4NPE A;  1N2D C;  3BAS A;  1LTJ B;  2IZ0 A;  1N73 A;  1GK4 A;  1LTG C;  1H89 A;  3KHU A;  4N3Y B;  2YIU C;  3M0A A;  2YO3 A;  3CX5 I;  4EDF A;  1M56 D;  2KZI A;  2P1J A;  3L74 J;  1FZC C;  1M7L A;  1BE3 J;  1QVG O;  2WPV B;  1K05 A;  2W27 A;  2QJY B;  1X9V A;  1UIX A;  2BCC E;  1HBW A;  1P84 E;  4I7Z C;  2E5T A;  3BRT B;  1EXI A;  2HR3 A;  1HJ0 A;  5L8R J;  2C0W A;  3B71 A;  1G2C B;  3WUU A;  1LTJ C;  4UB8 E;  4L76 A;  4YTP C;  4GIF A;  3E7K A;  5C39 A;  1VQP P;  3WUT A;  4U3F D;  3S1K A;  5AW9 B;  1SS1 A;  4L74 A;  5AW5 B;  1VQN P;  1EDK A;  4TT3 H;  4W80 A;  2QRX A;  2WSC H;  2PAJ A;  2QJY C;  1ZXG A;  1IFM A;  1KMI Z;  2AXC A;  2K9Y A;  3TNU A;  3A2A A;  1NTM K;  3Q2Y A;  3RL0 B;  4NPD A;  1T2K D;  3VOP A;  3G71 P;  1BSN A;  3NFQ A;  5CJ0 A;  5DJU B;  3EFG A;  4K3A A;  1W2E A;  4U7J A;  3PH0 A;  1KB9 D;  1SQB K;  1FAV A;  1L0L E;  2J58 A;  1MFZ A;  4WB4 A;  1OZH A;  2L91 A;  3W68 A;  2Q3E A;  2N1T B;  1K8A Q;  1LT1 A;  3AEF C;  5H2F H;  2FY8 A;  1ZV8 A;  1DX7 A;  2YMK A;  2WT7 A;  1HVV A;  1JMB A;  2R3S A;  2XV5 A;  1KIL E;  1NTK E;  1SQP E;  1BCC J;  1NTZ D;  1IFD A;  1EDL A;  4H0L B;  3RL0 C;  1KYO E;  2CPB A;  1VPC A;  2NRG A;  1FU1 A;  1BGY D;  1JEK A;  2MJZ A;  2W90 A;  1ZRT D;  4I6M C;  2SPZ A;  2IBZ D;  2V7Q H;  1NTK G;  2Q5U A;  1ZP0 C;  2YO2 A;  2A45 H;  5E79 H;  1NTZ K;  2YKO A;  1IK7 A;  1JY3 P;  1N7S C;  3VYI A;  4L75 A;  4ZKU A;  2M3B A;  2N1T C;  1OVR A;  3L70 G;  3RL0 D;  1EZV E;  2ZFC A;  1S5L E;  2B9B A;  1S72 P;  5KAI E;  2XDJ A;  1ZW0 A;  2KXP B;  3H1I E;  2FYU G;  1YHQ P;  1LWU B;  3OW2 O;  3KDP B;  3VMA A;  3L73 G;  3CWB G;  2N1T D;  3HE4 B;  3CME P;  3T97 B;  3V2N A;  1QGK B;  4H0L C;  1MUU A;  1RE4 C;  1PGJ A;  3H1L D;  1J1D C;  2RKL A;  3D70 A;  2HG5 D;  3NMD A;  3WUV A;  3GHG A;  3OJA B;  1KV4 A;  2N9Y B;  1LT9 B;  5DJT B;  2XND H;  3BVH A;  1MZ9 A;  3TYY A;  5AW8 B;  2LR2 A;  1S4X A;  2WPS A;  2E42 A;  1DH3 A;  5CCH C;  2WWW A;  1ZR4 A;  2NPS B;  2A06 E;  3U1A A;  4B86 A;  1QVF O;  1GDT A;  1LWU C;  1FOS F;  2KYV A;  2QM8 A;  5AVT B;  2FXM A;  3AEC C;  5EFW B;  1JTH B;  4OH8 B;  1QX8 A;  3IAO A;  2C9L Y;  4H44 B;  2B88 A;  2O01 J;  4U3F J;  4KHX A;  1NJI Q;  3H32 B;  1URQ B;  2H43 A;  4PD4 D;  2LXB A;  1NTM J;  4D6T E;  2KLV A;  1L0N E;  2J59 M;  2WVR A;  1NAY A;  2NPS C;  1X22 A;  3H1H G;  3WU2 H;  5AW2 B;  1HGZ A;  1FOS E;  1SQB J;  4HH2 A;  1L0N G;  3HUS A;  1IK9 A;  1N73 B;  5B5E H;  1KQL A;  1FZE A;  2PFX A;  2RN0 A;  2Q1K A;  2FYN B;  4WY4 A;  2JWA A;  3AEB C;  3AE2 C;  4H44 C;  3AE9 C;  1URQ C;  5H2F E;  5KJ7 D;  2QJK C;  2FXP A;  5APV A;  2FFD A;  4DJG A;  2M5A A;  2OYI A;  3RK2 C;  3H6P A;  2ZXX A;  2WSF J;  2YKQ A;  1M1J A;  3W67 A;  3KPE A;  1ZLL A;  1VQ9 P;  1N7S A;  1AQ5 A;  3MTU E;  2BEQ D;  3LW5 J;  1BE3 D;  1N73 C;  1BGY J;  1HJB A;  2IBZ I;  2H8P D;  3ITK A;  2ZT9 C;  2IDB A;  3CCU P;  1Y9B A;  1JNM A;  2FYN C;  4OWF A;  5E79 E;  1RHZ B;  4LLH A;  1VQ4 P;  1SQQ G;  2GA1 A;  2AEM A;  2K9J A;  3P8C D;  1ZN5 A;  1JCD A; 
#chains in the Genus database with same CATH homology
 2W6A A;  2WSF H;  3C9I A;  5AW7 B;  5CCH D;  2Q9I A;  5AW0 B;  2KSJ A;  1KFM A;  1S9K D;  2OAR A;  3TNU B;  2IX7 C;  1LTA C;  5AVV B;  1RE3 A;  3LW5 H;  1N2D C;  2Z4E A;  3BAS A;  3L35 A;  1J2J B;  1NKN A;  4XE5 B;  1LTJ B;  2E43 A;  1XTG B;  2L5G B;  5APQ A;  1N73 A;  3RK2 B;  3G3Z A;  2KB7 P;  3KQG A;  1GK4 A;  1LTG C;  1H89 A;  5CCH A;  3B5N B;  4WY4 D;  1RF1 A;  3U1C A;  4N3Y B;  3HD7 D;  3M0A A;  1JY2 P;  3P8C E;  2YO3 A;  2IFN A;  2W6B A;  1GL2 B;  1JY2 N;  2FYU K;  2P1J A;  1HH0 A;  1VDF A;  1L4A C;  1FZC C;  1FDM A;  5CMZ A;  1KIL B;  1M7L A;  4N78 D;  1JO5 A;  5APU A;  1S9K E;  2WT7 B;  1Z56 A;  5AVU B;  1LTI C;  3NTN A;  2W27 A;  1X9V A;  1JY3 O;  2NPS D;  1JUN A;  1HBW A;  2C9N Y;  4N6J A;  1DEB A;  2LKM A;  1YTZ T;  3BRT B;  3BAT A;  3HD7 A;  1IJD B;  3VMZ A;  2HPC A;  5APT A;  2C0W A;  1ZR2 A;  1G2C B;  2ZXE B;  1IFN A;  1T3U A;  3RK3 B;  3TSI A;  1LTJ C;  3M9B A;  1J1E C;  4GIF A;  1JMM A;  2Q3I A;  3B5N C;  3BRV B;  5AVW B;  1MV8 A;  1QL1 A;  5KLV K;  5AW9 B;  2XZR A;  2POH A;  4C7R A;  2HOD B;  5AW5 B;  1URQ D;  1GZL A;  3HE5 B;  3I5C A;  3CI9 A;  1FZC A;  1KIL C;  1A02 J;  4W80 A;  2N9B A;  2WPQ A;  2QM7 A;  2P67 A;  3NXS A;  3U59 A;  3HTK B;  2WSC H;  3P32 A;  3RK2 D;  5AVS B;  2PAJ A;  3OA7 A;  5CCG C;  3WMM 0;  3B5N D;  1IFM A;  2I1J A;  1GD2 E;  1L0L K;  3A2A A;  3TNU A;  1NTM K;  1GL2 D;  1L4A B;  3RL0 B;  1T2K D;  3VOP A;  1WT6 A;  3NFQ A;  5CJ0 A;  4C46 A;  2YNY A;  3EFG A;  3RK3 C;  1LTJ A;  1RY3 A;  1GK6 A;  2A45 G;  3GHG B;  1HUC A;  2GUV A;  5CCG D;  2R5D A;  1W2E A;  3LIE A;  2A45 I;  1EQ7 A;  1SQB K;  1NO4 A;  2CPS A;  1FAV A;  1RF0 C;  2J58 A;  1MFZ A;  3B5N A;  4WB4 A;  3HRN A;  3V5B A;  3CL3 D;  1FZB A;  2IFM A;  4AYC A;  1NTK K;  5APW A;  2N1T B;  1HGV A;  4Y99 C;  1GL2 A;  3L36 A;  1ZV8 A;  1KIL A;  1DX7 A;  1J1E B;  4LC1 A;  1H8A A;  3EQ2 A;  3VTP C;  1HTL C;  2R5B A;  2WT7 A;  2OYH C;  5AVZ B;  1HVV A;  2XV5 A;  2BAS A;  1SQV K;  3VMY A;  5CCG A;  1NWQ A;  2XKM A;  3MGN A;  1CW5 A;  1LT9 C;  1SQX K;  1IFD A;  1SLQ A;  2P2U A;  4I2L C;  3RL0 C;  3M9H A;  1AFO A;  2CPB A;  1VPC A;  3L4F A;  4JYB A;  1PFI A;  1FU1 A;  1LTB C;  1XTC C;  1G2C A;  2MJZ A;  1GW4 A;  4I6M C;  1LTT C;  1SFC B;  3GHG C;  2Q5U A;  5AVQ B;  3VP8 A;  2YO2 A;  5APX A;  1NU1 K;  4GT1 A;  1IO4 A;  2A45 H;  1NTZ K;  2YKO A;  1NOH A;  3IR9 A;  1JY3 P;  1N7S C;  3VYI A;  1FBM A;  1X79 B;  1CI6 B;  1JY3 N;  1L4A D;  4ZKU A;  2M3B A;  2N1T C;  3RL0 D;  5KJ7 C;  3V4Q A;  2ZFC A;  1SP4 A;  2HOD A;  3HE4 A;  3M9Q A;  3HE5 A;  3VMX A;  5CHX A;  1OXZ A;  2WPR A;  2XDJ A;  3HTK A;  2HYN A;  5AW3 B;  1YTZ I;  1LWU B;  4IFF A;  3VP9 A;  2M8R A;  2YKP A;  2C0X A;  3KDP B;  3HUS B;  4Y99 B;  2N1T D;  1LT9 A;  3II6 A;  3HE4 B;  2HFE D;  3V2N A;  1L4A A;  1SQQ K;  1MUU A;  1RE4 C;  1J1D C;  2OYH B;  3O8Z A;  1NH4 A;  3L37 A;  1SFC C;  1IFJ A;  2HG5 D;  1KZU B;  3GHG A;  3NMD A;  3OJA B;  2WZ7 A;  5APS A;  1LT9 B;  3BVH A;  3R2P A;  1GU5 A;  1MZ9 A;  3TYY A;  5AW8 B;  1KIL D;  2N1T A;  2OYI B;  5KJ7 A;  1QL2 A;  1SVF A;  2WPS A;  2E42 A;  3E1I A;  1DH3 A;  5CCH C;  5AW6 B;  2WWW A;  1ZR4 A;  4AUW A;  2NPS B;  5AVR B;  1M1J B;  4GKG A;  5APY A;  3N7N A;  1IC2 A;  3U1A A;  2XNX A;  2WIT A;  4B86 A;  3IFM A;  1YYC A;  4WBA A;  1GDT A;  1LWU C;  3M91 A;  1N7S B;  3A5T A;  3P8M C;  1FOS F;  2KYV A;  3HUS C;  3V2R A;  4C7N B;  2QM8 A;  1SQP K;  5AVT B;  2FXM A;  3MD0 A;  2WSE H;  2XU6 A;  3A3Y B;  1JTH B;  3N4X A;  3RK3 D;  4OH8 B;  4W7Y A;  1L0N K;  2VRS A;  1RE4 A;  4JF7 A;  1CZQ A;  2PP6 A;  4WY4 C;  3B8E B;  1NKZ B;  2C9L Y;  2FYZ A;  3UIA A;  2I1K A;  3HD7 C;  1SFC A;  4KHX A;  3H32 B;  1URQ B;  3M0D C;  1A02 F;  1NHL A;  2WTY A;  2H43 A;  2P7J A;  2YMY A;  3V2P A;  2KLV A;  2FFD C;  3SWF A;  1CI6 A;  2OYI C;  2J59 M;  1J1D B;  1JY2 O;  1FJP A;  2JEE A;  2NPS C;  1M1J C;  3M06 A;  5AW4 B;  5BVZ A;  1N7L A;  5AW2 B;  1LGH B;  5CJ4 A;  4I1L A;  1WRG A;  1HGZ A;  1FOS E;  1X8Y A;  3TK1 A;  1RF0 A;  2IPP A;  2H7H A;  1LWU A;  3VN0 A;  4HH2 A;  1G1J A;  3SWY A;  3HUS A;  1LTS C;  1IK9 A;  5AW1 B;  5AVX B;  1N73 B;  2R32 A;  1IFI A;  1KQL A;  3PP5 A;  1GTW A;  1FZE A;  2JJL A;  1RF1 B;  3MIW A;  3T97 A;  4M3L A;  2KP8 A;  4EOT A;  1CSB A;  2O01 H;  4WY4 A;  2OYH A;  4IFM A;  1FZG A;  1E5W A;  2FKW B;  5BU8 B;  1N7S D;  1GW3 A;  1FZA A;  1URQ C;  3M0D A;  3KYQ A;  5KJ7 D;  2Q7C A;  1T8Z A;  5APV A;  2R3C A;  1NAF A;  2FFD A;  2O1K A;  3A7O A;  5KTB A;  2OYI A;  2Z5H A;  3H6P A;  3RK2 C;  4WY4 B;  1GU4 A;  1OWA A;  5AVY B;  4DOJ A;  2YKQ A;  2NPS A;  4N78 E;  3HD7 B;  1M1J A;  4HYT B;  4DZO A;  1G1I A;  2HPC B;  1RE3 C;  3KPE A;  1GL2 C;  1ZLL A;  5BU5 A;  4JYC A;  4ZKP A;  4AQR D;  1H88 A;  1T2K C;  1N7S A;  1JCC A;  4EIJ A;  1AQ5 A;  2FFD B;  3MTU E;  3CLQ A;  4C7N A;  1FZF A;  1N73 C;  1HJB A;  2H8P D;  2Z5I A;  1KFN A;  2KOG A;  1RF1 C;  3MUD A;  3OAK A;  2GUS A;  1JTH A;  1N86 A;  1JNM A;  1SFC D;  1JOC A;  4LLH A;  4RES B;  2HLO A;  3LID A;  1FJK A;  4W7Z A;  1FZC B;  4O9B A;  3P7K A;  1T3J A;  2GM4 A;  3V2Q A;  4XA4 A;  4LGD E;  4IFD K;  3V4W A;  2O1J A;  3H32 A;  3P8C D;  1URQ A;  1ZN5 A;  1JCD A;  1HWT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...