2Z5IA

Crystal structure of the head-to-tail junction of tropomyosin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
49
structure length
49
Chain Sequence
GELLSKNYHLENEVARLKKLVDDLEDELYAQKLKYKAISEELDHALNDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords General control protein GCN4 and Tropomyosin alpha-1 chain
publication title Structural basis for tropomyosin overlap in thin (actin) filaments and the generation of a molecular swivel by troponin-T
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Contractile protein
total genus 22
structure length 49
sequence length 49
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2007-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2z5iA00
2WWWA 2WTYA 2YO3A 1HWTC 1SP4A 4AUWA 1OWAA 3I5CA 3TYYA 1GK6A 3V4WA 3HE5A 2N9BA 3VMZA 1CZQA 4JYBA 1DH3A 3NXSA 1JUNA 3HE5B 2H7HA 2C9NY 4B86A 3M9BA 2R5DA 2P2UA 2Z5HA 4KHXA 3LIDA 5APQA 2Q7CA 4DZOA 2E43A 3NTNA 5APUA 4JYCA 5AW1B 3L37A 2WPSA 5AVUB 3M06A 3VYIA 2BASA 1CI6A 1J2JB 5AVXB 2QM8A 2XZRA 4EOTA 2E42A 1GU5A 1GU4A 2Q3IA 2VRSA 4GKGA 4I6MC 3P8MC 3A7OA 5AVTB 1HBWA 1G2CB 3MGNA 3A2AA 4AYCA 3A5TA 4GT1A 3O8ZA 1H89A 1FOSF 3VN0A 1NAFA 2W6AA 5AVWB 1S9KD 5AW9B 3VMXA 3M91A 5APWA 1CI6B 3B8EB 1CSBA 3M0DA 2R32A 5AVZB 1FAVA 1S9KE 3NMDA 2XV5A 1H8AA 3TNUA 5AVRB 1SLQA 5APYA 1X8YA 3TNUB 5AW6B 1GZLA 5AVSB 3TK1A 3IR9A 1MUUA 2Z5IA 3P32A 3A3YB 3VMYA 1KQLA 3KDPB 5APSA 3UIAA 5APXA 1MFZA 5APTA 1H88A 2JJLA 4LC1A 5AW0B 2WPQA 3P7KA 1GTWA 5AW3B 3VTPC 2P7JA 4AQRD 1NWQA 3M0AA 1HJBA 1MV8A 3KQGA 5AW4B 1FOSE 1GD2E 2XU6A 2KP8A 3HE4A 4M3LA 1A02F 2YNYA 3HE4B 2W27A 4C7NA 1A02J 3M9HA 3L36A 5AVQB 5AW8B 4RESB 2ZXEB 4C7NB 3V5BA 1YYCA 4I2LC 3SWFA 2YO2A 5APVA 1T2KC 4C46A 3MD0A 2WT7A 2QM7A 5CMZA 2WT7B 1HUCA 2R3CA 5AW7B 2Q5UA 3L35A 4XE5B 1OXZA 3LIEA 4HYTB 3HTKA 2P67A 2R5BA 3NFQA 2C9LY 1GK4A 1JNMA 3V4QA 3T97A 1IO4A 2WPRA 2ZFCA 5AVVB 2IPPA 5AW2B 5AVYB 5AW5B 3OAKA 1T2KD
chains in the Genus database with same CATH superfamily
2FFDA 2YXRB 2K9JB 3D6YA 2YIUB 3KXDA 1NTME 2OYHB 4A7PA 4JYBA 1DH3A 1LTAC 4WY4C 2Q7CA 2KSEA 3VYIA 3H1IE 1PIXA 1S2EA 3RK3B 1PP9E 2YKOA 1RE3C 1JMMA 1BCCD 2FXPA 2WZ7A 3BATA 3ZDMA 2IYPA 2QSIA 4YXWH 1YQ4C 4LGDE 3A5TA 3D6ZA 4N6JA 2I1JA 3Q5PA 3HUSC 2NPSC 1W2EA 3NMDA 4H0LB 1Q90D 5AVRB 3PP5A 1M1KQ 3RK2C 5AW6B 3H1JE 3P32A 2FXMA 3VMYA 2DW3A 3KDPB 4NPFX 1GTWA 3M0AA 1NTMG 2J5UA 3P8CD 2W27A 4IL6X 1JM0A 4I2LC 3H1IG 1L4AA 2A06E 1R5LA 1PP9G 1GL2B 4DOJA 4XE5B 2QJYC 3L73E 1N73C 1RF1B 3QWOC 1KILD 1OX3A 2WSCJ 5CCGA 3T97B 1LP1B 2QVAA 3M9QA 1YHQP 3VMZA 3CXHD 3HE5B 3PRJA 1KYOE 3SWKA 5AW1B 2JWAA 3FXEA 2CK3H 3H1JG 1YQ3C 5AVXB 2KS1B 1JOCA 3VP8A 3CL3D 1LTIC 1YIJP 3AE3C 3CX5E 4GT1A 3FWLA 1YI2P 2ZT9D 3TSIA 2A06G 2FKWB 3M0DA 1QVFO 1FAVA 4L74A 1ZP0C 3WU2H 3L73G 2YKQA 1GZLA 4WB4A 1XTCC 5APTA 4IFMA 3H1HE 3H1KJ 2E75B 1KQSO 5CBNA 1SQBG 3CC7P 4D6TE 1SQVK 1LGHB 1RF0A 2RH0A 2KLUA 1T2KC 5KJ7C 1KZUB 1OXZA 4CPGA 3Q5RA 4WY4B 2PP6A 1NU1J 2C9LY 1T8ZA 2YMYA 1N7SC 2QIWA 2OGUA 2WWWA 2YO3A 3L4FA 1FZCA 2OYIC 1FC2C 1HTLC 1YITP 1NH4A 1SFCD 2J58A 1LTGC 1SVFA 3MHVA 1CI6A 2WSFH 4OVNF 2JWDA 1KYOI 2QM8A 3HUSB 2I1KA 2NPSB 3HD7A 3L75E 2QJPC 2E42A 3LW5J 3CWBJ 1PFIA 3H1HG 2XNXA 3RK2B 3A2AA 2AEJA 1IFIA 1SQQE 3CXHH 3MIWA 3O8ZA 4D6TG 4PV1C 3C1LA 3U59A 5AW9B 3G9RA 3OJAB 2JDIH 2PFXA 1S9KE 1D7MA 1L0NE 2OTLP 5APYA 3AEDC 1X8YA 1L0LK 1MUUA 3A3YB 5TISH 1KQLA 1IJDB 2WPQA 3AEEC 3H6PA 2QJYB 2FYUK 1S5LE 2HPCA 1N73B 2B9BA 2N1TA 2OTJP 1VQ9P 2YO2A 3CLQA 2Q6QA 2Y0EA 1HGZA 3L75G 1DD3A 3VMAA 2P10A 2A45G 1FZAA 3NFQA 3GHGC 3H1KD 1QVGO 4I7ZC 1GK4A 3HTKB 4PJ0H 2IPPA 1KB9I 1SQQG 3BASA 1IZNB 4TLFA 1GK6A 3RBZA 2Y9YA 2C9NY 4PD4D 2Z5HA 1NU1D 1URQA 4JYCA 1WT6A 3CPWO 1L0NG 2KLVA 4JF7A 3TGUJ 3U1CA 2AEFA 4OGQC 1EZVD 1GL2D 2FFDC 2KNCB 2O1JA 4BRYA 3WU2E 2QJKC 3S1KA 5KLVK 2BEQD 1GU5A 3GF3A 3EQ2A 1G2CA 4N78D 3E1RA 3MGNA 2A45I 1R5SA 5KAFH 4EYYQ 3AEGC 3CWBD 2M5AA 1IC2A 2OYHC 1VQ6P 2E76B 3RL0D 4L73A 5E79H 3PJSK 2K37A 1N7SB 3P8CE 4RO0A 4C46A 2QM7A 2E5YA 1KC8Q 1LTTC 2Q5UA 2QA4P 2AXCA 2P67A 3FX0A 1JY3N 3WMM0 2ZFCA 2XKMA 4H0LC 5AW5B 2B89A 1LNQA 3OAKA 1KILE 2QJPB 3AE1C 1L4AC 1PGOA 2NZ2A 3CMEP 1JEKA 1CW5A 3CXHE 1NJIQ 1BSNA 2FYZA 1EDLA 4PV1B 2M8RA 5GTIH 3II6A 1ZR4A 1QGKB 3CC2P 4XA4A 1RQVA 3B71A 5AVTB 5TISE 1VQ8P 3MZWB 5M1BA 1EDJA 4PD4H 3TGUD 1WMKA 1SQVJ 2H89C 5APWA 1SQXE 2WQYC 1NTZK 3N4XA 1YJWP 3GF7A 1PPJD 2NPSD 1RE4A 4PJ0E 1MV8A 3O6QA 3GHGB 4I7ZB 2WMMA 3RK2D 3H32B 2ZXEB 2KIKA 3CCQP 3SWFA 5TJHA 2PRRA 4Y28J 2UWJE 3F5HA 2LXCB 1SQBK 2R5BA 3KZIH 1NKNA 1AJYA 3V4QA 1GW3A 5AVVB 1TU3F 4OGQB 2WTYA 1RF0C 1OWAA 2FFDB 1LT9A 1U7JA 2QJKB 2H7HA 2IFNA 5KAFE 1SQXG 1KFMA 1L0LJ 1FZGA 1IFDA 1FZCC 1GU4A 2ZXXA 3CCEP 1EXJA 3OW2O 2FYUJ 3VN0A 5KTBA 5B5EH 1SFCA 3S9OA 2KOGA 3BRTB 1VF5C 1Q7YQ 1JTHA 1GW4A 4JQ0D 4EI2A 2BCCJ 5AW3B 3VTPC 1SQVD 2ZYDA 1VQLP 1GD2E 3HE4A 1X22A 1QEXA 3V5BA 1SQPE 2MJZA 1L4AB 2Z4EA 1JMBA 1QL1A 4TT3H 5KLVJ 2N1TC 1N7LA 1T2KD 1NKZB 5KJ7D 2H88C 1P84D 2KB7P 5EFWB 2GUSA 4B86A 1PGPA 1EQ7A 5APQA 4KHXA 3BVHA 3L72E 4PD4E 2BASA 1NU1E 3D71A 5K5GB 2XZRA 1S5LX 1LJ2A 1EZVE 2VRSA 1L0NK 3MP7B 4GKGA 5KAIH 4BWNA 5GTHH 1IFJA 3WUTA 1YBKA 2B87A 3W68A 4N78E 2W6AA 1SQPG 1L0LD 3VMXA 1VQNP 4LLHA 1NTMJ 1AQTA 2RN0A 1GL2A 4IFFA 2FYUD 3SFDC 3GLMA 2ZVNB 3H1IJ 5B66E 2JJLA 3KZIE 5H2FE 1KN7A 2YXQB 2NRGA 3L72G 1W2BO 4IOIH 1FZEA 2KXPB 1NU1G 3MD0A 5CCHD 3AE7C 2D2CB 2BCCD 3AE8C 4W7YA 1EZVG 3K5BA 1JY3O 1PZQA 4RKUJ 1U7MA 3JSVC 4UB6H 1K9MQ 3OA7A 4C7RA 3C8VA 5CBOA 1H0TA 1QX8A 2Q1KA 1LWUA 1VQOP 1FZCB 1YJ9P 3CCRP 1QL2A 2E43A 2E76C 1VQMP 1JY3P 1M90Q 5B5EE 5KLVD 1Q86Q 1J2JB 2K9YA 1NTZJ 2WPVB 4U7JA 3HD7B 4PD4I 4RJTA 4ASWA 1JO5A 2QRXA 1VF5B 3QH9A 3P8MC 1P84H 4H44C 1PV3A 1NAYA 1LTSC 1EC5A 2IZ0A 1Q81Q 2IBZD 1BGYJ 3AEFC 3AEBC 1N2DC 3L71J 1JY2N 1RY3A 3MUDA 4UB8H 1NTKK 3TGUE 1HJ0A 1UIIA 1SLQA 1SQBJ 2Z5IA 4L76A 1YTZI 3B5NA 1PPJE 2GM4A 5AW4B 2KP8A 3ITKA 3CX5I 2HPCB 1ZLLA 3PLNA 2N1TB 3L74J 4Z1MH 1G1IA 1MZ9A 3H1ID 3RK3D 1RE4C 2H8PD 4OH8B 2NPSA 4JPZB 2P58A 3D70A 1M1JC 1HWTC 1FJPA 2IDBA 4NPDA 2AXTH 4WVZA 5KAIE 1FZFA 3IN6A 3TGUG 5GTHE 1OIPA 2B88A 3H1LE 4HJGH 4JBZA 4EIJA 1J1EC 1ZV8A 4H0LD 1URQB 3CCMP 2HLOA 1L4AD 3IF4A 1ZMEC 4BRYB 4YXDC 1OVRA 1SQXK 1G2CB 2R44A 1NO4A 2ZJSE 4HKZH 4U3FJ 1NTZD 4ZKPA 2G3AA 4GOEA 3AE6C 2WSEH 2W8ZA 2M5AB 1E79H 3JCUH 3TK1A 1BCCE 2XNDH 5APSA 2IX7C 1BGYD 2E74C 2R3SA 3L71D 1NWQA 2HODA 3V6IA 1ZN5A 5KLIC 1AA0A 1SQVE 5CHXA 4C7NA 3H1LG 1PGJA 1SQBD 2C0XA 2PGDA 3C9IA 4GODA 1YYCA 3CD6P 1FDIA 1KYOD 3PHLA 2H43A 1FBMA 2ZAEB 2Q3EA 3RGUA 3LIEA 1Y8AA 1OVUA 2KZJA 1BSHA 2W6BA 2QE7H 1JCDA 1L0NJ 3L74D 1T3JA 1IK7A 2GUVA 1OW6A 1FDMA 2K1AA 1P84E 2RMZA 1NTMK 2R5DA 2P2UA 3NTNA 5APUA 4BXLA 4H44B 2WPSA 1K8AQ 1BCCG 1M8OB 4UB8E 3IFMA 1J1DC 1VQKP 3VP9A 3WUUA 1UIXA 5KJ7A 2E75D 2QEXP 1AVOA 1HBWA 1SQVG 4NPEA 5BVZA 2KI7B 1ZOYC 4N3YB 5CCGC 1OZHA 2R32A 4IFDK 3Q2YA 1L0LE 2WITA 1KILA 4WY4D 2OYIA 1KB9D 1FZBA 1SQPK 4ZKUA 4R4LA 2O01J 3UIAA 2JR8A 1MFZA 4LC1A 4U3FD 3P7KA 3CCSP 1VF5D 3MTUE 3O6QB 1HF9A 5DJUB 4O9BA 2JP3A 3SWYA 3CMAP 1X9VA 1K05A 1M1JB 3G71P 3ABVC 2AXTE 1FS0E 4H13C 1G1JA 2M3BA 2R3CA 3WUVA 1Q2NA 2K3RA 4QMAA 2FXOA 1J1EB 2BCCE 1LTBC 3M0DC 5AW2B 1XTGB 1JB0J 1SP4A 3TYYA 1RQUA 4WWIA 3V4WA 1NVOA 4K3AA 1KYOH 1S3JA 1L0LG 4W7ZA 5CCHA 3AE9C 1NTKJ 2N1TD 1LTJA 1P84I 1L0ND 2JKVA 1YJNP 2ZYGA 2OARA 3RL0C 5KLVE 2SPZA 3USSA 1LWUC 3AE2C 3G3ZA 2Q3IA 1ZR2A 3JCUE 3BCCJ 4R4MA 2D2CC 1KORA 2C0WA 4AYCA 1H89A 1NAFA 1VPCA 1JY2O 2E74B 2IBZE 3CXHI 5KLIB 2P1JA 2JO1A 1KFNA 2KYVA 2L91A 2LKMA 3TNUA 1PL5A 2O01N 3VOPA 1JTHB 1NYHA 2BCCG 3V2QA 2N9YB 3A0HH 5KKZC 3H25A 1JY2P 1RHZB 1EDIA 4M3LA 4L75A 3HD7C 5E79E 1VL2A 3HE4B 1IFPA 4HH2A 1A02J 1YTZT 1KD1Q 1IK9A 3L70J 1FE6A 4EDFA 2OYOA 4DJGA 2WT7A 5CMZA 2M3EA 5KLVG 1KB9H 3B5NC 4HYTB 3G6EP 3RK3E 1OW8A 3PH0A 1BE3J 1AVYA 1Y47A 2K9JA 1SQXJ 2I8DA 4AUWA 2OYHA 3B4SA 1J1DB 1DX7A 2J59M 3HRNA 1WRGA 2IBZG 1S1CX 1ZRTD 1L2PA 3H1KE 4EOTA 2A45H 5GTIE 2WSEJ 1S4XA 1FDOA 2E76D 3GG2A 4Y99C 3U1AA 1NTKD 1GMJA 1FOSF 3PTZA 1N7SD 1SQQK 1W5CE 2B87B 1AFOA 4IL6H 1NTZE 4H44D 3BCCD 1OW7A 1EXIA 2IBZI 5BU8B 1URQC 3Q3DA 4H13B 3I55P 5AW0B 4HB1A 2P7JA 1BDDA 2POHA 3KQGA 1DEEG 1S5LH 1BGYE 1FOSE 3L71E 2LXBA 2YNYA 3GMAA 3M9HA 1AV1A 3L36A 1S72P 1HGVA 3CWBE 2L5GB 1SQBE 3FXDA 4PV1D 3F89A 4OWFA 2KSJA 2WVRA 3H1KG 1KV4A 1RF1A 1Z56A 2HFED 1PP9J 3T97A 1LP1A 1GDTA 4KT0J 5AVYB 3CCJP 3L70D 3RL0B 3I5CA 1OFCX 1H0TB 3HE5A 1RH5B 2N9BA 3L74E 1CZQA 1LWUB 4WBAA 3M9BA 3LIDA 2O01H 1NTZG 1IFNA 2Y0DA 1BE3D 5AVUB 3M06A 1DEBA 1EDKA 2KS1A 1MKMA 1SQXD 2V4HA 1U57A 1SQPJ 3BRVB 3H1JJ 4XFJA 1AQ5A 4I6MC 1BGYG 3L71G 3A0HE 3AE4C 2HYNA 5AVWB 5KKZB 3CWBG 1CI6B 3A0BH 2XV5A 3AE5C 1X79B 1M56D 3L72J 3L73J 1KB9E 5APXA 2MKVA 2ZYAA 1EZVI 4OGQD 3B5NB 4AQRD 3L74G 4U3FE 2XU6A 3TDKA 2W90A 4YTPC 1KILC 4RESB 1SS1A 2KZIA 1OMIA 2HG5D 2E74D 2YKPA 1HUCA 5AW7B 4WY4A 3AEAC 2E5TA 3IAOA 4W80A 5CJ0A 2FYNC 1NTMD 1RE3A 3V2RA 3R4YA 4DT0A 3FWNA 1Q82Q 3NXSA 2V7QJ 4YPCA 4Y99B 1PP9D 4GDOA 3HUSA 3EFFK 2PAJA 1DIPA 4IL6E 2OQQA 2ZT9C 3V2PA 2FY8A 2W6JH 3SSUA 1QLED 4U3FG 2IYOA 3AECC 3H1HJ 5CCHC 1LTJC 3Q1MA 1SQPD 4D6TJ 3B8EB 2XDJA 3H1JD 1M57D 2CPBA 1LT9C 3IR9A 1PPJG 2M0BA 4ASVA 1KMIZ 4GIFA 2ZVOB 2G8YA 1FU1A 5CCGD 1HJBA 1N73A 2Y0CA 2HODB 2Q9IA 1ZW0A 1Y9BA 3I56P 2A06D 1NHLA 5AW8B 4C7NB 1ZXGA 3KHUA 3L72D 1KQFB 3L73D 3CCLP 1LT1A 3HTKA 2GA1A 1SFCC 4GOFA 3EWKA 4I1LA 3TF5A 1IO4A 3L75J 4UB6E 1VQPP 5BU5A 4H13D 4MN4C 2JEEA 3EFGA 1JUNA 1SQQJ 2LR2A 1ZRTE 3KPEA 2KNCA 4ZMDA 2WSCH 1IFMA 2KUBA 3A0BE 2YIUC 3G4SP 4ZNCA 3CX5D 3A7OA 2HR3A 2BEZF 3RK3C 3W67A 1NTKE 1X0TA 3M91A 1HVVA 1CSBA 3E7KA 2YMKA 1H8AA 2D2CD 1N8RQ 1JCCA 2Y9ZA 4DCKA 5AVSB 1KILB 5L8RJ 3H1LJ 2OYIB 3H1HD 3BCCE 1NGMB 1H88A 2WSSH 3CC4P 1M7LA 2CPSA 4D6TD 1N86A 1A02F 1N7SA 3CCUP 1NOHA 3E1IA 5AVQB 2FYNB 2O1KA 3S4RA 2KK7A 5APVA 3JC22 3L35A 1K04A 1FJKA 1OVVA 2FYUE 3HD7D 1JNMA 2QG4A 3CI9A 2W83C 1BCCJ 2ZT9B 1GL2C 3B5ND 1NTKG 3L70E 1KQGB 1PGQA 1T6AA 4DZOA 1RF1C 3L37A 2RKLA 2ITAA 1T3UA 3L75D 3KYQA 1LTJB 3N7NA 1BE3E 5DJTB 3BCCG 1NU1K 3RL0g 1E5WA 1SQQD 1LT9B 2O3JA 1VQ5P 5CJ4A 3FGAD 2OTKE 1R8EA 1S9KD 1K73Q 5AVZB 1BDCA 1VDFA 3LW5H 1M1JA 2FYUG 3TNUB 4KJMA 2IZ1A 3CX5H 5B66H 2V7QH 1DD4A 1USEA 3CCVP 2WSFJ 5H2FH 3GHGA 1HH0A 3L70G 2K88A 1SFCB 1KTMA 3H32A 1MFTA 3SFEC 2IFMA 1URQD 3GW6A 3H1LD 3R2PA 3V2NA 5C39A 1BE3G 2WT7B 2AEMA 1USDA 1VQ7P 2E75C 3Q5SA 1VQ4P 3MUDC 4K35A 2WPRA 2FBWC 3RBXA
chains in the Genus database with same CATH topology
2FFDA 1M1JC 3RL0B 1HWTC 3I5CA 1L4AC 3HE5A 2N9BA 2OYHB 1FJPA 1CZQA 1LWUB 4JYBA 1DH3A 1FZFA 1LTAC 4WBAA 4WY4C 3M9BA 1CW5A 2Q7CA 3LIDA 2O01H 4EIJA 1J1EC 1IFNA 1ZV8A 1URQB 2FYZA 5AVUB 3M06A 3VYIA 1DEBA 2HLOA 3RK3B 2YKOA 2M8RA 1L4AD 1RE3C 1JMMA 3BRVB 3II6A 1ZR4A 2WZ7A 3BATA 1AQ5A 4I6MC 1SQXK 4XA4A 5AVTB 1G2CB 4LGDE 3A5TA 1NO4A 4N6JA 2I1JA 2HYNA 5AVWB 3HUSC 2NPSC 1W2EA 4ZKPA 5APWA 1CI6B 3NMDA 2XV5A 2WSEH 5AVRB 3PP5A 1X79B 3RK2C 5AW6B 1NTZK 3N4XA 3TK1A 3P32A 2FXMA 3VMYA 3KDPB 5APSA 2IX7C 2NPSD 5APXA 1GTWA 1RE4A 3B5NB 1NWQA 4AQRD 3M0AA 1MV8A 2HODA 1ZN5A 3GHGB 2XU6A 3P8CD 3RK2D 2W27A 5CHXA 4C7NA 3H32B 1KILC 4RESB 2ZXEB 2C0XA 3C9IA 1YYCA 4I2LC 3SWFA 1L4AA 2H43A 2HG5D 1FBMA 2YKPA 1HUCA 1GL2B 4DOJA 5AW7B 4XE5B 4WY4A 1SQBK 3LIEA 4W80A 2R5BA 1NKNA 2W6BA 1N73C 1RF1B 5CJ0A 3V4QA 1KILD 1JCDA 1GW3A 5AVVB 5CCGA 1T3JA 1RE3A 3V2RA 2WTYA 1RF0C 3M9QA 2GUVA 1OWAA 2FFDB 1FDMA 1LT9A 3VMZA 3NXSA 3HE5B 2H7HA 1NTMK 2R5DA 2IFNA 2P2UA 3NTNA 5APUA 5AW1B 4Y99B 2WPSA 1KFMA 3HUSA 5AVXB 1FZGA 2PAJA 3IFMA 1IFDA 1J1DC 1JOCA 1FZCC 3V2PA 1GU4A 3VP9A 3VP8A 3CL3D 5KJ7A 1LTIC 1HBWA 5CCHC 4GT1A 5BVZA 3VN0A 5KTBA 1LTJC 4N3YB 1SFCA 3TSIA 2KOGA 2FKWB 5CCGC 3BRTB 3B8EB 3M0DA 2R32A 1FAVA 4IFDK 2XDJA 2WITA 2YKQA 1JTHA 1KILA 2CPBA 4WY4D 1LT9C 1GZLA 2OYIA 4WB4A 3IR9A 1FZBA 1GW4A 1SQPK 4ZKUA 1XTCC 4GIFA 3UIAA 1MFZA 5APTA 4IFMA 1FU1A 4LC1A 5CCGD 3P7KA 5AW3B 3VTPC 1HJBA 1N73A 1GD2E 3HE4A 2HODB 3MTUE 2Q9IA 4O9BA 1NHLA 5AW8B 3SWYA 4C7NB 1SQVK 3V5BA 1LGHB 1RF0A 1X9VA 1T2KC 1M1JB 5KJ7C 2MJZA 1G1JA 1L4AB 2M3BA 2R3CA 1KZUB 1OXZA 2Z4EA 4WY4B 1QL1A 3HTKA 2PP6A 2C9LY 1SFCC 4I1LA 1J1EB 1T8ZA 1LTBC 2YMYA 1IO4A 1N7SC 2N1TC 3M0DC 5AW2B 1N7LA 5BU5A 1T2KD 1NKZB 2WWWA 5KJ7D 1XTGB 2YO3A 1SP4A 3TYYA 3L4FA 1FZCA 2KB7P 3V4WA 2OYIC 1HTLC 2JEEA 3EFGA 1JUNA 2GUSA 4B86A 1NH4A 1SFCD 1EQ7A 2J58A 5APQA 4KHXA 1LTGC 1SVFA 3BVHA 4W7ZA 5CCHA 2N1TD 2BASA 1LTJA 1CI6A 2WSFH 3KPEA 2OARA 3RL0C 2QM8A 3HUSB 2I1KA 1IFMA 2NPSB 2WSCH 2XZRA 3HD7A 2E42A 1PFIA 1LWUC 3G3ZA 2Q3IA 2VRSA 1ZR2A 1L0NK 4GKGA 2XNXA 3A7OA 3RK2B 2C0WA 1IFJA 3A2AA 4AYCA 3MIWA 1IFIA 1H89A 3O8ZA 1NAFA 4N78E 3RK3C 1VPCA 2W6AA 3U59A 5AW9B 3VMXA 1JY2O 3OJAB 3M91A 1HVVA 1CSBA 4LLHA 1S9KE 2P1JA 1H8AA 1KFNA 2KYVA 3TNUA 2LKMA 5APYA 1JCCA 1X8YA 1L0LK 3VOPA 5AVSB 1GL2A 4IFFA 1JTHB 1KILB 1MUUA 2OYIB 3A3YB 3V2QA 1KQLA 1IJDB 1H88A 2JJLA 2WPQA 1M7LA 3H6PA 2CPSA 1JY2P 2FYUK 1N86A 4M3LA 1N73B 2HPCA 1A02F 3HD7C 1N7SA 2N1TA 3HE4B 1NOHA 4HH2A 1A02J 1YTZT 3E1IA 5AVQB 1IK9A 2O1KA 2YO2A 5APVA 1FZEA 3MD0A 2WT7A 5CCHD 3CLQA 5CMZA 1HGZA 3L35A 3B5NC 4HYTB 2A45G 1FJKA 4W7YA 3GHGC 1FZAA 3HD7D 3NFQA 1JY3O 1GK4A 3HTKB 1JNMA 3OA7A 4C7RA 2IPPA 3BASA 3CI9A 4AUWA 2OYHA 1J1DB 1LWUA 1GK6A 1DX7A 1GL2C 3B5ND 2J59M 3HRNA 1FZCB 1WRGA 2C9NY 1QL2A 2Z5HA 2E43A 4DZOA 1URQA 4JYCA 1RF1C 1WT6A 3L37A 2KLVA 1JY3P 1T3UA 4JF7A 1J2JB 3U1CA 3KYQA 1LTJB 3N7NA 1NU1K 1GL2D 2FFDC 4EOTA 2A45H 2O1JA 3HD7B 5KLVK 1GU5A 1JO5A 1E5WA 3EQ2A 3P8MC 1G2CA 4N78D 1LT9B 4Y99C 3U1AA 1LTSC 3MGNA 2A45I 1FOSF 5CJ4A 1N7SD 1SQQK 1S9KD 1AFOA 1N2DC 3MUDA 1JY2N 1RY3A 1NTKK 5AVZB 1VDFA 3LW5H 1IC2A 1M1JA 1SLQA 2OYHC 3TNUB 2Z5IA 5BU8B 1YTZI 1URQC 3B5NA 5AW0B 3RL0D 2P7JA 3GHGA 2GM4A 1HH0A 2POHA 3KQGA 5AW4B 1FOSE 2KP8A 1SFCB 3H32A 2YNYA 2HPCB 1ZLLA 2IFMA 3M9HA 1N7SB 2N1TB 3L36A 1G1IA 1MZ9A 3P8CE 1URQD 3V2NA 3R2PA 1HGVA 4C46A 2QM7A 2L5GB 1LTTC 2WT7B 3RK3D 2Q5UA 2KSJA 1RE4C 2P67A 1RF1A 2H8PD 1Z56A 2HFED 1JY3N 4OH8B 2NPSA 3WMM0 3T97A 2WPRA 2ZFCA 2XKMA 1GDTA 5AVYB 5AW5B 3OAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WWW A;  2WTY A;  2YO3 A;  1HWT C;  1SP4 A;  4AUW A;  1OWA A;  3I5C A;  3TYY A;  1GK6 A;  3V4W A;  3HE5 A;  2N9B A;  3VMZ A;  1CZQ A;  4JYB A;  1DH3 A;  3NXS A;  1JUN A;  3HE5 B;  2H7H A;  2C9N Y;  4B86 A;  3M9B A;  2R5D A;  2P2U A;  2Z5H A;  4KHX A;  3LID A;  5APQ A;  2Q7C A;  4DZO A;  2E43 A;  3NTN A;  5APU A;  4JYC A;  5AW1 B;  3L37 A;  2WPS A;  5AVU B;  3M06 A;  3VYI A;  2BAS A;  1CI6 A;  1J2J B;  5AVX B;  2QM8 A;  2XZR A;  4EOT A;  2E42 A;  1GU5 A;  1GU4 A;  2Q3I A;  2VRS A;  4GKG A;  4I6M C;  3P8M C;  3A7O A;  5AVT B;  1HBW A;  1G2C B;  3MGN A;  3A2A A;  4AYC A;  3A5T A;  4GT1 A;  3O8Z A;  1H89 A;  1FOS F;  3VN0 A;  1NAF A;  2W6A A;  5AVW B;  1S9K D;  5AW9 B;  3VMX A;  3M91 A;  5APW A;  1CI6 B;  3B8E B;  1CSB A;  3M0D A;  2R32 A;  5AVZ B;  1FAV A;  1S9K E;  3NMD A;  2XV5 A;  1H8A A;  3TNU A;  5AVR B;  1SLQ A;  5APY A;  1X8Y A;  3TNU B;  5AW6 B;  1GZL A;  5AVS B;  3TK1 A;  3IR9 A;  1MUU A;  2Z5I A;  3P32 A;  3A3Y B;  3VMY A;  1KQL A;  3KDP B;  5APS A;  3UIA A;  5APX A;  1MFZ A;  5APT A;  1H88 A;  2JJL A;  4LC1 A;  5AW0 B;  2WPQ A;  3P7K A;  1GTW A;  5AW3 B;  3VTP C;  2P7J A;  4AQR D;  1NWQ A;  3M0A A;  1HJB A;  1MV8 A;  3KQG A;  5AW4 B;  1FOS E;  1GD2 E;  2XU6 A;  2KP8 A;  3HE4 A;  4M3L A;  1A02 F;  2YNY A;  3HE4 B;  2W27 A;  4C7N A;  1A02 J;  3M9H A;  3L36 A;  5AVQ B;  5AW8 B;  4RES B;  2ZXE B;  4C7N B;  3V5B A;  1YYC A;  4I2L C;  3SWF A;  2YO2 A;  5APV A;  1T2K C;  4C46 A;  3MD0 A;  2WT7 A;  2QM7 A;  5CMZ A;  2WT7 B;  1HUC A;  2R3C A;  5AW7 B;  2Q5U A;  3L35 A;  4XE5 B;  1OXZ A;  3LIE A;  4HYT B;  3HTK A;  2P67 A;  2R5B A;  3NFQ A;  2C9L Y;  1GK4 A;  1JNM A;  3V4Q A;  3T97 A;  1IO4 A;  2WPR A;  2ZFC A;  5AVV B;  2IPP A;  5AW2 B;  5AVY B;  5AW5 B;  3OAK A;  1T2K D; 
#chains in the Genus database with same CATH topology
 2FFD A;  2YXR B;  2K9J B;  3D6Y A;  2YIU B;  3KXD A;  1NTM E;  2OYH B;  4A7P A;  4JYB A;  1DH3 A;  1LTA C;  4WY4 C;  2Q7C A;  2KSE A;  3VYI A;  3H1I E;  1PIX A;  1S2E A;  3RK3 B;  1PP9 E;  2YKO A;  1RE3 C;  1JMM A;  1BCC D;  2FXP A;  2WZ7 A;  3BAT A;  3ZDM A;  2IYP A;  2QSI A;  4YXW H;  1YQ4 C;  4LGD E;  3A5T A;  3D6Z A;  4N6J A;  2I1J A;  3Q5P A;  3HUS C;  2NPS C;  1W2E A;  3NMD A;  4H0L B;  1Q90 D;  5AVR B;  3PP5 A;  1M1K Q;  3RK2 C;  5AW6 B;  3H1J E;  3P32 A;  2FXM A;  3VMY A;  2DW3 A;  3KDP B;  4NPF X;  1GTW A;  3M0A A;  1NTM G;  2J5U A;  3P8C D;  2W27 A;  4IL6 X;  1JM0 A;  4I2L C;  3H1I G;  1L4A A;  2A06 E;  1R5L A;  1PP9 G;  1GL2 B;  4DOJ A;  4XE5 B;  2QJY C;  3L73 E;  1N73 C;  1RF1 B;  3QWO C;  1KIL D;  1OX3 A;  2WSC J;  5CCG A;  3T97 B;  1LP1 B;  2QVA A;  3M9Q A;  1YHQ P;  3VMZ A;  3CXH D;  3HE5 B;  3PRJ A;  1KYO E;  3SWK A;  5AW1 B;  2JWA A;  3FXE A;  2CK3 H;  3H1J G;  1YQ3 C;  5AVX B;  2KS1 B;  1JOC A;  3VP8 A;  3CL3 D;  1LTI C;  1YIJ P;  3AE3 C;  3CX5 E;  4GT1 A;  3FWL A;  1YI2 P;  2ZT9 D;  3TSI A;  2A06 G;  2FKW B;  3M0D A;  1QVF O;  1FAV A;  4L74 A;  1ZP0 C;  3WU2 H;  3L73 G;  2YKQ A;  1GZL A;  4WB4 A;  1XTC C;  5APT A;  4IFM A;  3H1H E;  3H1K J;  2E75 B;  1KQS O;  5CBN A;  1SQB G;  3CC7 P;  4D6T E;  1SQV K;  1LGH B;  1RF0 A;  2RH0 A;  2KLU A;  1T2K C;  5KJ7 C;  1KZU B;  1OXZ A;  4CPG A;  3Q5R A;  4WY4 B;  2PP6 A;  1NU1 J;  2C9L Y;  1T8Z A;  2YMY A;  1N7S C;  2QIW A;  2OGU A;  2WWW A;  2YO3 A;  3L4F A;  1FZC A;  2OYI C;  1FC2 C;  1HTL C;  1YIT P;  1NH4 A;  1SFC D;  2J58 A;  1LTG C;  1SVF A;  3MHV A;  1CI6 A;  2WSF H;  4OVN F;  2JWD A;  1KYO I;  2QM8 A;  3HUS B;  2I1K A;  2NPS B;  3HD7 A;  3L75 E;  2QJP C;  2E42 A;  3LW5 J;  3CWB J;  1PFI A;  3H1H G;  2XNX A;  3RK2 B;  3A2A A;  2AEJ A;  1IFI A;  1SQQ E;  3CXH H;  3MIW A;  3O8Z A;  4D6T G;  4PV1 C;  3C1L A;  3U59 A;  5AW9 B;  3G9R A;  3OJA B;  2JDI H;  2PFX A;  1S9K E;  1D7M A;  1L0N E;  2OTL P;  5APY A;  3AED C;  1X8Y A;  1L0L K;  1MUU A;  3A3Y B;  5TIS H;  1KQL A;  1IJD B;  2WPQ A;  3AEE C;  3H6P A;  2QJY B;  2FYU K;  1S5L E;  2HPC A;  1N73 B;  2B9B A;  2N1T A;  2OTJ P;  1VQ9 P;  2YO2 A;  3CLQ A;  2Q6Q A;  2Y0E A;  1HGZ A;  3L75 G;  1DD3 A;  3VMA A;  2P10 A;  2A45 G;  1FZA A;  3NFQ A;  3GHG C;  3H1K D;  1QVG O;  4I7Z C;  1GK4 A;  3HTK B;  4PJ0 H;  2IPP A;  1KB9 I;  1SQQ G;  3BAS A;  1IZN B;  4TLF A;  1GK6 A;  3RBZ A;  2Y9Y A;  2C9N Y;  4PD4 D;  2Z5H A;  1NU1 D;  1URQ A;  4JYC A;  1WT6 A;  3CPW O;  1L0N G;  2KLV A;  4JF7 A;  3TGU J;  3U1C A;  2AEF A;  4OGQ C;  1EZV D;  1GL2 D;  2FFD C;  2KNC B;  2O1J A;  4BRY A;  3WU2 E;  2QJK C;  3S1K A;  5KLV K;  2BEQ D;  1GU5 A;  3GF3 A;  3EQ2 A;  1G2C A;  4N78 D;  3E1R A;  3MGN A;  2A45 I;  1R5S A;  5KAF H;  4EYY Q;  3AEG C;  3CWB D;  2M5A A;  1IC2 A;  2OYH C;  1VQ6 P;  2E76 B;  3RL0 D;  4L73 A;  5E79 H;  3PJS K;  2K37 A;  1N7S B;  3P8C E;  4RO0 A;  4C46 A;  2QM7 A;  2E5Y A;  1KC8 Q;  1LTT C;  2Q5U A;  2QA4 P;  2AXC A;  2P67 A;  3FX0 A;  1JY3 N;  3WMM 0;  2ZFC A;  2XKM A;  4H0L C;  5AW5 B;  2B89 A;  1LNQ A;  3OAK A;  1KIL E;  2QJP B;  3AE1 C;  1L4A C;  1PGO A;  2NZ2 A;  3CME P;  1JEK A;  1CW5 A;  3CXH E;  1NJI Q;  1BSN A;  2FYZ A;  1EDL A;  4PV1 B;  2M8R A;  5GTI H;  3II6 A;  1ZR4 A;  1QGK B;  3CC2 P;  4XA4 A;  1RQV A;  3B71 A;  5AVT B;  5TIS E;  1VQ8 P;  3MZW B;  5M1B A;  1EDJ A;  4PD4 H;  3TGU D;  1WMK A;  1SQV J;  2H89 C;  5APW A;  1SQX E;  2WQY C;  1NTZ K;  3N4X A;  1YJW P;  3GF7 A;  1PPJ D;  2NPS D;  1RE4 A;  4PJ0 E;  1MV8 A;  3O6Q A;  3GHG B;  4I7Z B;  2WMM A;  3RK2 D;  3H32 B;  2ZXE B;  2KIK A;  3CCQ P;  3SWF A;  5TJH A;  2PRR A;  4Y28 J;  2UWJ E;  3F5H A;  2LXC B;  1SQB K;  2R5B A;  3KZI H;  1NKN A;  1AJY A;  3V4Q A;  1GW3 A;  5AVV B;  1TU3 F;  4OGQ B;  2WTY A;  1RF0 C;  1OWA A;  2FFD B;  1LT9 A;  1U7J A;  2QJK B;  2H7H A;  2IFN A;  5KAF E;  1SQX G;  1KFM A;  1L0L J;  1FZG A;  1IFD A;  1FZC C;  1GU4 A;  2ZXX A;  3CCE P;  1EXJ A;  3OW2 O;  2FYU J;  3VN0 A;  5KTB A;  5B5E H;  1SFC A;  3S9O A;  2KOG A;  3BRT B;  1VF5 C;  1Q7Y Q;  1JTH A;  1GW4 A;  4JQ0 D;  4EI2 A;  2BCC J;  5AW3 B;  3VTP C;  1SQV D;  2ZYD A;  1VQL P;  1GD2 E;  3HE4 A;  1X22 A;  1QEX A;  3V5B A;  1SQP E;  2MJZ A;  1L4A B;  2Z4E A;  1JMB A;  1QL1 A;  4TT3 H;  5KLV J;  2N1T C;  1N7L A;  1T2K D;  1NKZ B;  5KJ7 D;  2H88 C;  1P84 D;  2KB7 P;  5EFW B;  2GUS A;  4B86 A;  1PGP A;  1EQ7 A;  5APQ A;  4KHX A;  3BVH A;  3L72 E;  4PD4 E;  2BAS A;  1NU1 E;  3D71 A;  5K5G B;  2XZR A;  1S5L X;  1LJ2 A;  1EZV E;  2VRS A;  1L0N K;  3MP7 B;  4GKG A;  5KAI H;  4BWN A;  5GTH H;  1IFJ A;  3WUT A;  1YBK A;  2B87 A;  3W68 A;  4N78 E;  2W6A A;  1SQP G;  1L0L D;  3VMX A;  1VQN P;  4LLH A;  1NTM J;  1AQT A;  2RN0 A;  1GL2 A;  4IFF A;  2FYU D;  3SFD C;  3GLM A;  2ZVN B;  3H1I J;  5B66 E;  2JJL A;  3KZI E;  5H2F E;  1KN7 A;  2YXQ B;  2NRG A;  3L72 G;  1W2B O;  4IOI H;  1FZE A;  2KXP B;  1NU1 G;  3MD0 A;  5CCH D;  3AE7 C;  2D2C B;  2BCC D;  3AE8 C;  4W7Y A;  1EZV G;  3K5B A;  1JY3 O;  1PZQ A;  4RKU J;  1U7M A;  3JSV C;  4UB6 H;  1K9M Q;  3OA7 A;  4C7R A;  3C8V A;  5CBO A;  1H0T A;  1QX8 A;  2Q1K A;  1LWU A;  1VQO P;  1FZC B;  1YJ9 P;  3CCR P;  1QL2 A;  2E43 A;  2E76 C;  1VQM P;  1JY3 P;  1M90 Q;  5B5E E;  5KLV D;  1Q86 Q;  1J2J B;  2K9Y A;  1NTZ J;  2WPV B;  4U7J A;  3HD7 B;  4PD4 I;  4RJT A;  4ASW A;  1JO5 A;  2QRX A;  1VF5 B;  3QH9 A;  3P8M C;  1P84 H;  4H44 C;  1PV3 A;  1NAY A;  1LTS C;  1EC5 A;  2IZ0 A;  1Q81 Q;  2IBZ D;  1BGY J;  3AEF C;  3AEB C;  1N2D C;  3L71 J;  1JY2 N;  1RY3 A;  3MUD A;  4UB8 H;  1NTK K;  3TGU E;  1HJ0 A;  1UII A;  1SLQ A;  1SQB J;  2Z5I A;  4L76 A;  1YTZ I;  3B5N A;  1PPJ E;  2GM4 A;  5AW4 B;  2KP8 A;  3ITK A;  3CX5 I;  2HPC B;  1ZLL A;  3PLN A;  2N1T B;  3L74 J;  4Z1M H;  1G1I A;  1MZ9 A;  3H1I D;  3RK3 D;  1RE4 C;  2H8P D;  4OH8 B;  2NPS A;  4JPZ B;  2P58 A;  3D70 A;  1M1J C;  1HWT C;  1FJP A;  2IDB A;  4NPD A;  2AXT H;  4WVZ A;  5KAI E;  1FZF A;  3IN6 A;  3TGU G;  5GTH E;  1OIP A;  2B88 A;  3H1L E;  4HJG H;  4JBZ A;  4EIJ A;  1J1E C;  1ZV8 A;  4H0L D;  1URQ B;  3CCM P;  2HLO A;  1L4A D;  3IF4 A;  1ZME C;  4BRY B;  4YXD C;  1OVR A;  1SQX K;  1G2C B;  2R44 A;  1NO4 A;  2ZJS E;  4HKZ H;  4U3F J;  1NTZ D;  4ZKP A;  2G3A A;  4GOE A;  3AE6 C;  2WSE H;  2W8Z A;  2M5A B;  1E79 H;  3JCU H;  3TK1 A;  1BCC E;  2XND H;  5APS A;  2IX7 C;  1BGY D;  2E74 C;  2R3S A;  3L71 D;  1NWQ A;  2HOD A;  3V6I A;  1ZN5 A;  5KLI C;  1AA0 A;  1SQV E;  5CHX A;  4C7N A;  3H1L G;  1PGJ A;  1SQB D;  2C0X A;  2PGD A;  3C9I A;  4GOD A;  1YYC A;  3CD6 P;  1FDI A;  1KYO D;  3PHL A;  2H43 A;  1FBM A;  2ZAE B;  2Q3E A;  3RGU A;  3LIE A;  1Y8A A;  1OVU A;  2KZJ A;  1BSH A;  2W6B A;  2QE7 H;  1JCD A;  1L0N J;  3L74 D;  1T3J A;  1IK7 A;  2GUV A;  1OW6 A;  1FDM A;  2K1A A;  1P84 E;  2RMZ A;  1NTM K;  2R5D A;  2P2U A;  3NTN A;  5APU A;  4BXL A;  4H44 B;  2WPS A;  1K8A Q;  1BCC G;  1M8O B;  4UB8 E;  3IFM A;  1J1D C;  1VQK P;  3VP9 A;  3WUU A;  1UIX A;  5KJ7 A;  2E75 D;  2QEX P;  1AVO A;  1HBW A;  1SQV G;  4NPE A;  5BVZ A;  2KI7 B;  1ZOY C;  4N3Y B;  5CCG C;  1OZH A;  2R32 A;  4IFD K;  3Q2Y A;  1L0L E;  2WIT A;  1KIL A;  4WY4 D;  2OYI A;  1KB9 D;  1FZB A;  1SQP K;  4ZKU A;  4R4L A;  2O01 J;  3UIA A;  2JR8 A;  1MFZ A;  4LC1 A;  4U3F D;  3P7K A;  3CCS P;  1VF5 D;  3MTU E;  3O6Q B;  1HF9 A;  5DJU B;  4O9B A;  2JP3 A;  3SWY A;  3CMA P;  1X9V A;  1K05 A;  1M1J B;  3G71 P;  3ABV C;  2AXT E;  1FS0 E;  4H13 C;  1G1J A;  2M3B A;  2R3C A;  3WUV A;  1Q2N A;  2K3R A;  4QMA A;  2FXO A;  1J1E B;  2BCC E;  1LTB C;  3M0D C;  5AW2 B;  1XTG B;  1JB0 J;  1SP4 A;  3TYY A;  1RQU A;  4WWI A;  3V4W A;  1NVO A;  4K3A A;  1KYO H;  1S3J A;  1L0L G;  4W7Z A;  5CCH A;  3AE9 C;  1NTK J;  2N1T D;  1LTJ A;  1P84 I;  1L0N D;  2JKV A;  1YJN P;  2ZYG A;  2OAR A;  3RL0 C;  5KLV E;  2SPZ A;  3USS A;  1LWU C;  3AE2 C;  3G3Z A;  2Q3I A;  1ZR2 A;  3JCU E;  3BCC J;  4R4M A;  2D2C C;  1KOR A;  2C0W A;  4AYC A;  1H89 A;  1NAF A;  1VPC A;  1JY2 O;  2E74 B;  2IBZ E;  3CXH I;  5KLI B;  2P1J A;  2JO1 A;  1KFN A;  2KYV A;  2L91 A;  2LKM A;  3TNU A;  1PL5 A;  2O01 N;  3VOP A;  1JTH B;  1NYH A;  2BCC G;  3V2Q A;  2N9Y B;  3A0H H;  5KKZ C;  3H25 A;  1JY2 P;  1RHZ B;  1EDI A;  4M3L A;  4L75 A;  3HD7 C;  5E79 E;  1VL2 A;  3HE4 B;  1IFP A;  4HH2 A;  1A02 J;  1YTZ T;  1KD1 Q;  1IK9 A;  3L70 J;  1FE6 A;  4EDF A;  2OYO A;  4DJG A;  2WT7 A;  5CMZ A;  2M3E A;  5KLV G;  1KB9 H;  3B5N C;  4HYT B;  3G6E P;  3RK3 E;  1OW8 A;  3PH0 A;  1BE3 J;  1AVY A;  1Y47 A;  2K9J A;  1SQX J;  2I8D A;  4AUW A;  2OYH A;  3B4S A;  1J1D B;  1DX7 A;  2J59 M;  3HRN A;  1WRG A;  2IBZ G;  1S1C X;  1ZRT D;  1L2P A;  3H1K E;  4EOT A;  2A45 H;  5GTI E;  2WSE J;  1S4X A;  1FDO A;  2E76 D;  3GG2 A;  4Y99 C;  3U1A A;  1NTK D;  1GMJ A;  1FOS F;  3PTZ A;  1N7S D;  1SQQ K;  1W5C E;  2B87 B;  1AFO A;  4IL6 H;  1NTZ E;  4H44 D;  3BCC D;  1OW7 A;  1EXI A;  2IBZ I;  5BU8 B;  1URQ C;  3Q3D A;  4H13 B;  3I55 P;  5AW0 B;  4HB1 A;  2P7J A;  1BDD A;  2POH A;  3KQG A;  1DEE G;  1S5L H;  1BGY E;  1FOS E;  3L71 E;  2LXB A;  2YNY A;  3GMA A;  3M9H A;  1AV1 A;  3L36 A;  1S72 P;  1HGV A;  3CWB E;  2L5G B;  1SQB E;  3FXD A;  4PV1 D;  3F89 A;  4OWF A;  2KSJ A;  2WVR A;  3H1K G;  1KV4 A;  1RF1 A;  1Z56 A;  2HFE D;  1PP9 J;  3T97 A;  1LP1 A;  1GDT A;  4KT0 J;  5AVY B;  3CCJ P;  3L70 D;  3RL0 B;  3I5C A;  1OFC X;  1H0T B;  3HE5 A;  1RH5 B;  2N9B A;  3L74 E;  1CZQ A;  1LWU B;  4WBA A;  3M9B A;  3LID A;  2O01 H;  1NTZ G;  1IFN A;  2Y0D A;  1BE3 D;  5AVU B;  3M06 A;  1DEB A;  1EDK A;  2KS1 A;  1MKM A;  1SQX D;  2V4H A;  1U57 A;  1SQP J;  3BRV B;  3H1J J;  4XFJ A;  1AQ5 A;  4I6M C;  1BGY G;  3L71 G;  3A0H E;  3AE4 C;  2HYN A;  5AVW B;  5KKZ B;  3CWB G;  1CI6 B;  3A0B H;  2XV5 A;  3AE5 C;  1X79 B;  1M56 D;  3L72 J;  3L73 J;  1KB9 E;  5APX A;  2MKV A;  2ZYA A;  1EZV I;  4OGQ D;  3B5N B;  4AQR D;  3L74 G;  4U3F E;  2XU6 A;  3TDK A;  2W90 A;  4YTP C;  1KIL C;  4RES B;  1SS1 A;  2KZI A;  1OMI A;  2HG5 D;  2E74 D;  2YKP A;  1HUC A;  5AW7 B;  4WY4 A;  3AEA C;  2E5T A;  3IAO A;  4W80 A;  5CJ0 A;  2FYN C;  1NTM D;  1RE3 A;  3V2R A;  3R4Y A;  4DT0 A;  3FWN A;  1Q82 Q;  3NXS A;  2V7Q J;  4YPC A;  4Y99 B;  1PP9 D;  4GDO A;  3HUS A;  3EFF K;  2PAJ A;  1DIP A;  4IL6 E;  2OQQ A;  2ZT9 C;  3V2P A;  2FY8 A;  2W6J H;  3SSU A;  1QLE D;  4U3F G;  2IYO A;  3AEC C;  3H1H J;  5CCH C;  1LTJ C;  3Q1M A;  1SQP D;  4D6T J;  3B8E B;  2XDJ A;  3H1J D;  1M57 D;  2CPB A;  1LT9 C;  3IR9 A;  1PPJ G;  2M0B A;  4ASV A;  1KMI Z;  4GIF A;  2ZVO B;  2G8Y A;  1FU1 A;  5CCG D;  1HJB A;  1N73 A;  2Y0C A;  2HOD B;  2Q9I A;  1ZW0 A;  1Y9B A;  3I56 P;  2A06 D;  1NHL A;  5AW8 B;  4C7N B;  1ZXG A;  3KHU A;  3L72 D;  1KQF B;  3L73 D;  3CCL P;  1LT1 A;  3HTK A;  2GA1 A;  1SFC C;  4GOF A;  3EWK A;  4I1L A;  3TF5 A;  1IO4 A;  3L75 J;  4UB6 E;  1VQP P;  5BU5 A;  4H13 D;  4MN4 C;  2JEE A;  3EFG A;  1JUN A;  1SQQ J;  2LR2 A;  1ZRT E;  3KPE A;  2KNC A;  4ZMD A;  2WSC H;  1IFM A;  2KUB A;  3A0B E;  2YIU C;  3G4S P;  4ZNC A;  3CX5 D;  3A7O A;  2HR3 A;  2BEZ F;  3RK3 C;  3W67 A;  1NTK E;  1X0T A;  3M91 A;  1HVV A;  1CSB A;  3E7K A;  2YMK A;  1H8A A;  2D2C D;  1N8R Q;  1JCC A;  2Y9Z A;  4DCK A;  5AVS B;  1KIL B;  5L8R J;  3H1L J;  2OYI B;  3H1H D;  3BCC E;  1NGM B;  1H88 A;  2WSS H;  3CC4 P;  1M7L A;  2CPS A;  4D6T D;  1N86 A;  1A02 F;  1N7S A;  3CCU P;  1NOH A;  3E1I A;  5AVQ B;  2FYN B;  2O1K A;  3S4R A;  2KK7 A;  5APV A;  3JC2 2;  3L35 A;  1K04 A;  1FJK A;  1OVV A;  2FYU E;  3HD7 D;  1JNM A;  2QG4 A;  3CI9 A;  2W83 C;  1BCC J;  2ZT9 B;  1GL2 C;  3B5N D;  1NTK G;  3L70 E;  1KQG B;  1PGQ A;  1T6A A;  4DZO A;  1RF1 C;  3L37 A;  2RKL A;  2ITA A;  1T3U A;  3L75 D;  3KYQ A;  1LTJ B;  3N7N A;  1BE3 E;  5DJT B;  3BCC G;  1NU1 K;  3RL0 g;  1E5W A;  1SQQ D;  1LT9 B;  2O3J A;  1VQ5 P;  5CJ4 A;  3FGA D;  2OTK E;  1R8E A;  1S9K D;  1K73 Q;  5AVZ B;  1BDC A;  1VDF A;  3LW5 H;  1M1J A;  2FYU G;  3TNU B;  4KJM A;  2IZ1 A;  3CX5 H;  5B66 H;  2V7Q H;  1DD4 A;  1USE A;  3CCV P;  2WSF J;  5H2F H;  3GHG A;  1HH0 A;  3L70 G;  2K88 A;  1SFC B;  1KTM A;  3H32 A;  1MFT A;  3SFE C;  2IFM A;  1URQ D;  3GW6 A;  3H1L D;  3R2P A;  3V2N A;  5C39 A;  1BE3 G;  2WT7 B;  2AEM A;  1USD A;  1VQ7 P;  2E75 C;  3Q5S A;  1VQ4 P;  3MUD C;  4K35 A;  2WPR A;  2FBW C;  3RBX A; 
#chains in the Genus database with same CATH homology
 2FFD A;  1M1J C;  3RL0 B;  1HWT C;  3I5C A;  1L4A C;  3HE5 A;  2N9B A;  2OYH B;  1FJP A;  1CZQ A;  1LWU B;  4JYB A;  1DH3 A;  1FZF A;  1LTA C;  4WBA A;  4WY4 C;  3M9B A;  1CW5 A;  2Q7C A;  3LID A;  2O01 H;  4EIJ A;  1J1E C;  1IFN A;  1ZV8 A;  1URQ B;  2FYZ A;  5AVU B;  3M06 A;  3VYI A;  1DEB A;  2HLO A;  3RK3 B;  2YKO A;  2M8R A;  1L4A D;  1RE3 C;  1JMM A;  3BRV B;  3II6 A;  1ZR4 A;  2WZ7 A;  3BAT A;  1AQ5 A;  4I6M C;  1SQX K;  4XA4 A;  5AVT B;  1G2C B;  4LGD E;  3A5T A;  1NO4 A;  4N6J A;  2I1J A;  2HYN A;  5AVW B;  3HUS C;  2NPS C;  1W2E A;  4ZKP A;  5APW A;  1CI6 B;  3NMD A;  2XV5 A;  2WSE H;  5AVR B;  3PP5 A;  1X79 B;  3RK2 C;  5AW6 B;  1NTZ K;  3N4X A;  3TK1 A;  3P32 A;  2FXM A;  3VMY A;  3KDP B;  5APS A;  2IX7 C;  2NPS D;  5APX A;  1GTW A;  1RE4 A;  3B5N B;  1NWQ A;  4AQR D;  3M0A A;  1MV8 A;  2HOD A;  1ZN5 A;  3GHG B;  2XU6 A;  3P8C D;  3RK2 D;  2W27 A;  5CHX A;  4C7N A;  3H32 B;  1KIL C;  4RES B;  2ZXE B;  2C0X A;  3C9I A;  1YYC A;  4I2L C;  3SWF A;  1L4A A;  2H43 A;  2HG5 D;  1FBM A;  2YKP A;  1HUC A;  1GL2 B;  4DOJ A;  5AW7 B;  4XE5 B;  4WY4 A;  1SQB K;  3LIE A;  4W80 A;  2R5B A;  1NKN A;  2W6B A;  1N73 C;  1RF1 B;  5CJ0 A;  3V4Q A;  1KIL D;  1JCD A;  1GW3 A;  5AVV B;  5CCG A;  1T3J A;  1RE3 A;  3V2R A;  2WTY A;  1RF0 C;  3M9Q A;  2GUV A;  1OWA A;  2FFD B;  1FDM A;  1LT9 A;  3VMZ A;  3NXS A;  3HE5 B;  2H7H A;  1NTM K;  2R5D A;  2IFN A;  2P2U A;  3NTN A;  5APU A;  5AW1 B;  4Y99 B;  2WPS A;  1KFM A;  3HUS A;  5AVX B;  1FZG A;  2PAJ A;  3IFM A;  1IFD A;  1J1D C;  1JOC A;  1FZC C;  3V2P A;  1GU4 A;  3VP9 A;  3VP8 A;  3CL3 D;  5KJ7 A;  1LTI C;  1HBW A;  5CCH C;  4GT1 A;  5BVZ A;  3VN0 A;  5KTB A;  1LTJ C;  4N3Y B;  1SFC A;  3TSI A;  2KOG A;  2FKW B;  5CCG C;  3BRT B;  3B8E B;  3M0D A;  2R32 A;  1FAV A;  4IFD K;  2XDJ A;  2WIT A;  2YKQ A;  1JTH A;  1KIL A;  2CPB A;  4WY4 D;  1LT9 C;  1GZL A;  2OYI A;  4WB4 A;  3IR9 A;  1FZB A;  1GW4 A;  1SQP K;  4ZKU A;  1XTC C;  4GIF A;  3UIA A;  1MFZ A;  5APT A;  4IFM A;  1FU1 A;  4LC1 A;  5CCG D;  3P7K A;  5AW3 B;  3VTP C;  1HJB A;  1N73 A;  1GD2 E;  3HE4 A;  2HOD B;  3MTU E;  2Q9I A;  4O9B A;  1NHL A;  5AW8 B;  3SWY A;  4C7N B;  1SQV K;  3V5B A;  1LGH B;  1RF0 A;  1X9V A;  1T2K C;  1M1J B;  5KJ7 C;  2MJZ A;  1G1J A;  1L4A B;  2M3B A;  2R3C A;  1KZU B;  1OXZ A;  2Z4E A;  4WY4 B;  1QL1 A;  3HTK A;  2PP6 A;  2C9L Y;  1SFC C;  4I1L A;  1J1E B;  1T8Z A;  1LTB C;  2YMY A;  1IO4 A;  1N7S C;  2N1T C;  3M0D C;  5AW2 B;  1N7L A;  5BU5 A;  1T2K D;  1NKZ B;  2WWW A;  5KJ7 D;  1XTG B;  2YO3 A;  1SP4 A;  3TYY A;  3L4F A;  1FZC A;  2KB7 P;  3V4W A;  2OYI C;  1HTL C;  2JEE A;  3EFG A;  1JUN A;  2GUS A;  4B86 A;  1NH4 A;  1SFC D;  1EQ7 A;  2J58 A;  5APQ A;  4KHX A;  1LTG C;  1SVF A;  3BVH A;  4W7Z A;  5CCH A;  2N1T D;  2BAS A;  1LTJ A;  1CI6 A;  2WSF H;  3KPE A;  2OAR A;  3RL0 C;  2QM8 A;  3HUS B;  2I1K A;  1IFM A;  2NPS B;  2WSC H;  2XZR A;  3HD7 A;  2E42 A;  1PFI A;  1LWU C;  3G3Z A;  2Q3I A;  2VRS A;  1ZR2 A;  1L0N K;  4GKG A;  2XNX A;  3A7O A;  3RK2 B;  2C0W A;  1IFJ A;  3A2A A;  4AYC A;  3MIW A;  1IFI A;  1H89 A;  3O8Z A;  1NAF A;  4N78 E;  3RK3 C;  1VPC A;  2W6A A;  3U59 A;  5AW9 B;  3VMX A;  1JY2 O;  3OJA B;  3M91 A;  1HVV A;  1CSB A;  4LLH A;  1S9K E;  2P1J A;  1H8A A;  1KFN A;  2KYV A;  3TNU A;  2LKM A;  5APY A;  1JCC A;  1X8Y A;  1L0L K;  3VOP A;  5AVS B;  1GL2 A;  4IFF A;  1JTH B;  1KIL B;  1MUU A;  2OYI B;  3A3Y B;  3V2Q A;  1KQL A;  1IJD B;  1H88 A;  2JJL A;  2WPQ A;  1M7L A;  3H6P A;  2CPS A;  1JY2 P;  2FYU K;  1N86 A;  4M3L A;  1N73 B;  2HPC A;  1A02 F;  3HD7 C;  1N7S A;  2N1T A;  3HE4 B;  1NOH A;  4HH2 A;  1A02 J;  1YTZ T;  3E1I A;  5AVQ B;  1IK9 A;  2O1K A;  2YO2 A;  5APV A;  1FZE A;  3MD0 A;  2WT7 A;  5CCH D;  3CLQ A;  5CMZ A;  1HGZ A;  3L35 A;  3B5N C;  4HYT B;  2A45 G;  1FJK A;  4W7Y A;  3GHG C;  1FZA A;  3HD7 D;  3NFQ A;  1JY3 O;  1GK4 A;  3HTK B;  1JNM A;  3OA7 A;  4C7R A;  2IPP A;  3BAS A;  3CI9 A;  4AUW A;  2OYH A;  1J1D B;  1LWU A;  1GK6 A;  1DX7 A;  1GL2 C;  3B5N D;  2J59 M;  3HRN A;  1FZC B;  1WRG A;  2C9N Y;  1QL2 A;  2Z5H A;  2E43 A;  4DZO A;  1URQ A;  4JYC A;  1RF1 C;  1WT6 A;  3L37 A;  2KLV A;  1JY3 P;  1T3U A;  4JF7 A;  1J2J B;  3U1C A;  3KYQ A;  1LTJ B;  3N7N A;  1NU1 K;  1GL2 D;  2FFD C;  4EOT A;  2A45 H;  2O1J A;  3HD7 B;  5KLV K;  1GU5 A;  1JO5 A;  1E5W A;  3EQ2 A;  3P8M C;  1G2C A;  4N78 D;  1LT9 B;  4Y99 C;  3U1A A;  1LTS C;  3MGN A;  2A45 I;  1FOS F;  5CJ4 A;  1N7S D;  1SQQ K;  1S9K D;  1AFO A;  1N2D C;  3MUD A;  1JY2 N;  1RY3 A;  1NTK K;  5AVZ B;  1VDF A;  3LW5 H;  1IC2 A;  1M1J A;  1SLQ A;  2OYH C;  3TNU B;  2Z5I A;  5BU8 B;  1YTZ I;  1URQ C;  3B5N A;  5AW0 B;  3RL0 D;  2P7J A;  3GHG A;  2GM4 A;  1HH0 A;  2POH A;  3KQG A;  5AW4 B;  1FOS E;  2KP8 A;  1SFC B;  3H32 A;  2YNY A;  2HPC B;  1ZLL A;  2IFM A;  3M9H A;  1N7S B;  2N1T B;  3L36 A;  1G1I A;  1MZ9 A;  3P8C E;  1URQ D;  3V2N A;  3R2P A;  1HGV A;  4C46 A;  2QM7 A;  2L5G B;  1LTT C;  2WT7 B;  3RK3 D;  2Q5U A;  2KSJ A;  1RE4 C;  2P67 A;  1RF1 A;  2H8P D;  1Z56 A;  2HFE D;  1JY3 N;  4OH8 B;  2NPS A;  3WMM 0;  3T97 A;  2WPR A;  2ZFC A;  2XKM A;  1GDT A;  5AVY B;  5AW5 B;  3OAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...