1JTHB

Crystal structure and biophysical properties of a complex between the n-terminal region of snap25 and the snare region of syntaxin 1a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
67
structure length
67
Chain Sequence
b'ALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SNAP25
publication title Crystal structure and biophysical properties of a complex between the N-terminal SNARE region of SNAP25 and syntaxin 1a.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 33
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jthB00
1KILA 2KOGA 4WY4B 3P8CE 4W80A 2N1TD 3RK3D 5KJ7D 1SFCD 1L4AD 1KILD 2N1TA 5CCHD 3M0DC 1GL2C 3TSIA 4WY4A 5CCGC 5CCHA 3RL0C 3PP5A 3RK2B 1NHLA 4W7ZA 1GL2B 2YMYA 2WZ7A 2M8RA 3RL0B 4N78E 4LGDE 2NPSB 1JTHB 1URQC 4WY4D 4OH8B 3B5NB 3RK2C 3HTKB 1XTGB 1GL2D 1URQB 5CCGD 2XDJA 3HD7C 3RK3C 1N7SC 2NPSC 1GL2A 2PP6A 1L4AC 5CCGA 3HD7B 3RK3B 3B5NC 1N7SB 2NPSA 1JTHA 1SFCB 2HG5D 1L4AB 1KILB 3B5NA 2H8PD 3RK2D 1URQA 1T3JA 2N1TC 3HD7D 3RL0D 2HFED 4JF7A 5KJ7C 1N7SD 2NPSD 1SFCC 4W7YA 3KYQA 3VOPA 1KILC 3HD7A 2N1TB 4WY4C 5CCHC 1N7SA 3B5ND 5KJ7A 1SFCA 1HVVA 1L4AA 1URQD
chains in the Genus database with same CATH superfamily
1S2EA 1BE3D 1ZW0A 3A0BE 4H13D 1M57D 1D7MA 3H1JD 2SPZA 4PV1B 2A06D 1VL2A 3D71A 3G71P 3H1IG 1VPCA 4GOEA 2K88A 5AW6B 5CCGC 2E74D 3KZIH 2YMYA 2WZ7A 1PGQA 3GHGA 1QX8A 1RE4A 3A5TA 4ASWA 2WSFJ 3PRJA 1RE3A 5H2FE 3CX5E 4WB4A 1VDFA 2ZVOB 3H1KD 2OTKE 3T97B 1S72P 4PD4H 2OTJP 1BE3G 4H13C 4D6TE 1N7SD 2XV5A 2H7HA 3VOPA 2YKQA 1JY2O 2C0XA 3HE5B 1VF5B 4KHXA 4ZKPA 2FFDA 3H1JG 3JCUH 2A06G 3Q1MA 3K5BA 3USSA 1E79H 1PGPA 2E74C 1SQPD 1PL5A 1LNQA 2CK3H 5APTA 5AW0B 2HLOA 2IFNA 2KSJA 1RQVA 1KYOD 1N7LA 3AEDC 3Q2YA 2WSSH 1L0NE 1NU1K 2YXQB 3D6ZA 3VMAA 3AE2C 1KC8Q 4N78E 4LGDE 1RF0A 1JEKA 3L72J 2OARA 3B5NB 2PFXA 2V7QH 3H1KG 3V4WA 1RF1C 2N9YB 1KD1Q 1N7SC 1HF9A 2K1AA 2D2CD 2J58A 1KORA 3HD7B 1XTCC 1NH4A 4YTPC 2CPBA 1FU1A 4N3YB 1Q81Q 5TISE 3SWFA 4HKZH 1BGYE 2MJZA 1WMKA 1SQPG 5CHXA 3S9OA 1HJBA 1X0TA 4YXWH 2YXRB 3PJSK 5AVRB 2HPCB 5KJ7A 3H1HE 3IF4A 1K9MQ 3L75E 2KB7P 3BRVB 3MUDC 4WY4B 5AW7B 3L70D 2YNYA 2E43A 3EQ2A 1RE4C 5B5EH 1LT1A 2ZVNB 2JR8A 1YJ9P 2Q1KA 1ZXGA 2Y9ZA 1VQ6P 3M9BA 1H89A 4MN4C 5KLVD 3M0AA 2BASA 3VMXA 2V4HA 1AFOA 4BWNA 2HODB 4IFDK 3G9RA 1Y47A 1HBWA 1DIPA 2D2CC 4D6TD 2B88A 1KQSO 1Q90D 1FC2C 1Y8AA 3EFFK 1NTKK 2QA4P 1N8RQ 2FFDC 3KPEA 5KAFH 3C9IA 3ITKA 5CBOA 1EC5A 1KFNA 1NAFA 2KNCA 2W6AA 3RK3B 1KV4A 2IBZD 1PPJE 2KK7A 2KP8A 4PJ0H 4B86A 4UB6H 2QVAA 1AVYA 4L74A 1W2BO 1MKMA 3L70G 4AYCA 1HJ0A 4WVZA 2NPSD 4GDOA 3A0HH 1AV1A 3NFQA 1P84I 3MD0A 1U7JA 5KAIE 4N78D 1L0LE 1KB9I 1G1JA 1LTBC 5KLIB 1ZMEC 5KLVG 3CC4P 2CPSA 3FXEA 1KQGB 1LP1B 1U7MA 1X22A 1RF0C 2W27A 1TU3F 1NKNA 3H25A 2WTYA 2E75B 3CWBE 5CMZA 2WSFH 2Y0EA 3U59A 3U1AA 4D6TG 1KN7A 3BCCE 3VN0A 4DJGA 2YMKA 2Q9IA 1NYHA 5BU8B 3L74E 1BGYD 1YJWP 3CCSP 4D6TJ 1PIXA 3M91A 5AVVB 4OH8B 2GM4A 2IBZG 2LXBA 4L75A 4EOTA 3H1HD 1JY2P 4EYYQ 1VQ7P 1ZR2A 3L75D 2IYOA 1L0LK 5GTIE 2NPSC 2ZFCA 1YBKA 2WVRA 1FZGA 2B87B 1L0NG 4H13B 4GKGA 3SWKA 3E1RA 5KTBA 1A02F 1DEEG 3SFEC 1SQXK 2JWAA 1N86A 2KI7B 2ITAA 3AEBC 3N7NA 5BVZA 1X8YA 4O9BA 2KS1B 1L0NJ 5APUA 1W5CE 3QWOC 1KMIZ 3CX5I 2P58A 3MGNA 3O6QB 3B71A 1R5LA 3V2NA 3CCJP 1KILA 1M90Q 2GA1A 3AE5C 1MV8A 2C9LY 2Y9YA 3GW6A 1LWUA 3HUSB 3AE3C 5AW4B 1BCCE 2KSEA 2NRGA 1BGYG 1CI6A 2FY8A 3EWKA 4ASVA 1IO4A 1PPJD 1JY3N 1LT9C 2HR3A 1EZVE 1L2PA 1CZQA 4I6MC 3BVHA 3HRNA 3P8MC 3H1HG 2R44A 4C7RA 1BGYJ 3L75G 2QIWA 1RF1B 3BRTB 1QL1A 1QVFO 2K9YA 1GW4A 1VQ5P 1USEA 3L37A 5M1BA 3PH0A 2GUSA 2ZAEB 3H1HJ 2R3SA 3V4QA 1EDJA 3SSUA 1MZ9A 1VQLP 2O01H 2M5AB 5AW1B 2H89C 2E76D 1EDLA 1JTHA 1JCCA 1GU4A 3KHUA 2HYNA 2QG4A 5DJTB 1URQA 1WRGA 1KFMA 2Z5HA 5AW8B 1S5LH 3L74D 1FOSF 3AECC 4NPDA 3WU2E 1P84E 2QE7H 1QGKB 4BRYB 2KUBA 2YO2A 1KB9E 1PPJG 2VRSA 2K3RA 4YPCA 1G1IA 4N6JA 2AXTE 2RN0A 2UWJE 1K73Q 5APWA 1IFJA 2D2CB 1JM0A 4Y28J 5TJHA 1ZRTE 2OYIC 3UIAA 1PGJA 1JB0J 1VQ4P 3RL0C 1VQMP 2WSEJ 3HE4B 1E5WA 2E76C 1T8ZA 5AW5B 2QSIA 1K04A 2OYHA 1J1DB 5EFWB 1L0LJ 1SQQE 3CWBG 2P1JA 1FBMA 3TK1A 4GODA 2NZ2A 3VMZA 2Y0CA 3BCCG 1FZCC 1SQXJ 2ZJSE 2XU6A 1NWQA 4GT1A 4XFJA 3M06A 3CWBJ 3CCEP 3L74G 5AW9B 1PP9E 3L72D 3VMYA 5GTHH 3BCCJ 1FZEA 2Y0DA 5H2FH 1PGOA 2JP3A 1T3JA 1NGMB 3GMAA 3KQGA 3L74J 3A7OA 1IC2A 4L73A 3M9QA 2L91A 1NU1E 4JYCA 1SFCA 1L4AA 1IFNA 3CI9A 2AXCA 3A3YB 1JY3O 2FYUK 5L8RJ 1SQQK 1MUUA 2YKOA 1EDIA 2K9JA 4U3FE 3AEAC 3H32B 1SQBE 3MHVA 1NKZB 1J2JB 2O3JA 5CCHA 1GK4A 3GG2A 2XZRA 1GL2B 1OFCX 2M8RA 2NPSB 1URQC 3L4FA 3IN6A 1LTJC 2A45I 3CXHI 1P84D 3L72G 3Q5SA 3IR9A 1KB9D 3M0DA 3IAOA 2ZYDA 1S5LX 2O01N 1BCCJ 1ZV8A 1VQ8P 3G3ZA 5CJ0A 1VQNP 3LW5H 4RO0A 4BXLA 2W83C 2FYNB 3B4SA 2H8PD 3RK2D 1YITP 5B66E 1NTZE 1N73B 1IFDA 1DX7A 1SQBK 3D6YA 3TGUJ 4JF7A 2FXMA 2N1TB 5TISH 4EI2A 5AVXB 3T97A 2M3EA 1HGVA 2QJYC 3F5HA 1LT9B 1SQVK 4H0LB 2QJKC 1SLQA 1GMJA 2JO1A 2YIUC 2JJLA 4UB8E 3NXSA 1NTKE 3HE5A 1AVOA 5CCHD 1W2EA 1S4XA 1PP9D 1K05A 1S9KE 1VQOP 3GHGC 3I56P 5BU5A 1DD4A 1NTZK 1FDOA 2WSCH 3C1LA 1GTWA 3CX5D 3TF5A 1EZVI 3RK2C 1NU1D 3HTKB 1RE3C 1EXJA 2C9NY 1LTIC 1NTMK 1H0TA 2XDJA 1DEBA 3AEFC 1FDMA 5AW3B 1L4AC 1ZP0C 2HG5D 1SVFA 4KJMA 3C8VA 4U3FD 4ZMDA 3B5NA 5APXA 1Q86Q 5E79E 2C0WA 1M1JB 3OJAB 3RGUA 3KYQA 3HD7A 1NO4A 5CCHC 1IFMA 2P7JA 2WSEH 3CCUP 4IL6H 4PV1C 1HWTC 1SQQJ 1PP9G 3FXDA 3FWLA 5KAIH 2H43A 1L0ND 1EQ7A 1YQ3C 2OYIB 4H44D 4OVNF 5KJ7D 2FKWB 1X79B 2Q3IA 5KAFE 2OYOA 2HPCA 4I7ZC 1RHZB 4LLHA 2FYZA 1IFIA 2E76B 1R8EA 2H88C 3M0DC 1IK9A 1GD2E 1PP9J 2I1JA 3JC22 4WY4A 3RK3E 4PJ0E 4UB6E 3BATA 2W6BA 1NU1G 3PP5A 1KYOI 2K37A 1SQXE 3H1LE 2P10A 1FZCB 1FDIA 2QRXA 3OA7A 2WWWA 1NU1J 1Y9BA 2HODA 3CXHE 3NTNA 4RESB 4U3FG 4DCKA 3H1IE 1KILE 4JBZA 4GOFA 2WT7B 1PZQA 3VTPC 3RBZA 4IOIH 4U3FJ 1NTKD 1H88A 1IZNB 1OVUA 1SQBJ 3VYIA 1ZOYC 2RH0A 3CD6P 3HD7D 3OAKA 4H44C 2ZYGA 5KJ7C 5AVYB 1S9KD 4Z1MH 1MFTA 2W6JH 1OX3A 3GF3A 5APVA 2W8ZA 3FGAD 1SQVJ 3H6PA 3JSVC 2IX7C 2E74B 3TNUB 4C7NB 1YHQP 1BE3E 1K8AQ 2WMMA 3S1KA 1G2CB 2E5YA 4DZOA 3H1JE 1LP1A 1LTJB 3L71J 3SFDC 1NTZJ 2R5DA 1OVRA 2IZ1A 2WPSA 3W68A 4HH2A 1NTKG 4PD4I 3HD7C 3TGUE 1AQ5A 3TYYA 1HH0A 1UIXA 1S1CX 2FXOA 1N7SB 3MZWB 1NTKJ 5AVUB 1ZN5A 4IL6X 2KZIA 2B9BA 1QEXA 2BCCJ 3I5CA 1L0LD 3P32A 1JY2N 1NVOA 1OMIA 3RL0D 2HFED 2IDBA 3AE8C 3H1KE 2B87A 1BDDA 4WY4C 2QJKB 1SQXD 2YIUB 1HVVA 1NOHA 3V2PA 3CWBD 5DJUB 3BCCD 1YQ4C 3N4XA 2QJPC 2KS1A 3E7KA 4ZNCA 3CXHD 3WU2H 4DOJA 1JUNA 1P84H 1SP4A 1YTZI 3GHGB 1HGZA 1KILD 3ABVC 4K3AA 1KB9H 3P7KA 3BASA 3O6QA 1SQPE 1ZR4A 2LKMA 3LIDA 3CC2P 5CJ4A 3RK2B 1NHLA 2E75D 3HUSA 2R32A 2DW3A 1KYOE 1FZAA 4I1LA 3A0BH 3R4YA 2IPPA 1IJDB 1RQUA 5AVSB 1XTGB 1OW8A 2I1KA 4GIFA 3RL0g 3RK3C 4WWIA 1L0LG 1RF1A 3MP7B 2FFDB 2PAJA 3WUTA 2WQYC 2ZT9D 3WUUA 2FYUE 1SQXG 3H1LG 5AVTB 4DT0A 1SQPK 2OGUA 1RH5B 1H8AA 3VP9A 4EIJA 5KLIC 2M5AA 1KILC 2A45G 2KLUA 3H1LJ 2PGDA 1BCCD 4K35A 2YKPA 2P67A 1LWUC 1URQD 3AE9C 4I7ZB 2Q7CA 1RY3A 2IZ0A 4Y99C 3CX5H 2E75C 3MUDA 1EZVD 1QLED 1ZLLA 3TGUD 3WMM0 3H1IJ 3KZIE 3OW2O 3L70E 3CCVP 1HUCA 2WPVB 5AVWB 3PHLA 4BRYA 4AUWA 2JDIH 1FJKA 1LTSC 5GTHE 2R5BA 3FWNA 1T3UA 5KLVE 3Q5RA 2G8YA 3D70A 2ZT9C 1QVGO 2G3AA 1X9VA 5AVZB 1GDTA 4HJGH 2XNDH 4PD4E 1DH3A 2XKMA 1GU5A 3HE4A 3V2QA 1QL2A 4HYTB 4H44B 1LGHB 2Q6QA 1BE3J 1FZBA 1OIPA 1MFZA 1SQVE 1BCCG 4HB1A 3JCUE 1OVVA 1J1EC 4TT3H 2JWDA 3MTUE 1CW5A 3H1JJ 2WPQA 2IBZE 2AEJA 3B8EB 1FZFA 2RKLA 2JKVA 1VQKP 2XNXA 1EZVG 3O8ZA 4LC1A 1JMMA 3TGUG 5B66H 5KLVK 3HUSC 5K5GB 1KQLA 1H0TB 3L71E 4W80A 1ZRTD 5AW2B 3R2PA 1SFCD 1L4AD 1VQ9P 3CL3D 1NTME 2B89A 4YXDC 3CMEP 3AE4C 3AEGC 4UB8H 5APQA 2FYUD 2OTLP 1SQQD 2Q3EA 2O1JA 2OYHC 3CC7P 1LJ2A 3ZDMA 2KNCB 1PV3A 3M9HA 4OGQD 2IFMA 3H1KJ 3H32A 2BCCE 3MIWA 4RJTA 2M0BA 3LIEA 2E42A 4JYBA 2RMZA 2AEMA 4PV1D 2QEXP 3TDKA 1L0NK 1GL2A 2PP6A 2KXPB 1Z56A 2GUVA 2NPSA 5APYA 3L73E 2KLVA 1BSNA 4A7PA 1JCDA 3AE6C 1M1KQ 2O01J 1EDKA 2YO3A 1SQPJ 2ZXXA 1BDCA 1UIIA 3GF7A 5KKZC 1SFCC 4W7YA 1NAYA 2QJPB 5AVQB 2JEEA 1BSHA 5E79H 1T6AA 5B5EE 2FBWC 1FJPA 3FX0A 3CCMP 1SQBD 3P8CE 1N73A 3KDPB 2WITA 4OWFA 2FYUG 2LXCB 4JPZB 4PD4D 4KT0J 1SQQG 4OGQC 1FS0E 2N1TA 3V5BA 1IFPA 1VQPP 3CPWO 3TSIA 2FYUJ 1SQVD 3PLNA 4IFFA 1LT9A 2L5GB 3Q5PA 3S4RA 4TLFA 1VF5D 1J1DC 4L76A 3CLQA 3RL0B 1M56D 2POHA 1S3JA 1YTZT 1OXZA 1JO5A 1GK6A 2AEFA 3CCQP 1GL2D 3G4SP 3IFMA 4IL6E 3VP8A 1U57A 4CPGA 4NPFX 4XE5B 1GZLA 3L71D 1NTZD 5CBNA 1LTAC 2R3CA 2A45H 2PRRA 3CXHH 1HTLC 4U7JA 1KILB 3A0HE 3L70J 3G6EP 1FOSE 3HTKA 1NTMD 1NJIQ 1KTMA 1LWUB 1PFIA 1DD3A 1SQBG 4Y99B 1YIJP 2N9BA 2I8DA 1CI6B 5KLVJ 1JY3P 2ZYAA 1YI2P 3B5ND 3PTZA 4EDFA 2O1KA 1FAVA 3CCRP 5GTIH 2BEZF 2ZXEB 2BCCD 1Q7YQ 1M1JA 3GLMA 1VF5C 2N1TD 1SQVG 2IYPA 2ZT9B 4H0LD 4I2LC 1GL2C 3L73D 4RKUJ 2QM7A 4AQRD 4ZKUA 4W7ZA 3QH9A 1GW3A 2OYIA 2Z4EA 4R4LA 3L71G 3Q3DA 1JTHB 1NTZG 4WY4D 2KZJA 4IFMA 3L36A 3L35A 1URQB 1T2KD 2KYVA 2A06E 1NTMG 3E1IA 1WT6A 2MKVA 4C46A 3P8CD 1J1EB 5CCGA 3W67A 2FYNC 3V2RA 3I55P 3B5NC 1M8OB 1OWAA 2Z5IA 1N2DC 1FZCA 2M3BA 5C39A 1N73C 4WBAA 1R5SA 1NTMJ 3KXDA 2WPRA 1LTTC 2E5TA 3U1CA 3LW5J 2N1TC 1JNMA 2OQQA 1IK7A 2Q5UA 2BCCG 2V7QJ 3II6A 3L72E 4XA4A 2WT7A 1AQTA 3AE1C 2LR2A 4H0LC 2KOGA 2IBZI 1A02J 3CMAP 3L73G 1M7LA 1OW7A 1FE6A 3RK3D 4JQ0D 2QJYB 1AA0A 2OYHB 1EXIA 3H1LD 4NPEA 1CSBA 2W90A 2J59M 3L73J 3L75J 1USDA 3EFGA 1Q2NA 1T2KC 1SS1A 3NMDA 3RBXA 1JOCA 1YYCA 3TNUA 4C7NA 4QMAA 3H1ID 1LTGC 1G2CA 4R4MA 1KYOH 5CCGD 1AJYA 2WSCJ 2AXTH 1LTJA 3F89A 3AEEC 5KKZB 1OZHA 3CCLP 1Q82Q 2J5UA 1SFCB 1L4AB 1S5LE 2BEQD 1M1JC 5APSA 1JMBA 3AE7C 2KIKA 3WUVA 4M3LA 1OW6A 2P2UA 3V6IA 1KZUB 1YJNP 3SWYA 2K9JB 1KQFB 3A2AA 1N7SA 2FXPA 2QM8A 4OGQB
chains in the Genus database with same CATH topology
5KLVK 3V2NA 1KILA 3HUSC 1MV8A 2C9LY 1KQLA 1HWTC 1LWUA 4W80A 3HUSB 2H43A 1EQ7A 5AW4B 2OYIB 5AW2B 3R2PA 5KJ7D 2FKWB 1X79B 1SFCD 2Q3IA 1L4AD 2HPCA 1CI6A 4LLHA 2FYZA 3CL3D 1IO4A 1IFIA 1JY3N 1LT9C 3M0DC 1IK9A 1GD2E 2I1JA 1VPCA 1CZQA 4I6MC 4WY4A 5AW6B 3BVHA 5CCGC 5APQA 3BATA 2W6BA 3HRNA 3P8MC 3PP5A 4C7RA 2O1JA 2YMYA 2OYHC 1RF1B 2WZ7A 3BRTB 1QL1A 3GHGA 3M9HA 2IFMA 1GW4A 3H32A 3L37A 3OA7A 1FZCB 1RE4A 2WWWA 2GUSA 3MIWA 3LIEA 3A5TA 2HODA 2E42A 4JYBA 3NTNA 4RESB 3V4QA 1L0NK 1GL2A 1RE3A 2PP6A 1MZ9A 2O01H 5AW1B 4WB4A 2WT7B 1VDFA 1Z56A 2GUVA 3VTPC 2NPSA 5APYA 1JTHA 1JCCA 1GU4A 2KLVA 1H88A 2HYNA 1JCDA 2YO3A 1URQA 1WRGA 1KFMA 3VYIA 3HD7D 3OAKA 5KJ7C 1N7SD 2Z5HA 2XV5A 5AVYB 5AW8B 1SFCC 4W7YA 1S9KD 2H7HA 5AVQB 3VOPA 1FOSF 2YKQA 3HE5B 1JY2O 2C0XA 2JEEA 4KHXA 4ZKPA 2FFDA 5APVA 2YO2A 1FJPA 3P8CE 3H6PA 2VRSA 1N73A 1G1IA 3KDPB 2WITA 4N6JA 2IX7C 3TNUB 4C7NB 5APTA 5AW0B 2HLOA 2N1TA 2IFNA 2KSJA 5APWA 3V5BA 1IFJA 1N7LA 1G2CB 3TSIA 1NU1K 3UIAA 4DZOA 2OYIC 4IFFA 3RL0C 1LT9A 1LTJB 2L5GB 3HE4B 2R5DA 1J1DC 3CLQA 1E5WA 3RL0B 4N78E 4LGDE 1T8ZA 5AW5B 1RF0A 2POHA 2WPSA 2OYHA 2OARA 1J1DB 1YTZT 1OXZA 1JO5A 1GK6A 3B5NB 4HH2A 1GL2D 2P1JA 1FBMA 3V4WA 1RF1C 3IFMA 3HD7C 3TK1A 3VP8A 1AQ5A 3VMZA 1N7SC 4XE5B 1GZLA 3TYYA 1HH0A 1FZCC 2J58A 3HD7B 1XTCC 1NH4A 2XU6A 1NWQA 4GT1A 1LTAC 1N7SB 2CPBA 2R3CA 3M06A 2A45H 1HTLC 5AW9B 1FU1A 3VMYA 1KILB 5AVUB 1ZN5A 4N3YB 1FOSE 1FZEA 3HTKA 3SWFA 1LWUB 3I5CA 3P32A 1JY2N 2MJZA 1T3JA 1PFIA 3RL0D 2HFED 5CHXA 1HJBA 3KQGA 4Y99B 2N9BA 3A7OA 5AVRB 2HPCB 1CI6B 1IC2A 4WY4C 1JY3P 3M9QA 5KJ7A 3B5ND 4JYCA 1SFCA 2O1KA 1HVVA 1L4AA 1NOHA 1IFNA 2KB7P 3BRVB 3V2PA 1FAVA 3CI9A 4WY4B 5AW7B 2ZXEB 2YNYA 3N4XA 3A3YB 1JY3O 2FYUK 1M1JA 2E43A 3EQ2A 2N1TD 4DOJA 1JUNA 1SQQK 1RE4C 1MUUA 2YKOA 1SP4A 1YTZI 3GHGB 1HGZA 1KILD 3M9BA 3H32B 1H89A 3P7KA 3BASA 3M0AA 2BASA 3VMXA 4I2LC 1AFOA 1NKZB 1GL2C 1J2JB 1ZR4A 2HODB 2LKMA 2QM7A 4IFDK 5CCHA 1GK4A 3LIDA 2XZRA 5CJ4A 3RK2B 4AQRD 4ZKUA 1NHLA 4W7ZA 3HUSA 2R32A 1GL2B 1GW3A 2OYIA 2Z4EA 1HBWA 2M8RA 1FZAA 4I1LA 2NPSB 1JTHB 1URQC 3L4FA 4WY4D 2IPPA 4IFMA 1LTJC 2A45I 1IJDB 1NTKK 5AVSB 3L36A 1XTGB 2I1KA 1URQB 3L35A 3IR9A 4GIFA 1T2KD 2FFDC 3KPEA 2KYVA 3C9IA 3RK3C 3M0DA 3E1IA 1WT6A 4C46A 3P8CD 1KFNA 1RF1A 1J1EB 5CCGA 2FFDB 1NAFA 1ZV8A 2PAJA 2W6AA 3RK3B 3V2RA 3G3ZA 3B5NC 5CJ0A 2Z5IA 1OWAA 1N2DC 2KP8A 3LW5H 1FZCA 2M3BA 4B86A 1N73C 4WBAA 2H8PD 3RK2D 2WPRA 5AVTB 1LTTC 1SQPK 3U1CA 1IFDA 1N73B 1DX7A 1SQBK 2N1TC 1JNMA 4AYCA 4JF7A 1H8AA 2Q5UA 2NPSD 3II6A 3VP9A 4EIJA 1KILC 2A45G 4XA4A 2WT7A 3NFQA 3MD0A 2FXMA 2N1TB 4N78D 2YKPA 5AVXB 2P67A 1LWUC 1URQD 1G1JA 1LTBC 3T97A 2KOGA 1HGVA 2Q7CA 2CPSA 1RY3A 4Y99C 1LT9B 1SQVK 3MUDA 1A02J 1RF0C 1M7LA 2W27A 1NKNA 3RK3D 1SLQA 1ZLLA 2JJLA 3WMM0 2WTYA 3NXSA 5CMZA 2WSFH 3HE5A 2OYHB 3U59A 3U1AA 5CCHD 1W2EA 1CSBA 1HUCA 5AVWB 2J59M 4AUWA 3EFGA 3VN0A 1T2KC 1FJKA 1LTSC 2Q9IA 2R5BA 1S9KE 3GHGC 5BU8B 1T3UA 3NMDA 1JOCA 1YYCA 5BU5A 3TNUA 1NTZK 4C7NA 2WSCH 1GTWA 3M91A 5AVVB 4OH8B 1X9VA 5AVZB 2GM4A 1GDTA 1LTGC 3RK2C 4EOTA 1G2CA 1JY2P 3HTKB 1ZR2A 1RE3C 2C9NY 1LTIC 1NTMK 5CCGD 2XDJA 1L0LK 1DEBA 1LTJA 1DH3A 1FDMA 2XKMA 2NPSC 2ZFCA 1GU5A 3HE4A 5AW3B 1FZGA 1L4AC 3V2QA 1QL2A 4HYTB 4GKGA 5KTBA 1A02F 1LGHB 1SFCB 2HG5D 1L4AB 1SQXK 1SVFA 1FZBA 1M1JC 1MFZA 1N86A 3B5NA 5APXA 3N7NA 5BVZA 5APSA 1X8YA 4O9BA 1J1EC 5APUA 2C0WA 3MTUE 1M1JB 1CW5A 4M3LA 2WPQA 3B8EB 1FZFA 3OJAB 2P2UA 2XNXA 3O8ZA 1KZUB 4LC1A 3KYQA 3SWYA 3HD7A 1JMMA 3A2AA 1NO4A 3MGNA 5CCHC 1N7SA 1IFMA 2P7JA 2WSEH 2QM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KIL A;  2KOG A;  4WY4 B;  3P8C E;  4W80 A;  2N1T D;  3RK3 D;  5KJ7 D;  1SFC D;  1L4A D;  1KIL D;  2N1T A;  5CCH D;  3M0D C;  1GL2 C;  3TSI A;  4WY4 A;  5CCG C;  5CCH A;  3RL0 C;  3PP5 A;  3RK2 B;  1NHL A;  4W7Z A;  1GL2 B;  2YMY A;  2WZ7 A;  2M8R A;  3RL0 B;  4N78 E;  4LGD E;  2NPS B;  1JTH B;  1URQ C;  4WY4 D;  4OH8 B;  3B5N B;  3RK2 C;  3HTK B;  1XTG B;  1GL2 D;  1URQ B;  5CCG D;  2XDJ A;  3HD7 C;  3RK3 C;  1N7S C;  2NPS C;  1GL2 A;  2PP6 A;  1L4A C;  5CCG A;  3HD7 B;  3RK3 B;  3B5N C;  1N7S B;  2NPS A;  1JTH A;  1SFC B;  2HG5 D;  1L4A B;  1KIL B;  3B5N A;  2H8P D;  3RK2 D;  1URQ A;  1T3J A;  2N1T C;  3HD7 D;  3RL0 D;  2HFE D;  4JF7 A;  5KJ7 C;  1N7S D;  2NPS D;  1SFC C;  4W7Y A;  3KYQ A;  3VOP A;  1KIL C;  3HD7 A;  2N1T B;  4WY4 C;  5CCH C;  1N7S A;  3B5N D;  5KJ7 A;  1SFC A;  1HVV A;  1L4A A;  1URQ D; 
#chains in the Genus database with same CATH topology
 1S2E A;  1BE3 D;  1ZW0 A;  3A0B E;  4H13 D;  1M57 D;  1D7M A;  3H1J D;  2SPZ A;  4PV1 B;  2A06 D;  1VL2 A;  3D71 A;  3G71 P;  3H1I G;  1VPC A;  4GOE A;  2K88 A;  5AW6 B;  5CCG C;  2E74 D;  3KZI H;  2YMY A;  2WZ7 A;  1PGQ A;  3GHG A;  1QX8 A;  1RE4 A;  3A5T A;  4ASW A;  2WSF J;  3PRJ A;  1RE3 A;  5H2F E;  3CX5 E;  4WB4 A;  1VDF A;  2ZVO B;  3H1K D;  2OTK E;  3T97 B;  1S72 P;  4PD4 H;  2OTJ P;  1BE3 G;  4H13 C;  4D6T E;  1N7S D;  2XV5 A;  2H7H A;  3VOP A;  2YKQ A;  1JY2 O;  2C0X A;  3HE5 B;  1VF5 B;  4KHX A;  4ZKP A;  2FFD A;  3H1J G;  3JCU H;  2A06 G;  3Q1M A;  3K5B A;  3USS A;  1E79 H;  1PGP A;  2E74 C;  1SQP D;  1PL5 A;  1LNQ A;  2CK3 H;  5APT A;  5AW0 B;  2HLO A;  2IFN A;  2KSJ A;  1RQV A;  1KYO D;  1N7L A;  3AED C;  3Q2Y A;  2WSS H;  1L0N E;  1NU1 K;  2YXQ B;  3D6Z A;  3VMA A;  3AE2 C;  1KC8 Q;  4N78 E;  4LGD E;  1RF0 A;  1JEK A;  3L72 J;  2OAR A;  3B5N B;  2PFX A;  2V7Q H;  3H1K G;  3V4W A;  1RF1 C;  2N9Y B;  1KD1 Q;  1N7S C;  1HF9 A;  2K1A A;  2D2C D;  2J58 A;  1KOR A;  3HD7 B;  1XTC C;  1NH4 A;  4YTP C;  2CPB A;  1FU1 A;  4N3Y B;  1Q81 Q;  5TIS E;  3SWF A;  4HKZ H;  1BGY E;  2MJZ A;  1WMK A;  1SQP G;  5CHX A;  3S9O A;  1HJB A;  1X0T A;  4YXW H;  2YXR B;  3PJS K;  5AVR B;  2HPC B;  5KJ7 A;  3H1H E;  3IF4 A;  1K9M Q;  3L75 E;  2KB7 P;  3BRV B;  3MUD C;  4WY4 B;  5AW7 B;  3L70 D;  2YNY A;  2E43 A;  3EQ2 A;  1RE4 C;  5B5E H;  1LT1 A;  2ZVN B;  2JR8 A;  1YJ9 P;  2Q1K A;  1ZXG A;  2Y9Z A;  1VQ6 P;  3M9B A;  1H89 A;  4MN4 C;  5KLV D;  3M0A A;  2BAS A;  3VMX A;  2V4H A;  1AFO A;  4BWN A;  2HOD B;  4IFD K;  3G9R A;  1Y47 A;  1HBW A;  1DIP A;  2D2C C;  4D6T D;  2B88 A;  1KQS O;  1Q90 D;  1FC2 C;  1Y8A A;  3EFF K;  1NTK K;  2QA4 P;  1N8R Q;  2FFD C;  3KPE A;  5KAF H;  3C9I A;  3ITK A;  5CBO A;  1EC5 A;  1KFN A;  1NAF A;  2KNC A;  2W6A A;  3RK3 B;  1KV4 A;  2IBZ D;  1PPJ E;  2KK7 A;  2KP8 A;  4PJ0 H;  4B86 A;  4UB6 H;  2QVA A;  1AVY A;  4L74 A;  1W2B O;  1MKM A;  3L70 G;  4AYC A;  1HJ0 A;  4WVZ A;  2NPS D;  4GDO A;  3A0H H;  1AV1 A;  3NFQ A;  1P84 I;  3MD0 A;  1U7J A;  5KAI E;  4N78 D;  1L0L E;  1KB9 I;  1G1J A;  1LTB C;  5KLI B;  1ZME C;  5KLV G;  3CC4 P;  2CPS A;  3FXE A;  1KQG B;  1LP1 B;  1U7M A;  1X22 A;  1RF0 C;  2W27 A;  1TU3 F;  1NKN A;  3H25 A;  2WTY A;  2E75 B;  3CWB E;  5CMZ A;  2WSF H;  2Y0E A;  3U59 A;  3U1A A;  4D6T G;  1KN7 A;  3BCC E;  3VN0 A;  4DJG A;  2YMK A;  2Q9I A;  1NYH A;  5BU8 B;  3L74 E;  1BGY D;  1YJW P;  3CCS P;  4D6T J;  1PIX A;  3M91 A;  5AVV B;  4OH8 B;  2GM4 A;  2IBZ G;  2LXB A;  4L75 A;  4EOT A;  3H1H D;  1JY2 P;  4EYY Q;  1VQ7 P;  1ZR2 A;  3L75 D;  2IYO A;  1L0L K;  5GTI E;  2NPS C;  2ZFC A;  1YBK A;  2WVR A;  1FZG A;  2B87 B;  1L0N G;  4H13 B;  4GKG A;  3SWK A;  3E1R A;  5KTB A;  1A02 F;  1DEE G;  3SFE C;  1SQX K;  2JWA A;  1N86 A;  2KI7 B;  2ITA A;  3AEB C;  3N7N A;  5BVZ A;  1X8Y A;  4O9B A;  2KS1 B;  1L0N J;  5APU A;  1W5C E;  3QWO C;  1KMI Z;  3CX5 I;  2P58 A;  3MGN A;  3O6Q B;  3B71 A;  1R5L A;  3V2N A;  3CCJ P;  1KIL A;  1M90 Q;  2GA1 A;  3AE5 C;  1MV8 A;  2C9L Y;  2Y9Y A;  3GW6 A;  1LWU A;  3HUS B;  3AE3 C;  5AW4 B;  1BCC E;  2KSE A;  2NRG A;  1BGY G;  1CI6 A;  2FY8 A;  3EWK A;  4ASV A;  1IO4 A;  1PPJ D;  1JY3 N;  1LT9 C;  2HR3 A;  1EZV E;  1L2P A;  1CZQ A;  4I6M C;  3BVH A;  3HRN A;  3P8M C;  3H1H G;  2R44 A;  4C7R A;  1BGY J;  3L75 G;  2QIW A;  1RF1 B;  3BRT B;  1QL1 A;  1QVF O;  2K9Y A;  1GW4 A;  1VQ5 P;  1USE A;  3L37 A;  5M1B A;  3PH0 A;  2GUS A;  2ZAE B;  3H1H J;  2R3S A;  3V4Q A;  1EDJ A;  3SSU A;  1MZ9 A;  1VQL P;  2O01 H;  2M5A B;  5AW1 B;  2H89 C;  2E76 D;  1EDL A;  1JTH A;  1JCC A;  1GU4 A;  3KHU A;  2HYN A;  2QG4 A;  5DJT B;  1URQ A;  1WRG A;  1KFM A;  2Z5H A;  5AW8 B;  1S5L H;  3L74 D;  1FOS F;  3AEC C;  4NPD A;  3WU2 E;  1P84 E;  2QE7 H;  1QGK B;  4BRY B;  2KUB A;  2YO2 A;  1KB9 E;  1PPJ G;  2VRS A;  2K3R A;  4YPC A;  1G1I A;  4N6J A;  2AXT E;  2RN0 A;  2UWJ E;  1K73 Q;  5APW A;  1IFJ A;  2D2C B;  1JM0 A;  4Y28 J;  5TJH A;  1ZRT E;  2OYI C;  3UIA A;  1PGJ A;  1JB0 J;  1VQ4 P;  3RL0 C;  1VQM P;  2WSE J;  3HE4 B;  1E5W A;  2E76 C;  1T8Z A;  5AW5 B;  2QSI A;  1K04 A;  2OYH A;  1J1D B;  5EFW B;  1L0L J;  1SQQ E;  3CWB G;  2P1J A;  1FBM A;  3TK1 A;  4GOD A;  2NZ2 A;  3VMZ A;  2Y0C A;  3BCC G;  1FZC C;  1SQX J;  2ZJS E;  2XU6 A;  1NWQ A;  4GT1 A;  4XFJ A;  3M06 A;  3CWB J;  3CCE P;  3L74 G;  5AW9 B;  1PP9 E;  3L72 D;  3VMY A;  5GTH H;  3BCC J;  1FZE A;  2Y0D A;  5H2F H;  1PGO A;  2JP3 A;  1T3J A;  1NGM B;  3GMA A;  3KQG A;  3L74 J;  3A7O A;  1IC2 A;  4L73 A;  3M9Q A;  2L91 A;  1NU1 E;  4JYC A;  1SFC A;  1L4A A;  1IFN A;  3CI9 A;  2AXC A;  3A3Y B;  1JY3 O;  2FYU K;  5L8R J;  1SQQ K;  1MUU A;  2YKO A;  1EDI A;  2K9J A;  4U3F E;  3AEA C;  3H32 B;  1SQB E;  3MHV A;  1NKZ B;  1J2J B;  2O3J A;  5CCH A;  1GK4 A;  3GG2 A;  2XZR A;  1GL2 B;  1OFC X;  2M8R A;  2NPS B;  1URQ C;  3L4F A;  3IN6 A;  1LTJ C;  2A45 I;  3CXH I;  1P84 D;  3L72 G;  3Q5S A;  3IR9 A;  1KB9 D;  3M0D A;  3IAO A;  2ZYD A;  1S5L X;  2O01 N;  1BCC J;  1ZV8 A;  1VQ8 P;  3G3Z A;  5CJ0 A;  1VQN P;  3LW5 H;  4RO0 A;  4BXL A;  2W83 C;  2FYN B;  3B4S A;  2H8P D;  3RK2 D;  1YIT P;  5B66 E;  1NTZ E;  1N73 B;  1IFD A;  1DX7 A;  1SQB K;  3D6Y A;  3TGU J;  4JF7 A;  2FXM A;  2N1T B;  5TIS H;  4EI2 A;  5AVX B;  3T97 A;  2M3E A;  1HGV A;  2QJY C;  3F5H A;  1LT9 B;  1SQV K;  4H0L B;  2QJK C;  1SLQ A;  1GMJ A;  2JO1 A;  2YIU C;  2JJL A;  4UB8 E;  3NXS A;  1NTK E;  3HE5 A;  1AVO A;  5CCH D;  1W2E A;  1S4X A;  1PP9 D;  1K05 A;  1S9K E;  1VQO P;  3GHG C;  3I56 P;  5BU5 A;  1DD4 A;  1NTZ K;  1FDO A;  2WSC H;  3C1L A;  1GTW A;  3CX5 D;  3TF5 A;  1EZV I;  3RK2 C;  1NU1 D;  3HTK B;  1RE3 C;  1EXJ A;  2C9N Y;  1LTI C;  1NTM K;  1H0T A;  2XDJ A;  1DEB A;  3AEF C;  1FDM A;  5AW3 B;  1L4A C;  1ZP0 C;  2HG5 D;  1SVF A;  4KJM A;  3C8V A;  4U3F D;  4ZMD A;  3B5N A;  5APX A;  1Q86 Q;  5E79 E;  2C0W A;  1M1J B;  3OJA B;  3RGU A;  3KYQ A;  3HD7 A;  1NO4 A;  5CCH C;  1IFM A;  2P7J A;  2WSE H;  3CCU P;  4IL6 H;  4PV1 C;  1HWT C;  1SQQ J;  1PP9 G;  3FXD A;  3FWL A;  5KAI H;  2H43 A;  1L0N D;  1EQ7 A;  1YQ3 C;  2OYI B;  4H44 D;  4OVN F;  5KJ7 D;  2FKW B;  1X79 B;  2Q3I A;  5KAF E;  2OYO A;  2HPC A;  4I7Z C;  1RHZ B;  4LLH A;  2FYZ A;  1IFI A;  2E76 B;  1R8E A;  2H88 C;  3M0D C;  1IK9 A;  1GD2 E;  1PP9 J;  2I1J A;  3JC2 2;  4WY4 A;  3RK3 E;  4PJ0 E;  4UB6 E;  3BAT A;  2W6B A;  1NU1 G;  3PP5 A;  1KYO I;  2K37 A;  1SQX E;  3H1L E;  2P10 A;  1FZC B;  1FDI A;  2QRX A;  3OA7 A;  2WWW A;  1NU1 J;  1Y9B A;  2HOD A;  3CXH E;  3NTN A;  4RES B;  4U3F G;  4DCK A;  3H1I E;  1KIL E;  4JBZ A;  4GOF A;  2WT7 B;  1PZQ A;  3VTP C;  3RBZ A;  4IOI H;  4U3F J;  1NTK D;  1H88 A;  1IZN B;  1OVU A;  1SQB J;  3VYI A;  1ZOY C;  2RH0 A;  3CD6 P;  3HD7 D;  3OAK A;  4H44 C;  2ZYG A;  5KJ7 C;  5AVY B;  1S9K D;  4Z1M H;  1MFT A;  2W6J H;  1OX3 A;  3GF3 A;  5APV A;  2W8Z A;  3FGA D;  1SQV J;  3H6P A;  3JSV C;  2IX7 C;  2E74 B;  3TNU B;  4C7N B;  1YHQ P;  1BE3 E;  1K8A Q;  2WMM A;  3S1K A;  1G2C B;  2E5Y A;  4DZO A;  3H1J E;  1LP1 A;  1LTJ B;  3L71 J;  3SFD C;  1NTZ J;  2R5D A;  1OVR A;  2IZ1 A;  2WPS A;  3W68 A;  4HH2 A;  1NTK G;  4PD4 I;  3HD7 C;  3TGU E;  1AQ5 A;  3TYY A;  1HH0 A;  1UIX A;  1S1C X;  2FXO A;  1N7S B;  3MZW B;  1NTK J;  5AVU B;  1ZN5 A;  4IL6 X;  2KZI A;  2B9B A;  1QEX A;  2BCC J;  3I5C A;  1L0L D;  3P32 A;  1JY2 N;  1NVO A;  1OMI A;  3RL0 D;  2HFE D;  2IDB A;  3AE8 C;  3H1K E;  2B87 A;  1BDD A;  4WY4 C;  2QJK B;  1SQX D;  2YIU B;  1HVV A;  1NOH A;  3V2P A;  3CWB D;  5DJU B;  3BCC D;  1YQ4 C;  3N4X A;  2QJP C;  2KS1 A;  3E7K A;  4ZNC A;  3CXH D;  3WU2 H;  4DOJ A;  1JUN A;  1P84 H;  1SP4 A;  1YTZ I;  3GHG B;  1HGZ A;  1KIL D;  3ABV C;  4K3A A;  1KB9 H;  3P7K A;  3BAS A;  3O6Q A;  1SQP E;  1ZR4 A;  2LKM A;  3LID A;  3CC2 P;  5CJ4 A;  3RK2 B;  1NHL A;  2E75 D;  3HUS A;  2R32 A;  2DW3 A;  1KYO E;  1FZA A;  4I1L A;  3A0B H;  3R4Y A;  2IPP A;  1IJD B;  1RQU A;  5AVS B;  1XTG B;  1OW8 A;  2I1K A;  4GIF A;  3RL0 g;  3RK3 C;  4WWI A;  1L0L G;  1RF1 A;  3MP7 B;  2FFD B;  2PAJ A;  3WUT A;  2WQY C;  2ZT9 D;  3WUU A;  2FYU E;  1SQX G;  3H1L G;  5AVT B;  4DT0 A;  1SQP K;  2OGU A;  1RH5 B;  1H8A A;  3VP9 A;  4EIJ A;  5KLI C;  2M5A A;  1KIL C;  2A45 G;  2KLU A;  3H1L J;  2PGD A;  1BCC D;  4K35 A;  2YKP A;  2P67 A;  1LWU C;  1URQ D;  3AE9 C;  4I7Z B;  2Q7C A;  1RY3 A;  2IZ0 A;  4Y99 C;  3CX5 H;  2E75 C;  3MUD A;  1EZV D;  1QLE D;  1ZLL A;  3TGU D;  3WMM 0;  3H1I J;  3KZI E;  3OW2 O;  3L70 E;  3CCV P;  1HUC A;  2WPV B;  5AVW B;  3PHL A;  4BRY A;  4AUW A;  2JDI H;  1FJK A;  1LTS C;  5GTH E;  2R5B A;  3FWN A;  1T3U A;  5KLV E;  3Q5R A;  2G8Y A;  3D70 A;  2ZT9 C;  1QVG O;  2G3A A;  1X9V A;  5AVZ B;  1GDT A;  4HJG H;  2XND H;  4PD4 E;  1DH3 A;  2XKM A;  1GU5 A;  3HE4 A;  3V2Q A;  1QL2 A;  4HYT B;  4H44 B;  1LGH B;  2Q6Q A;  1BE3 J;  1FZB A;  1OIP A;  1MFZ A;  1SQV E;  1BCC G;  4HB1 A;  3JCU E;  1OVV A;  1J1E C;  4TT3 H;  2JWD A;  3MTU E;  1CW5 A;  3H1J J;  2WPQ A;  2IBZ E;  2AEJ A;  3B8E B;  1FZF A;  2RKL A;  2JKV A;  1VQK P;  2XNX A;  1EZV G;  3O8Z A;  4LC1 A;  1JMM A;  3TGU G;  5B66 H;  5KLV K;  3HUS C;  5K5G B;  1KQL A;  1H0T B;  3L71 E;  4W80 A;  1ZRT D;  5AW2 B;  3R2P A;  1SFC D;  1L4A D;  1VQ9 P;  3CL3 D;  1NTM E;  2B89 A;  4YXD C;  3CME P;  3AE4 C;  3AEG C;  4UB8 H;  5APQ A;  2FYU D;  2OTL P;  1SQQ D;  2Q3E A;  2O1J A;  2OYH C;  3CC7 P;  1LJ2 A;  3ZDM A;  2KNC B;  1PV3 A;  3M9H A;  4OGQ D;  2IFM A;  3H1K J;  3H32 A;  2BCC E;  3MIW A;  4RJT A;  2M0B A;  3LIE A;  2E42 A;  4JYB A;  2RMZ A;  2AEM A;  4PV1 D;  2QEX P;  3TDK A;  1L0N K;  1GL2 A;  2PP6 A;  2KXP B;  1Z56 A;  2GUV A;  2NPS A;  5APY A;  3L73 E;  2KLV A;  1BSN A;  4A7P A;  1JCD A;  3AE6 C;  1M1K Q;  2O01 J;  1EDK A;  2YO3 A;  1SQP J;  2ZXX A;  1BDC A;  1UII A;  3GF7 A;  5KKZ C;  1SFC C;  4W7Y A;  1NAY A;  2QJP B;  5AVQ B;  2JEE A;  1BSH A;  5E79 H;  1T6A A;  5B5E E;  2FBW C;  1FJP A;  3FX0 A;  3CCM P;  1SQB D;  3P8C E;  1N73 A;  3KDP B;  2WIT A;  4OWF A;  2FYU G;  2LXC B;  4JPZ B;  4PD4 D;  4KT0 J;  1SQQ G;  4OGQ C;  1FS0 E;  2N1T A;  3V5B A;  1IFP A;  1VQP P;  3CPW O;  3TSI A;  2FYU J;  1SQV D;  3PLN A;  4IFF A;  1LT9 A;  2L5G B;  3Q5P A;  3S4R A;  4TLF A;  1VF5 D;  1J1D C;  4L76 A;  3CLQ A;  3RL0 B;  1M56 D;  2POH A;  1S3J A;  1YTZ T;  1OXZ A;  1JO5 A;  1GK6 A;  2AEF A;  3CCQ P;  1GL2 D;  3G4S P;  3IFM A;  4IL6 E;  3VP8 A;  1U57 A;  4CPG A;  4NPF X;  4XE5 B;  1GZL A;  3L71 D;  1NTZ D;  5CBN A;  1LTA C;  2R3C A;  2A45 H;  2PRR A;  3CXH H;  1HTL C;  4U7J A;  1KIL B;  3A0H E;  3L70 J;  3G6E P;  1FOS E;  3HTK A;  1NTM D;  1NJI Q;  1KTM A;  1LWU B;  1PFI A;  1DD3 A;  1SQB G;  4Y99 B;  1YIJ P;  2N9B A;  2I8D A;  1CI6 B;  5KLV J;  1JY3 P;  2ZYA A;  1YI2 P;  3B5N D;  3PTZ A;  4EDF A;  2O1K A;  1FAV A;  3CCR P;  5GTI H;  2BEZ F;  2ZXE B;  2BCC D;  1Q7Y Q;  1M1J A;  3GLM A;  1VF5 C;  2N1T D;  1SQV G;  2IYP A;  2ZT9 B;  4H0L D;  4I2L C;  1GL2 C;  3L73 D;  4RKU J;  2QM7 A;  4AQR D;  4ZKU A;  4W7Z A;  3QH9 A;  1GW3 A;  2OYI A;  2Z4E A;  4R4L A;  3L71 G;  3Q3D A;  1JTH B;  1NTZ G;  4WY4 D;  2KZJ A;  4IFM A;  3L36 A;  3L35 A;  1URQ B;  1T2K D;  2KYV A;  2A06 E;  1NTM G;  3E1I A;  1WT6 A;  2MKV A;  4C46 A;  3P8C D;  1J1E B;  5CCG A;  3W67 A;  2FYN C;  3V2R A;  3I55 P;  3B5N C;  1M8O B;  1OWA A;  2Z5I A;  1N2D C;  1FZC A;  2M3B A;  5C39 A;  1N73 C;  4WBA A;  1R5S A;  1NTM J;  3KXD A;  2WPR A;  1LTT C;  2E5T A;  3U1C A;  3LW5 J;  2N1T C;  1JNM A;  2OQQ A;  1IK7 A;  2Q5U A;  2BCC G;  2V7Q J;  3II6 A;  3L72 E;  4XA4 A;  2WT7 A;  1AQT A;  3AE1 C;  2LR2 A;  4H0L C;  2KOG A;  2IBZ I;  1A02 J;  3CMA P;  3L73 G;  1M7L A;  1OW7 A;  1FE6 A;  3RK3 D;  4JQ0 D;  2QJY B;  1AA0 A;  2OYH B;  1EXI A;  3H1L D;  4NPE A;  1CSB A;  2W90 A;  2J59 M;  3L73 J;  3L75 J;  1USD A;  3EFG A;  1Q2N A;  1T2K C;  1SS1 A;  3NMD A;  3RBX A;  1JOC A;  1YYC A;  3TNU A;  4C7N A;  4QMA A;  3H1I D;  1LTG C;  1G2C A;  4R4M A;  1KYO H;  5CCG D;  1AJY A;  2WSC J;  2AXT H;  1LTJ A;  3F89 A;  3AEE C;  5KKZ B;  1OZH A;  3CCL P;  1Q82 Q;  2J5U A;  1SFC B;  1L4A B;  1S5L E;  2BEQ D;  1M1J C;  5APS A;  1JMB A;  3AE7 C;  2KIK A;  3WUV A;  4M3L A;  1OW6 A;  2P2U A;  3V6I A;  1KZU B;  1YJN P;  3SWY A;  2K9J B;  1KQF B;  3A2A A;  1N7S A;  2FXP A;  2QM8 A;  4OGQ B; 
#chains in the Genus database with same CATH homology
 5KLV K;  3V2N A;  1KIL A;  3HUS C;  1MV8 A;  2C9L Y;  1KQL A;  1HWT C;  1LWU A;  4W80 A;  3HUS B;  2H43 A;  1EQ7 A;  5AW4 B;  2OYI B;  5AW2 B;  3R2P A;  5KJ7 D;  2FKW B;  1X79 B;  1SFC D;  2Q3I A;  1L4A D;  2HPC A;  1CI6 A;  4LLH A;  2FYZ A;  3CL3 D;  1IO4 A;  1IFI A;  1JY3 N;  1LT9 C;  3M0D C;  1IK9 A;  1GD2 E;  2I1J A;  1VPC A;  1CZQ A;  4I6M C;  4WY4 A;  5AW6 B;  3BVH A;  5CCG C;  5APQ A;  3BAT A;  2W6B A;  3HRN A;  3P8M C;  3PP5 A;  4C7R A;  2O1J A;  2YMY A;  2OYH C;  1RF1 B;  2WZ7 A;  3BRT B;  1QL1 A;  3GHG A;  3M9H A;  2IFM A;  1GW4 A;  3H32 A;  3L37 A;  3OA7 A;  1FZC B;  1RE4 A;  2WWW A;  2GUS A;  3MIW A;  3LIE A;  3A5T A;  2HOD A;  2E42 A;  4JYB A;  3NTN A;  4RES B;  3V4Q A;  1L0N K;  1GL2 A;  1RE3 A;  2PP6 A;  1MZ9 A;  2O01 H;  5AW1 B;  4WB4 A;  2WT7 B;  1VDF A;  1Z56 A;  2GUV A;  3VTP C;  2NPS A;  5APY A;  1JTH A;  1JCC A;  1GU4 A;  2KLV A;  1H88 A;  2HYN A;  1JCD A;  2YO3 A;  1URQ A;  1WRG A;  1KFM A;  3VYI A;  3HD7 D;  3OAK A;  5KJ7 C;  1N7S D;  2Z5H A;  2XV5 A;  5AVY B;  5AW8 B;  1SFC C;  4W7Y A;  1S9K D;  2H7H A;  5AVQ B;  3VOP A;  1FOS F;  2YKQ A;  3HE5 B;  1JY2 O;  2C0X A;  2JEE A;  4KHX A;  4ZKP A;  2FFD A;  5APV A;  2YO2 A;  1FJP A;  3P8C E;  3H6P A;  2VRS A;  1N73 A;  1G1I A;  3KDP B;  2WIT A;  4N6J A;  2IX7 C;  3TNU B;  4C7N B;  5APT A;  5AW0 B;  2HLO A;  2N1T A;  2IFN A;  2KSJ A;  5APW A;  3V5B A;  1IFJ A;  1N7L A;  1G2C B;  3TSI A;  1NU1 K;  3UIA A;  4DZO A;  2OYI C;  4IFF A;  3RL0 C;  1LT9 A;  1LTJ B;  2L5G B;  3HE4 B;  2R5D A;  1J1D C;  3CLQ A;  1E5W A;  3RL0 B;  4N78 E;  4LGD E;  1T8Z A;  5AW5 B;  1RF0 A;  2POH A;  2WPS A;  2OYH A;  2OAR A;  1J1D B;  1YTZ T;  1OXZ A;  1JO5 A;  1GK6 A;  3B5N B;  4HH2 A;  1GL2 D;  2P1J A;  1FBM A;  3V4W A;  1RF1 C;  3IFM A;  3HD7 C;  3TK1 A;  3VP8 A;  1AQ5 A;  3VMZ A;  1N7S C;  4XE5 B;  1GZL A;  3TYY A;  1HH0 A;  1FZC C;  2J58 A;  3HD7 B;  1XTC C;  1NH4 A;  2XU6 A;  1NWQ A;  4GT1 A;  1LTA C;  1N7S B;  2CPB A;  2R3C A;  3M06 A;  2A45 H;  1HTL C;  5AW9 B;  1FU1 A;  3VMY A;  1KIL B;  5AVU B;  1ZN5 A;  4N3Y B;  1FOS E;  1FZE A;  3HTK A;  3SWF A;  1LWU B;  3I5C A;  3P32 A;  1JY2 N;  2MJZ A;  1T3J A;  1PFI A;  3RL0 D;  2HFE D;  5CHX A;  1HJB A;  3KQG A;  4Y99 B;  2N9B A;  3A7O A;  5AVR B;  2HPC B;  1CI6 B;  1IC2 A;  4WY4 C;  1JY3 P;  3M9Q A;  5KJ7 A;  3B5N D;  4JYC A;  1SFC A;  2O1K A;  1HVV A;  1L4A A;  1NOH A;  1IFN A;  2KB7 P;  3BRV B;  3V2P A;  1FAV A;  3CI9 A;  4WY4 B;  5AW7 B;  2ZXE B;  2YNY A;  3N4X A;  3A3Y B;  1JY3 O;  2FYU K;  1M1J A;  2E43 A;  3EQ2 A;  2N1T D;  4DOJ A;  1JUN A;  1SQQ K;  1RE4 C;  1MUU A;  2YKO A;  1SP4 A;  1YTZ I;  3GHG B;  1HGZ A;  1KIL D;  3M9B A;  3H32 B;  1H89 A;  3P7K A;  3BAS A;  3M0A A;  2BAS A;  3VMX A;  4I2L C;  1AFO A;  1NKZ B;  1GL2 C;  1J2J B;  1ZR4 A;  2HOD B;  2LKM A;  2QM7 A;  4IFD K;  5CCH A;  1GK4 A;  3LID A;  2XZR A;  5CJ4 A;  3RK2 B;  4AQR D;  4ZKU A;  1NHL A;  4W7Z A;  3HUS A;  2R32 A;  1GL2 B;  1GW3 A;  2OYI A;  2Z4E A;  1HBW A;  2M8R A;  1FZA A;  4I1L A;  2NPS B;  1JTH B;  1URQ C;  3L4F A;  4WY4 D;  2IPP A;  4IFM A;  1LTJ C;  2A45 I;  1IJD B;  1NTK K;  5AVS B;  3L36 A;  1XTG B;  2I1K A;  1URQ B;  3L35 A;  3IR9 A;  4GIF A;  1T2K D;  2FFD C;  3KPE A;  2KYV A;  3C9I A;  3RK3 C;  3M0D A;  3E1I A;  1WT6 A;  4C46 A;  3P8C D;  1KFN A;  1RF1 A;  1J1E B;  5CCG A;  2FFD B;  1NAF A;  1ZV8 A;  2PAJ A;  2W6A A;  3RK3 B;  3V2R A;  3G3Z A;  3B5N C;  5CJ0 A;  2Z5I A;  1OWA A;  1N2D C;  2KP8 A;  3LW5 H;  1FZC A;  2M3B A;  4B86 A;  1N73 C;  4WBA A;  2H8P D;  3RK2 D;  2WPR A;  5AVT B;  1LTT C;  1SQP K;  3U1C A;  1IFD A;  1N73 B;  1DX7 A;  1SQB K;  2N1T C;  1JNM A;  4AYC A;  4JF7 A;  1H8A A;  2Q5U A;  2NPS D;  3II6 A;  3VP9 A;  4EIJ A;  1KIL C;  2A45 G;  4XA4 A;  2WT7 A;  3NFQ A;  3MD0 A;  2FXM A;  2N1T B;  4N78 D;  2YKP A;  5AVX B;  2P67 A;  1LWU C;  1URQ D;  1G1J A;  1LTB C;  3T97 A;  2KOG A;  1HGV A;  2Q7C A;  2CPS A;  1RY3 A;  4Y99 C;  1LT9 B;  1SQV K;  3MUD A;  1A02 J;  1RF0 C;  1M7L A;  2W27 A;  1NKN A;  3RK3 D;  1SLQ A;  1ZLL A;  2JJL A;  3WMM 0;  2WTY A;  3NXS A;  5CMZ A;  2WSF H;  3HE5 A;  2OYH B;  3U59 A;  3U1A A;  5CCH D;  1W2E A;  1CSB A;  1HUC A;  5AVW B;  2J59 M;  4AUW A;  3EFG A;  3VN0 A;  1T2K C;  1FJK A;  1LTS C;  2Q9I A;  2R5B A;  1S9K E;  3GHG C;  5BU8 B;  1T3U A;  3NMD A;  1JOC A;  1YYC A;  5BU5 A;  3TNU A;  1NTZ K;  4C7N A;  2WSC H;  1GTW A;  3M91 A;  5AVV B;  4OH8 B;  1X9V A;  5AVZ B;  2GM4 A;  1GDT A;  1LTG C;  3RK2 C;  4EOT A;  1G2C A;  1JY2 P;  3HTK B;  1ZR2 A;  1RE3 C;  2C9N Y;  1LTI C;  1NTM K;  5CCG D;  2XDJ A;  1L0L K;  1DEB A;  1LTJ A;  1DH3 A;  1FDM A;  2XKM A;  2NPS C;  2ZFC A;  1GU5 A;  3HE4 A;  5AW3 B;  1FZG A;  1L4A C;  3V2Q A;  1QL2 A;  4HYT B;  4GKG A;  5KTB A;  1A02 F;  1LGH B;  1SFC B;  2HG5 D;  1L4A B;  1SQX K;  1SVF A;  1FZB A;  1M1J C;  1MFZ A;  1N86 A;  3B5N A;  5APX A;  3N7N A;  5BVZ A;  5APS A;  1X8Y A;  4O9B A;  1J1E C;  5APU A;  2C0W A;  3MTU E;  1M1J B;  1CW5 A;  4M3L A;  2WPQ A;  3B8E B;  1FZF A;  3OJA B;  2P2U A;  2XNX A;  3O8Z A;  1KZU B;  4LC1 A;  3KYQ A;  3SWY A;  3HD7 A;  1JMM A;  3A2A A;  1NO4 A;  3MGN A;  5CCH C;  1N7S A;  1IFM A;  2P7J A;  2WSE H;  2QM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...