1JTHB

Crystal structure and biophysical properties of a complex between the n-terminal region of snap25 and the snare region of syntaxin 1a
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
67
structure length
67
Chain Sequence
ALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SNAP25
publication title Crystal structure and biophysical properties of a complex between the N-terminal SNARE region of SNAP25 and syntaxin 1a.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 33
structure length 67
sequence length 67
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-08-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1jthB00
2N1TD 1GL2C 2XDJA 3HD7C 4WY4C 4N78E 5CCHD 1N7SA 1KILB 3RK3B 4W80A 1SFCB 3P8CE 2KOGA 1URQA 5CCGD 1GL2A 1HVVA 1T3JA 2YMYA 5KJ7D 1KILD 4WY4A 2NPSB 2N1TA 2M8RA 3RL0C 1L4AB 1URQC 2NPSD 2H8PD 3B5ND 1L4AD 2N1TC 1JTHB 4LGDE 2HG5D 1NHLA 2PP6A 3RK2C 1XTGB 5CCHC 1SFCA 4W7ZA 2WZ7A 3B5NB 5CCGC 3HTKB 4W7YA 5KJ7C 1KILC 3RK3C 1GL2B 1SFCC 5CCHA 4JF7A 1N7SD 3HD7B 4WY4B 2NPSC 5CCGA 3VOPA 1JTHA 1URQD 5KJ7A 1GL2D 1L4AC 1KILA 3HD7D 4WY4D 2HFED 1N7SB 2NPSA 3RK2D 3RL0B 3B5NA 3TSIA 1L4AA 1URQB 4OH8B 3RL0D 2N1TB 3PP5A 3B5NC 3HD7A 3KYQA 1N7SC 3RK3D 3RK2B 1SFCD 3M0DC
chains in the Genus database with same CATH superfamily
2ZXEB 2N9BA 3Q1MA 1DEBA 4R4MA 5APVA 4Y99B 3WUVA 1JY3P 5CBNA 1KN7A 1SQBD 2K9JA 3AE5C 2OYOA 1HH0A 2N9YB 3NFQA 1GL2A 5BVZA 5KJ7D 3O6QB 2FYNB 4NPEA 2J58A 2FYUK 4I1LA 2FXPA 1FZAA 4UB8H 2NPSD 3CI9A 1S2EA 4IL6X 3QH9A 2IX7C 3ITKA 1FZCC 2LXBA 4AQRD 1ZR2A 1LGHB 1JEKA 3B5NB 2QJKC 5KKZB 2W6JH 2WSSH 3RK3C 1YIJP 3HE4B 5CCHA 1SP4A 3D70A 1SQQK 4B86A 3U1AA 1WT6A 4BWNA 2UWJE 3AE6C 4IL6E 5E79H 4HKZH 3CXHH 1NH4A 2IBZE 3L4FA 5APTA 1TU3F 2ZVOB 2YNYA 3FXEA 3A0BE 5KLVE 3H1JG 2AXTH 3H32B 4U3FJ 1RF1C 5B5EE 2QJYB 1SFCD 4PJ0H 4I2LC 1HGZA 1KZUB 2ZVNB 3G4SP 2YO2A 5AVSB 3AE8C 5H2FE 1CI6B 3P8CE 4JQ0D 3CCJP 4EOTA 2NZ2A 2Y9YA 5GTIH 2OYHA 1DIPA 1NTME 2K3RA 3RL0C 1KV4A 3LIEA 1NKNA 4MN4C 2W27A 1IFDA 5DJUB 3M91A 4C7NB 3AEBC 1JMBA 4H0LC 3I56P 1EDLA 3H1KD 4N6JA 2Y0CA 4L75A 3BCCG 3FXDA 1DH3A 2P58A 3WU2E 2E74C 1FZCA 4XA4A 1USEA 2AEMA 1PZQA 2R3SA 1OW8A 3CC2P 5CJ4A 3GHGB 1KMIZ 3L70D 2POHA 1NU1G 4OWFA 1VQ6P 3B71A 1KQFB 3SWFA 1JM0A 1M7LA 3FWNA 4L76A 2E75D 1YJ9P 3KHUA 1J1DC 3ABVC 1W5CE 3RK3E 1OX3A 1SQBG 5C39A 2CK3H 3PLNA 3RK3D 2XNDH 3L71J 3M0DC 3CCVP 1A02F 1QL1A 3M9HA 1RF1A 1ZV8A 5AVRB 1IC2A 3H25A 1OW6A 1HVVA 3W68A 2HR3A 3A3YB 2NPSB 1X22A 2M5AB 2YIUC 3TDKA 5CHXA 3RL0g 1EZVG 5AVTB 5H2FH 2C9NY 3PRJA 4AUWA 3R4YA 1IFMA 5BU5A 1LT9C 1LWUC 1FZBA 1NTKG 4U3FE 1T2KD 1GW4A 2FY8A 4BRYA 2O1KA 1M90Q 3V6IA 5TJHA 2Z5HA 1FS0E 2J59M 2KS1A 4HH2A 2E76B 2WT7B 2BCCD 3WU2H 1JTHA 5APQA 1JO5A 3A0HE 3G71P 1R8EA 2NRGA 3L73J 4H0LD 3FGAD 4YXWH 3N4XA 1OW7A 1URQB 3CL3D 5AVWB 1G2CB 2M3BA 1KYOI 1YQ4C 1ZXGA 3PP5A 3PJSK 2E74D 3VMAA 1FOSF 2E5TA 1NWQA 1AVOA 3HRNA 2OYIB 2KNCA 3I5CA 1NVOA 1NU1K 3VP8A 3M0DA 3O8ZA 2Q7CA 1LTJB 2IZ0A 2N1TA 2M8RA 2YO3A 3CLQA 2OTLP 3S1KA 2YKQA 3H1KG 2FFDC 1PP9J 3EQ2A 2H8PD 1MZ9A 1SQBK 1GMJA 3MP7B 5AW7B 1VDFA 3L70G 1BCCJ 3L71E 3BASA 3O6QA 1YI2P 1KILC 1YTZT 2GM4A 3GF7A 3OJAB 4LLHA 3C9IA 1VQLP 1GK4A 1NTZJ 1KD1Q 2QJPB 5KTBA 1N7LA 2D2CD 2E75B 3BRVB 2R5DA 1OVUA 3HD7D 3Q2YA 1HWTC 1MUUA 1OIPA 4K35A 2HFED 3VTPC 3B5NA 2LKMA 2G3AA 2P1JA 5AVZB 1BDCA 3A0HH 1FDOA 3Q3DA 3HE4A 3G6EP 1OFCX 1NTKK 2ZXXA 3BATA 2PFXA 3LIDA 4H44D 3KPEA 2KZJA 1UIXA 1OZHA 2YMKA 3Q5PA 5APSA 4JYCA 1SVFA 1AVYA 5AVYB 3EWKA 2QRXA 4W80A 1G1IA 2A45I 1W2EA 3H32A 2IBZI 1X0TA 3P8MC 2WITA 3L73E 2QSIA 3IR9A 1BGYJ 1L4AD 4PV1D 4DT0A 3L73D 1NHLA 5TISE 3GMAA 1BE3E 2FFDA 3VMYA 2OTJP 1SQPJ 2BCCG 1LT1A 1SS1A 1NOHA 5CCGC 1BE3D 1Y8AA 4W7YA 4AYCA 2HLOA 2KLUA 3A5TA 1U7MA 1L0NG 3H1LG 4C7NA 5APYA 1KILA 4I7ZB 3S9OA 2AEFA 3L37A 1S9KE 1KYOD 1AV1A 5AW0B 4KT0J 1N7SB 1FZGA 1PP9E 1S9KD 1QLED 2WPRA 1ZMEC 1PP9D 1PGPA 2WPVB 1EDIA 1BCCE 2K1AA 3TGUG 4UB6H 1KQGB 2KLVA 4WY4C 4N78E 4WBAA 3U59A 4D6TJ 3H1IJ 3L36A 3VYIA 4HYTB 4IFFA 3AECC 4OGQC 1NTZE 3CX5H 1R5LA 1P84I 1GZLA 3M9QA 1OVVA 1RE3C 2ZT9D 1JB0J 1NTZD 4NPDA 3CMEP 4RJTA 5AVQB 3V2NA 2YKOA 2OYHC 5KLIC 3H1HJ 1RY3A 4XE5B 1USDA 5B66H 1L0LJ 2V4HA 1M1JC 4K3AA 2M5AA 1IK9A 2D2CB 2O3JA 1KQSO 2W8ZA 1FC2C 3EFFK 3HD7B 3GG2A 5CCGA 1D7MA 1GL2D 1EXJA 3F5HA 3K5BA 5GTHE 3MUDC 2ZYGA 1ZR4A 1Q90D 1FAVA 1KYOH 2Y0EA 1PV3A 4C7RA 3P7KA 1BGYE 4WB4A 5KAIE 4H44B 1VQ8P 3M9BA 3V4WA 1BGYD 3G3ZA 3RK2B 1SQPE 3TNUB 1L0NK 2H88C 1SQPD 2FYUJ 1BSHA 5CCHD 3C1LA 2IBZD 1IFIA 1URQA 3LW5J 3TF5A 1M8OB 3L73G 1FZEA 3D6YA 2XKMA 4WY4A 5KLVD 1L4AB 4PV1B 1VQPP 1VF5B 2WMMA 1BE3G 3HE5B 2OYIA 1HBWA 4LGDE 2BEQD 2K88A 1RE3A 2J5UA 2E43A 3RBZA 5AW2B 1SQQJ 1KC8Q 3NXSA 2WZ7A 4PD4I 1NKZB 3P8CD 1LTJA 1J1EB 2B87B 2LXCB 2O01J 4YPCA 4IFMA 4OGQD 3MIWA 3CCQP 3TYYA 1NTMD 2QEXP 2PGDA 3CPWO 2PAJA 4D6TE 1M1JA 3H1IE 2CPSA 1SQXG 5KAFE 2XNXA 1FZFA 3L72J 3W67A 2MJZA 5AW1B 2Q9IA 1Y47A 1NAYA 2H7HA 2XV5A 2HPCB 2R44A 3Q5RA 3MUDA 5GTHH 2KSJA 1PPJE 1N7SC 2IZ1A 1SQVG 2ZJSE 1P84E 1QGKB 4H13C 2WPSA 2WSCH 1PPJD 1P84D 1NTZG 2IPPA 1JY2O 4XFJA 2DW3A 3HTKA 2WSFH 2A45H 1DEEG 3VMZA 4IL6H 3D6ZA 3CWBJ 2ZT9B 4I6MC 2Q6QA 1H88A 2YMYA 1EC5A 1LNQA 2V7QJ 2W6BA 5CJ0A 4HJGH 3GW6A 4EI2A 3KXDA 3A0BH 5AVUB 1N73B 3HUSB 2B9BA 5AW6B 2N1TC 2K37A 5B5EH 3KDPB 1XTGB 3I55P 1JY3O 4Y99C 4N3YB 1S5LX 2QE7H 4O9BA 2LR2A 3JCUE 3AE1C 3MHVA 1LJ2A 2KSEA 1GL2B 4ZMDA 1RQUA 2FYUE 2E42A 1LP1B 2W6AA 2FYNC 3AEFC 2WQYC 2Y9ZA 3NMDA 2FYUD 1GD2E 4KJMA 1EQ7A 4U3FD 5EFWB 2A45G 1S5LE 2OTKE 5AW3B 3RL0D 3B5NC 2IBZG 1AQTA 3GF3A 5KKZC 1SQQE 3VP9A 1X8YA 3TK1A 2KXPB 3M06A 1LTGC 5KLVG 1SQQD 3N7NA 1N7SA 4ASVA 4GOFA 2YXQB 1P84H 2JWDA 1SFCB 1JOCA 3AE7C 1YYCA 1SQXK 3H1JJ 4EIJA 2JWAA 1H89A 1K04A 1AFOA 4L73A 3L72E 4PD4E 3WUUA 1YQ3C 2HYNA 1ZLLA 3ZDMA 1MKMA 1FE6A 5CMZA 2Q3IA 4PD4D 1CW5A 2QJYC 1NTMG 1SLQA 4H13D 3A7OA 4M3LA 1SQVK 3IFMA 3WMM0 1EDJA 4GIFA 1BDDA 1MFZA 1T3UA 4EDFA 2L91A 1M57D 3IAOA 2QVAA 3CWBE 3V2PA 1FJPA 2Q1KA 4QMAA 3CWBD 3MZWB 3AE9C 5AW4B 1HJBA 4DZOA 3L71D 1PPJG 2WSEJ 5AW9B 1LTBC 1FDMA 3E1RA 2FBWC 3HD7A 1NU1J 1VQNP 1FZCB 2BASA 3SFEC 1L2PA 3GHGC 1GW3A 3R2PA 2QJKB 1X9VA 1FU1A 3RK3B 3FX0A 2KOGA 2B89A 4JBZA 4YXDC 1SQBJ 4ASWA 4YTPC 2YKPA 3OW2O 1K73Q 1AA0A 1HUCA 1EZVI 3MTUE 3B5ND 3TNUA 1H0TB 2HODB 1M1KQ 4PD4H 5AVVB 3P32A 4W7ZA 2A06E 5AW5B 2QM7A 4NPFX 5KLVK 5KJ7C 2L5GB 2A06D 2KZIA 3T97B 3MGNA 1RH5B 2YXRB 4U3FG 2NPSC 2ZAEB 1PGQA 3D71A 3CD6P 3CC7P 1CI6A 3Q5SA 1NTKJ 2C9LY 3RL0B 3CCSP 3TSIA 1GU4A 3II6A 1Q86Q 1NTMK 4UB8E 1VPCA 4OH8B 1LTSC 3AEAC 4DJGA 3V2QA 2FXMA 3NTNA 1IFPA 1BSNA 1K8AQ 4H0LB 3FWLA 2E76C 1Q7YQ 4CPGA 2E74B 1KILE 2ZFCA 3QWOC 3A2AA 3GHGA 2R3CA 1KILD 2JR8A 3AE2C 1QEXA 1KTMA 1URQC 2PRRA 1IO4A 3L74J 5APUA 1BCCD 3RGUA 1YBKA 2M0BA 1VQKP 1J1DB 2HG5D 3AEEC 3CCRP 4N78D 3L75J 1MV8A 2OYIC 1G1JA 1NU1E 2AXTE 2KNCB 5L8RJ 1A02J 4JPZB 4KHXA 3AEDC 2OARA 2W83C 3H1KJ 4JYBA 3AE3C 1YTZI 5K5GB 2R5BA 4JF7A 5CBOA 3E1IA 1LTJC 1IFNA 1IZNB 2VRSA 1FJKA 1N73A 3L71G 5KJ7A 1JUNA 1PIXA 2JEEA 1GDTA 4IOIH 3L70J 4TLFA 3IN6A 5GTIE 1JY2N 1OWAA 1MFTA 2NPSA 2YIUB 5TISH 2CPBA 1RF0C 5M1BA 1LP1A 2IFMA 2WPQA 1QX8A 1LT9B 1LWUB 2JO1A 3V2RA 1CZQA 2QJPC 2E75C 4ZKPA 2ZYAA 1E5WA 1EZVE 4ZKUA 2WTYA 4Z1MH 3MD0A 1JNMA 2WWWA 2IYPA 5CCGD 1JY3N 1ZP0C 2W90A 1EZVD 1RE4C 2WT7A 1OVRA 2P2UA 1NTKE 1HJ0A 1OXZA 1WRGA 2QG4A 1KFMA 1NTKD 2A06G 2PP6A 2Q3EA 1G2CA 1SFCA 2E76D 3EFGA 2JDIH 2QA4P 2P7JA 1Z56A 2WSEH 4EYYQ 1KQLA 1ZOYC 2RKLA 2QIWA 1URQD 1RHZB 2MKVA 1NO4A 1QL2A 4WY4D 1KFNA 1Q81Q 1K9MQ 4TT3H 1GK6A 2BCCJ 2KK7A 2P67A 2KI7B 1T2KC 3L74E 2FFDB 1ZW0A 1L0NJ 2K9YA 3L74D 1K05A 3SFDC 1ZN5A 3L75E 3H1LJ 3USSA 1PP9G 4D6TD 1KORA 3H1ID 2H43A 2O01N 2WVRA 1VQ9P 1CSBA 1RF0A 1HGVA 2XDJA 3L75D 3H1KE 1YITP 3SWYA 5APXA 1KILB 4I7ZC 1BCCG 3H1HE 1T3JA 5AW8B 1L0LE 4C46A 1DX7A 4HB1A 3H1HD 3CCMP 3L70E 3M0AA 3CCEP 1Q82Q 5KAIH 1L0LD 3TGUJ 2C0XA 1YJNP 2E5YA 1RE4A 2FKWB 4OVNF 1VQOP 3C8VA 1NAFA 3L35A 2B88A 2ITAA 4A7PA 1PL5A 1EXIA 1ZRTE 1H0TA 2IDBA 2HODA 1ZRTD 2JJLA 2KUBA 1S1CX 3S4RA 2K9JB 1RQVA 5APWA 3OAKA 2QM8A 2KIKA 3T97A 3CX5I 1FOSE 4GDOA 2D2CC 1KB9I 1E79H 1BGYG 2SPZA 3HD7C 2AXCA 1T6AA 1YJWP 3VMXA 1W2BO 1DD4A 5KAFH 3BRTB 1SQPG 3SWKA 1NGMB 3UIAA 4L74A 5AVXB 1QVGO 5DJTB 2GA1A 2BCCE 3JC22 3KZIE 4H44C 3CCLP 3CMAP 3VN0A 3RK2C 1QVFO 1X79B 2Z4EA 1L0NE 2GUVA 1U7JA 1H8AA 1LTTC 3H1LE 4U7JA 3PH0A 3AE4C 1L0ND 1VQ7P 3H1LD 1N7SD 1BE3J 4WY4B 3L72D 2G8YA 1L4AC 1N86A 4PV1C 4Y28J 4OGQB 1VF5C 3L74G 4GOEA 2XZRA 3IF4A 2BEZF 2I1JA 3PHLA 3CXHI 2OGUA 4D6TG 3H1IG 1NTZK 3TGUE 3L75G 3E7KA 2Z5IA 1PGOA 2OYHB 4DOJA 2RMZA 3RBXA 5KLIB 3TGUD 1J1EC 1JCCA 3KYQA 3JCUH 1IK7A 2N1TD 1SQXJ 4GKGA 3BCCJ 3GLMA 1M1JB 3H1HG 3SSUA 4IFDK 1HF9A 1R5SA 2M3EA 1L0LG 3LW5H 2ZYDA 1VQ5P 1LTIC 2C0WA 1XTCC 1VQMP 2KP8A 4GT1A 3WUTA 1J2JB 2I8DA 1SQVJ 1LT9A 1S5LH 1LWUA 2R32A 3CC4P 1UIIA 4RO0A 3F89A 3KZIH 4GODA 3H6PA 2O01H 3HTKB 3PTZA 1YHQP 2Y0DA 2ZT9C 5BU8B 4UB6E 1SQPK 3CCUP 1LTAC 2O1JA 1EDKA 3CX5E 1U57A 2JP3A 1RF1B 2FYZA 1PGJA 4WWIA 1N73C 3HUSC 2FYUG 3V5BA 1VQ4P 1FBMA 3RK2D 1KB9E 1L4AA 3CX5D 1N8RQ 3B4SA 1KB9D 3HE5A 1VL2A 1AJYA 4R4LA 3H1JE 5B66E 4RESB 2P10A 1GL2C 1Q2NA 1Y9BA 1JMMA 2WSCJ 3H1JD 2OQQA 2B87A 2GUSA 3KQGA 1VF5D 1SQQG 2V7QH 2WSFJ 4BRYB 2IYOA 4RKUJ 2JKVA 4BXLA 3AEGC 2KS1B 1DD3A 3BVHA 1IJDB 1JTHB 5KLVJ 3JSVC 1KYOE 2IFNA 2KYVA 2HPCA 3OA7A 5CCHC 3L72G 1HTLC 4LC1A 1N2DC 2H89C 2RN0A 2Q5UA 1JCDA 1NJIQ 1SQXE 2AEJA 5E79E 3BCCE 1S3JA 4H13B 3CXHE 1L0LK 1SFCC 2KB7P 1NYHA 3G9RA 1SQXD 3VOPA 3BCCD 4ZNCA 1T8ZA 1JY2P 3CXHD 2RH0A 1NTMJ 2FXOA 3U1CA 3V4QA 4DCKA 1OMIA 4WVZA 2XU6A 1GTWA 1GU5A 2I1KA 1SQVE 1WMKA 1S72P 1NU1D 4PJ0E 3B8EB 1S4XA 3CWBG 1SQVD 2N1TB 3HUSA 1M56D 1AQ5A 1IFJA 1KB9H 1FDIA 1SQBE 1PFIA
chains in the Genus database with same CATH topology
2H43A 3VP9A 2ZXEB 2N9BA 1X8YA 1CSBA 1DEBA 1RF0A 1HGVA 5APVA 4Y99B 5APSA 3M06A 3TK1A 2XDJA 1JY3P 1LTGC 4JYCA 1SVFA 5AVYB 3N7NA 3SWYA 5APXA 1N7SA 1HH0A 1KILB 4W80A 1SFCB 1G1IA 1JOCA 3NFQA 2A45I 1GL2A 1T3JA 1YYCA 1W2EA 5BVZA 1SQXK 5KJ7D 5AW8B 4EIJA 4C46A 3H32A 1H89A 2J58A 1AFOA 1DX7A 2FYUK 3P8MC 4I1LA 3M0AA 2WITA 1FZAA 2HYNA 3IR9A 2NPSD 1ZLLA 2C0XA 1L4AD 3CI9A 1RE4A 2FKWB 5CMZA 2Q3IA 1CW5A 1NHLA 2IX7C 1SLQA 1FZCC 1NAFA 3A7OA 2FFDA 4M3LA 4AQRD 1ZR2A 1SQVK 3VMYA 1LGHB 3L35A 3IFMA 3WMM0 4GIFA 3B5NB 1NOHA 5CCGC 1MFZA 4W7YA 4AYCA 1T3UA 2HLOA 3A5TA 3RK3C 3HE4B 5CCHA 1SP4A 1SQQK 4B86A 3U1AA 1WT6A 4C7NA 5APYA 1KILA 2HODA 3V2PA 1FJPA 2JJLA 3L37A 1S9KE 1NH4A 5AW0B 1N7SB 1FZGA 5AW4B 3L4FA 1HJBA 5APTA 1S9KD 2YNYA 5APWA 4DZOA 5AW9B 2WPRA 3OAKA 1LTBC 1FDMA 3H32B 2QM8A 3T97A 1RF1C 3HD7A 1FZCB 1SFCD 1FOSE 2BASA 4I2LC 1HGZA 2KLVA 3GHGC 3HD7C 1KZUB 4WY4C 4N78E 1GW3A 3R2PA 4WBAA 1X9VA 2YO2A 3U59A 5AVSB 3VMXA 3L36A 1FU1A 3VYIA 3RK3B 4HYTB 4IFFA 1CI6B 3P8CE 2KOGA 3BRTB 4EOTA 1GZLA 3UIAA 5AVXB 3M9QA 2OYHA 2YKPA 3RL0C 1RE3C 3LIEA 1NKNA 1HUCA 2W27A 3MTUE 1IFDA 5AVQB 2YKOA 3B5ND 3TNUA 3V2NA 2OYHC 3M91A 4C7NB 3VN0A 1RY3A 2HODB 4XE5B 3RK2C 1X79B 2Z4EA 2GUVA 1H8AA 4N6JA 5AVVB 3P32A 1LTTC 4W7ZA 1M1JC 5AW5B 2QM7A 1DH3A 5KLVK 5KJ7C 1FZCA 4XA4A 2L5GB 1IK9A 3MGNA 5CJ4A 3GHGB 1N7SD 3HD7B 4WY4B 2POHA 2NPSC 5CCGA 1GL2D 1L4AC 1N86A 3SWFA 1M7LA 1CI6A 2XZRA 2C9LY 2I1JA 1ZR4A 1J1DC 3RL0B 1NTZK 1FAVA 3TSIA 1GU4A 3II6A 4C7RA 3P7KA 1NTMK 4WB4A 1VPCA 4OH8B 1LTSC 2Z5IA 3V2QA 2OYHB 2FXMA 3M9BA 3V4WA 4DOJA 3NTNA 1J1EC 1JCCA 3KYQA 3G3ZA 3RK3D 3RK2B 3M0DC 1A02F 2N1TD 1QL1A 3M9HA 3TNUB 4GKGA 1M1JB 1L0NK 1RF1A 1ZV8A 5AVRB 4IFDK 5CCHD 1IC2A 3LW5H 2ZFCA 1LTIC 1IFIA 2C0WA 1URQA 1XTCC 1HVVA 3A2AA 3A3YB 1FZEA 3GHGA 2R3CA 1KILD 2XKMA 4WY4A 2KP8A 2NPSB 4GT1A 1J2JB 1L4AB 5CHXA 1URQC 1IO4A 5AVTB 1LT9A 2C9NY 1LWUA 5APUA 2R32A 3HE5B 4AUWA 2OYIA 1HBWA 1J1DB 4LGDE 2HG5D 1IFMA 5BU5A 1RE3A 1LT9C 2E43A 4N78D 1LWUC 1FZBA 1MV8A 5AW2B 2OYIC 3NXSA 1G1JA 3H6PA 1T2KD 1GW4A 2WZ7A 2O01H 1A02J 1NKZB 2O1KA 3P8CD 1LTJA 1J1EB 4KHXA 3HTKB 2OARA 4IFMA 3MIWA 2Z5HA 4JYBA 3TYYA 1YTZI 2J59M 5BU8B 4HH2A 2R5BA 4JF7A 1SQPK 2PAJA 1LTJC 1M1JA 3E1IA 1IFNA 2CPSA 2VRSA 1LTAC 2WT7B 1FJKA 1N73A 1JTHA 5APQA 5KJ7A 1JO5A 1JUNA 2O1JA 2JEEA 1GDTA 2XNXA 1FZFA 1RF1B 2FYZA 2MJZA 1N73C 3HUSC 5AW1B 3V5BA 1JY2N 1OWAA 2NPSA 2Q9IA 1FBMA 3RK2D 3N4XA 2H7HA 2XV5A 1L4AA 1URQB 3CL3D 5AVWB 2HPCB 1G2CB 2M3BA 2CPBA 1RF0C 3HE5A 3MUDA 3PP5A 2KSJA 2IFMA 2WPQA 1N7SC 1FOSF 1LT9B 4RESB 1LWUB 1NWQA 3HRNA 2WPSA 2OYIB 2WSCH 1GL2C 3V2RA 1JMMA 1CZQA 3I5CA 2IPPA 1JY2O 3HTKA 4ZKPA 1NU1K 1E5WA 4ZKUA 2GUSA 2WSFH 3KQGA 2A45H 3MD0A 3VP8A 2WTYA 3M0DA 3VMZA 1JNMA 2WWWA 5CCGD 1JY3N 3O8ZA 4I6MC 2Q7CA 1H88A 2YMYA 1LTJB 2W6BA 1RE4C 2N1TA 2M8RA 2YO3A 3CLQA 5CJ0A 2WT7A 2YKQA 2P2UA 2FFDC 1OXZA 3EQ2A 2H8PD 5AVUB 3BVHA 1WRGA 1MZ9A 3HUSB 1IJDB 5AW6B 1KFMA 1SQBK 2N1TC 1N73B 1JTHB 2PP6A 3KDPB 2IFNA 2KYVA 1VDFA 5AW7B 2HPCA 3OA7A 1XTGB 1G2CA 5CCHC 1HTLC 1SFCA 1JY3O 4LC1A 4Y99C 1N2DC 3EFGA 4N3YB 2P7JA 3BASA 1Z56A 4O9BA 2Q5UA 2WSEH 1JCDA 1KILC 1YTZT 2GM4A 1KQLA 1L0LK 1GL2B 1SFCC 2KB7P 3OJAB 4LLHA 2E42A 2W6AA 3C9IA 1GK4A 3VOPA 5KTBA 1N7LA 1T8ZA 1JY2P 1URQD 3BRVB 3NMDA 2R5DA 1NO4A 1QL2A 1GD2E 3HD7D 3U1CA 4WY4D 1KFNA 1HWTC 1MUUA 1GK6A 3V4QA 2HFED 2XU6A 1EQ7A 2I1KA 2P67A 3VTPC 1T2KC 1GTWA 3B5NA 1GU5A 2LKMA 2P1JA 5AVZB 3B8EB 2FFDB 2A45G 5AW3B 3HE4A 3RL0D 2N1TB 1NTKK 3HUSA 3B5NC 1AQ5A 3BATA 1IFJA 1ZN5A 3LIDA 3KPEA 1PFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1T D;  1GL2 C;  2XDJ A;  3HD7 C;  4WY4 C;  4N78 E;  5CCH D;  1N7S A;  1KIL B;  3RK3 B;  4W80 A;  1SFC B;  3P8C E;  2KOG A;  1URQ A;  5CCG D;  1GL2 A;  1HVV A;  1T3J A;  2YMY A;  5KJ7 D;  1KIL D;  4WY4 A;  2NPS B;  2N1T A;  2M8R A;  3RL0 C;  1L4A B;  1URQ C;  2NPS D;  2H8P D;  3B5N D;  1L4A D;  2N1T C;  1JTH B;  4LGD E;  2HG5 D;  1NHL A;  2PP6 A;  3RK2 C;  1XTG B;  5CCH C;  1SFC A;  4W7Z A;  2WZ7 A;  3B5N B;  5CCG C;  3HTK B;  4W7Y A;  5KJ7 C;  1KIL C;  3RK3 C;  1GL2 B;  1SFC C;  5CCH A;  4JF7 A;  1N7S D;  3HD7 B;  4WY4 B;  2NPS C;  5CCG A;  3VOP A;  1JTH A;  1URQ D;  5KJ7 A;  1GL2 D;  1L4A C;  1KIL A;  3HD7 D;  4WY4 D;  2HFE D;  1N7S B;  2NPS A;  3RK2 D;  3RL0 B;  3B5N A;  3TSI A;  1L4A A;  1URQ B;  4OH8 B;  3RL0 D;  2N1T B;  3PP5 A;  3B5N C;  3HD7 A;  3KYQ A;  1N7S C;  3RK3 D;  3RK2 B;  1SFC D;  3M0D C; 
#chains in the Genus database with same CATH topology
 2ZXE B;  2N9B A;  3Q1M A;  1DEB A;  4R4M A;  5APV A;  4Y99 B;  3WUV A;  1JY3 P;  5CBN A;  1KN7 A;  1SQB D;  2K9J A;  3AE5 C;  2OYO A;  1HH0 A;  2N9Y B;  3NFQ A;  1GL2 A;  5BVZ A;  5KJ7 D;  3O6Q B;  2FYN B;  4NPE A;  2J58 A;  2FYU K;  4I1L A;  2FXP A;  1FZA A;  4UB8 H;  2NPS D;  3CI9 A;  1S2E A;  4IL6 X;  3QH9 A;  2IX7 C;  3ITK A;  1FZC C;  2LXB A;  4AQR D;  1ZR2 A;  1LGH B;  1JEK A;  3B5N B;  2QJK C;  5KKZ B;  2W6J H;  2WSS H;  3RK3 C;  1YIJ P;  3HE4 B;  5CCH A;  1SP4 A;  3D70 A;  1SQQ K;  4B86 A;  3U1A A;  1WT6 A;  4BWN A;  2UWJ E;  3AE6 C;  4IL6 E;  5E79 H;  4HKZ H;  3CXH H;  1NH4 A;  2IBZ E;  3L4F A;  5APT A;  1TU3 F;  2ZVO B;  2YNY A;  3FXE A;  3A0B E;  5KLV E;  3H1J G;  2AXT H;  3H32 B;  4U3F J;  1RF1 C;  5B5E E;  2QJY B;  1SFC D;  4PJ0 H;  4I2L C;  1HGZ A;  1KZU B;  2ZVN B;  3G4S P;  2YO2 A;  5AVS B;  3AE8 C;  5H2F E;  1CI6 B;  3P8C E;  4JQ0 D;  3CCJ P;  4EOT A;  2NZ2 A;  2Y9Y A;  5GTI H;  2OYH A;  1DIP A;  1NTM E;  2K3R A;  3RL0 C;  1KV4 A;  3LIE A;  1NKN A;  4MN4 C;  2W27 A;  1IFD A;  5DJU B;  3M91 A;  4C7N B;  3AEB C;  1JMB A;  4H0L C;  3I56 P;  1EDL A;  3H1K D;  4N6J A;  2Y0C A;  4L75 A;  3BCC G;  3FXD A;  1DH3 A;  2P58 A;  3WU2 E;  2E74 C;  1FZC A;  4XA4 A;  1USE A;  2AEM A;  1PZQ A;  2R3S A;  1OW8 A;  3CC2 P;  5CJ4 A;  3GHG B;  1KMI Z;  3L70 D;  2POH A;  1NU1 G;  4OWF A;  1VQ6 P;  3B71 A;  1KQF B;  3SWF A;  1JM0 A;  1M7L A;  3FWN A;  4L76 A;  2E75 D;  1YJ9 P;  3KHU A;  1J1D C;  3ABV C;  1W5C E;  3RK3 E;  1OX3 A;  1SQB G;  5C39 A;  2CK3 H;  3PLN A;  3RK3 D;  2XND H;  3L71 J;  3M0D C;  3CCV P;  1A02 F;  1QL1 A;  3M9H A;  1RF1 A;  1ZV8 A;  5AVR B;  1IC2 A;  3H25 A;  1OW6 A;  1HVV A;  3W68 A;  2HR3 A;  3A3Y B;  2NPS B;  1X22 A;  2M5A B;  2YIU C;  3TDK A;  5CHX A;  3RL0 g;  1EZV G;  5AVT B;  5H2F H;  2C9N Y;  3PRJ A;  4AUW A;  3R4Y A;  1IFM A;  5BU5 A;  1LT9 C;  1LWU C;  1FZB A;  1NTK G;  4U3F E;  1T2K D;  1GW4 A;  2FY8 A;  4BRY A;  2O1K A;  1M90 Q;  3V6I A;  5TJH A;  2Z5H A;  1FS0 E;  2J59 M;  2KS1 A;  4HH2 A;  2E76 B;  2WT7 B;  2BCC D;  3WU2 H;  1JTH A;  5APQ A;  1JO5 A;  3A0H E;  3G71 P;  1R8E A;  2NRG A;  3L73 J;  4H0L D;  3FGA D;  4YXW H;  3N4X A;  1OW7 A;  1URQ B;  3CL3 D;  5AVW B;  1G2C B;  2M3B A;  1KYO I;  1YQ4 C;  1ZXG A;  3PP5 A;  3PJS K;  2E74 D;  3VMA A;  1FOS F;  2E5T A;  1NWQ A;  1AVO A;  3HRN A;  2OYI B;  2KNC A;  3I5C A;  1NVO A;  1NU1 K;  3VP8 A;  3M0D A;  3O8Z A;  2Q7C A;  1LTJ B;  2IZ0 A;  2N1T A;  2M8R A;  2YO3 A;  3CLQ A;  2OTL P;  3S1K A;  2YKQ A;  3H1K G;  2FFD C;  1PP9 J;  3EQ2 A;  2H8P D;  1MZ9 A;  1SQB K;  1GMJ A;  3MP7 B;  5AW7 B;  1VDF A;  3L70 G;  1BCC J;  3L71 E;  3BAS A;  3O6Q A;  1YI2 P;  1KIL C;  1YTZ T;  2GM4 A;  3GF7 A;  3OJA B;  4LLH A;  3C9I A;  1VQL P;  1GK4 A;  1NTZ J;  1KD1 Q;  2QJP B;  5KTB A;  1N7L A;  2D2C D;  2E75 B;  3BRV B;  2R5D A;  1OVU A;  3HD7 D;  3Q2Y A;  1HWT C;  1MUU A;  1OIP A;  4K35 A;  2HFE D;  3VTP C;  3B5N A;  2LKM A;  2G3A A;  2P1J A;  5AVZ B;  1BDC A;  3A0H H;  1FDO A;  3Q3D A;  3HE4 A;  3G6E P;  1OFC X;  1NTK K;  2ZXX A;  3BAT A;  2PFX A;  3LID A;  4H44 D;  3KPE A;  2KZJ A;  1UIX A;  1OZH A;  2YMK A;  3Q5P A;  5APS A;  4JYC A;  1SVF A;  1AVY A;  5AVY B;  3EWK A;  2QRX A;  4W80 A;  1G1I A;  2A45 I;  1W2E A;  3H32 A;  2IBZ I;  1X0T A;  3P8M C;  2WIT A;  3L73 E;  2QSI A;  3IR9 A;  1BGY J;  1L4A D;  4PV1 D;  4DT0 A;  3L73 D;  1NHL A;  5TIS E;  3GMA A;  1BE3 E;  2FFD A;  3VMY A;  2OTJ P;  1SQP J;  2BCC G;  1LT1 A;  1SS1 A;  1NOH A;  5CCG C;  1BE3 D;  1Y8A A;  4W7Y A;  4AYC A;  2HLO A;  2KLU A;  3A5T A;  1U7M A;  1L0N G;  3H1L G;  4C7N A;  5APY A;  1KIL A;  4I7Z B;  3S9O A;  2AEF A;  3L37 A;  1S9K E;  1KYO D;  1AV1 A;  5AW0 B;  4KT0 J;  1N7S B;  1FZG A;  1PP9 E;  1S9K D;  1QLE D;  2WPR A;  1ZME C;  1PP9 D;  1PGP A;  2WPV B;  1EDI A;  1BCC E;  2K1A A;  3TGU G;  4UB6 H;  1KQG B;  2KLV A;  4WY4 C;  4N78 E;  4WBA A;  3U59 A;  4D6T J;  3H1I J;  3L36 A;  3VYI A;  4HYT B;  4IFF A;  3AEC C;  4OGQ C;  1NTZ E;  3CX5 H;  1R5L A;  1P84 I;  1GZL A;  3M9Q A;  1OVV A;  1RE3 C;  2ZT9 D;  1JB0 J;  1NTZ D;  4NPD A;  3CME P;  4RJT A;  5AVQ B;  3V2N A;  2YKO A;  2OYH C;  5KLI C;  3H1H J;  1RY3 A;  4XE5 B;  1USD A;  5B66 H;  1L0L J;  2V4H A;  1M1J C;  4K3A A;  2M5A A;  1IK9 A;  2D2C B;  2O3J A;  1KQS O;  2W8Z A;  1FC2 C;  3EFF K;  3HD7 B;  3GG2 A;  5CCG A;  1D7M A;  1GL2 D;  1EXJ A;  3F5H A;  3K5B A;  5GTH E;  3MUD C;  2ZYG A;  1ZR4 A;  1Q90 D;  1FAV A;  1KYO H;  2Y0E A;  1PV3 A;  4C7R A;  3P7K A;  1BGY E;  4WB4 A;  5KAI E;  4H44 B;  1VQ8 P;  3M9B A;  3V4W A;  1BGY D;  3G3Z A;  3RK2 B;  1SQP E;  3TNU B;  1L0N K;  2H88 C;  1SQP D;  2FYU J;  1BSH A;  5CCH D;  3C1L A;  2IBZ D;  1IFI A;  1URQ A;  3LW5 J;  3TF5 A;  1M8O B;  3L73 G;  1FZE A;  3D6Y A;  2XKM A;  4WY4 A;  5KLV D;  1L4A B;  4PV1 B;  1VQP P;  1VF5 B;  2WMM A;  1BE3 G;  3HE5 B;  2OYI A;  1HBW A;  4LGD E;  2BEQ D;  2K88 A;  1RE3 A;  2J5U A;  2E43 A;  3RBZ A;  5AW2 B;  1SQQ J;  1KC8 Q;  3NXS A;  2WZ7 A;  4PD4 I;  1NKZ B;  3P8C D;  1LTJ A;  1J1E B;  2B87 B;  2LXC B;  2O01 J;  4YPC A;  4IFM A;  4OGQ D;  3MIW A;  3CCQ P;  3TYY A;  1NTM D;  2QEX P;  2PGD A;  3CPW O;  2PAJ A;  4D6T E;  1M1J A;  3H1I E;  2CPS A;  1SQX G;  5KAF E;  2XNX A;  1FZF A;  3L72 J;  3W67 A;  2MJZ A;  5AW1 B;  2Q9I A;  1Y47 A;  1NAY A;  2H7H A;  2XV5 A;  2HPC B;  2R44 A;  3Q5R A;  3MUD A;  5GTH H;  2KSJ A;  1PPJ E;  1N7S C;  2IZ1 A;  1SQV G;  2ZJS E;  1P84 E;  1QGK B;  4H13 C;  2WPS A;  2WSC H;  1PPJ D;  1P84 D;  1NTZ G;  2IPP A;  1JY2 O;  4XFJ A;  2DW3 A;  3HTK A;  2WSF H;  2A45 H;  1DEE G;  3VMZ A;  4IL6 H;  3D6Z A;  3CWB J;  2ZT9 B;  4I6M C;  2Q6Q A;  1H88 A;  2YMY A;  1EC5 A;  1LNQ A;  2V7Q J;  2W6B A;  5CJ0 A;  4HJG H;  3GW6 A;  4EI2 A;  3KXD A;  3A0B H;  5AVU B;  1N73 B;  3HUS B;  2B9B A;  5AW6 B;  2N1T C;  2K37 A;  5B5E H;  3KDP B;  1XTG B;  3I55 P;  1JY3 O;  4Y99 C;  4N3Y B;  1S5L X;  2QE7 H;  4O9B A;  2LR2 A;  3JCU E;  3AE1 C;  3MHV A;  1LJ2 A;  2KSE A;  1GL2 B;  4ZMD A;  1RQU A;  2FYU E;  2E42 A;  1LP1 B;  2W6A A;  2FYN C;  3AEF C;  2WQY C;  2Y9Z A;  3NMD A;  2FYU D;  1GD2 E;  4KJM A;  1EQ7 A;  4U3F D;  5EFW B;  2A45 G;  1S5L E;  2OTK E;  5AW3 B;  3RL0 D;  3B5N C;  2IBZ G;  1AQT A;  3GF3 A;  5KKZ C;  1SQQ E;  3VP9 A;  1X8Y A;  3TK1 A;  2KXP B;  3M06 A;  1LTG C;  5KLV G;  1SQQ D;  3N7N A;  1N7S A;  4ASV A;  4GOF A;  2YXQ B;  1P84 H;  2JWD A;  1SFC B;  1JOC A;  3AE7 C;  1YYC A;  1SQX K;  3H1J J;  4EIJ A;  2JWA A;  1H89 A;  1K04 A;  1AFO A;  4L73 A;  3L72 E;  4PD4 E;  3WUU A;  1YQ3 C;  2HYN A;  1ZLL A;  3ZDM A;  1MKM A;  1FE6 A;  5CMZ A;  2Q3I A;  4PD4 D;  1CW5 A;  2QJY C;  1NTM G;  1SLQ A;  4H13 D;  3A7O A;  4M3L A;  1SQV K;  3IFM A;  3WMM 0;  1EDJ A;  4GIF A;  1BDD A;  1MFZ A;  1T3U A;  4EDF A;  2L91 A;  1M57 D;  3IAO A;  2QVA A;  3CWB E;  3V2P A;  1FJP A;  2Q1K A;  4QMA A;  3CWB D;  3MZW B;  3AE9 C;  5AW4 B;  1HJB A;  4DZO A;  3L71 D;  1PPJ G;  2WSE J;  5AW9 B;  1LTB C;  1FDM A;  3E1R A;  2FBW C;  3HD7 A;  1NU1 J;  1VQN P;  1FZC B;  2BAS A;  3SFE C;  1L2P A;  3GHG C;  1GW3 A;  3R2P A;  2QJK B;  1X9V A;  1FU1 A;  3RK3 B;  3FX0 A;  2KOG A;  2B89 A;  4JBZ A;  4YXD C;  1SQB J;  4ASW A;  4YTP C;  2YKP A;  3OW2 O;  1K73 Q;  1AA0 A;  1HUC A;  1EZV I;  3MTU E;  3B5N D;  3TNU A;  1H0T B;  2HOD B;  1M1K Q;  4PD4 H;  5AVV B;  3P32 A;  4W7Z A;  2A06 E;  5AW5 B;  2QM7 A;  4NPF X;  5KLV K;  5KJ7 C;  2L5G B;  2A06 D;  2KZI A;  3T97 B;  3MGN A;  1RH5 B;  2YXR B;  4U3F G;  2NPS C;  2ZAE B;  1PGQ A;  3D71 A;  3CD6 P;  3CC7 P;  1CI6 A;  3Q5S A;  1NTK J;  2C9L Y;  3RL0 B;  3CCS P;  3TSI A;  1GU4 A;  3II6 A;  1Q86 Q;  1NTM K;  4UB8 E;  1VPC A;  4OH8 B;  1LTS C;  3AEA C;  4DJG A;  3V2Q A;  2FXM A;  3NTN A;  1IFP A;  1BSN A;  1K8A Q;  4H0L B;  3FWL A;  2E76 C;  1Q7Y Q;  4CPG A;  2E74 B;  1KIL E;  2ZFC A;  3QWO C;  3A2A A;  3GHG A;  2R3C A;  1KIL D;  2JR8 A;  3AE2 C;  1QEX A;  1KTM A;  1URQ C;  2PRR A;  1IO4 A;  3L74 J;  5APU A;  1BCC D;  3RGU A;  1YBK A;  2M0B A;  1VQK P;  1J1D B;  2HG5 D;  3AEE C;  3CCR P;  4N78 D;  3L75 J;  1MV8 A;  2OYI C;  1G1J A;  1NU1 E;  2AXT E;  2KNC B;  5L8R J;  1A02 J;  4JPZ B;  4KHX A;  3AED C;  2OAR A;  2W83 C;  3H1K J;  4JYB A;  3AE3 C;  1YTZ I;  5K5G B;  2R5B A;  4JF7 A;  5CBO A;  3E1I A;  1LTJ C;  1IFN A;  1IZN B;  2VRS A;  1FJK A;  1N73 A;  3L71 G;  5KJ7 A;  1JUN A;  1PIX A;  2JEE A;  1GDT A;  4IOI H;  3L70 J;  4TLF A;  3IN6 A;  5GTI E;  1JY2 N;  1OWA A;  1MFT A;  2NPS A;  2YIU B;  5TIS H;  2CPB A;  1RF0 C;  5M1B A;  1LP1 A;  2IFM A;  2WPQ A;  1QX8 A;  1LT9 B;  1LWU B;  2JO1 A;  3V2R A;  1CZQ A;  2QJP C;  2E75 C;  4ZKP A;  2ZYA A;  1E5W A;  1EZV E;  4ZKU A;  2WTY A;  4Z1M H;  3MD0 A;  1JNM A;  2WWW A;  2IYP A;  5CCG D;  1JY3 N;  1ZP0 C;  2W90 A;  1EZV D;  1RE4 C;  2WT7 A;  1OVR A;  2P2U A;  1NTK E;  1HJ0 A;  1OXZ A;  1WRG A;  2QG4 A;  1KFM A;  1NTK D;  2A06 G;  2PP6 A;  2Q3E A;  1G2C A;  1SFC A;  2E76 D;  3EFG A;  2JDI H;  2QA4 P;  2P7J A;  1Z56 A;  2WSE H;  4EYY Q;  1KQL A;  1ZOY C;  2RKL A;  2QIW A;  1URQ D;  1RHZ B;  2MKV A;  1NO4 A;  1QL2 A;  4WY4 D;  1KFN A;  1Q81 Q;  1K9M Q;  4TT3 H;  1GK6 A;  2BCC J;  2KK7 A;  2P67 A;  2KI7 B;  1T2K C;  3L74 E;  2FFD B;  1ZW0 A;  1L0N J;  2K9Y A;  3L74 D;  1K05 A;  3SFD C;  1ZN5 A;  3L75 E;  3H1L J;  3USS A;  1PP9 G;  4D6T D;  1KOR A;  3H1I D;  2H43 A;  2O01 N;  2WVR A;  1VQ9 P;  1CSB A;  1RF0 A;  1HGV A;  2XDJ A;  3L75 D;  3H1K E;  1YIT P;  3SWY A;  5APX A;  1KIL B;  4I7Z C;  1BCC G;  3H1H E;  1T3J A;  5AW8 B;  1L0L E;  4C46 A;  1DX7 A;  4HB1 A;  3H1H D;  3CCM P;  3L70 E;  3M0A A;  3CCE P;  1Q82 Q;  5KAI H;  1L0L D;  3TGU J;  2C0X A;  1YJN P;  2E5Y A;  1RE4 A;  2FKW B;  4OVN F;  1VQO P;  3C8V A;  1NAF A;  3L35 A;  2B88 A;  2ITA A;  4A7P A;  1PL5 A;  1EXI A;  1ZRT E;  1H0T A;  2IDB A;  2HOD A;  1ZRT D;  2JJL A;  2KUB A;  1S1C X;  3S4R A;  2K9J B;  1RQV A;  5APW A;  3OAK A;  2QM8 A;  2KIK A;  3T97 A;  3CX5 I;  1FOS E;  4GDO A;  2D2C C;  1KB9 I;  1E79 H;  1BGY G;  2SPZ A;  3HD7 C;  2AXC A;  1T6A A;  1YJW P;  3VMX A;  1W2B O;  1DD4 A;  5KAF H;  3BRT B;  1SQP G;  3SWK A;  1NGM B;  3UIA A;  4L74 A;  5AVX B;  1QVG O;  5DJT B;  2GA1 A;  2BCC E;  3JC2 2;  3KZI E;  4H44 C;  3CCL P;  3CMA P;  3VN0 A;  3RK2 C;  1QVF O;  1X79 B;  2Z4E A;  1L0N E;  2GUV A;  1U7J A;  1H8A A;  1LTT C;  3H1L E;  4U7J A;  3PH0 A;  3AE4 C;  1L0N D;  1VQ7 P;  3H1L D;  1N7S D;  1BE3 J;  4WY4 B;  3L72 D;  2G8Y A;  1L4A C;  1N86 A;  4PV1 C;  4Y28 J;  4OGQ B;  1VF5 C;  3L74 G;  4GOE A;  2XZR A;  3IF4 A;  2BEZ F;  2I1J A;  3PHL A;  3CXH I;  2OGU A;  4D6T G;  3H1I G;  1NTZ K;  3TGU E;  3L75 G;  3E7K A;  2Z5I A;  1PGO A;  2OYH B;  4DOJ A;  2RMZ A;  3RBX A;  5KLI B;  3TGU D;  1J1E C;  1JCC A;  3KYQ A;  3JCU H;  1IK7 A;  2N1T D;  1SQX J;  4GKG A;  3BCC J;  3GLM A;  1M1J B;  3H1H G;  3SSU A;  4IFD K;  1HF9 A;  1R5S A;  2M3E A;  1L0L G;  3LW5 H;  2ZYD A;  1VQ5 P;  1LTI C;  2C0W A;  1XTC C;  1VQM P;  2KP8 A;  4GT1 A;  3WUT A;  1J2J B;  2I8D A;  1SQV J;  1LT9 A;  1S5L H;  1LWU A;  2R32 A;  3CC4 P;  1UII A;  4RO0 A;  3F89 A;  3KZI H;  4GOD A;  3H6P A;  2O01 H;  3HTK B;  3PTZ A;  1YHQ P;  2Y0D A;  2ZT9 C;  5BU8 B;  4UB6 E;  1SQP K;  3CCU P;  1LTA C;  2O1J A;  1EDK A;  3CX5 E;  1U57 A;  2JP3 A;  1RF1 B;  2FYZ A;  1PGJ A;  4WWI A;  1N73 C;  3HUS C;  2FYU G;  3V5B A;  1VQ4 P;  1FBM A;  3RK2 D;  1KB9 E;  1L4A A;  3CX5 D;  1N8R Q;  3B4S A;  1KB9 D;  3HE5 A;  1VL2 A;  1AJY A;  4R4L A;  3H1J E;  5B66 E;  4RES B;  2P10 A;  1GL2 C;  1Q2N A;  1Y9B A;  1JMM A;  2WSC J;  3H1J D;  2OQQ A;  2B87 A;  2GUS A;  3KQG A;  1VF5 D;  1SQQ G;  2V7Q H;  2WSF J;  4BRY B;  2IYO A;  4RKU J;  2JKV A;  4BXL A;  3AEG C;  2KS1 B;  1DD3 A;  3BVH A;  1IJD B;  1JTH B;  5KLV J;  3JSV C;  1KYO E;  2IFN A;  2KYV A;  2HPC A;  3OA7 A;  5CCH C;  3L72 G;  1HTL C;  4LC1 A;  1N2D C;  2H89 C;  2RN0 A;  2Q5U A;  1JCD A;  1NJI Q;  1SQX E;  2AEJ A;  5E79 E;  3BCC E;  1S3J A;  4H13 B;  3CXH E;  1L0L K;  1SFC C;  2KB7 P;  1NYH A;  3G9R A;  1SQX D;  3VOP A;  3BCC D;  4ZNC A;  1T8Z A;  1JY2 P;  3CXH D;  2RH0 A;  1NTM J;  2FXO A;  3U1C A;  3V4Q A;  4DCK A;  1OMI A;  4WVZ A;  2XU6 A;  1GTW A;  1GU5 A;  2I1K A;  1SQV E;  1WMK A;  1S72 P;  1NU1 D;  4PJ0 E;  3B8E B;  1S4X A;  3CWB G;  1SQV D;  2N1T B;  3HUS A;  1M56 D;  1AQ5 A;  1IFJ A;  1KB9 H;  1FDI A;  1SQB E;  1PFI A; 
#chains in the Genus database with same CATH homology
 2H43 A;  3VP9 A;  2ZXE B;  2N9B A;  1X8Y A;  1CSB A;  1DEB A;  1RF0 A;  1HGV A;  5APV A;  4Y99 B;  5APS A;  3M06 A;  3TK1 A;  2XDJ A;  1JY3 P;  1LTG C;  4JYC A;  1SVF A;  5AVY B;  3N7N A;  3SWY A;  5APX A;  1N7S A;  1HH0 A;  1KIL B;  4W80 A;  1SFC B;  1G1I A;  1JOC A;  3NFQ A;  2A45 I;  1GL2 A;  1T3J A;  1YYC A;  1W2E A;  5BVZ A;  1SQX K;  5KJ7 D;  5AW8 B;  4EIJ A;  4C46 A;  3H32 A;  1H89 A;  2J58 A;  1AFO A;  1DX7 A;  2FYU K;  3P8M C;  4I1L A;  3M0A A;  2WIT A;  1FZA A;  2HYN A;  3IR9 A;  2NPS D;  1ZLL A;  2C0X A;  1L4A D;  3CI9 A;  1RE4 A;  2FKW B;  5CMZ A;  2Q3I A;  1CW5 A;  1NHL A;  2IX7 C;  1SLQ A;  1FZC C;  1NAF A;  3A7O A;  2FFD A;  4M3L A;  4AQR D;  1ZR2 A;  1SQV K;  3VMY A;  1LGH B;  3L35 A;  3IFM A;  3WMM 0;  4GIF A;  3B5N B;  1NOH A;  5CCG C;  1MFZ A;  4W7Y A;  4AYC A;  1T3U A;  2HLO A;  3A5T A;  3RK3 C;  3HE4 B;  5CCH A;  1SP4 A;  1SQQ K;  4B86 A;  3U1A A;  1WT6 A;  4C7N A;  5APY A;  1KIL A;  2HOD A;  3V2P A;  1FJP A;  2JJL A;  3L37 A;  1S9K E;  1NH4 A;  5AW0 B;  1N7S B;  1FZG A;  5AW4 B;  3L4F A;  1HJB A;  5APT A;  1S9K D;  2YNY A;  5APW A;  4DZO A;  5AW9 B;  2WPR A;  3OAK A;  1LTB C;  1FDM A;  3H32 B;  2QM8 A;  3T97 A;  1RF1 C;  3HD7 A;  1FZC B;  1SFC D;  1FOS E;  2BAS A;  4I2L C;  1HGZ A;  2KLV A;  3GHG C;  3HD7 C;  1KZU B;  4WY4 C;  4N78 E;  1GW3 A;  3R2P A;  4WBA A;  1X9V A;  2YO2 A;  3U59 A;  5AVS B;  3VMX A;  3L36 A;  1FU1 A;  3VYI A;  3RK3 B;  4HYT B;  4IFF A;  1CI6 B;  3P8C E;  2KOG A;  3BRT B;  4EOT A;  1GZL A;  3UIA A;  5AVX B;  3M9Q A;  2OYH A;  2YKP A;  3RL0 C;  1RE3 C;  3LIE A;  1NKN A;  1HUC A;  2W27 A;  3MTU E;  1IFD A;  5AVQ B;  2YKO A;  3B5N D;  3TNU A;  3V2N A;  2OYH C;  3M91 A;  4C7N B;  3VN0 A;  1RY3 A;  2HOD B;  4XE5 B;  3RK2 C;  1X79 B;  2Z4E A;  2GUV A;  1H8A A;  4N6J A;  5AVV B;  3P32 A;  1LTT C;  4W7Z A;  1M1J C;  5AW5 B;  2QM7 A;  1DH3 A;  5KLV K;  5KJ7 C;  1FZC A;  4XA4 A;  2L5G B;  1IK9 A;  3MGN A;  5CJ4 A;  3GHG B;  1N7S D;  3HD7 B;  4WY4 B;  2POH A;  2NPS C;  5CCG A;  1GL2 D;  1L4A C;  1N86 A;  3SWF A;  1M7L A;  1CI6 A;  2XZR A;  2C9L Y;  2I1J A;  1ZR4 A;  1J1D C;  3RL0 B;  1NTZ K;  1FAV A;  3TSI A;  1GU4 A;  3II6 A;  4C7R A;  3P7K A;  1NTM K;  4WB4 A;  1VPC A;  4OH8 B;  1LTS C;  2Z5I A;  3V2Q A;  2OYH B;  2FXM A;  3M9B A;  3V4W A;  4DOJ A;  3NTN A;  1J1E C;  1JCC A;  3KYQ A;  3G3Z A;  3RK3 D;  3RK2 B;  3M0D C;  1A02 F;  2N1T D;  1QL1 A;  3M9H A;  3TNU B;  4GKG A;  1M1J B;  1L0N K;  1RF1 A;  1ZV8 A;  5AVR B;  4IFD K;  5CCH D;  1IC2 A;  3LW5 H;  2ZFC A;  1LTI C;  1IFI A;  2C0W A;  1URQ A;  1XTC C;  1HVV A;  3A2A A;  3A3Y B;  1FZE A;  3GHG A;  2R3C A;  1KIL D;  2XKM A;  4WY4 A;  2KP8 A;  2NPS B;  4GT1 A;  1J2J B;  1L4A B;  5CHX A;  1URQ C;  1IO4 A;  5AVT B;  1LT9 A;  2C9N Y;  1LWU A;  5APU A;  2R32 A;  3HE5 B;  4AUW A;  2OYI A;  1HBW A;  1J1D B;  4LGD E;  2HG5 D;  1IFM A;  5BU5 A;  1RE3 A;  1LT9 C;  2E43 A;  4N78 D;  1LWU C;  1FZB A;  1MV8 A;  5AW2 B;  2OYI C;  3NXS A;  1G1J A;  3H6P A;  1T2K D;  1GW4 A;  2WZ7 A;  2O01 H;  1A02 J;  1NKZ B;  2O1K A;  3P8C D;  1LTJ A;  1J1E B;  4KHX A;  3HTK B;  2OAR A;  4IFM A;  3MIW A;  2Z5H A;  4JYB A;  3TYY A;  1YTZ I;  2J59 M;  5BU8 B;  4HH2 A;  2R5B A;  4JF7 A;  1SQP K;  2PAJ A;  1LTJ C;  1M1J A;  3E1I A;  1IFN A;  2CPS A;  2VRS A;  1LTA C;  2WT7 B;  1FJK A;  1N73 A;  1JTH A;  5APQ A;  5KJ7 A;  1JO5 A;  1JUN A;  2O1J A;  2JEE A;  1GDT A;  2XNX A;  1FZF A;  1RF1 B;  2FYZ A;  2MJZ A;  1N73 C;  3HUS C;  5AW1 B;  3V5B A;  1JY2 N;  1OWA A;  2NPS A;  2Q9I A;  1FBM A;  3RK2 D;  3N4X A;  2H7H A;  2XV5 A;  1L4A A;  1URQ B;  3CL3 D;  5AVW B;  2HPC B;  1G2C B;  2M3B A;  2CPB A;  1RF0 C;  3HE5 A;  3MUD A;  3PP5 A;  2KSJ A;  2IFM A;  2WPQ A;  1N7S C;  1FOS F;  1LT9 B;  4RES B;  1LWU B;  1NWQ A;  3HRN A;  2WPS A;  2OYI B;  2WSC H;  1GL2 C;  3V2R A;  1JMM A;  1CZQ A;  3I5C A;  2IPP A;  1JY2 O;  3HTK A;  4ZKP A;  1NU1 K;  1E5W A;  4ZKU A;  2GUS A;  2WSF H;  3KQG A;  2A45 H;  3MD0 A;  3VP8 A;  2WTY A;  3M0D A;  3VMZ A;  1JNM A;  2WWW A;  5CCG D;  1JY3 N;  3O8Z A;  4I6M C;  2Q7C A;  1H88 A;  2YMY A;  1LTJ B;  2W6B A;  1RE4 C;  2N1T A;  2M8R A;  2YO3 A;  3CLQ A;  5CJ0 A;  2WT7 A;  2YKQ A;  2P2U A;  2FFD C;  1OXZ A;  3EQ2 A;  2H8P D;  5AVU B;  3BVH A;  1WRG A;  1MZ9 A;  3HUS B;  1IJD B;  5AW6 B;  1KFM A;  1SQB K;  2N1T C;  1N73 B;  1JTH B;  2PP6 A;  3KDP B;  2IFN A;  2KYV A;  1VDF A;  5AW7 B;  2HPC A;  3OA7 A;  1XTG B;  1G2C A;  5CCH C;  1HTL C;  1SFC A;  1JY3 O;  4LC1 A;  4Y99 C;  1N2D C;  3EFG A;  4N3Y B;  2P7J A;  3BAS A;  1Z56 A;  4O9B A;  2Q5U A;  2WSE H;  1JCD A;  1KIL C;  1YTZ T;  2GM4 A;  1KQL A;  1L0L K;  1GL2 B;  1SFC C;  2KB7 P;  3OJA B;  4LLH A;  2E42 A;  2W6A A;  3C9I A;  1GK4 A;  3VOP A;  5KTB A;  1N7L A;  1T8Z A;  1JY2 P;  1URQ D;  3BRV B;  3NMD A;  2R5D A;  1NO4 A;  1QL2 A;  1GD2 E;  3HD7 D;  3U1C A;  4WY4 D;  1KFN A;  1HWT C;  1MUU A;  1GK6 A;  3V4Q A;  2HFE D;  2XU6 A;  1EQ7 A;  2I1K A;  2P67 A;  3VTP C;  1T2K C;  1GTW A;  3B5N A;  1GU5 A;  2LKM A;  2P1J A;  5AVZ B;  3B8E B;  2FFD B;  2A45 G;  5AW3 B;  3HE4 A;  3RL0 D;  2N1T B;  1NTK K;  3HUS A;  3B5N C;  1AQ5 A;  3BAT A;  1IFJ A;  1ZN5 A;  3LID A;  3KPE A;  1PFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...