1HTLC

Mutation of a buried residue causes lack of activity but no conformational change: crystal structure of e. coli heat-labile enterotoxin mutant val 97--> lys
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
41
structure length
41
Chain Sequence
GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Enterotoxin
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
publication title Mutation of a buried residue causes loss of activity but no conformational change in the heat-labile enterotoxin of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
total genus 15
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1995-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1htlC00
1LTSC 1LTAC 1LTTC 1XTCC 1LTGC 1HTLC 1LTBC 1LTIC
chains in the Genus database with same CATH superfamily
1LT9B 1JTHA 2IBZG 2QJKB 1OX3A 3PTZA 1H0TA 1P84I 2H43A 4PD4I 3L35A 1NU1E 2WSFJ 4W80A 2AEJA 1GW4A 1USDA 1CW5A 2CPSA 1R5LA 4UB8E 2B87B 1NO4A 3R4YA 3RK2D 2A45I 2C9LY 4I1LA 3MUDC 1LP1A 2XV5A 2C0XA 4I7ZC 1URQD 1KQLA 3RBXA 3SFEC 2M8RA 1USEA 4D6TJ 3VP9A 1IJDB 2YKPA 1YITP 1PGJA 2P1JA 1KB9D 4IL6E 1HH0A 4I6MC 3PRJA 4AYCA 2OYHB 2K9YA 2O01H 3V2NA 4C7RA 5AVWB 1NVOA 2N1TA 2R3SA 3S1KA 1BE3J 4QMAA 4U3FJ 1J1DC 2HG5D 2WT7A 2LXBA 5AW7B 2QIWA 1SFCA 5B5EH 3CD6P 1AA0A 3SWKA 4ZKPA 5CCHD 1PP9J 2WPRA 3HRNA 4PD4E 1FZCC 5CCGA 1KB9I 3CPWO 1VQPP 2QJPC 3MIWA 4C46A 1LTTC 5BVZA 1Q81Q 1EDLA 3NFQA 3CL3D 1NTMG 4A7PA 1FDOA 1GL2B 1VQ5P 1NWQA 1QVFO 2M0BA 1BCCE 2V7QH 1VQLP 2QJPB 3IN6A 1OVUA 4HKZH 5KLIB 2GUSA 1NTZG 2AEFA 5CBNA 2YMKA 1GD2E 3HUSB 4WVZA 2E43A 3B5NA 3VN0A 1KILE 1FZBA 5AVUB 3M0AA 1L4AC 2NPSB 5KLVG 2B9BA 1SQBG 4L73A 2K88A 2OTKE 3CC4P 3KPEA 1FS0E 2BCCD 3BCCJ 2SPZA 4IOIH 1HGZA 3VYIA 1YTZI 4N78D 2XKMA 5AW1B 2O01N 1RY3A 1FOSE 3H1HE 1L4AB 3RK2B 2D2CC 4UB6E 1N86A 4DZOA 1URQB 2GA1A 2KSJA 3L70J 2FFDA 4I2LC 2ITAA 2Y9YA 3P7KA 1PPJG 3GLMA 3H32B 1SQQE 3A0BH 2OQQA 4Y28J 3CCQP 3MUDA 1KMIZ 2G8YA 5DJTB 2HFED 4JQ0D 3AE6C 1T2KD 1PFIA 1X8YA 2Q3IA 3H1ID 1GU4A 2IPPA 4R4MA 3RK3D 1S9KD 1GTWA 1M56D 1L0LK 5KAIH 1FC2C 3AECC 1VDFA 3PP5A 5KJ7C 1JMMA 4N3YB 3P8MC 5E79E 3HD7A 1NKNA 1L0NK 1G1IA 1BSHA 3N4XA 1J2JB 1PL5A 2A45G 3HTKA 3CWBE 2OGUA 1BE3E 1LTJA 3V5BA 3P8CD 2N1TD 1KFNA 1RE3A 2O1KA 3N7NA 2PGDA 1SQVD 2O1JA 3AEBC 3CCEP 1SFCD 2W6BA 2YO3A 3NXSA 4PV1D 1SP4A 1IZNB 3CMEP 4YPCA 1IFMA 2WPQA 3IR9A 4N78E 3EFGA 5CCGD 2LKMA 3O8ZA 1FBMA 3TGUJ 1CSBA 1YYCA 1AV1A 3VMZA 4WY4A 3IF4A 1BDCA 1S2EA 3HE4B 3A0HE 2A06D 4EOTA 1L0LE 3G3ZA 1J1EB 3SFDC 1JY2N 1RF0C 1VQ8P 2Y0CA 3V6IA 3AEGC 5KLVJ 5KTBA 3WU2E 5AVXB 1DD4A 1XTGB 1SQBJ 1L0NE 1N73A 2OYIB 3PJSK 1ZRTD 3O6QB 1JEKA 3CC2P 2M3EA 1ZMEC 2FYUJ 5GTHE 4L76A 3CX5H 3B5ND 4AUWA 4RKUJ 1JY2O 1AJYA 1NJIQ 1S9KE 3AE8C 3AE9C 3EWKA 4ZNCA 3L37A 3C8VA 4JYBA 1H0TB 1S5LX 2QEXP 3CC7P 1G1JA 2Z5HA 5K5GB 2MJZA 1KQFB 3BRTB 5BU5A 1BDDA 5KAFH 3H1JD 1KD1Q 3P8CE 3M9QA 1LP1B 2P7JA 1EQ7A 4WWIA 1SQPE 3T97A 3I55P 3AE1C 3L70E 2KS1B 1BGYJ 1NU1D 5APTA 3CCSP 3L75J 1AVOA 3E7KA 4U7JA 2B88A 4BRYA 2P2UA 1S5LH 2I1KA 1VPCA 3KZIE 3M0DC 3H1LJ 2L5GB 3IFMA 3AEEC 1K05A 2WMMA 1OWAA 1IK9A 2QG4A 2K9JA 4K35A 4YXDC 1LTGC 4NPFX 3M06A 2QVAA 2N1TB 3JSVC 3RL0D 4JYCA 2O01J 1LWUA 2WT7B 1JO5A 1YJWP 1FAVA 2BCCG 4W7ZA 1SFCB 3GF7A 2YMYA 2BASA 1WRGA 2R32A 1T3JA 4LLHA 1RE4A 2WZ7A 1LTAC 1MZ9A 4N6JA 3HD7D 1ZRTE 4GODA 2FYUK 1EXIA 1FDIA 1YIJP 2QSIA 2WSSH 3QWOC 3AEFC 2RMZA 3CCRP 1N7SA 1LT9C 2C9NY 4ASWA 1GK4A 4PD4D 1CI6A 1E5WA 4UB8H 4TT3H 1T3UA 2QJKC 3D6YA 3TF5A 1FZFA 2E74B 4HYTB 4RESB 2OTJP 1GZLA 4NPDA 5KKZB 3GF3A 3TGUE 2V7QJ 4H44D 1SLQA 2M3BA 2E76D 3H1JE 2IZ0A 3L4FA 3H1IG 1BCCD 1N8RQ 3B5NB 2PAJA 4WY4D 3V2RA 3CCVP 2VRSA 1Q7YQ 3L36A 3E1RA 1RF0A 2HODA 1K73Q 2P67A 1DEBA 4XFJA 4ASVA 3SWFA 2FBWC 5H2FE 1S4XA 1RH5B 2RKLA 1KORA 3G9RA 2L91A 1NHLA 4DOJA 1M7LA 2E5YA 2W6JH 3CXHI 2LXCB 1IO4A 3V2PA 1KILD 1N7LA 1OW7A 2FYUE 3L73E 1L2PA 3H1KJ 3AEAC 2OYHC 1PGQA 1MKMA 2E75D 1KQGB 3B71A 3D6ZA 1NAYA 3TYYA 3CCJP 5GTIE 2KP8A 2IYOA 3II6A 1P84H 3TNUA 3V4QA 1A02F 4PD4H 1SQVG 2JEEA 4EDFA 1X9VA 4WB4A 3L74D 2R44A 3K5BA 3G71P 2HPCA 1XTCC 1G2CA 2OARA 3GHGA 2FFDB 1SQXE 3H1HD 2A45H 2FYZA 1X22A 2KK7A 1EZVE 2KXPB 1NTKJ 1OZHA 2M5AA 3FGAD 2Q9IA 3AEDC 4L74A 3ABVC 3A2AA 3H25A 1GL2C 3BRVB 2A06G 1BGYE 3RL0B 3Q1MA 2KUBA 3L75E 1SQQD 3VMXA 3C9IA 1T6AA 1H88A 1YHQP 2QM8A 3H1LE 3TK1A 5KLIC 3MP7B 3Q2YA 3KQGA 2W90A 3CXHE 3W67A 3HD7B 1PIXA 1ZOYC 3HUSC 3D71A 3VMYA 1R8EA 1JY2P 4Y99B 2JWAA 1BSNA 2Y0EA 4M3LA 1LTJB 1ZP0C 5L8RJ 3FWLA 1IFDA 1VF5D 2NPSC 2YIUB 2FYNB 3OJAB 3L72G 1KB9H 4JF7A 1LGHB 1EDJA 2KZJA 1X0TA 4UB6H 5B5EE 2N9YB 3CWBD 3Q5PA 1BE3D 2W27A 2I1JA 3L71J 1RQVA 4H44B 1QGKB 4KHXA 3U1AA 2E76B 1A02J 3RK2C 5AVSB 1KN7A 4WY4B 1N7SD 1PP9D 4WBAA 1URQC 1NU1G 4EI2A 1Q2NA 3KDPB 4XA4A 1KYOI 2H89C 3L74E 1RF1B 2BEZF 1EC5A 2OYOA 4PJ0H 1W2EA 1LTBC 1M1JB 1NTKK 4MN4C 1N73B 1KILB 3MHVA 1OVVA 4H13D 1JNMA 2E75B 3HE5A 1IFJA 1L0LD 2Q5UA 1JOCA 1Q82Q 1M57D 3H6PA 1L0ND 2IZ1A 3FXDA 1HTLC 2YKQA 4AQRD 5CCHC 2OYHA 2Z5IA 1VQNP 3H1KE 3U1CA 2XU6A 3MD0A 2GM4A 4OVNF 1S1CX 1ZN5A 4D6TE 3BASA 4DCKA 1PV3A 2ZT9D 4KT0J 1YQ3C 3AE7C 1KYOE 2POHA 2ZFCA 5AVZB 3KXDA 4BRYB 2DW3A 1NTKE 4JPZB 4U3FE 1IFPA 3A0HH 1SQPD 2AXTE 3QH9A 2NRGA 3L70D 1BCCG 1NTMJ 2PP6A 2K9JB 3Q5RA 1HJ0A 4XE5B 1AQ5A 1FZCA 1LNQA 1PP9E 3WU2H 1VF5B 1UIXA 1LWUB 1J1EC 2HYNA 1FJKA 4LGDE 5AVRB 2FXOA 1LTIC 3ZDMA 1H89A 3CCUP 3L72J 2FY8A 2OYIC 1NTZJ 3CLQA 2Q3EA 3GW6A 5TISH 3CCLP 1YI2P 2NPSA 1DEEG 2ZYDA 2AXCA 3OW2O 2PRRA 1N7SB 3R2PA 1KTMA 3F5HA 1FJPA 1AVYA 2H88C 4OGQD 5AVYB 3H1HG 5APQA 3LIDA 2HR3A 4H0LD 1W2BO 3S4RA 1L4AA 4BWNA 3LW5H 3L71E 4GOFA 2K37A 3UIAA 1JCDA 4H13B 1T2KC 2YNYA 2ZYGA 1JTHB 1Y47A 3BCCE 3SSUA 3KHUA 1JUNA 2QA4P 1RQUA 3JC22 1QL2A 1VQ7P 1SQQG 3VP8A 2HODB 2IBZE 3RK3C 3BVHA 3NTNA 3TGUD 3EQ2A 3G6EP 5B66H 2CK3H 4GDOA 3VOPA 3JCUH 3WUUA 3I5CA 3FXEA 1U57A 2ZYAA 2JDIH 1N2DC 1AQTA 1NTMK 5CJ0A 5CMZA 3RK3B 1JB0J 1VQ6P 1CZQA 2N1TC 1DIPA 3TNUB 2ZT9B 4O9BA 3CX5E 3VTPC 3GMAA 3CI9A 1SFCC 1PGOA 2FYUD 3L73D 2KIKA 1G2CB 3GHGB 5AW0B 2W6AA 2XDJA 3CWBG 2WSCH 1BE3G 1GK6A 2H8PD 5AW8B 5CCGC 1NTZK 4R4LA 3WUTA 1QEXA 4NPEA 2M5AB 1IK7A 1QVGO 4OWFA 2O3JA 2Q7CA 5KJ7A 2KB7P 5APVA 3RL0g 1D7MA 4KJMA 4PV1B 1SQXD 4EYYQ 5KAFE 5APSA 5KLVK 3B8EB 2KOGA 1BCCJ 1EZVD 1SQBK 2KNCA 4HJGH 2CPBA 1PPJD 2E74C 5AVVB 2ZVOB 1GW3A 5KKZC 1LJ2A 3AE4C 5AW3B 1S5LE 1M8OB 1NTME 1BGYD 2AEMA 1L0LG 3L75D 4IL6X 3B5NC 4Z1MH 4GT1A 2KLUA 1EZVI 3H1LD 1W5CE 1L0NG 2PFXA 1GDTA 1LT1A 4OGQB 2Q1KA 3CXHD 1VQ4P 1GMJA 2XNXA 2K3RA 4YXWH 4H0LB 5GTIH 1NTZE 2QJYB 3H1HJ 1VL2A 1K04A 2WSEH 1RHZB 3WUVA 1IC2A 1SS1A 4IL6H 2NPSD 2ZXXA 2WQYC 4IFDK 5KLVE 1WT6A 1NOHA 3GG2A 2J5UA 1SQBE 4GIFA 3P32A 2FFDC 2J59M 3LIEA 1SQQJ 1GU5A 3I56P 1L4AD 2YO2A 1MUUA 1SQPG 2JKVA 2K1AA 3L70G 1HWTC 2ZJSE 2RH0A 1NAFA 1X79B 3V4WA 1M90Q 1NKZB 3HE5B 2KS1A 3M91A 1PGPA 5M1BA 3RL0C 2C0WA 1FZGA 1K9MQ 3CXHH 1OMIA 1R5SA 1JM0A 5CJ4A 4BXLA 2Y9ZA 1PPJE 1ZR2A 2D2CD 1K8AQ 4I7ZB 3EFFK 1NGMB 5DJUB 3HD7C 5AW6B 2WVRA 3PHLA 3CWBJ 3BATA 1FZEA 4Y99C 1LTJC 2R3CA 3M0DA 3SWYA 3VMAA 1RE3C 2YIUC 2P10A 2FYNC 1VQ9P 1E79H 2BCCJ 3F89A 1P84E 3H1KD 1QLED 2RN0A 3D70A 4DJGA 1OW6A 4D6TD 1KC8Q 3HTKB 1J1DB 4C7NA 4H44C 2IYPA 1DH3A 3RGUA 4K3AA 2E76C 3A3YB 2UWJE 3OA7A 5KJ7D 1DX7A 1KYOD 1H8AA 3V2QA 4WY4C 1QX8A 3U59A 1FZCB 3PH0A 1JY3N 1L0LJ 1NTKD 2YKOA 1RF1C 3AE3C 3TGUG 4U3FD 1KQSO 2H7HA 5AVQB 2R5DA 3H1JG 1SQQK 1L0NJ 3AE2C 2WITA 1M1JC 1LT9A 2JP3A 1N73C 1KILC 1UIIA 2WSFH 1YBKA 5AW9B 2Y0DA 1VQKP 4CPGA 2E75C 1JY3O 3Q5SA 3H1IJ 2QE7H 1KFMA 2MKVA 1MFTA 1EDIA 2KSEA 2XZRA 2QM7A 1YJ9P 2B87A 3WMM0 2I8DA 2FYUG 3L73G 4W7YA 5EFWB 2J58A 1AFOA 1EDKA 1WMKA 1KB9E 5CBOA 2W83C 1U7MA 2ZVNB 1OFCX 1ZXGA 5E79H 3NMDA 2R5BA 1KYOH 3LW5J 1SQXG 1SQPJ 2JR8A 1SQVJ 1EZVG 1YQ4C 3L71D 2AXTH 1Q90D 2ZAEB 1ZLLA 2D2CB 2E5TA 3TSIA 1ZV8A 5AW4B 1FE6A 1IFNA 2LR2A 1M1KQ 1YJNP 3BCCD 1BGYG 1FU1A 4PJ0E 3L75G 3T97B 2IBZD 2KYVA 1KZUB 3MGNA 1VF5C 3H1LG 1FZAA 1HGVA 3RBZA 1LWUC 3OAKA 2ZXEB 4LC1A 1GL2A 3A0BE 2N9BA 3MTUE 1RE4C 2Q6QA 2FXMA 2IBZI 1HJBA 2WSCJ 3CX5D 2KLVA 1SVFA 2IDBA 3KYQA 2GUVA 5GTHH 1HVVA 1N7SC 2IFMA 2JJLA 5AW2B 4JBZA 2BCCE 3HUSA 4ZMDA 5KAIE 2KNCB 1Z56A 3A5TA 1YTZT 1IFIA 5TJHA 2JO1A 5APXA 3A7OA 1FDMA 1S3JA 3H1JJ 4H13C 2WPVB 2E42A 3CX5I 3L74G 2W8ZA 5AW5B 1U7JA 1CI6B 1SQPK 5BU8B 1RF1A 3USSA 1SQVK 1NU1J 1VQOP 3W68A 1DD3A 2E74D 4HH2A 2WWWA 1M1JA 1KILA 1NTMD 2B89A 4GKGA 1URQA 3L73J 3ITKA 3KZIH 1ZW0A 5APWA 3H1IE 1OIPA 3M9HA 4GOEA 3G4SP 3H32A 2HLOA 4DT0A 2WSEJ 3RK3E 5TISE 3MZWB 2YXRB 2WPSA 3L72D 2ZT9C 1JMBA 1MV8A 1NTZD 3M9BA 3H1KG 1EXJA 1SQXJ 3GHGC 5APYA 2XNDH 3TDKA 1MFZA 1TU3F 4D6TG 2KZIA 1FOSF 1Q86Q 1HF9A 4HB1A 5KLVD 1VQMP 1SQBD 5APUA 1HBWA 5CCHA 4OH8B 2QRXA 4PV1C 1SQVE 2KI7B 1Y9BA 2HPCB 1JCCA 1NTKG 3E1IA 4L75A 2IFNA 4U3FG 5C39A 3CMAP 1HUCA 3Q3DA 1ZR4A 1PP9G 1KV4A 1NYHA 1JY3P 4YTPC 4IFMA 1Y8AA 5B66E 2IX7C 1QL1A 2FKWB 1S72P 3JCUE 2A06E 1NU1K 5CHXA 2JWDA 2WTYA 1T8ZA 4OGQC 1NH4A 1OVRA 2P58A 4EIJA 1OW8A 4H0LC 1OXZA 3HE4A 2V4HA 5H2FH 4ZKUA 2QJYC 1GL2D 1PZQA 3CCMP 3FWNA 3PLNA 4C7NB 5AVTB 4TLFA 3IAOA 3FX0A 2Z4EA 2FXPA 1P84D 2NZ2A 3S9OA 2OTLP 2OYIA 3C1LA 3L72E 3O6QA 3L74J 1LTSC 2YXQB 3L71G 2BEQD 1SQXK 4IFFA 3AE5C 4RJTA 3B4SA 4B86A 4RO0A 3BCCG 2G3AA
chains in the Genus database with same CATH topology
1LT9B 1JTHA 3U59A 1FZCB 1JY3N 2YKOA 3P8CE 3M9QA 1RF1C 2P7JA 1EQ7A 2H43A 3T97A 2H7HA 5AVQB 3L35A 2R5DA 5APTA 1SQQK 2PP6A 4W80A 1GW4A 1CW5A 2CPSA 2WITA 1M1JC 1LT9A 4XE5B 1AQ5A 1N73C 1KILC 1FZCA 1NO4A 2WSFH 5AW9B 3RK2D 2A45I 2P2UA 2C9LY 2I1KA 1VPCA 4I1LA 3M0DC 2L5GB 3IFMA 1JY3O 1LWUB 1J1EC 2HYNA 1FJKA 4LGDE 2XV5A 1KFMA 2C0XA 5AVRB 1OWAA 1IK9A 1URQD 1KQLA 1LTIC 2XZRA 2QM7A 1H89A 1LTGC 2M8RA 2OYIC 3M06A 3WMM0 3VP9A 3CLQA 2N1TB 1IJDB 2YKPA 4W7YA 3RL0D 4JYCA 2J58A 1LWUA 2WT7B 1AFOA 1JO5A 2NPSA 2P1JA 1FAVA 4W7ZA 1SFCB 1HH0A 2BASA 2YMYA 4I6MC 4AYCA 1WRGA 2O01H 2R32A 2OYHB 3V2NA 1N7SB 3R2PA 4C7RA 1T3JA 5AVWB 4LLHA 1FJPA 1RE4A 2WZ7A 3NMDA 2N1TA 2R5BA 1LTAC 1MZ9A 4N6JA 3HD7D 5AVYB 5APQA 1J1DC 2HG5D 3LIDA 2WT7A 2FYUK 5AW7B 1SFCA 1L4AA 3LW5H 1N7SA 4ZKPA 5CCHD 3UIAA 2WPRA 1LT9C 1JCDA 2C9NY 3HRNA 1FZCC 1ZLLA 1T2KC 1GK4A 5CCGA 3TSIA 1ZV8A 2YNYA 5AW4B 1IFNA 1CI6A 1E5WA 1JTHB 1T3UA 3MIWA 4C46A 1LTTC 1FZFA 1JUNA 5BVZA 4HYTB 1QL2A 3NFQA 3CL3D 4RESB 1FU1A 3VP8A 1GZLA 2HODB 3RK3C 3BVHA 3NTNA 2KYVA 1GL2B 1KZUB 1SLQA 2M3BA 3EQ2A 3MGNA 1NWQA 3L4FA 1FZAA 1HGVA 3B5NB 1LWUC 2PAJA 4WY4D 3V2RA 3OAKA 3VOPA 2ZXEB 2VRSA 3I5CA 3L36A 1RF0A 2HODA 4LC1A 2P67A 1DEBA 1N2DC 2GUSA 1NTMK 5CJ0A 3SWFA 1GL2A 5CMZA 3RK3B 2N9BA 3MTUE 1RE4C 1CZQA 2N1TC 1GD2E 3HUSB 3TNUB 2FXMA 2E43A 1NHLA 4DOJA 1M7LA 3B5NA 4O9BA 3VN0A 1HJBA 3VTPC 1FZBA 5AVUB 3V2PA 1KILD 1N7LA 3CI9A 3M0AA 1IO4A 2KLVA 1SFCC 1L4AC 1SVFA 3KYQA 2NPSB 2OYHC 2GUVA 3GHGB 1G2CB 1HVVA 1N7SC 2IFMA 2JJLA 5AW0B 2W6AA 2XDJA 5AW2B 3TYYA 2WSCH 2KP8A 1GK6A 3KPEA 3HUSA 3II6A 2H8PD 5AW8B 5CCGC 1NTZK 3TNUA 3V4QA 1A02F 1HGZA 3VYIA 1Z56A 1YTZI 4N78D 3A5TA 1YTZT 2JEEA 2XKMA 1IFIA 5AW1B 1X9VA 4WB4A 2Q7CA 1RY3A 5KJ7A 2KB7P 2HPCA 1XTCC 1FOSE 1G2CA 2OARA 3GHGA 5APVA 3A7OA 5APXA 2FFDB 1FDMA 1L4AB 2A45H 3RK2B 5APSA 2FYZA 5KLVK 3B8EB 2KOGA 2E42A 1SQBK 1N86A 5AW5B 2CPBA 1CI6B 1SQPK 5AVVB 4DZOA 1URQB 5BU8B 1RF1A 2Q9IA 2KSJA 1SQVK 1GW3A 3A2AA 2FFDA 4I2LC 4HH2A 1GL2C 2WWWA 3BRVB 5AW3B 3P7KA 1M1JA 3RL0B 3H32B 1KILA 3VMXA 3C9IA 4GKGA 3MUDA 1URQA 3B5NC 1H88A 2HFED 4GT1A 1T2KD 2QM8A 5APWA 1PFIA 3TK1A 1X8YA 2Q3IA 3M9HA 1GDTA 3KQGA 1GU4A 2IPPA 3H32A 3HD7B 2HLOA 2XNXA 3HUSC 3RK3D 1S9KD 2WPSA 1GTWA 3VMYA 1JY2P 4Y99B 1MV8A 1L0LK 3M9BA 4M3LA 1LTJB 2WSEH 1VDFA 3PP5A 5KJ7C 1JMMA 1IFDA 2NPSC 3GHGC 4N3YB 3P8MC 5APYA 1IC2A 1MFZA 3OJAB 3HD7A 1NKNA 1L0NK 1FOSF 2NPSD 1G1IA 4JF7A 1LGHB 3N4XA 4IFDK 1J2JB 1WT6A 1NOHA 2A45G 3HTKA 5APUA 1HBWA 1LTJA 3V5BA 3P8CD 2W27A 4GIFA 2N1TD 5CCHA 2I1JA 3P32A 1KFNA 4OH8B 1RE3A 2FFDC 2O1KA 3N7NA 4KHXA 2HPCB 3U1AA 2J59M 2O1JA 3LIEA 1A02J 3RK2C 1JCCA 1GU5A 1SFCD 3E1IA 5AVSB 2W6BA 2YO3A 2YO2A 1L4AD 3NXSA 2IFNA 1MUUA 1SP4A 4WY4B 1N7SD 4WBAA 1URQC 1IFMA 2WPQA 3IR9A 4N78E 1HWTC 3KDPB 1NAFA 1X79B 3V4WA 4XA4A 3EFGA 1NKZB 5CCGD 2LKMA 1RF1B 3O8ZA 3HE5B 1FBMA 1HUCA 3M91A 1ZR4A 1CSBA 1YYCA 1JY3P 3RL0C 2C0WA 1FZGA 4IFMA 3VMZA 1W2EA 1LTBC 2IX7C 4WY4A 1M1JB 1QL1A 1NTKK 1N73B 1KILB 3HE4B 5CJ4A 2FKWB 1ZR2A 1JNMA 4EOTA 3HE5A 1IFJA 1NU1K 5CHXA 3G3ZA 2WTYA 1J1EB 1T8ZA 1JY2N 2Q5UA 1RF0C 1NH4A 3HD7C 5AW6B 1JOCA 4EIJA 5KTBA 5AVXB 1XTGB 1N73A 1OXZA 3BATA 3H6PA 3HE4A 1FZEA 2OYIB 4Y99C 4ZKUA 1HTLC 1GL2D 1LTJC 2R3CA 2YKQA 3M0DA 4AQRD 5CCHC 4C7NB 3SWYA 1RE3C 2OYHA 2Z5IA 5AVTB 3B5ND 4AUWA 2Z4EA 1JY2O 3U1CA 2XU6A 3MD0A 2GM4A 2OYIA 1ZN5A 1S9KE 1LTSC 3L37A 3BASA 3HTKB 1J1DB 4JYBA 4C7NA 1SQXK 1DH3A 4IFFA 3A3YB 1G1JA 2Z5HA 3OA7A 2MJZA 4B86A 5KJ7D 2POHA 1DX7A 2ZFCA 1H8AA 3BRTB 3V2QA 4WY4C 5AVZB 5BU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTS C;  1LTA C;  1LTT C;  1XTC C;  1LTG C;  1HTL C;  1LTB C;  1LTI C; 
#chains in the Genus database with same CATH topology
 1LT9 B;  1JTH A;  2IBZ G;  2QJK B;  1OX3 A;  3PTZ A;  1H0T A;  1P84 I;  2H43 A;  4PD4 I;  3L35 A;  1NU1 E;  2WSF J;  4W80 A;  2AEJ A;  1GW4 A;  1USD A;  1CW5 A;  2CPS A;  1R5L A;  4UB8 E;  2B87 B;  1NO4 A;  3R4Y A;  3RK2 D;  2A45 I;  2C9L Y;  4I1L A;  3MUD C;  1LP1 A;  2XV5 A;  2C0X A;  4I7Z C;  1URQ D;  1KQL A;  3RBX A;  3SFE C;  2M8R A;  1USE A;  4D6T J;  3VP9 A;  1IJD B;  2YKP A;  1YIT P;  1PGJ A;  2P1J A;  1KB9 D;  4IL6 E;  1HH0 A;  4I6M C;  3PRJ A;  4AYC A;  2OYH B;  2K9Y A;  2O01 H;  3V2N A;  4C7R A;  5AVW B;  1NVO A;  2N1T A;  2R3S A;  3S1K A;  1BE3 J;  4QMA A;  4U3F J;  1J1D C;  2HG5 D;  2WT7 A;  2LXB A;  5AW7 B;  2QIW A;  1SFC A;  5B5E H;  3CD6 P;  1AA0 A;  3SWK A;  4ZKP A;  5CCH D;  1PP9 J;  2WPR A;  3HRN A;  4PD4 E;  1FZC C;  5CCG A;  1KB9 I;  3CPW O;  1VQP P;  2QJP C;  3MIW A;  4C46 A;  1LTT C;  5BVZ A;  1Q81 Q;  1EDL A;  3NFQ A;  3CL3 D;  1NTM G;  4A7P A;  1FDO A;  1GL2 B;  1VQ5 P;  1NWQ A;  1QVF O;  2M0B A;  1BCC E;  2V7Q H;  1VQL P;  2QJP B;  3IN6 A;  1OVU A;  4HKZ H;  5KLI B;  2GUS A;  1NTZ G;  2AEF A;  5CBN A;  2YMK A;  1GD2 E;  3HUS B;  4WVZ A;  2E43 A;  3B5N A;  3VN0 A;  1KIL E;  1FZB A;  5AVU B;  3M0A A;  1L4A C;  2NPS B;  5KLV G;  2B9B A;  1SQB G;  4L73 A;  2K88 A;  2OTK E;  3CC4 P;  3KPE A;  1FS0 E;  2BCC D;  3BCC J;  2SPZ A;  4IOI H;  1HGZ A;  3VYI A;  1YTZ I;  4N78 D;  2XKM A;  5AW1 B;  2O01 N;  1RY3 A;  1FOS E;  3H1H E;  1L4A B;  3RK2 B;  2D2C C;  4UB6 E;  1N86 A;  4DZO A;  1URQ B;  2GA1 A;  2KSJ A;  3L70 J;  2FFD A;  4I2L C;  2ITA A;  2Y9Y A;  3P7K A;  1PPJ G;  3GLM A;  3H32 B;  1SQQ E;  3A0B H;  2OQQ A;  4Y28 J;  3CCQ P;  3MUD A;  1KMI Z;  2G8Y A;  5DJT B;  2HFE D;  4JQ0 D;  3AE6 C;  1T2K D;  1PFI A;  1X8Y A;  2Q3I A;  3H1I D;  1GU4 A;  2IPP A;  4R4M A;  3RK3 D;  1S9K D;  1GTW A;  1M56 D;  1L0L K;  5KAI H;  1FC2 C;  3AEC C;  1VDF A;  3PP5 A;  5KJ7 C;  1JMM A;  4N3Y B;  3P8M C;  5E79 E;  3HD7 A;  1NKN A;  1L0N K;  1G1I A;  1BSH A;  3N4X A;  1J2J B;  1PL5 A;  2A45 G;  3HTK A;  3CWB E;  2OGU A;  1BE3 E;  1LTJ A;  3V5B A;  3P8C D;  2N1T D;  1KFN A;  1RE3 A;  2O1K A;  3N7N A;  2PGD A;  1SQV D;  2O1J A;  3AEB C;  3CCE P;  1SFC D;  2W6B A;  2YO3 A;  3NXS A;  4PV1 D;  1SP4 A;  1IZN B;  3CME P;  4YPC A;  1IFM A;  2WPQ A;  3IR9 A;  4N78 E;  3EFG A;  5CCG D;  2LKM A;  3O8Z A;  1FBM A;  3TGU J;  1CSB A;  1YYC A;  1AV1 A;  3VMZ A;  4WY4 A;  3IF4 A;  1BDC A;  1S2E A;  3HE4 B;  3A0H E;  2A06 D;  4EOT A;  1L0L E;  3G3Z A;  1J1E B;  3SFD C;  1JY2 N;  1RF0 C;  1VQ8 P;  2Y0C A;  3V6I A;  3AEG C;  5KLV J;  5KTB A;  3WU2 E;  5AVX B;  1DD4 A;  1XTG B;  1SQB J;  1L0N E;  1N73 A;  2OYI B;  3PJS K;  1ZRT D;  3O6Q B;  1JEK A;  3CC2 P;  2M3E A;  1ZME C;  2FYU J;  5GTH E;  4L76 A;  3CX5 H;  3B5N D;  4AUW A;  4RKU J;  1JY2 O;  1AJY A;  1NJI Q;  1S9K E;  3AE8 C;  3AE9 C;  3EWK A;  4ZNC A;  3L37 A;  3C8V A;  4JYB A;  1H0T B;  1S5L X;  2QEX P;  3CC7 P;  1G1J A;  2Z5H A;  5K5G B;  2MJZ A;  1KQF B;  3BRT B;  5BU5 A;  1BDD A;  5KAF H;  3H1J D;  1KD1 Q;  3P8C E;  3M9Q A;  1LP1 B;  2P7J A;  1EQ7 A;  4WWI A;  1SQP E;  3T97 A;  3I55 P;  3AE1 C;  3L70 E;  2KS1 B;  1BGY J;  1NU1 D;  5APT A;  3CCS P;  3L75 J;  1AVO A;  3E7K A;  4U7J A;  2B88 A;  4BRY A;  2P2U A;  1S5L H;  2I1K A;  1VPC A;  3KZI E;  3M0D C;  3H1L J;  2L5G B;  3IFM A;  3AEE C;  1K05 A;  2WMM A;  1OWA A;  1IK9 A;  2QG4 A;  2K9J A;  4K35 A;  4YXD C;  1LTG C;  4NPF X;  3M06 A;  2QVA A;  2N1T B;  3JSV C;  3RL0 D;  4JYC A;  2O01 J;  1LWU A;  2WT7 B;  1JO5 A;  1YJW P;  1FAV A;  2BCC G;  4W7Z A;  1SFC B;  3GF7 A;  2YMY A;  2BAS A;  1WRG A;  2R32 A;  1T3J A;  4LLH A;  1RE4 A;  2WZ7 A;  1LTA C;  1MZ9 A;  4N6J A;  3HD7 D;  1ZRT E;  4GOD A;  2FYU K;  1EXI A;  1FDI A;  1YIJ P;  2QSI A;  2WSS H;  3QWO C;  3AEF C;  2RMZ A;  3CCR P;  1N7S A;  1LT9 C;  2C9N Y;  4ASW A;  1GK4 A;  4PD4 D;  1CI6 A;  1E5W A;  4UB8 H;  4TT3 H;  1T3U A;  2QJK C;  3D6Y A;  3TF5 A;  1FZF A;  2E74 B;  4HYT B;  4RES B;  2OTJ P;  1GZL A;  4NPD A;  5KKZ B;  3GF3 A;  3TGU E;  2V7Q J;  4H44 D;  1SLQ A;  2M3B A;  2E76 D;  3H1J E;  2IZ0 A;  3L4F A;  3H1I G;  1BCC D;  1N8R Q;  3B5N B;  2PAJ A;  4WY4 D;  3V2R A;  3CCV P;  2VRS A;  1Q7Y Q;  3L36 A;  3E1R A;  1RF0 A;  2HOD A;  1K73 Q;  2P67 A;  1DEB A;  4XFJ A;  4ASV A;  3SWF A;  2FBW C;  5H2F E;  1S4X A;  1RH5 B;  2RKL A;  1KOR A;  3G9R A;  2L91 A;  1NHL A;  4DOJ A;  1M7L A;  2E5Y A;  2W6J H;  3CXH I;  2LXC B;  1IO4 A;  3V2P A;  1KIL D;  1N7L A;  1OW7 A;  2FYU E;  3L73 E;  1L2P A;  3H1K J;  3AEA C;  2OYH C;  1PGQ A;  1MKM A;  2E75 D;  1KQG B;  3B71 A;  3D6Z A;  1NAY A;  3TYY A;  3CCJ P;  5GTI E;  2KP8 A;  2IYO A;  3II6 A;  1P84 H;  3TNU A;  3V4Q A;  1A02 F;  4PD4 H;  1SQV G;  2JEE A;  4EDF A;  1X9V A;  4WB4 A;  3L74 D;  2R44 A;  3K5B A;  3G71 P;  2HPC A;  1XTC C;  1G2C A;  2OAR A;  3GHG A;  2FFD B;  1SQX E;  3H1H D;  2A45 H;  2FYZ A;  1X22 A;  2KK7 A;  1EZV E;  2KXP B;  1NTK J;  1OZH A;  2M5A A;  3FGA D;  2Q9I A;  3AED C;  4L74 A;  3ABV C;  3A2A A;  3H25 A;  1GL2 C;  3BRV B;  2A06 G;  1BGY E;  3RL0 B;  3Q1M A;  2KUB A;  3L75 E;  1SQQ D;  3VMX A;  3C9I A;  1T6A A;  1H88 A;  1YHQ P;  2QM8 A;  3H1L E;  3TK1 A;  5KLI C;  3MP7 B;  3Q2Y A;  3KQG A;  2W90 A;  3CXH E;  3W67 A;  3HD7 B;  1PIX A;  1ZOY C;  3HUS C;  3D71 A;  3VMY A;  1R8E A;  1JY2 P;  4Y99 B;  2JWA A;  1BSN A;  2Y0E A;  4M3L A;  1LTJ B;  1ZP0 C;  5L8R J;  3FWL A;  1IFD A;  1VF5 D;  2NPS C;  2YIU B;  2FYN B;  3OJA B;  3L72 G;  1KB9 H;  4JF7 A;  1LGH B;  1EDJ A;  2KZJ A;  1X0T A;  4UB6 H;  5B5E E;  2N9Y B;  3CWB D;  3Q5P A;  1BE3 D;  2W27 A;  2I1J A;  3L71 J;  1RQV A;  4H44 B;  1QGK B;  4KHX A;  3U1A A;  2E76 B;  1A02 J;  3RK2 C;  5AVS B;  1KN7 A;  4WY4 B;  1N7S D;  1PP9 D;  4WBA A;  1URQ C;  1NU1 G;  4EI2 A;  1Q2N A;  3KDP B;  4XA4 A;  1KYO I;  2H89 C;  3L74 E;  1RF1 B;  2BEZ F;  1EC5 A;  2OYO A;  4PJ0 H;  1W2E A;  1LTB C;  1M1J B;  1NTK K;  4MN4 C;  1N73 B;  1KIL B;  3MHV A;  1OVV A;  4H13 D;  1JNM A;  2E75 B;  3HE5 A;  1IFJ A;  1L0L D;  2Q5U A;  1JOC A;  1Q82 Q;  1M57 D;  3H6P A;  1L0N D;  2IZ1 A;  3FXD A;  1HTL C;  2YKQ A;  4AQR D;  5CCH C;  2OYH A;  2Z5I A;  1VQN P;  3H1K E;  3U1C A;  2XU6 A;  3MD0 A;  2GM4 A;  4OVN F;  1S1C X;  1ZN5 A;  4D6T E;  3BAS A;  4DCK A;  1PV3 A;  2ZT9 D;  4KT0 J;  1YQ3 C;  3AE7 C;  1KYO E;  2POH A;  2ZFC A;  5AVZ B;  3KXD A;  4BRY B;  2DW3 A;  1NTK E;  4JPZ B;  4U3F E;  1IFP A;  3A0H H;  1SQP D;  2AXT E;  3QH9 A;  2NRG A;  3L70 D;  1BCC G;  1NTM J;  2PP6 A;  2K9J B;  3Q5R A;  1HJ0 A;  4XE5 B;  1AQ5 A;  1FZC A;  1LNQ A;  1PP9 E;  3WU2 H;  1VF5 B;  1UIX A;  1LWU B;  1J1E C;  2HYN A;  1FJK A;  4LGD E;  5AVR B;  2FXO A;  1LTI C;  3ZDM A;  1H89 A;  3CCU P;  3L72 J;  2FY8 A;  2OYI C;  1NTZ J;  3CLQ A;  2Q3E A;  3GW6 A;  5TIS H;  3CCL P;  1YI2 P;  2NPS A;  1DEE G;  2ZYD A;  2AXC A;  3OW2 O;  2PRR A;  1N7S B;  3R2P A;  1KTM A;  3F5H A;  1FJP A;  1AVY A;  2H88 C;  4OGQ D;  5AVY B;  3H1H G;  5APQ A;  3LID A;  2HR3 A;  4H0L D;  1W2B O;  3S4R A;  1L4A A;  4BWN A;  3LW5 H;  3L71 E;  4GOF A;  2K37 A;  3UIA A;  1JCD A;  4H13 B;  1T2K C;  2YNY A;  2ZYG A;  1JTH B;  1Y47 A;  3BCC E;  3SSU A;  3KHU A;  1JUN A;  2QA4 P;  1RQU A;  3JC2 2;  1QL2 A;  1VQ7 P;  1SQQ G;  3VP8 A;  2HOD B;  2IBZ E;  3RK3 C;  3BVH A;  3NTN A;  3TGU D;  3EQ2 A;  3G6E P;  5B66 H;  2CK3 H;  4GDO A;  3VOP A;  3JCU H;  3WUU A;  3I5C A;  3FXE A;  1U57 A;  2ZYA A;  2JDI H;  1N2D C;  1AQT A;  1NTM K;  5CJ0 A;  5CMZ A;  3RK3 B;  1JB0 J;  1VQ6 P;  1CZQ A;  2N1T C;  1DIP A;  3TNU B;  2ZT9 B;  4O9B A;  3CX5 E;  3VTP C;  3GMA A;  3CI9 A;  1SFC C;  1PGO A;  2FYU D;  3L73 D;  2KIK A;  1G2C B;  3GHG B;  5AW0 B;  2W6A A;  2XDJ A;  3CWB G;  2WSC H;  1BE3 G;  1GK6 A;  2H8P D;  5AW8 B;  5CCG C;  1NTZ K;  4R4L A;  3WUT A;  1QEX A;  4NPE A;  2M5A B;  1IK7 A;  1QVG O;  4OWF A;  2O3J A;  2Q7C A;  5KJ7 A;  2KB7 P;  5APV A;  3RL0 g;  1D7M A;  4KJM A;  4PV1 B;  1SQX D;  4EYY Q;  5KAF E;  5APS A;  5KLV K;  3B8E B;  2KOG A;  1BCC J;  1EZV D;  1SQB K;  2KNC A;  4HJG H;  2CPB A;  1PPJ D;  2E74 C;  5AVV B;  2ZVO B;  1GW3 A;  5KKZ C;  1LJ2 A;  3AE4 C;  5AW3 B;  1S5L E;  1M8O B;  1NTM E;  1BGY D;  2AEM A;  1L0L G;  3L75 D;  4IL6 X;  3B5N C;  4Z1M H;  4GT1 A;  2KLU A;  1EZV I;  3H1L D;  1W5C E;  1L0N G;  2PFX A;  1GDT A;  1LT1 A;  4OGQ B;  2Q1K A;  3CXH D;  1VQ4 P;  1GMJ A;  2XNX A;  2K3R A;  4YXW H;  4H0L B;  5GTI H;  1NTZ E;  2QJY B;  3H1H J;  1VL2 A;  1K04 A;  2WSE H;  1RHZ B;  3WUV A;  1IC2 A;  1SS1 A;  4IL6 H;  2NPS D;  2ZXX A;  2WQY C;  4IFD K;  5KLV E;  1WT6 A;  1NOH A;  3GG2 A;  2J5U A;  1SQB E;  4GIF A;  3P32 A;  2FFD C;  2J59 M;  3LIE A;  1SQQ J;  1GU5 A;  3I56 P;  1L4A D;  2YO2 A;  1MUU A;  1SQP G;  2JKV A;  2K1A A;  3L70 G;  1HWT C;  2ZJS E;  2RH0 A;  1NAF A;  1X79 B;  3V4W A;  1M90 Q;  1NKZ B;  3HE5 B;  2KS1 A;  3M91 A;  1PGP A;  5M1B A;  3RL0 C;  2C0W A;  1FZG A;  1K9M Q;  3CXH H;  1OMI A;  1R5S A;  1JM0 A;  5CJ4 A;  4BXL A;  2Y9Z A;  1PPJ E;  1ZR2 A;  2D2C D;  1K8A Q;  4I7Z B;  3EFF K;  1NGM B;  5DJU B;  3HD7 C;  5AW6 B;  2WVR A;  3PHL A;  3CWB J;  3BAT A;  1FZE A;  4Y99 C;  1LTJ C;  2R3C A;  3M0D A;  3SWY A;  3VMA A;  1RE3 C;  2YIU C;  2P10 A;  2FYN C;  1VQ9 P;  1E79 H;  2BCC J;  3F89 A;  1P84 E;  3H1K D;  1QLE D;  2RN0 A;  3D70 A;  4DJG A;  1OW6 A;  4D6T D;  1KC8 Q;  3HTK B;  1J1D B;  4C7N A;  4H44 C;  2IYP A;  1DH3 A;  3RGU A;  4K3A A;  2E76 C;  3A3Y B;  2UWJ E;  3OA7 A;  5KJ7 D;  1DX7 A;  1KYO D;  1H8A A;  3V2Q A;  4WY4 C;  1QX8 A;  3U59 A;  1FZC B;  3PH0 A;  1JY3 N;  1L0L J;  1NTK D;  2YKO A;  1RF1 C;  3AE3 C;  3TGU G;  4U3F D;  1KQS O;  2H7H A;  5AVQ B;  2R5D A;  3H1J G;  1SQQ K;  1L0N J;  3AE2 C;  2WIT A;  1M1J C;  1LT9 A;  2JP3 A;  1N73 C;  1KIL C;  1UII A;  2WSF H;  1YBK A;  5AW9 B;  2Y0D A;  1VQK P;  4CPG A;  2E75 C;  1JY3 O;  3Q5S A;  3H1I J;  2QE7 H;  1KFM A;  2MKV A;  1MFT A;  1EDI A;  2KSE A;  2XZR A;  2QM7 A;  1YJ9 P;  2B87 A;  3WMM 0;  2I8D A;  2FYU G;  3L73 G;  4W7Y A;  5EFW B;  2J58 A;  1AFO A;  1EDK A;  1WMK A;  1KB9 E;  5CBO A;  2W83 C;  1U7M A;  2ZVN B;  1OFC X;  1ZXG A;  5E79 H;  3NMD A;  2R5B A;  1KYO H;  3LW5 J;  1SQX G;  1SQP J;  2JR8 A;  1SQV J;  1EZV G;  1YQ4 C;  3L71 D;  2AXT H;  1Q90 D;  2ZAE B;  1ZLL A;  2D2C B;  2E5T A;  3TSI A;  1ZV8 A;  5AW4 B;  1FE6 A;  1IFN A;  2LR2 A;  1M1K Q;  1YJN P;  3BCC D;  1BGY G;  1FU1 A;  4PJ0 E;  3L75 G;  3T97 B;  2IBZ D;  2KYV A;  1KZU B;  3MGN A;  1VF5 C;  3H1L G;  1FZA A;  1HGV A;  3RBZ A;  1LWU C;  3OAK A;  2ZXE B;  4LC1 A;  1GL2 A;  3A0B E;  2N9B A;  3MTU E;  1RE4 C;  2Q6Q A;  2FXM A;  2IBZ I;  1HJB A;  2WSC J;  3CX5 D;  2KLV A;  1SVF A;  2IDB A;  3KYQ A;  2GUV A;  5GTH H;  1HVV A;  1N7S C;  2IFM A;  2JJL A;  5AW2 B;  4JBZ A;  2BCC E;  3HUS A;  4ZMD A;  5KAI E;  2KNC B;  1Z56 A;  3A5T A;  1YTZ T;  1IFI A;  5TJH A;  2JO1 A;  5APX A;  3A7O A;  1FDM A;  1S3J A;  3H1J J;  4H13 C;  2WPV B;  2E42 A;  3CX5 I;  3L74 G;  2W8Z A;  5AW5 B;  1U7J A;  1CI6 B;  1SQP K;  5BU8 B;  1RF1 A;  3USS A;  1SQV K;  1NU1 J;  1VQO P;  3W68 A;  1DD3 A;  2E74 D;  4HH2 A;  2WWW A;  1M1J A;  1KIL A;  1NTM D;  2B89 A;  4GKG A;  1URQ A;  3L73 J;  3ITK A;  3KZI H;  1ZW0 A;  5APW A;  3H1I E;  1OIP A;  3M9H A;  4GOE A;  3G4S P;  3H32 A;  2HLO A;  4DT0 A;  2WSE J;  3RK3 E;  5TIS E;  3MZW B;  2YXR B;  2WPS A;  3L72 D;  2ZT9 C;  1JMB A;  1MV8 A;  1NTZ D;  3M9B A;  3H1K G;  1EXJ A;  1SQX J;  3GHG C;  5APY A;  2XND H;  3TDK A;  1MFZ A;  1TU3 F;  4D6T G;  2KZI A;  1FOS F;  1Q86 Q;  1HF9 A;  4HB1 A;  5KLV D;  1VQM P;  1SQB D;  5APU A;  1HBW A;  5CCH A;  4OH8 B;  2QRX A;  4PV1 C;  1SQV E;  2KI7 B;  1Y9B A;  2HPC B;  1JCC A;  1NTK G;  3E1I A;  4L75 A;  2IFN A;  4U3F G;  5C39 A;  3CMA P;  1HUC A;  3Q3D A;  1ZR4 A;  1PP9 G;  1KV4 A;  1NYH A;  1JY3 P;  4YTP C;  4IFM A;  1Y8A A;  5B66 E;  2IX7 C;  1QL1 A;  2FKW B;  1S72 P;  3JCU E;  2A06 E;  1NU1 K;  5CHX A;  2JWD A;  2WTY A;  1T8Z A;  4OGQ C;  1NH4 A;  1OVR A;  2P58 A;  4EIJ A;  1OW8 A;  4H0L C;  1OXZ A;  3HE4 A;  2V4H A;  5H2F H;  4ZKU A;  2QJY C;  1GL2 D;  1PZQ A;  3CCM P;  3FWN A;  3PLN A;  4C7N B;  5AVT B;  4TLF A;  3IAO A;  3FX0 A;  2Z4E A;  2FXP A;  1P84 D;  2NZ2 A;  3S9O A;  2OTL P;  2OYI A;  3C1L A;  3L72 E;  3O6Q A;  3L74 J;  1LTS C;  2YXQ B;  3L71 G;  2BEQ D;  1SQX K;  4IFF A;  3AE5 C;  4RJT A;  3B4S A;  4B86 A;  4RO0 A;  3BCC G;  2G3A A; 
#chains in the Genus database with same CATH homology
 1LT9 B;  1JTH A;  3U59 A;  1FZC B;  1JY3 N;  2YKO A;  3P8C E;  3M9Q A;  1RF1 C;  2P7J A;  1EQ7 A;  2H43 A;  3T97 A;  2H7H A;  5AVQ B;  3L35 A;  2R5D A;  5APT A;  1SQQ K;  2PP6 A;  4W80 A;  1GW4 A;  1CW5 A;  2CPS A;  2WIT A;  1M1J C;  1LT9 A;  4XE5 B;  1AQ5 A;  1N73 C;  1KIL C;  1FZC A;  1NO4 A;  2WSF H;  5AW9 B;  3RK2 D;  2A45 I;  2P2U A;  2C9L Y;  2I1K A;  1VPC A;  4I1L A;  3M0D C;  2L5G B;  3IFM A;  1JY3 O;  1LWU B;  1J1E C;  2HYN A;  1FJK A;  4LGD E;  2XV5 A;  1KFM A;  2C0X A;  5AVR B;  1OWA A;  1IK9 A;  1URQ D;  1KQL A;  1LTI C;  2XZR A;  2QM7 A;  1H89 A;  1LTG C;  2M8R A;  2OYI C;  3M06 A;  3WMM 0;  3VP9 A;  3CLQ A;  2N1T B;  1IJD B;  2YKP A;  4W7Y A;  3RL0 D;  4JYC A;  2J58 A;  1LWU A;  2WT7 B;  1AFO A;  1JO5 A;  2NPS A;  2P1J A;  1FAV A;  4W7Z A;  1SFC B;  1HH0 A;  2BAS A;  2YMY A;  4I6M C;  4AYC A;  1WRG A;  2O01 H;  2R32 A;  2OYH B;  3V2N A;  1N7S B;  3R2P A;  4C7R A;  1T3J A;  5AVW B;  4LLH A;  1FJP A;  1RE4 A;  2WZ7 A;  3NMD A;  2N1T A;  2R5B A;  1LTA C;  1MZ9 A;  4N6J A;  3HD7 D;  5AVY B;  5APQ A;  1J1D C;  2HG5 D;  3LID A;  2WT7 A;  2FYU K;  5AW7 B;  1SFC A;  1L4A A;  3LW5 H;  1N7S A;  4ZKP A;  5CCH D;  3UIA A;  2WPR A;  1LT9 C;  1JCD A;  2C9N Y;  3HRN A;  1FZC C;  1ZLL A;  1T2K C;  1GK4 A;  5CCG A;  3TSI A;  1ZV8 A;  2YNY A;  5AW4 B;  1IFN A;  1CI6 A;  1E5W A;  1JTH B;  1T3U A;  3MIW A;  4C46 A;  1LTT C;  1FZF A;  1JUN A;  5BVZ A;  4HYT B;  1QL2 A;  3NFQ A;  3CL3 D;  4RES B;  1FU1 A;  3VP8 A;  1GZL A;  2HOD B;  3RK3 C;  3BVH A;  3NTN A;  2KYV A;  1GL2 B;  1KZU B;  1SLQ A;  2M3B A;  3EQ2 A;  3MGN A;  1NWQ A;  3L4F A;  1FZA A;  1HGV A;  3B5N B;  1LWU C;  2PAJ A;  4WY4 D;  3V2R A;  3OAK A;  3VOP A;  2ZXE B;  2VRS A;  3I5C A;  3L36 A;  1RF0 A;  2HOD A;  4LC1 A;  2P67 A;  1DEB A;  1N2D C;  2GUS A;  1NTM K;  5CJ0 A;  3SWF A;  1GL2 A;  5CMZ A;  3RK3 B;  2N9B A;  3MTU E;  1RE4 C;  1CZQ A;  2N1T C;  1GD2 E;  3HUS B;  3TNU B;  2FXM A;  2E43 A;  1NHL A;  4DOJ A;  1M7L A;  3B5N A;  4O9B A;  3VN0 A;  1HJB A;  3VTP C;  1FZB A;  5AVU B;  3V2P A;  1KIL D;  1N7L A;  3CI9 A;  3M0A A;  1IO4 A;  2KLV A;  1SFC C;  1L4A C;  1SVF A;  3KYQ A;  2NPS B;  2OYH C;  2GUV A;  3GHG B;  1G2C B;  1HVV A;  1N7S C;  2IFM A;  2JJL A;  5AW0 B;  2W6A A;  2XDJ A;  5AW2 B;  3TYY A;  2WSC H;  2KP8 A;  1GK6 A;  3KPE A;  3HUS A;  3II6 A;  2H8P D;  5AW8 B;  5CCG C;  1NTZ K;  3TNU A;  3V4Q A;  1A02 F;  1HGZ A;  3VYI A;  1Z56 A;  1YTZ I;  4N78 D;  3A5T A;  1YTZ T;  2JEE A;  2XKM A;  1IFI A;  5AW1 B;  1X9V A;  4WB4 A;  2Q7C A;  1RY3 A;  5KJ7 A;  2KB7 P;  2HPC A;  1XTC C;  1FOS E;  1G2C A;  2OAR A;  3GHG A;  5APV A;  3A7O A;  5APX A;  2FFD B;  1FDM A;  1L4A B;  2A45 H;  3RK2 B;  5APS A;  2FYZ A;  5KLV K;  3B8E B;  2KOG A;  2E42 A;  1SQB K;  1N86 A;  5AW5 B;  2CPB A;  1CI6 B;  1SQP K;  5AVV B;  4DZO A;  1URQ B;  5BU8 B;  1RF1 A;  2Q9I A;  2KSJ A;  1SQV K;  1GW3 A;  3A2A A;  2FFD A;  4I2L C;  4HH2 A;  1GL2 C;  2WWW A;  3BRV B;  5AW3 B;  3P7K A;  1M1J A;  3RL0 B;  3H32 B;  1KIL A;  3VMX A;  3C9I A;  4GKG A;  3MUD A;  1URQ A;  3B5N C;  1H88 A;  2HFE D;  4GT1 A;  1T2K D;  2QM8 A;  5APW A;  1PFI A;  3TK1 A;  1X8Y A;  2Q3I A;  3M9H A;  1GDT A;  3KQG A;  1GU4 A;  2IPP A;  3H32 A;  3HD7 B;  2HLO A;  2XNX A;  3HUS C;  3RK3 D;  1S9K D;  2WPS A;  1GTW A;  3VMY A;  1JY2 P;  4Y99 B;  1MV8 A;  1L0L K;  3M9B A;  4M3L A;  1LTJ B;  2WSE H;  1VDF A;  3PP5 A;  5KJ7 C;  1JMM A;  1IFD A;  2NPS C;  3GHG C;  4N3Y B;  3P8M C;  5APY A;  1IC2 A;  1MFZ A;  3OJA B;  3HD7 A;  1NKN A;  1L0N K;  1FOS F;  2NPS D;  1G1I A;  4JF7 A;  1LGH B;  3N4X A;  4IFD K;  1J2J B;  1WT6 A;  1NOH A;  2A45 G;  3HTK A;  5APU A;  1HBW A;  1LTJ A;  3V5B A;  3P8C D;  2W27 A;  4GIF A;  2N1T D;  5CCH A;  2I1J A;  3P32 A;  1KFN A;  4OH8 B;  1RE3 A;  2FFD C;  2O1K A;  3N7N A;  4KHX A;  2HPC B;  3U1A A;  2J59 M;  2O1J A;  3LIE A;  1A02 J;  3RK2 C;  1JCC A;  1GU5 A;  1SFC D;  3E1I A;  5AVS B;  2W6B A;  2YO3 A;  2YO2 A;  1L4A D;  3NXS A;  2IFN A;  1MUU A;  1SP4 A;  4WY4 B;  1N7S D;  4WBA A;  1URQ C;  1IFM A;  2WPQ A;  3IR9 A;  4N78 E;  1HWT C;  3KDP B;  1NAF A;  1X79 B;  3V4W A;  4XA4 A;  3EFG A;  1NKZ B;  5CCG D;  2LKM A;  1RF1 B;  3O8Z A;  3HE5 B;  1FBM A;  1HUC A;  3M91 A;  1ZR4 A;  1CSB A;  1YYC A;  1JY3 P;  3RL0 C;  2C0W A;  1FZG A;  4IFM A;  3VMZ A;  1W2E A;  1LTB C;  2IX7 C;  4WY4 A;  1M1J B;  1QL1 A;  1NTK K;  1N73 B;  1KIL B;  3HE4 B;  5CJ4 A;  2FKW B;  1ZR2 A;  1JNM A;  4EOT A;  3HE5 A;  1IFJ A;  1NU1 K;  5CHX A;  3G3Z A;  2WTY A;  1J1E B;  1T8Z A;  1JY2 N;  2Q5U A;  1RF0 C;  1NH4 A;  3HD7 C;  5AW6 B;  1JOC A;  4EIJ A;  5KTB A;  5AVX B;  1XTG B;  1N73 A;  1OXZ A;  3BAT A;  3H6P A;  3HE4 A;  1FZE A;  2OYI B;  4Y99 C;  4ZKU A;  1HTL C;  1GL2 D;  1LTJ C;  2R3C A;  2YKQ A;  3M0D A;  4AQR D;  5CCH C;  4C7N B;  3SWY A;  1RE3 C;  2OYH A;  2Z5I A;  5AVT B;  3B5N D;  4AUW A;  2Z4E A;  1JY2 O;  3U1C A;  2XU6 A;  3MD0 A;  2GM4 A;  2OYI A;  1ZN5 A;  1S9K E;  1LTS C;  3L37 A;  3BAS A;  3HTK B;  1J1D B;  4JYB A;  4C7N A;  1SQX K;  1DH3 A;  4IFF A;  3A3Y B;  1G1J A;  2Z5H A;  3OA7 A;  2MJZ A;  4B86 A;  5KJ7 D;  2POH A;  1DX7 A;  2ZFC A;  1H8A A;  3BRT B;  3V2Q A;  4WY4 C;  5AVZ B;  5BU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...