1HTLC

Mutation of a buried residue causes lack of activity but no conformational change: crystal structure of e. coli heat-labile enterotoxin mutant val 97--> lys
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
41
structure length
41
Chain Sequence
GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
publication title Mutation of a buried residue causes loss of activity but no conformational change in the heat-labile enterotoxin of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 15
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1995-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1htlC00
1HTLC 1LTGC 1LTBC 1LTTC 1XTCC 1LTAC 1LTIC 1LTSC
chains in the Genus database with same CATH superfamily
1NTZK 5APWA 2FY8A 3V2RA 1LTJC 4BXLA 1WT6A 2QA4P 1AQ5A 2YMKA 3MHVA 2OYHA 3B8EB 3SSUA 3W68A 2HPCB 3OA7A 2LR2A 2FYUE 1KQGB 1QL1A 5AVYB 3KXDA 1FAVA 1N7SD 2YIUC 2N1TA 2YO3A 4IL6H 1SQXD 3CWBJ 3WU2E 1YTZT 3CI9A 3TYYA 1LTJA 3V2NA 2H7HA 1Q90D 2QJKB 2RMZA 1MUUA 3FWLA 3G6EP 3HTKA 3D70A 2Y0DA 3M0AA 3CXHH 4WVZA 1IFPA 4EYYQ 3TDKA 2W6JH 1LJ2A 2XV5A 1VQLP 1OMIA 1M8OB 2K37A 2E43A 3PRJA 1OW8A 3NFQA 2ZAEB 4W7YA 3KHUA 3PTZA 1Y8AA 4H13C 1L0LD 1QEXA 2ZJSE 2WITA 4DOJA 4QMAA 2A06E 3I5CA 1T3JA 2HR3A 3HD7B 1DD3A 1M1KQ 1S5LH 1HWTC 3GLMA 4OH8B 1BGYE 5CCHC 1K73Q 1L0NJ 1FZCB 3KPEA 3CL3D 3KDPB 5CHXA 4D6TE 1LTTC 4N78E 1PP9J 2BCCG 1AVYA 2WSEJ 2E76C 1NTME 2V7QJ 1HUCA 1HGZA 3L74G 4Y28J 5KJ7C 1N73B 4LLHA 3G4SP 1QX8A 2IX7C 3L75G 1SFCB 1JEKA 4UB6E 4R4LA 2HG5D 2QE7H 2XZRA 2D2CD 1GL2A 1J2JB 3HE4A 2ZT9C 5CCGD 3RK3B 5AW8B 2ITAA 5AVQB 1JUNA 2AXTH 4N3YB 1BE3J 2FFDC 3H6PA 2DW3A 1SQQG 4EOTA 5KJ7A 3L70E 1OIPA 1KFNA 1JY2O 1CI6A 2KLUA 4I6MC 4KHXA 2FKWB 2W90A 2FYNB 1ZR4A 3V4WA 1KQSO 5TISE 2GUVA 3H1KJ 2FYUG 1M1JB 3Q2YA 1L2PA 1VL2A 1HJBA 2QVAA 2SPZA 2QIWA 3CMAP 1P84I 3SWKA 2Q3IA 1S4XA 2R32A 1JCDA 1JOCA 3P8CD 3CCQP 1SQPD 2PAJA 1LWUA 5APYA 4YPCA 1U7JA 1ZN5A 2PP6A 1NTKJ 1NAYA 2I1JA 5AW6B 3VN0A 3AEGC 2E75C 1YI2P 4PD4I 2PFXA 3VYIA 5APVA 1BCCE 1HJ0A 3EWKA 4B86A 4TLFA 1M90Q 5KLVG 2WSSH 1LT9B 3BATA 2Z5IA 3AEDC 1YJWP 1LTIC 2H43A 1FDIA 2HPCA 4WBAA 4A7PA 1PFIA 2A06D 4N6JA 2JEEA 1VQKP 4EIJA 3H1LG 2YO2A 3CCEP 3TGUE 2Q6QA 3L36A 3KZIE 1K8AQ 4D6TD 1NTMG 1YITP 1VQMP 3L72E 2NPSB 1SQVJ 2GUSA 3HD7C 2OYIB 1VQNP 1SQQK 1L4AC 4PJ0E 3TK1A 1FZCC 3M0DA 2ZYDA 3A0BE 4U3FJ 2LKMA 3CX5I 1K9MQ 2QJPB 3SFDC 1X8YA 1L0ND 3AE4C 2QG4A 1KQLA 2K1AA 2FYUK 1M57D 1BSHA 3A0HE 1PP9D 4UB8E 4WB4A 5CJ0A 3BVHA 1G1JA 3NTNA 2GM4A 1YJNP 1SFCC 2YIUB 1SQBE 4IFFA 1KC8Q 1XTCC 3B5NC 3AE1C 4RJTA 3PJSK 1J1EB 3AEBC 4ZNCA 4IOIH 1T6AA 2NRGA 1AA0A 1DD4A 3RK3C 1RY3A 4BWNA 1EZVD 3A7OA 2OYOA 1P84H 1N73A 3CMEP 5APQA 1KQFB 1ZRTD 1NOHA 3H1JJ 4H13D 1SQXE 4DT0A 5AW0B 3V4QA 1BE3D 3WUUA 1HTLC 3QH9A 2FYNC 2WSCH 4GKGA 3B71A 5B5EE 3RL0g 2CPSA 1E79H 3Q5PA 1NYHA 1M1JC 2JWDA 2M3BA 3IFMA 4H13B 3H1KD 5CCHD 1KORA 1EDIA 1VQ6P 5GTHE 4H44C 5E79E 3AE7C 3CCVP 3VP8A 1LP1B 3OAKA 1BCCD 2E76D 2R3CA 3CCJP 1LTBC 1FDOA 3EFFK 4YXWH 1EDLA 5KJ7D 1M1JA 3V5BA 2XKMA 5AVXB 1OVVA 3F89A 3RBXA 1L0LE 1NTMK 3O6QB 5AW4B 1NTKD 1GTWA 2E76B 1AJYA 5APXA 2ZT9D 1LT9C 1ZXGA 4W80A 1VQ9P 2IYPA 1QLED 2P67A 1EXIA 2OTKE 2Y9ZA 1ZLLA 3L74J 3L72G 2IFMA 1H88A 1FOSF 3WUTA 5KAIH 3L75J 5BU8B 2XDJA 2KS1A 1JM0A 4C7NB 1GMJA 3BCCG 1KB9I 1VF5B 1LT9A 5AVSB 3CX5H 4YTPC 3AE8C 1IFNA 1NU1E 3N7NA 3G71P 3HRNA 3JCUE 1SQQJ 2YXQB 2YNYA 2NPSC 2B87A 3H1IG 1RF1B 3CD6P 3SFEC 1PGPA 3HE5A 1PGQA 1T3UA 2W83C 2IDBA 3CXHD 1SQBD 1YYCA 1IK9A 3M91A 1H8AA 2KXPB 1CZQA 1FS0E 2QJPC 3VOPA 3L73E 1A02J 5KLIB 4U3FD 2E74B 3KZIH 1HVVA 1M7LA 1Q7YQ 1VQ4P 2LXCB 1SQXG 3FXDA 1PGOA 2OYIA 3D71A 2YXRB 3H32B 4Y99B 2E75B 2ZXEB 5B66E 2KB7P 3VP9A 3P8CE 1HH0A 1SQPE 2P7JA 1J1EC 1N7LA 1DX7A 3MUDC 3H1HJ 1KYOE 1JY3P 4NPFX 2WSFH 1NJIQ 2KNCA 3ZDMA 2BASA 3C9IA 1VPCA 2H88C 3TNUA 5KLVJ 2FYZA 1KZUB 1IO4A 4HKZH 1Q81Q 3RGUA 1AV1A 4UB8H 2FXPA 3H1JD 2JR8A 1R8EA 3W67A 3HD7D 3CWBE 3E1RA 4C46A 1L0LG 2LXBA 4L74A 4H0LB 2HFED 1OXZA 4L75A 3FX0A 3H1LJ 3HUSB 3AE9C 3C8VA 3CCMP 1A02F 3V2PA 1WRGA 1ZP0C 3LW5H 1VDFA 2PGDA 2QM8A 2N9YB 1L4AB 2WSCJ 3GHGB 1SFCD 2W6AA 1SVFA 5B5EH 1DEEG 2RN0A 2B88A 1KB9H 1H0TB 4HJGH 1LP1A 1SQBK 2J5UA 3WUVA 3RK3D 1GD2E 2QJYB 2ZYAA 3PHLA 1LT1A 2O01N 1BSNA 3MTUE 3B5NB 5CCHA 1EDKA 1YHQP 1NU1D 5K5GB 1L0NE 3O6QA 1RQVA 1Y9BA 1KILB 1JTHB 2M0BA 3L74D 3EFGA 1JMBA 1URQB 1PP9E 3E7KA 2JO1A 2K9JB 4OWFA 3L75D 1SQXK 1VF5C 2KLVA 2OQQA 4PV1B 2IYOA 3L35A 1KTMA 4ASVA 3L73D 1S1CX 3PLNA 4I7ZB 4WY4B 1FZAA 1NTZJ 1EZVE 3LIEA 1RF1C 1IFDA 4Z1MH 5CBNA 3ABVC 2WT7A 4C7RA 4C7NA 2FFDA 1ZRTE 1YBKA 1SQPG 2JWAA 4H44B 1OVUA 3NXSA 1BE3E 1RE3C 2L91A 2IFNA 1Q82Q 3AE6C 2BEZF 2K88A 4L73A 1KYOD 3RK2B 2Q9IA 5KLIC 3M9BA 1QGKB 5CMZA 2QSIA 2E74C 2YKQA 4XE5B 1L0LK 3PP5A 3H1KE 2ZXXA 5AVZB 4Y99C 2M5AB 3T97B 2JJLA 1ZMEC 1EXJA 1RH5B 2KOGA 3L37A 2JDIH 4I2LC 1S9KD 1NKZB 1OX3A 1JY2P 3CWBD 5AVUB 2PRRA 1DH3A 4ZKPA 2O1KA 2WPVB 3IN6A 3H1HD 2A06G 4EDFA 1MV8A 1NAFA 1RE4C 3L71J 1NTKE 1PL5A 2YKOA 2WZ7A 2HYNA 4KT0J 2W27A 1N2DC 1R5SA 1VQ7P 2C0WA 1BGYG 3SWYA 2NPSD 5KLVD 5GTIE 1W5CE 1IJDB 4D6TG 1RQUA 2WWWA 3AEEC 5AVWB 4H0LC 1NU1K 4BRYB 3Q5RA 5AVRB 2KUBA 1FZGA 2WSFJ 3WU2H 3BCCJ 2K3RA 2Q3EA 1BDCA 3HUSC 2IZ1A 3LIDA 1QVFO 1CW5A 4RESB 1KFMA 3TF5A 1J1DB 1P84D 5TJHA 3GF7A 2P10A 3FWNA 3GHGC 2O01H 5AW2B 4IL6E 2AEFA 3H1IJ 2OYHB 1L0NG 1ZOYC 5AVVB 4EI2A 2Q7CA 1N8RQ 1KMIZ 1PP9G 3M9HA 2N1TB 3HUSA 5AW5B 3L70G 5AW1B 3HD7A 2POHA 1K04A 5AW3B 2QJYC 4JPZB 1SQVE 3CXHE 4PD4D 4YXDC 1L4AA 1SQPK 1FZCA 3IF4A 1NKNA 3HTKB 1EZVG 2P2UA 1USEA 2H89C 3BASA 1PIXA 1KILC 2WMMA 4U3FE 1DEBA 1URQC 2E5YA 4ZMDA 4PV1C 1VQPP 4NPEA 2P1JA 1JNMA 1SFCA 4AYCA 2A45I 3JSVC 3B5NA 1Q86Q 1XTGB 1S5LE 4LC1A 2J58A 4I7ZC 4WY4C 1T2KC 1JO5A 1N86A 3H1KG 2D2CC 2N9BA 1JTHA 4UB6H 1NTZD 1OW7A 1FC2C 3P7KA 2KZJA 1BCCG 4W7ZA 1R5LA 2AXCA 1VQ8P 1Q2NA 2WPRA 2Q5UA 3H1JE 3RK2C 3TSIA 4DJGA 1FOSE 4WY4A 1RHZB 3CX5D 3ITKA 1NTKG 3P8MC 2HODB 4U7JA 1FJPA 1RF0C 5TISH 5AVTB 3TGUG 1FE6A 4GDOA 4JF7A 1GL2B 2BCCJ 1IFJA 3CLQA 3HE4B 2KI7B 1NVOA 2R5BA 2A45G 2I1KA 2OTJP 1GDTA 3VMYA 4XA4A 4LGDE 1VF5D 5BU5A 2M3EA 1L0NK 2VRSA 4OGQB 2M5AA 1FZBA 4IFDK 1CI6B 2Y0CA 3RBZA 4RO0A 2J59M 1SS1A 2NZ2A 4M3LA 2AEJA 3BRTB 1PPJD 2B9BA 3L71D 3RK3E 1KV4A 1GZLA 2AEMA 1GK6A 1G2CB 2OGUA 2R3SA 1T8ZA 3RL0C 1EC5A 5BVZA 1SP4A 3L74E 1OFCX 1SQBG 5H2FE 1J1DC 3L75E 2E74D 1SQVD 2XU6A 2FYUJ 2OYHC 4MN4C 2C9NY 3L4FA 2E75D 4BRYA 1LTSC 2R5DA 4U3FG 2OTLP 2UWJE 2WPQA 5GTIH 2N1TC 3H1ID 3F5HA 2IBZD 2G3AA 2NPSA 5AW7B 5KKZC 1SQQE 2ZYGA 3A2AA 1AFOA 1USDA 2A45H 1LTGC 3K5BA 1FJKA 3A3YB 4ASWA 1QVGO 2R44A 2O01J 1PZQA 2E5TA 2ZVNB 1GW3A 2Y9YA 4PJ0H 1PV3A 1EQ7A 1H89A 4NPDA 1PGJA 3A0BH 1NTKK 1UIIA 3MIWA 1IFIA 2BEQD 2W6BA 4H0LD 1MFZA 2JKVA 3OJAB 3H1JG 1KB9D 3H25A 3AE5C 1N7SB 3A0HH 2JP3A 1S9KE 1GW4A 2O1JA 3MUDA 1X22A 4ZKUA 4JYCA 3H1HE 2IPPA 1L4AD 1BGYJ 2FBWC 3CC4P 3NMDA 4D6TJ 1NGMB 1CSBA 5KLVE 1NTMJ 1D7MA 1U7MA 1FU1A 2YKPA 4IFMA 2Y0EA 1ZR2A 4GOFA 1NO4A 3E1IA 3Q5SA 1JMMA 1OVRA 3GW6A 2B89A 3B5ND 1YQ4C 3KYQA 2M8RA 3II6A 1FBMA 3AEFC 3VMZA 3D6ZA 1KYOI 1SQVK 4HB1A 1GL2C 1KILD 1P84E 1Z56A 3H1LE 1EDJA 5APTA 3OW2O 1URQD 1E5WA 5GTHH 1NU1G 5E79H 4PV1D 3L70J 2WPSA 2I8DA 1NHLA 3AE2C 3O8ZA 2BCCD 4OGQC 2RH0A 2HODA 4JQ0D 1FDMA 5EFWB 1LGHB 3EQ2A 3CC2P 2C0XA 4WY4D 1T2KD 2C9LY 5CBOA 4PD4E 1LNQA 3L73G 3VTPC 4H44D 2V4HA 3M9QA 2KIKA 4IL6X 5DJUB 3USSA 4GODA 2D2CB 3CCSP 4AQRD 3RK2D 2RKLA 1SQQD 3P32A 1OWAA 5AW9B 4AUWA 1LWUC 2HLOA 4KJMA 1W2BO 2XNDH 1G2CA 4L76A 1TU3F 3VMAA 2FYUD 3IAOA 3CCUP 4HH2A 1BCCJ 1RF1A 1Y47A 4DZOA 1NTZE 5KTBA 1OZHA 3I56P 3JCUH 5KAIE 2Z5HA 3VMXA 2KSEA 3B4SA 3N4XA 3CWBG 1YJ9P 1RE3A 3UIAA 2KYVA 5H2FH 2Z4EA 1K05A 3H1HG 4HYTB 3MGNA 2KS1B 3CX5E 1S5LX 3R2PA 1GK4A 2G8YA 3JC22 3TGUJ 3A5TA 2ZVOB 5C39A 3H32A 1OW6A 3QWOC 5KAFE 2QJKC 1N7SC 3R4YA 3RL0D 1FZFA 1EZVI 3L72J 3U59A 3PH0A 3C1LA 3GG2A 4TT3H 1ZW0A 5B66H 2B87B 2QRXA 3HE5B 5L8RJ 1IZNB 3RL0B 1KYOH 1RE4A 3GMAA 1YTZI 4K35A 3M0DC 1BGYD 2N1TD 1PPJE 3L71E 1N7SA 3H1LD 2OARA 1JB0J 4N78D 2KK7A 2KP8A 1NTMD 3KQGA 3FXEA 1SQBJ 3IR9A 4JYBA 2L5GB 1JY3N 2P58A 4R4MA 2FXMA 5M1BA 3BCCE 3AECC 1JCCA 1KD1Q 4XFJA 5KKZB 1IK7A 3CCRP 1LTJB 3LW5J 3GHGA 2KNCB 4WWIA 3U1AA 1SQXJ 2E42A 1WMKA 1N73C 2H8PD 3H1IE 1G1IA 3GF3A 3TNUB 2IBZE 3L70D 1H0TA 1BE3G 1AQTA 1BDDA 4O9BA 3U1CA 3Q1MA 4RKUJ 1IC2A 1NTZG 1KILA 1YQ3C 1KN7A 1QL2A 1URQA 3CPWO 2K9JA 5CCGC 5APUA 2CK3H 1GU5A 3S4RA 1HGVA 3S9OA 5KLVK 1KB9E 1L0LJ 4JBZA 2O3JA 4GIFA 5CJ4A 2YMYA 1M56D 3MP7B 2WQYC 2WSEH 2V7QH 1X79B 4PD4H 1GL2D 1ZV8A 4GOEA 3Q3DA 3CXHI 3MZWB 3WMM0 1MFTA 2W8ZA 2WTYA 1FZEA 1W2EA 5CCGA 1X9VA 4OGQD 2AXTE 1S72P 3CC7P 2IBZI 2Q1KA 2KSJA 4DCKA 3AE3C 3G3ZA 2CPBA 5DJTB 3SWFA 3D6YA 1NWQA 1VQOP 3BRVB 3CCLP 1MKMA 3FGAD 3T97A 2GA1A 1PPJG 3L71G 3S1KA 1RF0A 3TGUD 1NU1J 1HBWA 2XNXA 3G9RA 1KILE 1UIXA 2IZ0A 4CPGA 4GT1A 3M06A 2ZT9B 2WVRA 1NH4A 3L72D 2BCCE 4I1LA 2WT7B 1HF9A 5APSA 1S3JA 1U57A 3V2QA 1DIPA 3AEAC 4K3AA 2FFDB 1S2EA 1LTAC 1JY3O 3L73J 1SQVG 2MJZA 3BCCD 1X0TA 2KZIA 1LWUB 2QEXP 1VQ5P 3V6IA 2QM7A 1AVOA 2K9YA 2ZFCA 1SLQA 1GU4A 5KAFH 2IBZG 1YIJP 3I55P 1IFMA 2OYIC 2FXOA 1JY2N 1SQPJ 3MD0A 2MKVA 1MZ9A 4OVNF
chains in the Genus database with same CATH topology
1NTZK 2M3BA 2W27A 1N2DC 2WPSA 1NHLA 2C0WA 3O8ZA 3SWYA 5APWA 3IFMA 2NPSD 3V2RA 5CCHD 1LTJC 2HODA 1IJDB 1WT6A 1AQ5A 2WWWA 5AVWB 2OYHA 1FDMA 3VP8A 1NU1K 3B8EB 1LGHB 3EQ2A 2C0XA 4WY4D 5AVRB 1T2KD 1FZGA 2HPCB 3OA7A 2C9LY 3OAKA 1QL1A 2R3CA 5AVYB 1LTBC 1FAVA 1N7SD 3HUSC 2N1TA 3LIDA 2YO3A 1CW5A 3VTPC 5KJ7D 4RESB 1KFMA 1M1JA 3V5BA 2XKMA 1J1DB 3M9QA 1YTZT 5AVXB 1NTMK 3CI9A 3TYYA 3GHGC 5AW4B 2O01H 1LTJA 3V2NA 5AW2B 2H7HA 1GTWA 2OYHB 4AQRD 3RK2D 1MUUA 5APXA 5AVVB 3P32A 3HTKA 1OWAA 5AW9B 4AUWA 2Q7CA 1LWUC 3M0AA 2HLOA 3M9HA 1LT9C 2N1TB 4W80A 3HUSA 5AW5B 5AW1B 2P67A 3HD7A 1ZLLA 1G2CA 2POHA 2XV5A 5AW3B 2IFMA 2E43A 1H88A 1FOSF 3NFQA 4HH2A 1L4AA 1SQPK 2XDJA 5BU8B 1RF1A 1FZCA 4DZOA 1NKNA 4W7YA 4C7NB 3HTKB 2P2UA 5KTBA 3BASA 2Z5HA 1KILC 3VMXA 2WITA 1LT9A 4DOJA 5AVSB 1DEBA 3I5CA 3N4XA 1URQC 1RE3A 1T3JA 3UIAA 3HD7B 2KYVA 1IFNA 3N7NA 2Z4EA 1HWTC 3HRNA 2P1JA 1JNMA 1SFCA 2YNYA 4OH8B 4AYCA 4HYTB 3MGNA 2A45I 2NPSC 3R2PA 1RF1B 1GK4A 5CCHC 1FZCB 3KPEA 3B5NA 3HE5A 3CL3D 3KDPB 1XTGB 5CHXA 1T3UA 3A5TA 4LC1A 1LTTC 2J58A 4N78E 3H32A 4WY4C 1T2KC 1YYCA 1JO5A 1N86A 1IK9A 2N9BA 3M91A 1JTHA 1H8AA 1N7SC 3RL0D 1HUCA 1CZQA 1FZFA 1HGZA 3U59A 3VOPA 5KJ7C 1N73B 4LLHA 3P7KA 2IX7C 1SFCB 1A02J 4W7ZA 1HVVA 1M7LA 2WPRA 2HG5D 2Q5UA 2XZRA 3HE5B 1GL2A 1J2JB 2OYIA 3RK2C 3HE4A 3TSIA 3RL0B 3H32B 4Y99B 1RE4A 1YTZI 2ZXEB 1FOSE 4WY4A 3M0DC 5CCGD 3RK3B 2KB7P 5AW8B 2N1TD 3P8CE 3VP9A 3P8MC 5AVQB 1HH0A 1JUNA 1N7SA 2P7JA 1J1EC 2OARA 4N3YB 1N7LA 1DX7A 2FFDC 2HODB 3H6PA 4EOTA 1JY3P 4N78D 5KJ7A 1FJPA 2KP8A 1KFNA 1RF0C 1JY2O 1CI6A 5AVTB 2WSFH 4I6MC 4KHXA 2FKWB 3KQGA 2BASA 3C9IA 1VPCA 1ZR4A 3IR9A 4JF7A 1GL2B 2L5GB 4JYBA 3V4WA 3HE4B 1IFJA 3CLQA 1JY3N 3TNUA 2R5BA 2A45G 2I1KA 2FXMA 2FYZA 2GUVA 1GDTA 1KZUB 1M1JB 3VMYA 4XA4A 4LGDE 1IO4A 1JCCA 5BU5A 1HJBA 1L0NK 2VRSA 3HD7D 1LTJB 4C46A 3GHGA 1FZBA 4IFDK 1CI6B 2J59M 2Q3IA 4M3LA 2R32A 1JCDA 3BRTB 1JOCA 3P8CD 3U1AA 2E42A 2PAJA 1N73C 2H8PD 1GZLA 1LWUA 2HFED 5APYA 1OXZA 1G1IA 3TNUB 1GK6A 3HUSB 1ZN5A 2PP6A 1A02F 3V2PA 1G2CB 2I1JA 1WRGA 3LW5H 1T8ZA 1VDFA 3RL0C 2QM8A 4O9BA 1L4AB 1SP4A 5AW6B 3GHGB 3VN0A 5BVZA 3U1CA 1SFCD 1J1DC 3VYIA 5APVA 1IC2A 2W6AA 4B86A 1SVFA 2XU6A 1LT9B 1KILA 2OYHC 3BATA 2Z5IA 1QL2A 2C9NY 1URQA 3L4FA 1LTIC 2H43A 1LTSC 2R5DA 1SQBK 2HPCA 5CCGC 3RK3D 5APUA 1GD2E 2WPQA 4WBAA 1GU5A 2N1TC 1PFIA 1HGVA 3MTUE 5KLVK 2NPSA 5AW7B 3B5NB 4N6JA 5CCHA 4GIFA 5CJ4A 2JEEA 2YMYA 3A2AA 1AFOA 2A45H 2WSEH 1LTGC 4EIJA 1X79B 2YO2A 1FJKA 3A3YB 1GL2D 1KILB 1JTHB 1ZV8A 3L36A 3EFGA 1URQB 3WMM0 2WTYA 1FZEA 1SQXK 1W2EA 2KLVA 5CCGA 1GW3A 1X9VA 2NPSB 1EQ7A 2GUSA 3L35A 1H89A 3HD7C 1NTKK 2OYIB 3MIWA 1IFIA 2KSJA 2W6BA 1MFZA 1SQQK 1L4AC 4WY4B 1FZAA 3OJAB 3LIEA 1RF1C 1IFDA 3TK1A 1FZCC 3G3ZA 3M0DA 2CPBA 2WT7A 4C7RA 1N7SB 3SWFA 4C7NA 1S9KE 2LKMA 1NWQA 1GW4A 2O1JA 3BRVB 3MUDA 2FFDA 1X8YA 3T97A 4ZKUA 1RF0A 1KQLA 3NXSA 1RE3C 2FYUK 1HBWA 4JYCA 2IFNA 2XNXA 2IPPA 1L4AD 4WB4A 5CJ0A 3BVHA 4GT1A 1G1JA 3NTNA 2GM4A 3RK2B 1SFCC 2Q9IA 3M9BA 3M06A 4IFFA 3NMDA 5CMZA 1NH4A 1XTCC 2YKQA 3B5NC 4XE5B 1CSBA 1L0LK 4I1LA 2WT7B 3PP5A 5APSA 3V2QA 1J1EB 1FU1A 2YKPA 4Y99C 5AVZB 4IFMA 2FFDB 2JJLA 1ZR2A 1LTAC 1JY3O 3RK3C 1RY3A 1NO4A 2MJZA 3E1IA 2KOGA 3A7OA 3L37A 1JMMA 4I2LC 1LWUB 1S9KD 1NKZB 3B5ND 1N73A 3KYQA 5APQA 1JY2P 2M8RA 5AVUB 2QM7A 3II6A 1FBMA 1NOHA 2ZFCA 1DH3A 4ZKPA 2O1KA 3VMZA 5AW0B 1SLQA 3V4QA 1GU4A 1HTLC 1SQVK 1MV8A 1GL2C 1KILD 1IFMA 1Z56A 2WSCH 2OYIC 4GKGA 5APTA 1URQD 2CPSA 1NAFA 1JY2N 1RE4C 3MD0A 1E5WA 2YKOA 2WZ7A 1M1JC 2HYNA 1MZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTL C;  1LTG C;  1LTB C;  1LTT C;  1XTC C;  1LTA C;  1LTI C;  1LTS C; 
#chains in the Genus database with same CATH topology
 1NTZ K;  5APW A;  2FY8 A;  3V2R A;  1LTJ C;  4BXL A;  1WT6 A;  2QA4 P;  1AQ5 A;  2YMK A;  3MHV A;  2OYH A;  3B8E B;  3SSU A;  3W68 A;  2HPC B;  3OA7 A;  2LR2 A;  2FYU E;  1KQG B;  1QL1 A;  5AVY B;  3KXD A;  1FAV A;  1N7S D;  2YIU C;  2N1T A;  2YO3 A;  4IL6 H;  1SQX D;  3CWB J;  3WU2 E;  1YTZ T;  3CI9 A;  3TYY A;  1LTJ A;  3V2N A;  2H7H A;  1Q90 D;  2QJK B;  2RMZ A;  1MUU A;  3FWL A;  3G6E P;  3HTK A;  3D70 A;  2Y0D A;  3M0A A;  3CXH H;  4WVZ A;  1IFP A;  4EYY Q;  3TDK A;  2W6J H;  1LJ2 A;  2XV5 A;  1VQL P;  1OMI A;  1M8O B;  2K37 A;  2E43 A;  3PRJ A;  1OW8 A;  3NFQ A;  2ZAE B;  4W7Y A;  3KHU A;  3PTZ A;  1Y8A A;  4H13 C;  1L0L D;  1QEX A;  2ZJS E;  2WIT A;  4DOJ A;  4QMA A;  2A06 E;  3I5C A;  1T3J A;  2HR3 A;  3HD7 B;  1DD3 A;  1M1K Q;  1S5L H;  1HWT C;  3GLM A;  4OH8 B;  1BGY E;  5CCH C;  1K73 Q;  1L0N J;  1FZC B;  3KPE A;  3CL3 D;  3KDP B;  5CHX A;  4D6T E;  1LTT C;  4N78 E;  1PP9 J;  2BCC G;  1AVY A;  2WSE J;  2E76 C;  1NTM E;  2V7Q J;  1HUC A;  1HGZ A;  3L74 G;  4Y28 J;  5KJ7 C;  1N73 B;  4LLH A;  3G4S P;  1QX8 A;  2IX7 C;  3L75 G;  1SFC B;  1JEK A;  4UB6 E;  4R4L A;  2HG5 D;  2QE7 H;  2XZR A;  2D2C D;  1GL2 A;  1J2J B;  3HE4 A;  2ZT9 C;  5CCG D;  3RK3 B;  5AW8 B;  2ITA A;  5AVQ B;  1JUN A;  2AXT H;  4N3Y B;  1BE3 J;  2FFD C;  3H6P A;  2DW3 A;  1SQQ G;  4EOT A;  5KJ7 A;  3L70 E;  1OIP A;  1KFN A;  1JY2 O;  1CI6 A;  2KLU A;  4I6M C;  4KHX A;  2FKW B;  2W90 A;  2FYN B;  1ZR4 A;  3V4W A;  1KQS O;  5TIS E;  2GUV A;  3H1K J;  2FYU G;  1M1J B;  3Q2Y A;  1L2P A;  1VL2 A;  1HJB A;  2QVA A;  2SPZ A;  2QIW A;  3CMA P;  1P84 I;  3SWK A;  2Q3I A;  1S4X A;  2R32 A;  1JCD A;  1JOC A;  3P8C D;  3CCQ P;  1SQP D;  2PAJ A;  1LWU A;  5APY A;  4YPC A;  1U7J A;  1ZN5 A;  2PP6 A;  1NTK J;  1NAY A;  2I1J A;  5AW6 B;  3VN0 A;  3AEG C;  2E75 C;  1YI2 P;  4PD4 I;  2PFX A;  3VYI A;  5APV A;  1BCC E;  1HJ0 A;  3EWK A;  4B86 A;  4TLF A;  1M90 Q;  5KLV G;  2WSS H;  1LT9 B;  3BAT A;  2Z5I A;  3AED C;  1YJW P;  1LTI C;  2H43 A;  1FDI A;  2HPC A;  4WBA A;  4A7P A;  1PFI A;  2A06 D;  4N6J A;  2JEE A;  1VQK P;  4EIJ A;  3H1L G;  2YO2 A;  3CCE P;  3TGU E;  2Q6Q A;  3L36 A;  3KZI E;  1K8A Q;  4D6T D;  1NTM G;  1YIT P;  1VQM P;  3L72 E;  2NPS B;  1SQV J;  2GUS A;  3HD7 C;  2OYI B;  1VQN P;  1SQQ K;  1L4A C;  4PJ0 E;  3TK1 A;  1FZC C;  3M0D A;  2ZYD A;  3A0B E;  4U3F J;  2LKM A;  3CX5 I;  1K9M Q;  2QJP B;  3SFD C;  1X8Y A;  1L0N D;  3AE4 C;  2QG4 A;  1KQL A;  2K1A A;  2FYU K;  1M57 D;  1BSH A;  3A0H E;  1PP9 D;  4UB8 E;  4WB4 A;  5CJ0 A;  3BVH A;  1G1J A;  3NTN A;  2GM4 A;  1YJN P;  1SFC C;  2YIU B;  1SQB E;  4IFF A;  1KC8 Q;  1XTC C;  3B5N C;  3AE1 C;  4RJT A;  3PJS K;  1J1E B;  3AEB C;  4ZNC A;  4IOI H;  1T6A A;  2NRG A;  1AA0 A;  1DD4 A;  3RK3 C;  1RY3 A;  4BWN A;  1EZV D;  3A7O A;  2OYO A;  1P84 H;  1N73 A;  3CME P;  5APQ A;  1KQF B;  1ZRT D;  1NOH A;  3H1J J;  4H13 D;  1SQX E;  4DT0 A;  5AW0 B;  3V4Q A;  1BE3 D;  3WUU A;  1HTL C;  3QH9 A;  2FYN C;  2WSC H;  4GKG A;  3B71 A;  5B5E E;  3RL0 g;  2CPS A;  1E79 H;  3Q5P A;  1NYH A;  1M1J C;  2JWD A;  2M3B A;  3IFM A;  4H13 B;  3H1K D;  5CCH D;  1KOR A;  1EDI A;  1VQ6 P;  5GTH E;  4H44 C;  5E79 E;  3AE7 C;  3CCV P;  3VP8 A;  1LP1 B;  3OAK A;  1BCC D;  2E76 D;  2R3C A;  3CCJ P;  1LTB C;  1FDO A;  3EFF K;  4YXW H;  1EDL A;  5KJ7 D;  1M1J A;  3V5B A;  2XKM A;  5AVX B;  1OVV A;  3F89 A;  3RBX A;  1L0L E;  1NTM K;  3O6Q B;  5AW4 B;  1NTK D;  1GTW A;  2E76 B;  1AJY A;  5APX A;  2ZT9 D;  1LT9 C;  1ZXG A;  4W80 A;  1VQ9 P;  2IYP A;  1QLE D;  2P67 A;  1EXI A;  2OTK E;  2Y9Z A;  1ZLL A;  3L74 J;  3L72 G;  2IFM A;  1H88 A;  1FOS F;  3WUT A;  5KAI H;  3L75 J;  5BU8 B;  2XDJ A;  2KS1 A;  1JM0 A;  4C7N B;  1GMJ A;  3BCC G;  1KB9 I;  1VF5 B;  1LT9 A;  5AVS B;  3CX5 H;  4YTP C;  3AE8 C;  1IFN A;  1NU1 E;  3N7N A;  3G71 P;  3HRN A;  3JCU E;  1SQQ J;  2YXQ B;  2YNY A;  2NPS C;  2B87 A;  3H1I G;  1RF1 B;  3CD6 P;  3SFE C;  1PGP A;  3HE5 A;  1PGQ A;  1T3U A;  2W83 C;  2IDB A;  3CXH D;  1SQB D;  1YYC A;  1IK9 A;  3M91 A;  1H8A A;  2KXP B;  1CZQ A;  1FS0 E;  2QJP C;  3VOP A;  3L73 E;  1A02 J;  5KLI B;  4U3F D;  2E74 B;  3KZI H;  1HVV A;  1M7L A;  1Q7Y Q;  1VQ4 P;  2LXC B;  1SQX G;  3FXD A;  1PGO A;  2OYI A;  3D71 A;  2YXR B;  3H32 B;  4Y99 B;  2E75 B;  2ZXE B;  5B66 E;  2KB7 P;  3VP9 A;  3P8C E;  1HH0 A;  1SQP E;  2P7J A;  1J1E C;  1N7L A;  1DX7 A;  3MUD C;  3H1H J;  1KYO E;  1JY3 P;  4NPF X;  2WSF H;  1NJI Q;  2KNC A;  3ZDM A;  2BAS A;  3C9I A;  1VPC A;  2H88 C;  3TNU A;  5KLV J;  2FYZ A;  1KZU B;  1IO4 A;  4HKZ H;  1Q81 Q;  3RGU A;  1AV1 A;  4UB8 H;  2FXP A;  3H1J D;  2JR8 A;  1R8E A;  3W67 A;  3HD7 D;  3CWB E;  3E1R A;  4C46 A;  1L0L G;  2LXB A;  4L74 A;  4H0L B;  2HFE D;  1OXZ A;  4L75 A;  3FX0 A;  3H1L J;  3HUS B;  3AE9 C;  3C8V A;  3CCM P;  1A02 F;  3V2P A;  1WRG A;  1ZP0 C;  3LW5 H;  1VDF A;  2PGD A;  2QM8 A;  2N9Y B;  1L4A B;  2WSC J;  3GHG B;  1SFC D;  2W6A A;  1SVF A;  5B5E H;  1DEE G;  2RN0 A;  2B88 A;  1KB9 H;  1H0T B;  4HJG H;  1LP1 A;  1SQB K;  2J5U A;  3WUV A;  3RK3 D;  1GD2 E;  2QJY B;  2ZYA A;  3PHL A;  1LT1 A;  2O01 N;  1BSN A;  3MTU E;  3B5N B;  5CCH A;  1EDK A;  1YHQ P;  1NU1 D;  5K5G B;  1L0N E;  3O6Q A;  1RQV A;  1Y9B A;  1KIL B;  1JTH B;  2M0B A;  3L74 D;  3EFG A;  1JMB A;  1URQ B;  1PP9 E;  3E7K A;  2JO1 A;  2K9J B;  4OWF A;  3L75 D;  1SQX K;  1VF5 C;  2KLV A;  2OQQ A;  4PV1 B;  2IYO A;  3L35 A;  1KTM A;  4ASV A;  3L73 D;  1S1C X;  3PLN A;  4I7Z B;  4WY4 B;  1FZA A;  1NTZ J;  1EZV E;  3LIE A;  1RF1 C;  1IFD A;  4Z1M H;  5CBN A;  3ABV C;  2WT7 A;  4C7R A;  4C7N A;  2FFD A;  1ZRT E;  1YBK A;  1SQP G;  2JWA A;  4H44 B;  1OVU A;  3NXS A;  1BE3 E;  1RE3 C;  2L91 A;  2IFN A;  1Q82 Q;  3AE6 C;  2BEZ F;  2K88 A;  4L73 A;  1KYO D;  3RK2 B;  2Q9I A;  5KLI C;  3M9B A;  1QGK B;  5CMZ A;  2QSI A;  2E74 C;  2YKQ A;  4XE5 B;  1L0L K;  3PP5 A;  3H1K E;  2ZXX A;  5AVZ B;  4Y99 C;  2M5A B;  3T97 B;  2JJL A;  1ZME C;  1EXJ A;  1RH5 B;  2KOG A;  3L37 A;  2JDI H;  4I2L C;  1S9K D;  1NKZ B;  1OX3 A;  1JY2 P;  3CWB D;  5AVU B;  2PRR A;  1DH3 A;  4ZKP A;  2O1K A;  2WPV B;  3IN6 A;  3H1H D;  2A06 G;  4EDF A;  1MV8 A;  1NAF A;  1RE4 C;  3L71 J;  1NTK E;  1PL5 A;  2YKO A;  2WZ7 A;  2HYN A;  4KT0 J;  2W27 A;  1N2D C;  1R5S A;  1VQ7 P;  2C0W A;  1BGY G;  3SWY A;  2NPS D;  5KLV D;  5GTI E;  1W5C E;  1IJD B;  4D6T G;  1RQU A;  2WWW A;  3AEE C;  5AVW B;  4H0L C;  1NU1 K;  4BRY B;  3Q5R A;  5AVR B;  2KUB A;  1FZG A;  2WSF J;  3WU2 H;  3BCC J;  2K3R A;  2Q3E A;  1BDC A;  3HUS C;  2IZ1 A;  3LID A;  1QVF O;  1CW5 A;  4RES B;  1KFM A;  3TF5 A;  1J1D B;  1P84 D;  5TJH A;  3GF7 A;  2P10 A;  3FWN A;  3GHG C;  2O01 H;  5AW2 B;  4IL6 E;  2AEF A;  3H1I J;  2OYH B;  1L0N G;  1ZOY C;  5AVV B;  4EI2 A;  2Q7C A;  1N8R Q;  1KMI Z;  1PP9 G;  3M9H A;  2N1T B;  3HUS A;  5AW5 B;  3L70 G;  5AW1 B;  3HD7 A;  2POH A;  1K04 A;  5AW3 B;  2QJY C;  4JPZ B;  1SQV E;  3CXH E;  4PD4 D;  4YXD C;  1L4A A;  1SQP K;  1FZC A;  3IF4 A;  1NKN A;  3HTK B;  1EZV G;  2P2U A;  1USE A;  2H89 C;  3BAS A;  1PIX A;  1KIL C;  2WMM A;  4U3F E;  1DEB A;  1URQ C;  2E5Y A;  4ZMD A;  4PV1 C;  1VQP P;  4NPE A;  2P1J A;  1JNM A;  1SFC A;  4AYC A;  2A45 I;  3JSV C;  3B5N A;  1Q86 Q;  1XTG B;  1S5L E;  4LC1 A;  2J58 A;  4I7Z C;  4WY4 C;  1T2K C;  1JO5 A;  1N86 A;  3H1K G;  2D2C C;  2N9B A;  1JTH A;  4UB6 H;  1NTZ D;  1OW7 A;  1FC2 C;  3P7K A;  2KZJ A;  1BCC G;  4W7Z A;  1R5L A;  2AXC A;  1VQ8 P;  1Q2N A;  2WPR A;  2Q5U A;  3H1J E;  3RK2 C;  3TSI A;  4DJG A;  1FOS E;  4WY4 A;  1RHZ B;  3CX5 D;  3ITK A;  1NTK G;  3P8M C;  2HOD B;  4U7J A;  1FJP A;  1RF0 C;  5TIS H;  5AVT B;  3TGU G;  1FE6 A;  4GDO A;  4JF7 A;  1GL2 B;  2BCC J;  1IFJ A;  3CLQ A;  3HE4 B;  2KI7 B;  1NVO A;  2R5B A;  2A45 G;  2I1K A;  2OTJ P;  1GDT A;  3VMY A;  4XA4 A;  4LGD E;  1VF5 D;  5BU5 A;  2M3E A;  1L0N K;  2VRS A;  4OGQ B;  2M5A A;  1FZB A;  4IFD K;  1CI6 B;  2Y0C A;  3RBZ A;  4RO0 A;  2J59 M;  1SS1 A;  2NZ2 A;  4M3L A;  2AEJ A;  3BRT B;  1PPJ D;  2B9B A;  3L71 D;  3RK3 E;  1KV4 A;  1GZL A;  2AEM A;  1GK6 A;  1G2C B;  2OGU A;  2R3S A;  1T8Z A;  3RL0 C;  1EC5 A;  5BVZ A;  1SP4 A;  3L74 E;  1OFC X;  1SQB G;  5H2F E;  1J1D C;  3L75 E;  2E74 D;  1SQV D;  2XU6 A;  2FYU J;  2OYH C;  4MN4 C;  2C9N Y;  3L4F A;  2E75 D;  4BRY A;  1LTS C;  2R5D A;  4U3F G;  2OTL P;  2UWJ E;  2WPQ A;  5GTI H;  2N1T C;  3H1I D;  3F5H A;  2IBZ D;  2G3A A;  2NPS A;  5AW7 B;  5KKZ C;  1SQQ E;  2ZYG A;  3A2A A;  1AFO A;  1USD A;  2A45 H;  1LTG C;  3K5B A;  1FJK A;  3A3Y B;  4ASW A;  1QVG O;  2R44 A;  2O01 J;  1PZQ A;  2E5T A;  2ZVN B;  1GW3 A;  2Y9Y A;  4PJ0 H;  1PV3 A;  1EQ7 A;  1H89 A;  4NPD A;  1PGJ A;  3A0B H;  1NTK K;  1UII A;  3MIW A;  1IFI A;  2BEQ D;  2W6B A;  4H0L D;  1MFZ A;  2JKV A;  3OJA B;  3H1J G;  1KB9 D;  3H25 A;  3AE5 C;  1N7S B;  3A0H H;  2JP3 A;  1S9K E;  1GW4 A;  2O1J A;  3MUD A;  1X22 A;  4ZKU A;  4JYC A;  3H1H E;  2IPP A;  1L4A D;  1BGY J;  2FBW C;  3CC4 P;  3NMD A;  4D6T J;  1NGM B;  1CSB A;  5KLV E;  1NTM J;  1D7M A;  1U7M A;  1FU1 A;  2YKP A;  4IFM A;  2Y0E A;  1ZR2 A;  4GOF A;  1NO4 A;  3E1I A;  3Q5S A;  1JMM A;  1OVR A;  3GW6 A;  2B89 A;  3B5N D;  1YQ4 C;  3KYQ A;  2M8R A;  3II6 A;  1FBM A;  3AEF C;  3VMZ A;  3D6Z A;  1KYO I;  1SQV K;  4HB1 A;  1GL2 C;  1KIL D;  1P84 E;  1Z56 A;  3H1L E;  1EDJ A;  5APT A;  3OW2 O;  1URQ D;  1E5W A;  5GTH H;  1NU1 G;  5E79 H;  4PV1 D;  3L70 J;  2WPS A;  2I8D A;  1NHL A;  3AE2 C;  3O8Z A;  2BCC D;  4OGQ C;  2RH0 A;  2HOD A;  4JQ0 D;  1FDM A;  5EFW B;  1LGH B;  3EQ2 A;  3CC2 P;  2C0X A;  4WY4 D;  1T2K D;  2C9L Y;  5CBO A;  4PD4 E;  1LNQ A;  3L73 G;  3VTP C;  4H44 D;  2V4H A;  3M9Q A;  2KIK A;  4IL6 X;  5DJU B;  3USS A;  4GOD A;  2D2C B;  3CCS P;  4AQR D;  3RK2 D;  2RKL A;  1SQQ D;  3P32 A;  1OWA A;  5AW9 B;  4AUW A;  1LWU C;  2HLO A;  4KJM A;  1W2B O;  2XND H;  1G2C A;  4L76 A;  1TU3 F;  3VMA A;  2FYU D;  3IAO A;  3CCU P;  4HH2 A;  1BCC J;  1RF1 A;  1Y47 A;  4DZO A;  1NTZ E;  5KTB A;  1OZH A;  3I56 P;  3JCU H;  5KAI E;  2Z5H A;  3VMX A;  2KSE A;  3B4S A;  3N4X A;  3CWB G;  1YJ9 P;  1RE3 A;  3UIA A;  2KYV A;  5H2F H;  2Z4E A;  1K05 A;  3H1H G;  4HYT B;  3MGN A;  2KS1 B;  3CX5 E;  1S5L X;  3R2P A;  1GK4 A;  2G8Y A;  3JC2 2;  3TGU J;  3A5T A;  2ZVO B;  5C39 A;  3H32 A;  1OW6 A;  3QWO C;  5KAF E;  2QJK C;  1N7S C;  3R4Y A;  3RL0 D;  1FZF A;  1EZV I;  3L72 J;  3U59 A;  3PH0 A;  3C1L A;  3GG2 A;  4TT3 H;  1ZW0 A;  5B66 H;  2B87 B;  2QRX A;  3HE5 B;  5L8R J;  1IZN B;  3RL0 B;  1KYO H;  1RE4 A;  3GMA A;  1YTZ I;  4K35 A;  3M0D C;  1BGY D;  2N1T D;  1PPJ E;  3L71 E;  1N7S A;  3H1L D;  2OAR A;  1JB0 J;  4N78 D;  2KK7 A;  2KP8 A;  1NTM D;  3KQG A;  3FXE A;  1SQB J;  3IR9 A;  4JYB A;  2L5G B;  1JY3 N;  2P58 A;  4R4M A;  2FXM A;  5M1B A;  3BCC E;  3AEC C;  1JCC A;  1KD1 Q;  4XFJ A;  5KKZ B;  1IK7 A;  3CCR P;  1LTJ B;  3LW5 J;  3GHG A;  2KNC B;  4WWI A;  3U1A A;  1SQX J;  2E42 A;  1WMK A;  1N73 C;  2H8P D;  3H1I E;  1G1I A;  3GF3 A;  3TNU B;  2IBZ E;  3L70 D;  1H0T A;  1BE3 G;  1AQT A;  1BDD A;  4O9B A;  3U1C A;  3Q1M A;  4RKU J;  1IC2 A;  1NTZ G;  1KIL A;  1YQ3 C;  1KN7 A;  1QL2 A;  1URQ A;  3CPW O;  2K9J A;  5CCG C;  5APU A;  2CK3 H;  1GU5 A;  3S4R A;  1HGV A;  3S9O A;  5KLV K;  1KB9 E;  1L0L J;  4JBZ A;  2O3J A;  4GIF A;  5CJ4 A;  2YMY A;  1M56 D;  3MP7 B;  2WQY C;  2WSE H;  2V7Q H;  1X79 B;  4PD4 H;  1GL2 D;  1ZV8 A;  4GOE A;  3Q3D A;  3CXH I;  3MZW B;  3WMM 0;  1MFT A;  2W8Z A;  2WTY A;  1FZE A;  1W2E A;  5CCG A;  1X9V A;  4OGQ D;  2AXT E;  1S72 P;  3CC7 P;  2IBZ I;  2Q1K A;  2KSJ A;  4DCK A;  3AE3 C;  3G3Z A;  2CPB A;  5DJT B;  3SWF A;  3D6Y A;  1NWQ A;  1VQO P;  3BRV B;  3CCL P;  1MKM A;  3FGA D;  3T97 A;  2GA1 A;  1PPJ G;  3L71 G;  3S1K A;  1RF0 A;  3TGU D;  1NU1 J;  1HBW A;  2XNX A;  3G9R A;  1KIL E;  1UIX A;  2IZ0 A;  4CPG A;  4GT1 A;  3M06 A;  2ZT9 B;  2WVR A;  1NH4 A;  3L72 D;  2BCC E;  4I1L A;  2WT7 B;  1HF9 A;  5APS A;  1S3J A;  1U57 A;  3V2Q A;  1DIP A;  3AEA C;  4K3A A;  2FFD B;  1S2E A;  1LTA C;  1JY3 O;  3L73 J;  1SQV G;  2MJZ A;  3BCC D;  1X0T A;  2KZI A;  1LWU B;  2QEX P;  1VQ5 P;  3V6I A;  2QM7 A;  1AVO A;  2K9Y A;  2ZFC A;  1SLQ A;  1GU4 A;  5KAF H;  2IBZ G;  1YIJ P;  3I55 P;  1IFM A;  2OYI C;  2FXO A;  1JY2 N;  1SQP J;  3MD0 A;  2MKV A;  1MZ9 A;  4OVN F; 
#chains in the Genus database with same CATH homology
 1NTZ K;  2M3B A;  2W27 A;  1N2D C;  2WPS A;  1NHL A;  2C0W A;  3O8Z A;  3SWY A;  5APW A;  3IFM A;  2NPS D;  3V2R A;  5CCH D;  1LTJ C;  2HOD A;  1IJD B;  1WT6 A;  1AQ5 A;  2WWW A;  5AVW B;  2OYH A;  1FDM A;  3VP8 A;  1NU1 K;  3B8E B;  1LGH B;  3EQ2 A;  2C0X A;  4WY4 D;  5AVR B;  1T2K D;  1FZG A;  2HPC B;  3OA7 A;  2C9L Y;  3OAK A;  1QL1 A;  2R3C A;  5AVY B;  1LTB C;  1FAV A;  1N7S D;  3HUS C;  2N1T A;  3LID A;  2YO3 A;  1CW5 A;  3VTP C;  5KJ7 D;  4RES B;  1KFM A;  1M1J A;  3V5B A;  2XKM A;  1J1D B;  3M9Q A;  1YTZ T;  5AVX B;  1NTM K;  3CI9 A;  3TYY A;  3GHG C;  5AW4 B;  2O01 H;  1LTJ A;  3V2N A;  5AW2 B;  2H7H A;  1GTW A;  2OYH B;  4AQR D;  3RK2 D;  1MUU A;  5APX A;  5AVV B;  3P32 A;  3HTK A;  1OWA A;  5AW9 B;  4AUW A;  2Q7C A;  1LWU C;  3M0A A;  2HLO A;  3M9H A;  1LT9 C;  2N1T B;  4W80 A;  3HUS A;  5AW5 B;  5AW1 B;  2P67 A;  3HD7 A;  1ZLL A;  1G2C A;  2POH A;  2XV5 A;  5AW3 B;  2IFM A;  2E43 A;  1H88 A;  1FOS F;  3NFQ A;  4HH2 A;  1L4A A;  1SQP K;  2XDJ A;  5BU8 B;  1RF1 A;  1FZC A;  4DZO A;  1NKN A;  4W7Y A;  4C7N B;  3HTK B;  2P2U A;  5KTB A;  3BAS A;  2Z5H A;  1KIL C;  3VMX A;  2WIT A;  1LT9 A;  4DOJ A;  5AVS B;  1DEB A;  3I5C A;  3N4X A;  1URQ C;  1RE3 A;  1T3J A;  3UIA A;  3HD7 B;  2KYV A;  1IFN A;  3N7N A;  2Z4E A;  1HWT C;  3HRN A;  2P1J A;  1JNM A;  1SFC A;  2YNY A;  4OH8 B;  4AYC A;  4HYT B;  3MGN A;  2A45 I;  2NPS C;  3R2P A;  1RF1 B;  1GK4 A;  5CCH C;  1FZC B;  3KPE A;  3B5N A;  3HE5 A;  3CL3 D;  3KDP B;  1XTG B;  5CHX A;  1T3U A;  3A5T A;  4LC1 A;  1LTT C;  2J58 A;  4N78 E;  3H32 A;  4WY4 C;  1T2K C;  1YYC A;  1JO5 A;  1N86 A;  1IK9 A;  2N9B A;  3M91 A;  1JTH A;  1H8A A;  1N7S C;  3RL0 D;  1HUC A;  1CZQ A;  1FZF A;  1HGZ A;  3U59 A;  3VOP A;  5KJ7 C;  1N73 B;  4LLH A;  3P7K A;  2IX7 C;  1SFC B;  1A02 J;  4W7Z A;  1HVV A;  1M7L A;  2WPR A;  2HG5 D;  2Q5U A;  2XZR A;  3HE5 B;  1GL2 A;  1J2J B;  2OYI A;  3RK2 C;  3HE4 A;  3TSI A;  3RL0 B;  3H32 B;  4Y99 B;  1RE4 A;  1YTZ I;  2ZXE B;  1FOS E;  4WY4 A;  3M0D C;  5CCG D;  3RK3 B;  2KB7 P;  5AW8 B;  2N1T D;  3P8C E;  3VP9 A;  3P8M C;  5AVQ B;  1HH0 A;  1JUN A;  1N7S A;  2P7J A;  1J1E C;  2OAR A;  4N3Y B;  1N7L A;  1DX7 A;  2FFD C;  2HOD B;  3H6P A;  4EOT A;  1JY3 P;  4N78 D;  5KJ7 A;  1FJP A;  2KP8 A;  1KFN A;  1RF0 C;  1JY2 O;  1CI6 A;  5AVT B;  2WSF H;  4I6M C;  4KHX A;  2FKW B;  3KQG A;  2BAS A;  3C9I A;  1VPC A;  1ZR4 A;  3IR9 A;  4JF7 A;  1GL2 B;  2L5G B;  4JYB A;  3V4W A;  3HE4 B;  1IFJ A;  3CLQ A;  1JY3 N;  3TNU A;  2R5B A;  2A45 G;  2I1K A;  2FXM A;  2FYZ A;  2GUV A;  1GDT A;  1KZU B;  1M1J B;  3VMY A;  4XA4 A;  4LGD E;  1IO4 A;  1JCC A;  5BU5 A;  1HJB A;  1L0N K;  2VRS A;  3HD7 D;  1LTJ B;  4C46 A;  3GHG A;  1FZB A;  4IFD K;  1CI6 B;  2J59 M;  2Q3I A;  4M3L A;  2R32 A;  1JCD A;  3BRT B;  1JOC A;  3P8C D;  3U1A A;  2E42 A;  2PAJ A;  1N73 C;  2H8P D;  1GZL A;  1LWU A;  2HFE D;  5APY A;  1OXZ A;  1G1I A;  3TNU B;  1GK6 A;  3HUS B;  1ZN5 A;  2PP6 A;  1A02 F;  3V2P A;  1G2C B;  2I1J A;  1WRG A;  3LW5 H;  1T8Z A;  1VDF A;  3RL0 C;  2QM8 A;  4O9B A;  1L4A B;  1SP4 A;  5AW6 B;  3GHG B;  3VN0 A;  5BVZ A;  3U1C A;  1SFC D;  1J1D C;  3VYI A;  5APV A;  1IC2 A;  2W6A A;  4B86 A;  1SVF A;  2XU6 A;  1LT9 B;  1KIL A;  2OYH C;  3BAT A;  2Z5I A;  1QL2 A;  2C9N Y;  1URQ A;  3L4F A;  1LTI C;  2H43 A;  1LTS C;  2R5D A;  1SQB K;  2HPC A;  5CCG C;  3RK3 D;  5APU A;  1GD2 E;  2WPQ A;  4WBA A;  1GU5 A;  2N1T C;  1PFI A;  1HGV A;  3MTU E;  5KLV K;  2NPS A;  5AW7 B;  3B5N B;  4N6J A;  5CCH A;  4GIF A;  5CJ4 A;  2JEE A;  2YMY A;  3A2A A;  1AFO A;  2A45 H;  2WSE H;  1LTG C;  4EIJ A;  1X79 B;  2YO2 A;  1FJK A;  3A3Y B;  1GL2 D;  1KIL B;  1JTH B;  1ZV8 A;  3L36 A;  3EFG A;  1URQ B;  3WMM 0;  2WTY A;  1FZE A;  1SQX K;  1W2E A;  2KLV A;  5CCG A;  1GW3 A;  1X9V A;  2NPS B;  1EQ7 A;  2GUS A;  3L35 A;  1H89 A;  3HD7 C;  1NTK K;  2OYI B;  3MIW A;  1IFI A;  2KSJ A;  2W6B A;  1MFZ A;  1SQQ K;  1L4A C;  4WY4 B;  1FZA A;  3OJA B;  3LIE A;  1RF1 C;  1IFD A;  3TK1 A;  1FZC C;  3G3Z A;  3M0D A;  2CPB A;  2WT7 A;  4C7R A;  1N7S B;  3SWF A;  4C7N A;  1S9K E;  2LKM A;  1NWQ A;  1GW4 A;  2O1J A;  3BRV B;  3MUD A;  2FFD A;  1X8Y A;  3T97 A;  4ZKU A;  1RF0 A;  1KQL A;  3NXS A;  1RE3 C;  2FYU K;  1HBW A;  4JYC A;  2IFN A;  2XNX A;  2IPP A;  1L4A D;  4WB4 A;  5CJ0 A;  3BVH A;  4GT1 A;  1G1J A;  3NTN A;  2GM4 A;  3RK2 B;  1SFC C;  2Q9I A;  3M9B A;  3M06 A;  4IFF A;  3NMD A;  5CMZ A;  1NH4 A;  1XTC C;  2YKQ A;  3B5N C;  4XE5 B;  1CSB A;  1L0L K;  4I1L A;  2WT7 B;  3PP5 A;  5APS A;  3V2Q A;  1J1E B;  1FU1 A;  2YKP A;  4Y99 C;  5AVZ B;  4IFM A;  2FFD B;  2JJL A;  1ZR2 A;  1LTA C;  1JY3 O;  3RK3 C;  1RY3 A;  1NO4 A;  2MJZ A;  3E1I A;  2KOG A;  3A7O A;  3L37 A;  1JMM A;  4I2L C;  1LWU B;  1S9K D;  1NKZ B;  3B5N D;  1N73 A;  3KYQ A;  5APQ A;  1JY2 P;  2M8R A;  5AVU B;  2QM7 A;  3II6 A;  1FBM A;  1NOH A;  2ZFC A;  1DH3 A;  4ZKP A;  2O1K A;  3VMZ A;  5AW0 B;  1SLQ A;  3V4Q A;  1GU4 A;  1HTL C;  1SQV K;  1MV8 A;  1GL2 C;  1KIL D;  1IFM A;  1Z56 A;  2WSC H;  2OYI C;  4GKG A;  5APT A;  1URQ D;  2CPS A;  1NAF A;  1JY2 N;  1RE4 C;  3MD0 A;  1E5W A;  2YKO A;  2WZ7 A;  1M1J C;  2HYN A;  1MZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...