1HTLC

Mutation of a buried residue causes lack of activity but no conformational change: crystal structure of e. coli heat-labile enterotoxin mutant val 97--> lys
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
41
structure length
41
Chain Sequence
GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
publication title Mutation of a buried residue causes loss of activity but no conformational change in the heat-labile enterotoxin of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 15
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1995-02-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1htlC00
1LTIC 1HTLC 1LTBC 1LTTC 1XTCC 1LTAC 1LTGC 1LTSC
chains in the Genus database with same CATH superfamily
5GTHH 1ZRTE 1JMMA 4OH8B 1VQ9P 1A02F 3CCEP 1GMJA 5KAIH 2W27A 1ZV8A 3F5HA 3CMEP 2Y0CA 2C0WA 3H25A 1SQPG 2YIUC 3A5TA 1YJWP 5KJ7D 3MHVA 4EYYQ 1IFIA 3CCRP 1LT9B 3RK2C 4WWIA 2W6BA 2FXMA 2R44A 4B86A 2VRSA 1T3JA 4ASVA 3Q5SA 1NU1J 2WT7B 3NXSA 1RY3A 1URQB 3V5BA 3RBZA 4WY4C 1ZR2A 1LWUA 2WWWA 1YTZT 2M5AA 1EZVE 1SQBG 1YTZI 1M7LA 1P84E 2WMMA 2JKVA 1WRGA 1KV4A 1SQBK 3L35A 1L0LJ 3B8EB 2P10A 4AUWA 1PP9G 2FYUE 1PV3A 1FS0E 3GF3A 4BRYA 2KLVA 2Q9IA 1PIXA 1RF1A 4EIJA 3Q2YA 1HUCA 3TDKA 1LTBC 1N7SB 4N6JA 5DJUB 2FKWB 2D2CB 2HODB 2B87B 2R5DA 3FX0A 1H89A 4OGQB 2QJYC 1SQPE 5M1BA 1SQVJ 2Q3EA 2L91A 1PPJD 5CCGD 3L70D 1FOSE 2I1KA 2H43A 3AEGC 2RMZA 1OW6A 3AE9C 3HUSB 3VTPC 2OYHB 1WT6A 3CCUP 4UB6E 3T97B 3MGNA 4R4MA 1BE3D 2KZJA 1LTJC 2HLOA 4H0LC 4D6TG 4LLHA 3L74G 1VPCA 2CPBA 1GTWA 1OX3A 1W5CE 3Q5RA 1SQBE 2V7QH 3VP8A 1NYHA 3B5ND 1U7MA 1FBMA 4YPCA 2W90A 1KILE 4ASWA 1BCCJ 3L70E 1DD3A 1M90Q 2E75D 1KILA 2J5UA 3RK3B 1ZR4A 1PP9E 3CPWO 3H1JD 5KLVD 1M56D 5AW2B 1OVUA 3AE6C 3CC7P 3RL0B 4C46A 5KKZC 5AVQB 5CCHC 3LIDA 3C8VA 2KP8A 4H44B 3JSVC 3CWBG 3SFEC 1KB9H 1OFCX 1MZ9A 1HWTC 3GG2A 3H32B 3HE4A 3N4XA 1OW8A 2A45H 4AYCA 3G3ZA 3AE7C 5AW0B 2KOGA 1SQQJ 3A0BH 3HTKB 2PAJA 5AVZB 2NRGA 1VQLP 4D6TE 1BSNA 1M1JC 2FYZA 2JR8A 3RL0g 1YQ3C 4IL6H 3VMZA 1X8YA 1JY3P 4L74A 1KYOI 2QA4P 3CMAP 1GL2A 2QJKC 2QIWA 2HYNA 1EDIA 2B89A 2NPSB 1L2PA 5BU8B 1JO5A 2B9BA 2I8DA 2YXRB 4A7PA 3PP5A 2R32A 4U3FD 4AQRD 1PFIA 3F89A 4GODA 1GZLA 4RESB 1NJIQ 2KIKA 1YBKA 2KZIA 2Y0EA 1NU1G 3H1IJ 3L37A 1OMIA 1NKZB 3VYIA 5APQA 1L0NJ 1L4AD 1DIPA 3CWBE 1ZMEC 1ZOYC 1S9KD 1NU1K 3CC4P 1YJ9P 2QM8A 2IFNA 3VN0A 5CMZA 1QVFO 3AECC 3WU2H 4BWNA 1BDDA 2ZYDA 2O01H 2KS1A 4H13D 1BSHA 1LTTC 2XKMA 3HE5B 2G3AA 2E74C 5APWA 2XU6A 3L71J 4I2LC 1R5LA 3AE4C 2GUVA 2G8YA 1JB0J 3RGUA 1L4AA 1KYOD 2IFMA 1LTJA 2NZ2A 2ZT9D 2J58A 1PGOA 1SQVG 1GU4A 2PFXA 4PV1C 3QWOC 1QLED 2IBZI 2QE7H 3G71P 5AW6B 5K5GB 4W7ZA 2K1AA 3O8ZA 1L0LD 1NTZJ 3VP9A 3WUUA 1J1DC 2IPPA 1NU1E 3H1KJ 2ZYAA 2GUSA 3OW2O 1Y8AA 1NTMJ 1RE4A 2YIUB 2LXCB 5E79H 2K3RA 1LWUC 1IFMA 1AA0A 1DEBA 1YITP 3RK2B 2PRRA 1GDTA 3PJSK 1HGZA 5CCHA 1OXZA 4C7NA 1BCCG 1URQD 4KHXA 4IFDK 3R2PA 3AEDC 1ZLLA 5KJ7C 1L0LE 1CI6B 2WZ7A 3GLMA 3H1HG 5AVTB 1U7JA 4WY4B 3ABVC 1NTKG 5TISE 1RF1C 3W68A 4I7ZC 3H1JJ 5KLVJ 1NTKK 3KXDA 3HD7B 1LNQA 1NWQA 5AW9B 1M1JA 1SQVE 3EFGA 2BCCJ 1SQXD 3MTUE 1N7SD 2AXTE 2WSFH 2OYIB 2IBZD 2D2CD 4OGQD 2KK7A 3K5BA 1FZCA 1JY3O 3CX5H 2YKPA 2GM4A 4ZKPA 1SQQG 2E76B 2QJYB 1SVFA 1NVOA 3CL3D 4JQ0D 4M3LA 4JYCA 1GW3A 1SQQK 3CLQA 1S4XA 5BVZA 1FDIA 1BCCE 3PLNA 1IO4A 1Q2NA 3CC2P 2POHA 1KILC 3O6QA 5CCGC 2Q6QA 2JO1A 3WUTA 4H0LB 1NTKE 4YXWH 1Y47A 2AEJA 3WUVA 2N9YB 4PD4H 1G1JA 3JC22 2RH0A 1DEEG 3RK3D 1N73A 3IAOA 5GTIE 1IC2A 5AVYB 2K9JA 4GKGA 1LTGC 1KN7A 3E7KA 1JY2P 2FFDC 3CXHE 4UB8H 3A7OA 5AW8B 3RL0D 2E75C 2FYUK 1MUUA 2MKVA 3TYYA 1S72P 3GF7A 2OTLP 5KKZB 4H44D 1SQQE 4L75A 1QVGO 2HR3A 1HF9A 3CCVP 4IFMA 2IZ1A 3I56P 4DJGA 1LP1A 1J1EC 2Q5UA 5AW1B 1SQPK 2P2UA 3H1ID 2ZVNB 1AFOA 1JTHB 1L0ND 2YKQA 3AE8C 1GL2C 1KB9I 3MUDA 3A2AA 1GK6A 1K04A 3P8MC 4K3AA 2YO2A 2A45I 2ZVOB 1EDKA 1PPJG 1N86A 3L70G 1G1IA 3L71D 5KJ7A 4GOEA 2NPSD 3SWYA 3IR9A 5H2FE 3H1IE 1S5LX 1L0NE 1S5LE 1JM0A 2ZFCA 2H89C 1H88A 2KYVA 4Y99C 4YXDC 2O01N 1HTLC 2YXQB 1DX7A 1BE3G 3TGUD 1LTIC 3FWNA 1P84H 1VQKP 3VMYA 2FY8A 3W67A 2M8RA 1ZXGA 3V6IA 1M1KQ 2Z4EA 1QL2A 3O6QB 1NTZD 4OWFA 3L71E 3UIAA 1SLQA 3EQ2A 5KLIC 3H1KD 3AEFC 1SFCB 1NTMD 2OYOA 2N1TD 3H1JG 3RBXA 5KLVG 4HKZH 1L4AC 2KNCB 1ZW0A 2R3CA 2E74B 1QX8A 2ZXEB 2QVAA 1KB9D 5KLVK 2Y0DA 1H0TA 3VMXA 4H13C 2WSEH 1SQXJ 1PPJE 1NTZE 1FZAA 2Q1KA 1NGMB 3JCUE 1S3JA 3KZIE 1XTCC 1PGJA 1OIPA 5CCGA 2W6JH 2WSSH 5APVA 3BCCJ 2M0BA 1T2KD 2RKLA 1NTME 4PJ0E 1G2CA 1RE4C 1KC8Q 4PV1B 2ZYGA 2I1JA 1BE3E 3IF4A 3GW6A 1N2DC 3TSIA 2Y9YA 4N78D 3S4RA 2M3EA 2BCCD 2LKMA 3C9IA 1J1DB 3BVHA 3B5NA 3CCSP 2FFDA 3RK2D 1FAVA 3M9BA 1LWUB 1JY2O 2M5AB 3H1JE 1CZQA 1SP4A 1IJDB 5KLVE 4U3FG 1LT9C 1QGKB 4YTPC 2Q7CA 3KHUA 2QM7A 2BCCE 4C7RA 1PZQA 2LXBA 2C9NY 1E5WA 1N7LA 1BGYD 1RHZB 1VQ4P 4BRYB 2HPCA 1RF1B 1URQC 3HD7D 4I7ZB 3KQGA 1FZCC 1KQSO 1VF5B 4WB4A 3TF5A 3CCMP 2M3BA 2IX7C 1Q81Q 3L72J 2E76D 3CCJP 1T3UA 1OW7A 2CPSA 2KLUA 4L76A 4QMAA 2K37A 3M91A 2WPVB 1JY3N 3IN6A 3PH0A 4Z1MH 4RO0A 1N7SC 5AVSB 3P8CD 3AE5C 1HBWA 3OJAB 5TJHA 4EDFA 4OGQC 1T8ZA 3CX5I 1HVVA 4HH2A 2Y9ZA 4U3FE 1UIIA 1N73C 1IFNA 3U1CA 5B5EE 1L0LG 4H0LD 1KILB 3VMAA 1FZFA 3H6PA 2PGDA 1JNMA 4LC1A 3IFMA 2FXOA 2C0XA 1L0LK 2ZAEB 3Q1MA 3A3YB 3II6A 4ZMDA 1S9KE 3P8CE 2V7QJ 3GHGA 3TGUJ 1RE3A 1AQTA 1FZBA 3P32A 4PD4I 1AQ5A 1YQ4C 1MKMA 1Q7YQ 1SQVK 3HE4B 2R5BA 1FDMA 3MUDC 1DH3A 4CPGA 5EFWB 2A06D 1KYOE 3L73D 1KORA 1KFNA 1J1EB 5KAFE 1EXIA 1OWAA 5AVUB 1SQXG 5CHXA 3L75D 4JBZA 1J2JB 1Z56A 1YYCA 1GL2B 2IBZG 2BEZF 4BXLA 1SQXK 3B4SA 2H8PD 3BRVB 1FJKA 2QG4A 2MJZA 3V2QA 4Y28J 2O1JA 4DOJA 2AEFA 4RJTA 1Q90D 4NPFX 1OVVA 1LT9A 1NAYA 1NAFA 4GT1A 4W80A 2W8ZA 1NH4A 2WT7A 1MFTA 1VQMP 3A0HE 4Y99B 4PD4D 1URQA 2BASA 3BCCD 4NPDA 5CJ0A 5TISH 4D6TJ 3L74J 2KS1B 3D6ZA 1LTSC 3USSA 1EZVI 2YNYA 2ZXXA 1SFCD 1P84I 2J59M 3H1LD 3WMM0 5KLIB 2AXTH 1SQXE 2OARA 2OTKE 5B66E 3M9QA 1BGYJ 5APUA 1VQ7P 2E74D 1IK7A 2IBZE 4K35A 1L4AB 2E43A 1N7SA 1RF0C 2O01J 1MFZA 1LTAC 1LTJB 2K88A 4XA4A 2HODA 2B87A 1EDJA 2K9YA 1FJPA 1K8AQ 2N1TC 2UWJE 4KJMA 1ZRTD 5GTHE 1U57A 1ZN5A 3NFQA 1USEA 4XFJA 4UB8E 3HUSA 3H1IG 4PV1D 4IFFA 5KAIE 5APSA 3SWKA 1L0NG 2OYHA 4HJGH 3B5NC 2AEMA 3Q5PA 3T97A 2L5GB 2WSCH 1QL1A 1L0NK 2WPQA 2QJPC 1Y9BA 1IFPA 1T2KC 5C39A 1VQ8P 4C7NB 2P7JA 1JEKA 1QEXA 3L72D 1T6AA 3RK3E 5GTIH 3L71G 2QRXA 1FU1A 2FYNC 3ITKA 1VL2A 1TU3F 3CXHH 1EZVD 4LGDE 1IZNB 1P84D 4EOTA 1JY2N 4HYTB 3KPEA 3TGUG 4DT0A 1DD4A 4I1LA 1M1JB 1AJYA 4WBAA 2FYUD 3L36A 1EDLA 3L72E 1Q86Q 1NTZG 1OVRA 1VQ5P 2KI7B 2HFED 1VF5D 5APTA 3H32A 2QJKB 2FBWC 1FZCB 3H1KG 2R3SA 1NTZK 1NTMG 1SQPD 2WPSA 1KZUB 3HTKA 3HD7C 3C1LA 1M8OB 3V2PA 1NTMK 4MN4C 3L73J 3M0DC 1W2BO 1KMIZ 2WSFJ 1FDOA 3CD6P 1FE6A 2OYIC 5H2FH 3L75J 2A45G 3M0AA 3S1KA 1S5LH 2WTYA 5AVWB 3TNUA 4OVNF 2NPSA 5AW7B 2E76C 1SQBD 1N8RQ 1KILD 1YJNP 3PHLA 1M57D 3TGUE 1VQNP 3GHGC 1N73B 1BDCA 1RE3C 5AVRB 2QSIA 1YHQP 3P7KA 2BCCG 2K9JB 1RQUA 3G9RA 1PP9D 2KXPB 2H88C 2CK3H 5DJTB 2P1JA 3SFDC 3E1IA 3V2RA 1LT1A 1HGVA 5CBNA 3LIEA 1YIJP 3U59A 2H7HA 4KT0J 1KQLA 1E79H 3H1KE 1RF0A 4RKUJ 1KTMA 4UB6H 4JYBA 1K9MQ 3FWLA 3HE5A 2XZRA 1JUNA 2N1TA 4NPEA 1JCCA 3OAKA 1LP1B 1NHLA 3H1HJ 1KB9E 3S9OA 3B71A 3D6YA 2ZT9C 3BRTB 3EWKA 1BGYG 3BATA 2O3JA 3H1LJ 4W7YA 1NTKJ 3JCUH 3KZIH 3G4SP 2WSCJ 2KUBA 2ITAA 2E5YA 1NOHA 3N7NA 1IFDA 3A0BE 4U7JA 1S2EA 4D6TD 4PJ0H 3L74D 2AXCA 1MV8A 2P67A 1JCDA 1GD2E 3FXEA 4IL6X 4TT3H 1PL5A 4IL6E 1GL2D 1HH0A 2XDJA 1PGPA 2JDIH 1JMBA 2IDBA 1KD1Q 4N78E 4WY4D 3D70A 4GIFA 3R4YA 2C9LY 5CBOA 3OA7A 2XV5A 1R8EA 1K05A 3V2NA 1FZEA 3I55P 1WMKA 2JWDA 2Z5IA 3L74E 1CSBA 3VOPA 1IFJA 4L73A 4IOIH 3PTZA 1YI2P 3HRNA 3CWBD 1LJ2A 1CI6A 3M9HA 3BASA 3PRJA 3QH9A 3NMDA 1KFMA 1X22A 3TNUB 3TK1A 3AEAC 4WY4A 1GW4A 1BGYE 2OTJP 2V4HA 5KTBA 3GMAA 3WU2E 1JOCA 3HD7A 1IK9A 2YKOA 2D2CC 1RQVA 3LW5H 3CCLP 1H0TB 3M0DA 2PP6A 5APYA 1K73Q 1OZHA 4R4LA 2FYUJ 5CJ4A 5APXA 2OYIA 3HUSC 1W2EA 3AE3C 1SFCC 2WQYC 1X9VA 4DZOA 2OYHC 2GA1A 4ZNCA 1VQOP 1G2CB 2WITA 2W83C 1GU5A 4TLFA 3KDPB 3I5CA 1SQPJ 2YMKA 2N1TB 2A06G 1HJBA 2FXPA 3L73G 1EXJA 4O9BA 2WSEJ 1NU1D 2XNXA 2E42A 3E1RA 2YMYA 5B5EH 2IZ0A 3L75G 2IYOA 3B5NB 3V4WA 1AV1A 4N3YB 2HG5D 3NTNA 4XE5B 2FFDB 2WVRA 1SS1A 3AE1C 3RK3C 3SWFA 5E79E 1R5SA 2E75B 2Q3IA 3MP7B 5CCHD 1FOSF 1AVOA 2QJPB 1SQBJ 2JJLA 1EC5A 1X0TA 2YO3A 3M06A 1S1CX 5AVXB 1H8AA 3RL0C 1X79B 3L70J 1VQ6P 2FYNB 3FXDA 2Z5HA 2W6AA 4H44C 1PP9J 2HPCB 2WPRA 3CX5D 3MIWA 1XTGB 2KSEA 3BCCG 1BE3J 3U1AA 2JEEA 5AW4B 1SQVD 3CXHI 1D7MA 1KQGB 2B88A 4ZKUA 1KYOH 2N9BA 1NKNA 2JP3A 2A06E 5KAFH 3CI9A 3L73E 2QEXP 1USDA 3H1LG 1JTHA 2LR2A 3L75E 1EQ7A 4WVZA 3CX5E 5AW5B 1ZP0C 1VF5C 3G6EP 1VDFA 2NPSC 1AVYA 3SSUA 4GDOA 3AEBC 2SPZA 3MD0A 1Q82Q 1CW5A 3KYQA 1BCCD 1FZGA 3CCQP 3MZWB 1RH5B 2ZJSE 1HJ0A 1PGQA 3H1HD 1UIXA 3AEEC 1VQPP 3D71A 1NTKD 5L8RJ 3A0HH 3AE2C 5BU5A 4DCKA 3LW5J 4PD4E 3Q3DA 2JWAA 3BCCE 3GHGB 4I6MC 2FYUG 2BEQD 2KSJA 2KB7P 2IYPA 3FGAD 2OGUA 4JF7A 4H13B 3L72G 5AW3B 3CXHD 2P58A 3H1HE 2E5TA 3V4QA 2DW3A 3CWBJ 4GOFA 5AVVB 5B66H 2RN0A 3H1LE 1KQFB 4EI2A 1SFCA 1EZVG 4JPZB 1SQQD 4HB1A 2O1KA 3ZDMA 3L4FA 1A02J 2XNDH 2KNCA 4U3FJ 1LGHB 1GK4A 2OQQA 1NO4A 3EFFK 1FC2C 2ZT9B
chains in the Genus database with same CATH topology
1ZLLA 5KJ7C 1CI6B 1JMMA 4OH8B 1A02F 2WZ7A 1T3UA 2P1JA 2CPSA 3E1IA 3V2RA 5AVTB 2W27A 1ZV8A 1HGVA 4WY4B 3M91A 1JY3N 3LIEA 1RF1C 3U59A 1N7SC 2H7HA 5AVSB 2C0WA 1KQLA 3P8CD 1RF0A 1HBWA 3OJAB 3A5TA 4JYBA 1NTKK 5KJ7D 1T8ZA 3HD7B 1HVVA 1IFIA 3HE5A 1NWQA 2XZRA 5AW9B 1M1JA 2N1TA 4HH2A 1JUNA 1JCCA 1LT9B 3RK2C 3OAKA 3EFGA 2W6BA 3MTUE 2FXMA 4B86A 2VRSA 1T3JA 1N73C 1IFNA 3U1CA 1NHLA 1N7SD 1KILB 1FZFA 3H6PA 2WSFH 3BRTB 3BATA 4LC1A 2WT7B 1JNMA 2OYIB 4W7YA 3IFMA 3NXSA 2C0XA 1RY3A 1URQB 1FZCA 1JY3O 3V5BA 1L0LK 1NOHA 3A3YB 3N7NA 2YKPA 4WY4C 2GM4A 1ZR2A 3II6A 4ZKPA 1LWUA 1IFDA 2WWWA 1YTZT 1S9KE 3P8CE 1YTZI 1SVFA 1M7LA 1MV8A 2P67A 1JCDA 3CL3D 3GHGA 1GD2E 1RE3A 4M3LA 1FZBA 4JYCA 1GW3A 1SQQK 1WRGA 3P32A 1GL2D 1HH0A 2XDJA 3CLQA 1SQBK 3L35A 1AQ5A 5BVZA 3B8EB 4N78E 4WY4D 4AUWA 4GIFA 1IO4A 1SQVK 2POHA 1KILC 2KLVA 2Q9IA 3HE4B 2C9LY 5CCGC 1RF1A 4EIJA 3OA7A 1HUCA 1LTBC 2XV5A 3V2NA 1N7SB 2R5BA 1FZEA 1FDMA 4N6JA 1DH3A 2FKWB 2HODB 2R5DA 1CSBA 2Z5IA 1H89A 1G1JA 3VOPA 1IFJA 1KFNA 1J1EB 3RK3D 1N73A 5CCGD 1OWAA 5AVUB 1FOSE 2I1KA 2H43A 1IC2A 5AVYB 4GKGA 3HRNA 1LTGC 5CHXA 1CI6A 3M9HA 3BASA 1J2JB 1Z56A 1JY2P 3HUSB 3NMDA 1YYCA 3VTPC 1KFMA 2FFDC 1GL2B 2OYHB 1WT6A 3TNUB 3TK1A 1SQXK 4WY4A 1GW4A 2H8PD 3BRVB 1FJKA 3A7OA 5AW8B 3RL0D 2MJZA 3V2QA 3MGNA 2FYUK 1MUUA 5KTBA 3TYYA 1LTJC 2O1JA 4DOJA 2HLOA 4LLHA 1VPCA 2CPBA 1GTWA 1JOCA 3HD7A 1IK9A 2YKOA 3VP8A 3B5ND 4IFMA 3LW5H 1FBMA 1LT9A 1NAFA 4GT1A 1J1EC 3M0DA 2Q5UA 2PP6A 5APYA 5AW1B 4W80A 1SQPK 1KILA 2P2UA 5CJ4A 1AFOA 1JTHB 1NH4A 5APXA 3RK3B 2WT7A 1ZR4A 2OYIA 4Y99B 3HUSC 1URQA 1W2EA 2BASA 2YKQA 1SFCC 1GL2C 4DZOA 1X9VA 2OYHC 3MUDA 5CJ0A 3A2AA 1GK6A 1G2CB 2WITA 5AW2B 1GU5A 3KDPB 3I5CA 3P8MC 2N1TB 3RL0B 4C46A 2YO2A 2A45I 5AVQB 1HJBA 1LTSC 5CCHC 4O9BA 3LIDA 2YNYA 2KP8A 2XNXA 2E42A 1SFCD 1N86A 2YMYA 1G1IA 2J59M 5KJ7A 2NPSD 3SWYA 3WMM0 2OARA 3IR9A 1MZ9A 3B5NB 3V4WA 1HWTC 4N3YB 3M9QA 2HG5D 3NTNA 4XE5B 2FFDB 5APUA 3H32B 3HE4A 3N4XA 2ZFCA 3RK3C 3SWFA 1H88A 2KYVA 4Y99C 1L4AB 2A45H 1N7SA 2Q3IA 4AYCA 2E43A 1HTLC 1RF0C 3G3ZA 5AW0B 2KOGA 1MFZA 5CCHD 1FOSF 1DX7A 1LTAC 1LTJB 3HTKB 4XA4A 2PAJA 1LTIC 2HODA 2JJLA 2YO3A 3M06A 5AVZB 1FJPA 1M1JC 2N1TC 2FYZA 3VMYA 5AVXB 1H8AA 3RL0C 2M8RA 1X79B 3VMZA 2Z4EA 1QL2A 1X8YA 1JY3P 1ZN5A 3NFQA 2Z5HA 3UIAA 1SLQA 2W6AA 3HUSA 4IFFA 5APSA 2HPCB 2WPRA 3EQ2A 1GL2A 2OYHA 3MIWA 2HYNA 3B5NC 1SFCB 1XTGB 2N1TD 2NPSB 3T97A 3U1AA 2JEEA 5BU8B 1JO5A 1L4AC 2WSCH 2L5GB 1QL1A 1L0NK 5AW4B 2WPQA 3PP5A 2R32A 2R3CA 4AQRD 1PFIA 1GZLA 4RESB 4ZKUA 1T2KC 2ZXEB 2N9BA 1NKNA 4C7NB 5KLVK 2P7JA 3CI9A 3VMXA 2WSEH 3L37A 1FZAA 1NKZB 1FU1A 1JTHA 3VYIA 5APQA 1L4AD 1XTCC 5CCGA 1S9KD 1EQ7A 5APVA 1NU1K 4LGDE 1T2KD 2QM8A 2IFNA 3VN0A 4EOTA 5AW5B 1JY2N 4HYTB 3KPEA 5CMZA 1G2CA 1RE4C 1VDFA 2I1JA 2NPSC 2O01H 1LTTC 2XKMA 3HE5B 3MD0A 1N2DC 3TSIA 4I1LA 1M1JB 1CW5A 3KYQA 1FZGA 4N78D 5APWA 4WBAA 2LKMA 3C9IA 1J1DB 2XU6A 3L36A 3BVHA 4I2LC 2HFED 3B5NA 2GUVA 5APTA 2FFDA 3H32A 3RK2D 1FZCB 1FAVA 5BU5A 3M9BA 1L4AA 1NTZK 1LWUB 1JY2O 2WPSA 1KZUB 2IFMA 1LTJA 3HTKA 2J58A 1CZQA 3GHGB 4I6MC 1SP4A 3HD7C 1IJDB 1GU4A 2KSJA 2KB7P 3V2PA 1NTMK 1LT9C 5AW6B 2Q7CA 3M0DC 4W7ZA 2QM7A 3O8ZA 4C7RA 4JF7A 2C9NY 3VP9A 1E5WA 1N7LA 5AW3B 1J1DC 2IPPA 3V4QA 2OYIC 2HPCA 5AVVB 2A45G 3M0AA 1RF1B 2GUSA 1URQC 3HD7D 2WTYA 1SFCA 5AVWB 1RE4A 2O1KA 3TNUA 3L4FA 3KQGA 1FZCC 2NPSA 5AW7B 1A02J 4WB4A 1LWUC 1IFMA 1DEBA 1KILD 3RK2B 1GDTA 1LGHB 3GHGC 1HGZA 1N73B 2M3BA 1RE3C 2IX7C 5AVRB 5CCHA 1OXZA 1GK4A 4C7NA 1URQD 4KHXA 4IFDK 1NO4A 3P7KA 3R2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTI C;  1HTL C;  1LTB C;  1LTT C;  1XTC C;  1LTA C;  1LTG C;  1LTS C; 
#chains in the Genus database with same CATH topology
 5GTH H;  1ZRT E;  1JMM A;  4OH8 B;  1VQ9 P;  1A02 F;  3CCE P;  1GMJ A;  5KAI H;  2W27 A;  1ZV8 A;  3F5H A;  3CME P;  2Y0C A;  2C0W A;  3H25 A;  1SQP G;  2YIU C;  3A5T A;  1YJW P;  5KJ7 D;  3MHV A;  4EYY Q;  1IFI A;  3CCR P;  1LT9 B;  3RK2 C;  4WWI A;  2W6B A;  2FXM A;  2R44 A;  4B86 A;  2VRS A;  1T3J A;  4ASV A;  3Q5S A;  1NU1 J;  2WT7 B;  3NXS A;  1RY3 A;  1URQ B;  3V5B A;  3RBZ A;  4WY4 C;  1ZR2 A;  1LWU A;  2WWW A;  1YTZ T;  2M5A A;  1EZV E;  1SQB G;  1YTZ I;  1M7L A;  1P84 E;  2WMM A;  2JKV A;  1WRG A;  1KV4 A;  1SQB K;  3L35 A;  1L0L J;  3B8E B;  2P10 A;  4AUW A;  1PP9 G;  2FYU E;  1PV3 A;  1FS0 E;  3GF3 A;  4BRY A;  2KLV A;  2Q9I A;  1PIX A;  1RF1 A;  4EIJ A;  3Q2Y A;  1HUC A;  3TDK A;  1LTB C;  1N7S B;  4N6J A;  5DJU B;  2FKW B;  2D2C B;  2HOD B;  2B87 B;  2R5D A;  3FX0 A;  1H89 A;  4OGQ B;  2QJY C;  1SQP E;  5M1B A;  1SQV J;  2Q3E A;  2L91 A;  1PPJ D;  5CCG D;  3L70 D;  1FOS E;  2I1K A;  2H43 A;  3AEG C;  2RMZ A;  1OW6 A;  3AE9 C;  3HUS B;  3VTP C;  2OYH B;  1WT6 A;  3CCU P;  4UB6 E;  3T97 B;  3MGN A;  4R4M A;  1BE3 D;  2KZJ A;  1LTJ C;  2HLO A;  4H0L C;  4D6T G;  4LLH A;  3L74 G;  1VPC A;  2CPB A;  1GTW A;  1OX3 A;  1W5C E;  3Q5R A;  1SQB E;  2V7Q H;  3VP8 A;  1NYH A;  3B5N D;  1U7M A;  1FBM A;  4YPC A;  2W90 A;  1KIL E;  4ASW A;  1BCC J;  3L70 E;  1DD3 A;  1M90 Q;  2E75 D;  1KIL A;  2J5U A;  3RK3 B;  1ZR4 A;  1PP9 E;  3CPW O;  3H1J D;  5KLV D;  1M56 D;  5AW2 B;  1OVU A;  3AE6 C;  3CC7 P;  3RL0 B;  4C46 A;  5KKZ C;  5AVQ B;  5CCH C;  3LID A;  3C8V A;  2KP8 A;  4H44 B;  3JSV C;  3CWB G;  3SFE C;  1KB9 H;  1OFC X;  1MZ9 A;  1HWT C;  3GG2 A;  3H32 B;  3HE4 A;  3N4X A;  1OW8 A;  2A45 H;  4AYC A;  3G3Z A;  3AE7 C;  5AW0 B;  2KOG A;  1SQQ J;  3A0B H;  3HTK B;  2PAJ A;  5AVZ B;  2NRG A;  1VQL P;  4D6T E;  1BSN A;  1M1J C;  2FYZ A;  2JR8 A;  3RL0 g;  1YQ3 C;  4IL6 H;  3VMZ A;  1X8Y A;  1JY3 P;  4L74 A;  1KYO I;  2QA4 P;  3CMA P;  1GL2 A;  2QJK C;  2QIW A;  2HYN A;  1EDI A;  2B89 A;  2NPS B;  1L2P A;  5BU8 B;  1JO5 A;  2B9B A;  2I8D A;  2YXR B;  4A7P A;  3PP5 A;  2R32 A;  4U3F D;  4AQR D;  1PFI A;  3F89 A;  4GOD A;  1GZL A;  4RES B;  1NJI Q;  2KIK A;  1YBK A;  2KZI A;  2Y0E A;  1NU1 G;  3H1I J;  3L37 A;  1OMI A;  1NKZ B;  3VYI A;  5APQ A;  1L0N J;  1L4A D;  1DIP A;  3CWB E;  1ZME C;  1ZOY C;  1S9K D;  1NU1 K;  3CC4 P;  1YJ9 P;  2QM8 A;  2IFN A;  3VN0 A;  5CMZ A;  1QVF O;  3AEC C;  3WU2 H;  4BWN A;  1BDD A;  2ZYD A;  2O01 H;  2KS1 A;  4H13 D;  1BSH A;  1LTT C;  2XKM A;  3HE5 B;  2G3A A;  2E74 C;  5APW A;  2XU6 A;  3L71 J;  4I2L C;  1R5L A;  3AE4 C;  2GUV A;  2G8Y A;  1JB0 J;  3RGU A;  1L4A A;  1KYO D;  2IFM A;  1LTJ A;  2NZ2 A;  2ZT9 D;  2J58 A;  1PGO A;  1SQV G;  1GU4 A;  2PFX A;  4PV1 C;  3QWO C;  1QLE D;  2IBZ I;  2QE7 H;  3G71 P;  5AW6 B;  5K5G B;  4W7Z A;  2K1A A;  3O8Z A;  1L0L D;  1NTZ J;  3VP9 A;  3WUU A;  1J1D C;  2IPP A;  1NU1 E;  3H1K J;  2ZYA A;  2GUS A;  3OW2 O;  1Y8A A;  1NTM J;  1RE4 A;  2YIU B;  2LXC B;  5E79 H;  2K3R A;  1LWU C;  1IFM A;  1AA0 A;  1DEB A;  1YIT P;  3RK2 B;  2PRR A;  1GDT A;  3PJS K;  1HGZ A;  5CCH A;  1OXZ A;  4C7N A;  1BCC G;  1URQ D;  4KHX A;  4IFD K;  3R2P A;  3AED C;  1ZLL A;  5KJ7 C;  1L0L E;  1CI6 B;  2WZ7 A;  3GLM A;  3H1H G;  5AVT B;  1U7J A;  4WY4 B;  3ABV C;  1NTK G;  5TIS E;  1RF1 C;  3W68 A;  4I7Z C;  3H1J J;  5KLV J;  1NTK K;  3KXD A;  3HD7 B;  1LNQ A;  1NWQ A;  5AW9 B;  1M1J A;  1SQV E;  3EFG A;  2BCC J;  1SQX D;  3MTU E;  1N7S D;  2AXT E;  2WSF H;  2OYI B;  2IBZ D;  2D2C D;  4OGQ D;  2KK7 A;  3K5B A;  1FZC A;  1JY3 O;  3CX5 H;  2YKP A;  2GM4 A;  4ZKP A;  1SQQ G;  2E76 B;  2QJY B;  1SVF A;  1NVO A;  3CL3 D;  4JQ0 D;  4M3L A;  4JYC A;  1GW3 A;  1SQQ K;  3CLQ A;  1S4X A;  5BVZ A;  1FDI A;  1BCC E;  3PLN A;  1IO4 A;  1Q2N A;  3CC2 P;  2POH A;  1KIL C;  3O6Q A;  5CCG C;  2Q6Q A;  2JO1 A;  3WUT A;  4H0L B;  1NTK E;  4YXW H;  1Y47 A;  2AEJ A;  3WUV A;  2N9Y B;  4PD4 H;  1G1J A;  3JC2 2;  2RH0 A;  1DEE G;  3RK3 D;  1N73 A;  3IAO A;  5GTI E;  1IC2 A;  5AVY B;  2K9J A;  4GKG A;  1LTG C;  1KN7 A;  3E7K A;  1JY2 P;  2FFD C;  3CXH E;  4UB8 H;  3A7O A;  5AW8 B;  3RL0 D;  2E75 C;  2FYU K;  1MUU A;  2MKV A;  3TYY A;  1S72 P;  3GF7 A;  2OTL P;  5KKZ B;  4H44 D;  1SQQ E;  4L75 A;  1QVG O;  2HR3 A;  1HF9 A;  3CCV P;  4IFM A;  2IZ1 A;  3I56 P;  4DJG A;  1LP1 A;  1J1E C;  2Q5U A;  5AW1 B;  1SQP K;  2P2U A;  3H1I D;  2ZVN B;  1AFO A;  1JTH B;  1L0N D;  2YKQ A;  3AE8 C;  1GL2 C;  1KB9 I;  3MUD A;  3A2A A;  1GK6 A;  1K04 A;  3P8M C;  4K3A A;  2YO2 A;  2A45 I;  2ZVO B;  1EDK A;  1PPJ G;  1N86 A;  3L70 G;  1G1I A;  3L71 D;  5KJ7 A;  4GOE A;  2NPS D;  3SWY A;  3IR9 A;  5H2F E;  3H1I E;  1S5L X;  1L0N E;  1S5L E;  1JM0 A;  2ZFC A;  2H89 C;  1H88 A;  2KYV A;  4Y99 C;  4YXD C;  2O01 N;  1HTL C;  2YXQ B;  1DX7 A;  1BE3 G;  3TGU D;  1LTI C;  3FWN A;  1P84 H;  1VQK P;  3VMY A;  2FY8 A;  3W67 A;  2M8R A;  1ZXG A;  3V6I A;  1M1K Q;  2Z4E A;  1QL2 A;  3O6Q B;  1NTZ D;  4OWF A;  3L71 E;  3UIA A;  1SLQ A;  3EQ2 A;  5KLI C;  3H1K D;  3AEF C;  1SFC B;  1NTM D;  2OYO A;  2N1T D;  3H1J G;  3RBX A;  5KLV G;  4HKZ H;  1L4A C;  2KNC B;  1ZW0 A;  2R3C A;  2E74 B;  1QX8 A;  2ZXE B;  2QVA A;  1KB9 D;  5KLV K;  2Y0D A;  1H0T A;  3VMX A;  4H13 C;  2WSE H;  1SQX J;  1PPJ E;  1NTZ E;  1FZA A;  2Q1K A;  1NGM B;  3JCU E;  1S3J A;  3KZI E;  1XTC C;  1PGJ A;  1OIP A;  5CCG A;  2W6J H;  2WSS H;  5APV A;  3BCC J;  2M0B A;  1T2K D;  2RKL A;  1NTM E;  4PJ0 E;  1G2C A;  1RE4 C;  1KC8 Q;  4PV1 B;  2ZYG A;  2I1J A;  1BE3 E;  3IF4 A;  3GW6 A;  1N2D C;  3TSI A;  2Y9Y A;  4N78 D;  3S4R A;  2M3E A;  2BCC D;  2LKM A;  3C9I A;  1J1D B;  3BVH A;  3B5N A;  3CCS P;  2FFD A;  3RK2 D;  1FAV A;  3M9B A;  1LWU B;  1JY2 O;  2M5A B;  3H1J E;  1CZQ A;  1SP4 A;  1IJD B;  5KLV E;  4U3F G;  1LT9 C;  1QGK B;  4YTP C;  2Q7C A;  3KHU A;  2QM7 A;  2BCC E;  4C7R A;  1PZQ A;  2LXB A;  2C9N Y;  1E5W A;  1N7L A;  1BGY D;  1RHZ B;  1VQ4 P;  4BRY B;  2HPC A;  1RF1 B;  1URQ C;  3HD7 D;  4I7Z B;  3KQG A;  1FZC C;  1KQS O;  1VF5 B;  4WB4 A;  3TF5 A;  3CCM P;  2M3B A;  2IX7 C;  1Q81 Q;  3L72 J;  2E76 D;  3CCJ P;  1T3U A;  1OW7 A;  2CPS A;  2KLU A;  4L76 A;  4QMA A;  2K37 A;  3M91 A;  2WPV B;  1JY3 N;  3IN6 A;  3PH0 A;  4Z1M H;  4RO0 A;  1N7S C;  5AVS B;  3P8C D;  3AE5 C;  1HBW A;  3OJA B;  5TJH A;  4EDF A;  4OGQ C;  1T8Z A;  3CX5 I;  1HVV A;  4HH2 A;  2Y9Z A;  4U3F E;  1UII A;  1N73 C;  1IFN A;  3U1C A;  5B5E E;  1L0L G;  4H0L D;  1KIL B;  3VMA A;  1FZF A;  3H6P A;  2PGD A;  1JNM A;  4LC1 A;  3IFM A;  2FXO A;  2C0X A;  1L0L K;  2ZAE B;  3Q1M A;  3A3Y B;  3II6 A;  4ZMD A;  1S9K E;  3P8C E;  2V7Q J;  3GHG A;  3TGU J;  1RE3 A;  1AQT A;  1FZB A;  3P32 A;  4PD4 I;  1AQ5 A;  1YQ4 C;  1MKM A;  1Q7Y Q;  1SQV K;  3HE4 B;  2R5B A;  1FDM A;  3MUD C;  1DH3 A;  4CPG A;  5EFW B;  2A06 D;  1KYO E;  3L73 D;  1KOR A;  1KFN A;  1J1E B;  5KAF E;  1EXI A;  1OWA A;  5AVU B;  1SQX G;  5CHX A;  3L75 D;  4JBZ A;  1J2J B;  1Z56 A;  1YYC A;  1GL2 B;  2IBZ G;  2BEZ F;  4BXL A;  1SQX K;  3B4S A;  2H8P D;  3BRV B;  1FJK A;  2QG4 A;  2MJZ A;  3V2Q A;  4Y28 J;  2O1J A;  4DOJ A;  2AEF A;  4RJT A;  1Q90 D;  4NPF X;  1OVV A;  1LT9 A;  1NAY A;  1NAF A;  4GT1 A;  4W80 A;  2W8Z A;  1NH4 A;  2WT7 A;  1MFT A;  1VQM P;  3A0H E;  4Y99 B;  4PD4 D;  1URQ A;  2BAS A;  3BCC D;  4NPD A;  5CJ0 A;  5TIS H;  4D6T J;  3L74 J;  2KS1 B;  3D6Z A;  1LTS C;  3USS A;  1EZV I;  2YNY A;  2ZXX A;  1SFC D;  1P84 I;  2J59 M;  3H1L D;  3WMM 0;  5KLI B;  2AXT H;  1SQX E;  2OAR A;  2OTK E;  5B66 E;  3M9Q A;  1BGY J;  5APU A;  1VQ7 P;  2E74 D;  1IK7 A;  2IBZ E;  4K35 A;  1L4A B;  2E43 A;  1N7S A;  1RF0 C;  2O01 J;  1MFZ A;  1LTA C;  1LTJ B;  2K88 A;  4XA4 A;  2HOD A;  2B87 A;  1EDJ A;  2K9Y A;  1FJP A;  1K8A Q;  2N1T C;  2UWJ E;  4KJM A;  1ZRT D;  5GTH E;  1U57 A;  1ZN5 A;  3NFQ A;  1USE A;  4XFJ A;  4UB8 E;  3HUS A;  3H1I G;  4PV1 D;  4IFF A;  5KAI E;  5APS A;  3SWK A;  1L0N G;  2OYH A;  4HJG H;  3B5N C;  2AEM A;  3Q5P A;  3T97 A;  2L5G B;  2WSC H;  1QL1 A;  1L0N K;  2WPQ A;  2QJP C;  1Y9B A;  1IFP A;  1T2K C;  5C39 A;  1VQ8 P;  4C7N B;  2P7J A;  1JEK A;  1QEX A;  3L72 D;  1T6A A;  3RK3 E;  5GTI H;  3L71 G;  2QRX A;  1FU1 A;  2FYN C;  3ITK A;  1VL2 A;  1TU3 F;  3CXH H;  1EZV D;  4LGD E;  1IZN B;  1P84 D;  4EOT A;  1JY2 N;  4HYT B;  3KPE A;  3TGU G;  4DT0 A;  1DD4 A;  4I1L A;  1M1J B;  1AJY A;  4WBA A;  2FYU D;  3L36 A;  1EDL A;  3L72 E;  1Q86 Q;  1NTZ G;  1OVR A;  1VQ5 P;  2KI7 B;  2HFE D;  1VF5 D;  5APT A;  3H32 A;  2QJK B;  2FBW C;  1FZC B;  3H1K G;  2R3S A;  1NTZ K;  1NTM G;  1SQP D;  2WPS A;  1KZU B;  3HTK A;  3HD7 C;  3C1L A;  1M8O B;  3V2P A;  1NTM K;  4MN4 C;  3L73 J;  3M0D C;  1W2B O;  1KMI Z;  2WSF J;  1FDO A;  3CD6 P;  1FE6 A;  2OYI C;  5H2F H;  3L75 J;  2A45 G;  3M0A A;  3S1K A;  1S5L H;  2WTY A;  5AVW B;  3TNU A;  4OVN F;  2NPS A;  5AW7 B;  2E76 C;  1SQB D;  1N8R Q;  1KIL D;  1YJN P;  3PHL A;  1M57 D;  3TGU E;  1VQN P;  3GHG C;  1N73 B;  1BDC A;  1RE3 C;  5AVR B;  2QSI A;  1YHQ P;  3P7K A;  2BCC G;  2K9J B;  1RQU A;  3G9R A;  1PP9 D;  2KXP B;  2H88 C;  2CK3 H;  5DJT B;  2P1J A;  3SFD C;  3E1I A;  3V2R A;  1LT1 A;  1HGV A;  5CBN A;  3LIE A;  1YIJ P;  3U59 A;  2H7H A;  4KT0 J;  1KQL A;  1E79 H;  3H1K E;  1RF0 A;  4RKU J;  1KTM A;  4UB6 H;  4JYB A;  1K9M Q;  3FWL A;  3HE5 A;  2XZR A;  1JUN A;  2N1T A;  4NPE A;  1JCC A;  3OAK A;  1LP1 B;  1NHL A;  3H1H J;  1KB9 E;  3S9O A;  3B71 A;  3D6Y A;  2ZT9 C;  3BRT B;  3EWK A;  1BGY G;  3BAT A;  2O3J A;  3H1L J;  4W7Y A;  1NTK J;  3JCU H;  3KZI H;  3G4S P;  2WSC J;  2KUB A;  2ITA A;  2E5Y A;  1NOH A;  3N7N A;  1IFD A;  3A0B E;  4U7J A;  1S2E A;  4D6T D;  4PJ0 H;  3L74 D;  2AXC A;  1MV8 A;  2P67 A;  1JCD A;  1GD2 E;  3FXE A;  4IL6 X;  4TT3 H;  1PL5 A;  4IL6 E;  1GL2 D;  1HH0 A;  2XDJ A;  1PGP A;  2JDI H;  1JMB A;  2IDB A;  1KD1 Q;  4N78 E;  4WY4 D;  3D70 A;  4GIF A;  3R4Y A;  2C9L Y;  5CBO A;  3OA7 A;  2XV5 A;  1R8E A;  1K05 A;  3V2N A;  1FZE A;  3I55 P;  1WMK A;  2JWD A;  2Z5I A;  3L74 E;  1CSB A;  3VOP A;  1IFJ A;  4L73 A;  4IOI H;  3PTZ A;  1YI2 P;  3HRN A;  3CWB D;  1LJ2 A;  1CI6 A;  3M9H A;  3BAS A;  3PRJ A;  3QH9 A;  3NMD A;  1KFM A;  1X22 A;  3TNU B;  3TK1 A;  3AEA C;  4WY4 A;  1GW4 A;  1BGY E;  2OTJ P;  2V4H A;  5KTB A;  3GMA A;  3WU2 E;  1JOC A;  3HD7 A;  1IK9 A;  2YKO A;  2D2C C;  1RQV A;  3LW5 H;  3CCL P;  1H0T B;  3M0D A;  2PP6 A;  5APY A;  1K73 Q;  1OZH A;  4R4L A;  2FYU J;  5CJ4 A;  5APX A;  2OYI A;  3HUS C;  1W2E A;  3AE3 C;  1SFC C;  2WQY C;  1X9V A;  4DZO A;  2OYH C;  2GA1 A;  4ZNC A;  1VQO P;  1G2C B;  2WIT A;  2W83 C;  1GU5 A;  4TLF A;  3KDP B;  3I5C A;  1SQP J;  2YMK A;  2N1T B;  2A06 G;  1HJB A;  2FXP A;  3L73 G;  1EXJ A;  4O9B A;  2WSE J;  1NU1 D;  2XNX A;  2E42 A;  3E1R A;  2YMY A;  5B5E H;  2IZ0 A;  3L75 G;  2IYO A;  3B5N B;  3V4W A;  1AV1 A;  4N3Y B;  2HG5 D;  3NTN A;  4XE5 B;  2FFD B;  2WVR A;  1SS1 A;  3AE1 C;  3RK3 C;  3SWF A;  5E79 E;  1R5S A;  2E75 B;  2Q3I A;  3MP7 B;  5CCH D;  1FOS F;  1AVO A;  2QJP B;  1SQB J;  2JJL A;  1EC5 A;  1X0T A;  2YO3 A;  3M06 A;  1S1C X;  5AVX B;  1H8A A;  3RL0 C;  1X79 B;  3L70 J;  1VQ6 P;  2FYN B;  3FXD A;  2Z5H A;  2W6A A;  4H44 C;  1PP9 J;  2HPC B;  2WPR A;  3CX5 D;  3MIW A;  1XTG B;  2KSE A;  3BCC G;  1BE3 J;  3U1A A;  2JEE A;  5AW4 B;  1SQV D;  3CXH I;  1D7M A;  1KQG B;  2B88 A;  4ZKU A;  1KYO H;  2N9B A;  1NKN A;  2JP3 A;  2A06 E;  5KAF H;  3CI9 A;  3L73 E;  2QEX P;  1USD A;  3H1L G;  1JTH A;  2LR2 A;  3L75 E;  1EQ7 A;  4WVZ A;  3CX5 E;  5AW5 B;  1ZP0 C;  1VF5 C;  3G6E P;  1VDF A;  2NPS C;  1AVY A;  3SSU A;  4GDO A;  3AEB C;  2SPZ A;  3MD0 A;  1Q82 Q;  1CW5 A;  3KYQ A;  1BCC D;  1FZG A;  3CCQ P;  3MZW B;  1RH5 B;  2ZJS E;  1HJ0 A;  1PGQ A;  3H1H D;  1UIX A;  3AEE C;  1VQP P;  3D71 A;  1NTK D;  5L8R J;  3A0H H;  3AE2 C;  5BU5 A;  4DCK A;  3LW5 J;  4PD4 E;  3Q3D A;  2JWA A;  3BCC E;  3GHG B;  4I6M C;  2FYU G;  2BEQ D;  2KSJ A;  2KB7 P;  2IYP A;  3FGA D;  2OGU A;  4JF7 A;  4H13 B;  3L72 G;  5AW3 B;  3CXH D;  2P58 A;  3H1H E;  2E5T A;  3V4Q A;  2DW3 A;  3CWB J;  4GOF A;  5AVV B;  5B66 H;  2RN0 A;  3H1L E;  1KQF B;  4EI2 A;  1SFC A;  1EZV G;  4JPZ B;  1SQQ D;  4HB1 A;  2O1K A;  3ZDM A;  3L4F A;  1A02 J;  2XND H;  2KNC A;  4U3F J;  1LGH B;  1GK4 A;  2OQQ A;  1NO4 A;  3EFF K;  1FC2 C;  2ZT9 B; 
#chains in the Genus database with same CATH homology
 1ZLL A;  5KJ7 C;  1CI6 B;  1JMM A;  4OH8 B;  1A02 F;  2WZ7 A;  1T3U A;  2P1J A;  2CPS A;  3E1I A;  3V2R A;  5AVT B;  2W27 A;  1ZV8 A;  1HGV A;  4WY4 B;  3M91 A;  1JY3 N;  3LIE A;  1RF1 C;  3U59 A;  1N7S C;  2H7H A;  5AVS B;  2C0W A;  1KQL A;  3P8C D;  1RF0 A;  1HBW A;  3OJA B;  3A5T A;  4JYB A;  1NTK K;  5KJ7 D;  1T8Z A;  3HD7 B;  1HVV A;  1IFI A;  3HE5 A;  1NWQ A;  2XZR A;  5AW9 B;  1M1J A;  2N1T A;  4HH2 A;  1JUN A;  1JCC A;  1LT9 B;  3RK2 C;  3OAK A;  3EFG A;  2W6B A;  3MTU E;  2FXM A;  4B86 A;  2VRS A;  1T3J A;  1N73 C;  1IFN A;  3U1C A;  1NHL A;  1N7S D;  1KIL B;  1FZF A;  3H6P A;  2WSF H;  3BRT B;  3BAT A;  4LC1 A;  2WT7 B;  1JNM A;  2OYI B;  4W7Y A;  3IFM A;  3NXS A;  2C0X A;  1RY3 A;  1URQ B;  1FZC A;  1JY3 O;  3V5B A;  1L0L K;  1NOH A;  3A3Y B;  3N7N A;  2YKP A;  4WY4 C;  2GM4 A;  1ZR2 A;  3II6 A;  4ZKP A;  1LWU A;  1IFD A;  2WWW A;  1YTZ T;  1S9K E;  3P8C E;  1YTZ I;  1SVF A;  1M7L A;  1MV8 A;  2P67 A;  1JCD A;  3CL3 D;  3GHG A;  1GD2 E;  1RE3 A;  4M3L A;  1FZB A;  4JYC A;  1GW3 A;  1SQQ K;  1WRG A;  3P32 A;  1GL2 D;  1HH0 A;  2XDJ A;  3CLQ A;  1SQB K;  3L35 A;  1AQ5 A;  5BVZ A;  3B8E B;  4N78 E;  4WY4 D;  4AUW A;  4GIF A;  1IO4 A;  1SQV K;  2POH A;  1KIL C;  2KLV A;  2Q9I A;  3HE4 B;  2C9L Y;  5CCG C;  1RF1 A;  4EIJ A;  3OA7 A;  1HUC A;  1LTB C;  2XV5 A;  3V2N A;  1N7S B;  2R5B A;  1FZE A;  1FDM A;  4N6J A;  1DH3 A;  2FKW B;  2HOD B;  2R5D A;  1CSB A;  2Z5I A;  1H89 A;  1G1J A;  3VOP A;  1IFJ A;  1KFN A;  1J1E B;  3RK3 D;  1N73 A;  5CCG D;  1OWA A;  5AVU B;  1FOS E;  2I1K A;  2H43 A;  1IC2 A;  5AVY B;  4GKG A;  3HRN A;  1LTG C;  5CHX A;  1CI6 A;  3M9H A;  3BAS A;  1J2J B;  1Z56 A;  1JY2 P;  3HUS B;  3NMD A;  1YYC A;  3VTP C;  1KFM A;  2FFD C;  1GL2 B;  2OYH B;  1WT6 A;  3TNU B;  3TK1 A;  1SQX K;  4WY4 A;  1GW4 A;  2H8P D;  3BRV B;  1FJK A;  3A7O A;  5AW8 B;  3RL0 D;  2MJZ A;  3V2Q A;  3MGN A;  2FYU K;  1MUU A;  5KTB A;  3TYY A;  1LTJ C;  2O1J A;  4DOJ A;  2HLO A;  4LLH A;  1VPC A;  2CPB A;  1GTW A;  1JOC A;  3HD7 A;  1IK9 A;  2YKO A;  3VP8 A;  3B5N D;  4IFM A;  3LW5 H;  1FBM A;  1LT9 A;  1NAF A;  4GT1 A;  1J1E C;  3M0D A;  2Q5U A;  2PP6 A;  5APY A;  5AW1 B;  4W80 A;  1SQP K;  1KIL A;  2P2U A;  5CJ4 A;  1AFO A;  1JTH B;  1NH4 A;  5APX A;  3RK3 B;  2WT7 A;  1ZR4 A;  2OYI A;  4Y99 B;  3HUS C;  1URQ A;  1W2E A;  2BAS A;  2YKQ A;  1SFC C;  1GL2 C;  4DZO A;  1X9V A;  2OYH C;  3MUD A;  5CJ0 A;  3A2A A;  1GK6 A;  1G2C B;  2WIT A;  5AW2 B;  1GU5 A;  3KDP B;  3I5C A;  3P8M C;  2N1T B;  3RL0 B;  4C46 A;  2YO2 A;  2A45 I;  5AVQ B;  1HJB A;  1LTS C;  5CCH C;  4O9B A;  3LID A;  2YNY A;  2KP8 A;  2XNX A;  2E42 A;  1SFC D;  1N86 A;  2YMY A;  1G1I A;  2J59 M;  5KJ7 A;  2NPS D;  3SWY A;  3WMM 0;  2OAR A;  3IR9 A;  1MZ9 A;  3B5N B;  3V4W A;  1HWT C;  4N3Y B;  3M9Q A;  2HG5 D;  3NTN A;  4XE5 B;  2FFD B;  5APU A;  3H32 B;  3HE4 A;  3N4X A;  2ZFC A;  3RK3 C;  3SWF A;  1H88 A;  2KYV A;  4Y99 C;  1L4A B;  2A45 H;  1N7S A;  2Q3I A;  4AYC A;  2E43 A;  1HTL C;  1RF0 C;  3G3Z A;  5AW0 B;  2KOG A;  1MFZ A;  5CCH D;  1FOS F;  1DX7 A;  1LTA C;  1LTJ B;  3HTK B;  4XA4 A;  2PAJ A;  1LTI C;  2HOD A;  2JJL A;  2YO3 A;  3M06 A;  5AVZ B;  1FJP A;  1M1J C;  2N1T C;  2FYZ A;  3VMY A;  5AVX B;  1H8A A;  3RL0 C;  2M8R A;  1X79 B;  3VMZ A;  2Z4E A;  1QL2 A;  1X8Y A;  1JY3 P;  1ZN5 A;  3NFQ A;  2Z5H A;  3UIA A;  1SLQ A;  2W6A A;  3HUS A;  4IFF A;  5APS A;  2HPC B;  2WPR A;  3EQ2 A;  1GL2 A;  2OYH A;  3MIW A;  2HYN A;  3B5N C;  1SFC B;  1XTG B;  2N1T D;  2NPS B;  3T97 A;  3U1A A;  2JEE A;  5BU8 B;  1JO5 A;  1L4A C;  2WSC H;  2L5G B;  1QL1 A;  1L0N K;  5AW4 B;  2WPQ A;  3PP5 A;  2R32 A;  2R3C A;  4AQR D;  1PFI A;  1GZL A;  4RES B;  4ZKU A;  1T2K C;  2ZXE B;  2N9B A;  1NKN A;  4C7N B;  5KLV K;  2P7J A;  3CI9 A;  3VMX A;  2WSE H;  3L37 A;  1FZA A;  1NKZ B;  1FU1 A;  1JTH A;  3VYI A;  5APQ A;  1L4A D;  1XTC C;  5CCG A;  1S9K D;  1EQ7 A;  5APV A;  1NU1 K;  4LGD E;  1T2K D;  2QM8 A;  2IFN A;  3VN0 A;  4EOT A;  5AW5 B;  1JY2 N;  4HYT B;  3KPE A;  5CMZ A;  1G2C A;  1RE4 C;  1VDF A;  2I1J A;  2NPS C;  2O01 H;  1LTT C;  2XKM A;  3HE5 B;  3MD0 A;  1N2D C;  3TSI A;  4I1L A;  1M1J B;  1CW5 A;  3KYQ A;  1FZG A;  4N78 D;  5APW A;  4WBA A;  2LKM A;  3C9I A;  1J1D B;  2XU6 A;  3L36 A;  3BVH A;  4I2L C;  2HFE D;  3B5N A;  2GUV A;  5APT A;  2FFD A;  3H32 A;  3RK2 D;  1FZC B;  1FAV A;  5BU5 A;  3M9B A;  1L4A A;  1NTZ K;  1LWU B;  1JY2 O;  2WPS A;  1KZU B;  2IFM A;  1LTJ A;  3HTK A;  2J58 A;  1CZQ A;  3GHG B;  4I6M C;  1SP4 A;  3HD7 C;  1IJD B;  1GU4 A;  2KSJ A;  2KB7 P;  3V2P A;  1NTM K;  1LT9 C;  5AW6 B;  2Q7C A;  3M0D C;  4W7Z A;  2QM7 A;  3O8Z A;  4C7R A;  4JF7 A;  2C9N Y;  3VP9 A;  1E5W A;  1N7L A;  5AW3 B;  1J1D C;  2IPP A;  3V4Q A;  2OYI C;  2HPC A;  5AVV B;  2A45 G;  3M0A A;  1RF1 B;  2GUS A;  1URQ C;  3HD7 D;  2WTY A;  1SFC A;  5AVW B;  1RE4 A;  2O1K A;  3TNU A;  3L4F A;  3KQG A;  1FZC C;  2NPS A;  5AW7 B;  1A02 J;  4WB4 A;  1LWU C;  1IFM A;  1DEB A;  1KIL D;  3RK2 B;  1GDT A;  1LGH B;  3GHG C;  1HGZ A;  1N73 B;  2M3B A;  1RE3 C;  2IX7 C;  5AVR B;  5CCH A;  1OXZ A;  1GK4 A;  4C7N A;  1URQ D;  4KHX A;  4IFD K;  1NO4 A;  3P7K A;  3R2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...