2M0BA

Homodimeric transmembrane domain of the human receptor tyrosine kinase erbb1 (egfr, her1) in micelles
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
44
structure length
44
Chain Sequence
EGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFMRRRHIVRKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords Epidermal growth factor receptor
publication title Left-handed homodimeric transmembrane domain of the human receptor tyrosine kinase ErbB1 (EGFR, HER1)
rcsb
source organism Homo sapiens
total genus 12
structure length 44
sequence length 44
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2m0bA00
2KIKA 4ASWA 2QRXA 2KS1B 4GOFA 2KZIA 2OTKE 3MHVA 1BDCA 3MZWB 4NPFX 3ZDMA 1S3JA 1U7JA 4HJGH 2RKLA 1DEEG 2LXBA 1OVRA 1OVUA 1OVVA 2HR3A 2I8DA 3FXDA 1EDIA 4ZNCA 4HB1A 1EDKA 5C39A 1EC5A 1NVOA 4GODA 4HKZH 4ZMDA 1H0TB 4K35A 1JMBA 3PH0A 1ZXGA 2B87B 4MN4C 3FXEA 5CBNA 1H0TA 2KZJA 1JM0A 3S1KA 4WWIA 2B87A 1Y47A 4K3AA 5K5GB 1SS1A 2M0BA 3RGUA 2M5AB 2R44A 4KJMA 2JWDA 1Q2NA 1EDLA 1LT1A 4IOIH 2M5AA 2LXCB 4BXLA 5EFWB 1U7MA 1LP1B 2SPZA 1EDJA 2KI7B 2ZAEB 4GOEA 1X0TA 3QWOC 2QVAA 4NPDA 1FC2C 2P58A 2K3RA 1LP1A 4ASVA 5DJTB 5DJUB 1BDDA 4EYYQ 2LR2A 1MFTA 2WMMA 5CBOA 1ZW0A 2UWJE 4NPEA 2KUBA 2Q1KA 4CPGA 2B88A 2B89A 4JBZA
chains in the Genus database with same CATH superfamily
5GTHE 4GOFA 2KZIA 3H1KD 1M90Q 3OA7A 2HLOA 1DEEG 3H1JG 1KTMA 3TYYA 4DJGA 1FBMA 2AEJA 3KHUA 3I55P 5CCHC 2FY8A 2YMKA 1NTKE 3VMAA 1RF1C 4C7NA 4HKZH 1QL1A 1VQ4P 1SFCB 2XKMA 3L75J 2BEZF 2OYOA 1HGVA 3F5HA 3H1HJ 1VQOP 3HTKB 1N73A 3RL0B 2HPCB 5KKZB 3RGUA 1S5LE 2H8PD 2JWDA 2NPSA 2FFDC 3EWKA 5E79E 2OTJP 3AE8C 1KORA 5KLIC 1KQFB 1Q7YQ 3E1IA 3CPWO 1IC2A 1X0TA 3H1KG 3FX0A 1M57D 4RJTA 2P67A 2ZT9C 1PPJE 2YIUB 2C9LY 2I1KA 5CBOA 4TT3H 2H43A 1HVVA 2IX7C 2WPRA 1VQMP 3MP7B 4OH8B 1WT6A 3MD0A 3GF7A 1NU1K 2KS1B 1NYHA 4L73A 1JY3O 3N4XA 1HUCA 2P10A 1IFIA 3VYIA 3H1LG 2BCCJ 1N2DC 1J1DC 3L70G 3KQGA 1NWQA 1SFCD 3B5NC 3AE2C 1FJPA 1LTJA 1OXZA 2C0WA 2GUSA 2OGUA 2HYNA 2KXPB 3RL0D 1H0TB 2QJYC 3L71E 3RK3C 5BU8B 2Q3EA 3CMAP 1S9KE 1LT9B 5H2FH 3CX5H 1YJWP 4R4MA 1PL5A 3KZIH 1RE4C 1AQTA 2WPVB 1L4AA 3P8MC 3A2AA 1LWUB 4OWFA 3L72J 1BE3J 1PIXA 1CZQA 4IFFA 1MKMA 1FC2C 4D6TE 1K04A 3IR9A 1SQBJ 1BDDA 3VN0A 1YQ3C 4B86A 3L72D 2KSJA 1BE3D 2Q1KA 4I7ZB 1G2CB 2YMYA 1HJ0A 2K9JA 3WUUA 1NKZB 3L35A 1BDCA 1FS0E 1RHZB 1SQBD 1Y9BA 5GTIE 2WTYA 1QVGO 3KDPB 2AXTH 3GHGC 4U3FJ 1H89A 2POHA 1ZP0C 1SQPE 2LXBA 1OWAA 1HTLC 1IJDB 1N7SC 5APYA 3BVHA 3L74E 1JB0J 1E5WA 4U3FD 2HFED 5TISH 1ZXGA 1SLQA 1FZGA 1BCCG 3F89A 1ZRTD 1UIXA 2ZYDA 3EQ2A 2FYUJ 1HBWA 1NTME 1RF1B 1VL2A 1T8ZA 3D6YA 3TK1A 1Q2NA 3RK2B 4UB8E 3L72G 1BE3G 2QG4A 2WPSA 2FYUD 2Y0DA 4L75A 2XV5A 4GOEA 4JYBA 1HH0A 3P8CE 1SQQJ 2ZVNB 2KLUA 2PFXA 1A02J 5E79H 2WVRA 2QIWA 1NTKD 2JR8A 1HF9A 2WT7B 1NHLA 1L0LJ 1X8YA 4Y99C 2E76B 2ZYGA 1LJ2A 1ZN5A 2HODB 1CW5A 3BRVB 2A45I 3K5BA 4RO0A 5AW2B 1GMJA 3C1LA 4U3FG 3AECC 4NPFX 1GU4A 1AJYA 3AEBC 1OVRA 3VTPC 5KJ7C 4RESB 1KD1Q 3TF5A 1GL2B 4IFDK 1AA0A 1KZUB 2ZFCA 3B5NB 4H44B 2QE7H 3RK2D 2KZJA 3G3ZA 3AE6C 1JY2O 1L0LK 2B87A 1NTKG 3HE4A 5KAFE 1NU1E 2L91A 2YO3A 5KAIH 1LT1A 5EFWB 4AQRD 1QGKB 4JF7A 5AVXB 2E76D 5KLVJ 1QX8A 5AVTB 2Z5IA 2M3BA 1OMIA 4IL6X 3A5TA 3JCUE 2H7HA 3AE9C 3SFDC 1KMIZ 2JO1A 1YTZT 2KP8A 2VRSA 3HD7A 1BSNA 1NKNA 1S9KD 1PPJG 1USDA 4WBAA 1FZEA 1EZVE 1S3JA 1SP4A 1R5SA 1GL2D 2KB7P 2RMZA 1OFCX 1T6AA 1OVUA 5AW8B 1KYOI 3HUSA 5AVVB 3B5ND 5GTIH 3GW6A 4H44D 1M1KQ 3AE5C 4D6TD 3GHGB 1NAYA 4XA4A 2R3SA 3BASA 3KYQA 5KLVK 1MZ9A 4AUWA 3TNUB 3T97A 1KILE 1M1JC 1PGJA 3L73E 2OYIC 4C7RA 1N7SB 3HD7C 3B8EB 2QJPC 3S1KA 3M0AA 2XNDH 1UIIA 2Q3IA 1JCDA 2QJKB 1SS1A 2KYVA 3NMDA 2A45G 1T3UA 3L71G 1KV4A 3HE5A 3L4FA 3R4YA 1S5LX 4KT0J 1SQPD 3M9QA 2KI7B 3M0DC 1NAFA 3SWFA 1VQKP 4H13C 4UB8H 1NTMJ 2WSCH 2BEQD 2ITAA 2ZXXA 2N1TA 3L74D 1JNMA 2K1AA 5AVUB 3SSUA 1FOSF 3IF4A 2FYNC 1L0NE 4JBZA 2JJLA 4D6TG 3Q5SA 3H1IE 3PTZA 1CI6A 1NTMD 1EQ7A 3PLNA 1J1EC 3H1KJ 1FDIA 2E74C 4DT0A 2LKMA 4Y99B 5AVWB 3S9OA 2Q5UA 2QM7A 1FU1A 2KNCA 2GA1A 3AEEC 1VQ8P 3H32B 1N7SD 3P8CD 2OQQA 3NTNA 2N1TC 1ZR4A 1P84E 1SQPG 1T3JA 5CCGA 3D71A 1KC8Q 3CCJP 3CLQA 3C8VA 1S1CX 3MIWA 3TSIA 3E7KA 3LW5H 3H1LJ 3A0BE 1JM0A 3GG2A 1NGMB 3L70J 5TISE 3Q1MA 3L74G 2J59M 1FDMA 4H0LB 1A02F 2JKVA 1IK7A 4IOIH 5B66E 1FAVA 3LIDA 2J58A 3H1LD 1Q81Q 3V2NA 1SVFA 1S2EA 5KAFH 1GK6A 1NTMG 3L70D 1Y8AA 4PV1C 2O01H 3A0HE 2C9NY 1CSBA 3V6IA 3CL3D 1LP1A 2G8YA 1W2EA 2PP6A 4BWNA 2D2CC 2WMMA 4W7YA 1YI2P 1HJBA 4EDFA 3AE7C 3M06A 2PGDA 1NOHA 1YQ4C 1DIPA 3JCUH 2V4HA 2WSFH 1SQVE 1W5CE 3CWBE 4RKUJ 1NU1D 1FZCA 4PJ0E 1KILB 1BSHA 3E1RA 4QMAA 3CC7P 1GL2A 3CC4P 1OVVA 2FXMA 2KSEA 1N73C 1URQA 5KJ7D 3WMM0 1GU5A 1EDIA 3N7NA 1EDKA 2NPSC 3CX5I 1IO4A 4GODA 3LIEA 3D6ZA 1D7MA 4H0LD 4HYTB 1OW6A 2FXPA 3B71A 3FGAD 2YO2A 4BRYB 3VMYA 2N9YB 2WQYC 3I5CA 2OYHB 3O6QB 4TLFA 3EFFK 4JQ0D 4GIFA 1K05A 1IFJA 3MUDA 1M1JB 1GW3A 3L37A 2M5AA 4WY4A 1JTHA 2WSEH 3PHLA 3U1AA 1EDJA 2C0XA 3GF3A 2I1JA 4W80A 1BCCJ 5CHXA 1M8OB 1DD3A 2QVAA 5KAIE 4NPDA 1KN7A 1NU1G 2IZ1A 4A7PA 2J5UA 3G71P 1KFMA 1YITP 4JPZB 1LTJC 1PP9E 1KILD 1IZNB 3L73D 2KUBA 1IFDA 2B88A 2B89A 3PP5A 1BCCD 3BATA 5AVYB 4ASWA 3R2PA 3MGNA 1SQXE 2W6BA 2M8RA 3BCCE 2FYNB 2ZYAA 2IBZE 3CX5D 3RK3E 4PD4E 5AW7B 3TNUA 3B4SA 1EXIA 1EZVG 2E74B 4HB1A 1EC5A 1ZR2A 1N8RQ 2Z4EA 1L4AC 1J2JB 5AW6B 1VQ7P 1VPCA 1NTZE 4OGQC 1P84H 1L0ND 3H1ID 2YKQA 2Q9IA 1RE3A 3HRNA 1E79H 3VMXA 3A0BH 2WITA 3L73G 1VF5C 4BXLA 1SQBK 3PJSK 5B66H 1YJ9P 2JDIH 4ASVA 5DJTB 4EYYQ 1NTKJ 1P84D 2LR2A 1MFTA 3A0HH 5BU5A 1IFMA 4PV1B 5APQA 1YHQP 2QRXA 1BGYE 2YKPA 1W2BO 2FFDB 2JWAA 2E74D 2O1JA 2RKLA 1OX3A 5KLIB 1L0NG 3D70A 3H1IG 1JO5A 4PJ0H 3FXDA 3I56P 4C7NB 3WU2E 1H88A 1JUNA 4ZNCA 2ZT9B 3CD6P 4W7ZA 2FYUK 3CXHE 4K35A 1KB9H 1N73B 2AEFA 2FYZA 3IN6A 1NTKK 1SFCA 3M9HA 2IYOA 2NPSB 5AW0B 4K3AA 1USEA 5CCHD 1PGPA 1SQVD 2JEEA 3FWLA 2R44A 3CWBD 3HTKA 1EDLA 1X9VA 1PPJD 1SQQK 1J1DB 2HG5D 2HPCA 3NFQA 1U7MA 5APTA 3V4WA 2E43A 3QWOC 3AEFC 4PV1D 3H6PA 1RH5B 3SWKA 2K3RA 2ZJSE 2BASA 2IBZI 2DW3A 3L75E 2B9BA 2QJYB 4XFJA 3H1HE 4WVZA 1R8EA 3RK3B 5AW9B 1KILA 5APUA 3L71J 2E42A 3V4QA 4EIJA 2KIKA 4EOTA 1KFNA 2YKOA 3OJAB 3RL0C 1Z56A 3JSVC 1U7JA 5KKZC 2ZT9D 1LTJB 1YIJP 2KS1A 2KOGA 3WUVA 2RH0A 3L71D 2HR3A 1GD2E 1JY2N 4Z1MH 2OTLP 1SQVG 1RQUA 3II6A 1T2KC 2CPBA 1G1IA 2R5DA 3CWBG 2GUVA 3QH9A 1NVOA 4D6TJ 2NPSD 1SQXJ 4PD4H 1PP9D 1H0TA 5APVA 1Y47A 3VOPA 1L4AB 2K88A 3H25A 1SQXD 2BCCE 1LT9A 1Q82Q 2PRRA 1AVOA 5AVRB 3CC2P 1SQPJ 1TU3F 2IBZD 2H89C 3RK3D 1NTZJ 4PD4D 1QVFO 1LWUA 2CK3H 1VF5B 5DJUB 3G9RA 3AEGC 3L74J 4DCKA 2P1JA 3HUSC 2IFNA 2K9JB 2UWJE 3AEAC 1N7LA 1NTZD 2Y9YA 5AVZB 1LT9C 1G2CA 1K8AQ 2OARA 1Q86Q 1PP9G 2O1KA 3V2QA 2WSCJ 1KQSO 1LWUC 3OW2O 2V7QH 1AQ5A 1SQBE 1SQXG 4N6JA 3RBZA 3BCCG 4ZMDA 1L4AD 3WU2H 1PGQA 2XU6A 2JP3A 2IBZG 2H88C 5CBNA 3IAOA 2NZ2A 3CXHH 4I7ZC 1S72P 1BGYD 4DZOA 4AYCA 1RF1A 1VF5D 1NTMK 1NTZG 3V5BA 1GZLA 3A7OA 3S4RA 2W83C 1N86A 3LW5J 3PRJA 3CXHD 2ZXEB 2FFDA 3V2RA 2FYUE 1EZVI 1WRGA 5AW5B 2WT7A 2P2UA 2OTKE 1PV3A 5M1BA 3Q5RA 2HODA 5CCGC 1NU1J 4GDOA 2O01J 2AEMA 3RK2C 1SQQE 1BGYG 1OZHA 2ZVOB 1VDFA 3KPEA 1DH3A 3Q2YA 4YXDC 2Q6QA 1GDTA 1L0LE 3L75D 4L74A 2A06E 2B87B 3H1HD 3SWYA 2WSFJ 3Q5PA 4MN4C 3HE4B 2QSIA 2O3JA 2E76C 3B5NA 1KB9E 3CCUP 4M3LA 1H8AA 4I2LC 2IFMA 2WSSH 1AV1A 3AE4C 4YPCA 1RY3A 3MTUE 2K9YA 3VMZA 2W90A 3CCEP 1KQGB 1FZCC 1OW7A 1EZVD 1GL2C 2OYIB 1RF0A 1RE4A 3HD7B 1Q90D 1URQC 2QJPB 4H44C 3L73J 3NXSA 4CPGA 1JOCA 4N78E 2QEXP 1G1JA 1JY3N 4N3YB 3L75G 3MZWB 1K9MQ 1FDOA 1IFPA 2WSEJ 3H1HG 3HUSB 2BCCD 3A3YB 4WB4A 2WPQA 1LTGC 4L76A 2IPPA 2KLVA 2P7JA 1VQNP 4DOJA 5KLVE 1P84I 4H13B 3VP8A 1S4XA 2MJZA 1T2KD 1R5LA 4O9BA 2MKVA 3MUDC 3T97B 2FXOA 2YNYA 4KHXA 1RF0C 1PFIA 3TDKA 1JMBA 1FZAA 4WY4C 3GHGA 3RL0g 1NH4A 1LTAC 3M91A 3AEDC 4WWIA 1OIPA 3TGUE 1L0NJ 3G4SP 1N7SA 3HE5B 3USSA 1MV8A 1J1EB 3H1IJ 2Y0EA 4KJMA 1RQVA 1MUUA 3GLMA 4IL6H 3SFEC 1JEKA 2E75C 4OVNF 1PGOA 2Z5HA 1MFZA 3IFMA 2GM4A 4YXWH 3HD7D 2N1TB 5B5EE 3GMAA 1ZLLA 2L5GB 2BCCG 3VP9A 2QA4P 2RN0A 5GTHH 1CI6B 1ZW0A 3H1JE 1VQ5P 4IFMA 4NPEA 5KTBA 5APXA 1JY2P 4H13D 2KNCB 2QJKC 4HJGH 4GKGA 1KB9I 1L0NK 2M3EA 1FZFA 2Y0CA 3RBXA 3Q3DA 1RE3C 1GW4A 1IFNA 1GTWA 1VQLP 3W67A 2K37A 4JYCA 5C39A 3CCSP 3H32A 1KYOE 2D2CB 2W6JH 1LTIC 3FWNA 3PH0A 2FBWC 2IYPA 3UIAA 1S5LH 3FXEA 1M56D 5CJ0A 1SQBG 1XTCC 3H1KE 5KJ7A 2M0BA 2N1TD 1ZMEC 1SQVJ 3CWBJ 2KK7A 1AFOA 4UB6E 5AW4B 3U1CA 1LP1B 4U7JA 1LTBC 1SQQD 4YTPC 4GT1A 2NRGA 3BRTB 1VQ6P 1QLED 2AXCA 1L0LD 4XE5B 1L2PA 1JCCA 2A06D 3H1LE 2R32A 4ZKUA 1AVYA 1JMMA 2XNXA 3L70E 1PZQA 2YXRB 1FZCB 4ZKPA 4Y28J 3W68A 1KB9D 3MHVA 2FKWB 1YBKA 3ZDMA 5CCGD 3CCVP 1U57A 4H0LC 4PD4I 1LGHB 1URQB 3AE1C 2D2CD 2FYUG 2PAJA 1SQVK 1SFCC 2CPSA 2I8DA 1HGZA 2A45H 1FZBA 4C46A 3AE3C 3CCMP 3JC22 1NJIQ 1X79B 5CJ4A 1X22A 1SQQG 1PP9J 2G3AA 4N78D 2QM8A 5K5GB 4I1LA 1L0LG 2M5AB 4BRYA 1IK9A 5AVQB 4WY4B 1JTHB 2OYHA 4LC1A 3O6QA 2A06G 3OAKA 2YIUC 1KILC 2LXCB 3ITKA 3BCCJ 2WZ7A 5APWA 5CMZA 3CMEP 1M1JA 2OYIA 2ZAEB 5KLVD 1ZV8A 2P58A 5AW1B 2WWWA 1DEBA 3TGUJ 2YXQB 5L8RJ 1DD4A 2W8ZA 5AW3B 1KQLA 1FE6A 3KXDA 2E75B 3L36A 5B5EH 3BCCD 5AVSB 4OGQB 1URQD 2W6AA 4LGDE 3U59A 3M0DA 3TGUD 1VQPP 3WUTA 2OYHC 3G6EP 4LLHA 5TJHA 1LNQA 3V2PA 1M7LA 1ZOYC 3P7KA 3H1JJ 1BCCE 1WMKA 2N9BA 1SQXK 3CI9A 3CXHI 1LTTC 2Y9ZA 3EFGA 1HWTC 2IZ0A 4WY4D 2E5TA 5KLVG 3P32A 3H1JD 3L72E 5H2FE 3CX5E 1BE3E 1KYOH 2E5YA 1XTGB 3KZIE 3CCLP 4HH2A 3ABVC 1SQPK 1YJNP 1VQ9P 1BGYJ 2Q7CA 2XDJA 2R5BA 4EI2A 1DX7A 1NTZK 1QEXA 5BVZA 1YTZI 1NO4A 1K73Q 2V7QJ 2E75D 1GK4A 2SPZA 3TGUG 4IL6E 3CCQP 3O8ZA 1EXJA 4OGQD 4UB6H 3M9BA 5APSA 1FJKA 1JY3P 1LTSC 4R4LA 5CCHA 1KYOD 1QL2A 2R3CA 4U3FE 1FOSE 1OW8A 2IDBA 2XZRA 1YYCA 3C9IA 4I6MC 3CCRP 2W27A 1ZRTE 2O01N 2AXTE
chains in the Genus database with same CATH topology
2KIKA 4ASWA 2QRXA 2KS1B 4GOFA 2KZIA 2OTKE 3MHVA 1BDCA 3MZWB 4NPFX 3ZDMA 1S3JA 1U7JA 4HJGH 2RKLA 1DEEG 2LXBA 1OVRA 1OVUA 1OVVA 2HR3A 2I8DA 3FXDA 1EDIA 4ZNCA 4HB1A 1EDKA 5C39A 1EC5A 1NVOA 4GODA 4HKZH 4ZMDA 1H0TB 4K35A 1JMBA 3PH0A 1ZXGA 2B87B 4MN4C 3FXEA 5CBNA 1H0TA 2KZJA 1JM0A 3S1KA 4WWIA 2B87A 1Y47A 4K3AA 5K5GB 1SS1A 2M0BA 3RGUA 2M5AB 2R44A 4KJMA 2JWDA 1Q2NA 1EDLA 1LT1A 4IOIH 2M5AA 2LXCB 4BXLA 5EFWB 1U7MA 1LP1B 2SPZA 1EDJA 2KI7B 2ZAEB 4GOEA 1X0TA 3QWOC 2QVAA 4NPDA 1FC2C 2P58A 2K3RA 1LP1A 4ASVA 5DJTB 5DJUB 1BDDA 4EYYQ 2LR2A 1MFTA 2WMMA 5CBOA 1ZW0A 2UWJE 4NPEA 2KUBA 2Q1KA 4CPGA 2B88A 2B89A 4JBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KIK A;  4ASW A;  2QRX A;  2KS1 B;  4GOF A;  2KZI A;  2OTK E;  3MHV A;  1BDC A;  3MZW B;  4NPF X;  3ZDM A;  1S3J A;  1U7J A;  4HJG H;  2RKL A;  1DEE G;  2LXB A;  1OVR A;  1OVU A;  1OVV A;  2HR3 A;  2I8D A;  3FXD A;  1EDI A;  4ZNC A;  4HB1 A;  1EDK A;  5C39 A;  1EC5 A;  1NVO A;  4GOD A;  4HKZ H;  4ZMD A;  1H0T B;  4K35 A;  1JMB A;  3PH0 A;  1ZXG A;  2B87 B;  4MN4 C;  3FXE A;  5CBN A;  1H0T A;  2KZJ A;  1JM0 A;  3S1K A;  4WWI A;  2B87 A;  1Y47 A;  4K3A A;  5K5G B;  1SS1 A;  2M0B A;  3RGU A;  2M5A B;  2R44 A;  4KJM A;  2JWD A;  1Q2N A;  1EDL A;  1LT1 A;  4IOI H;  2M5A A;  2LXC B;  4BXL A;  5EFW B;  1U7M A;  1LP1 B;  2SPZ A;  1EDJ A;  2KI7 B;  2ZAE B;  4GOE A;  1X0T A;  3QWO C;  2QVA A;  4NPD A;  1FC2 C;  2P58 A;  2K3R A;  1LP1 A;  4ASV A;  5DJT B;  5DJU B;  1BDD A;  4EYY Q;  2LR2 A;  1MFT A;  2WMM A;  5CBO A;  1ZW0 A;  2UWJ E;  4NPE A;  2KUB A;  2Q1K A;  4CPG A;  2B88 A;  2B89 A;  4JBZ A; 
#chains in the Genus database with same CATH topology
 5GTH E;  4GOF A;  2KZI A;  3H1K D;  1M90 Q;  3OA7 A;  2HLO A;  1DEE G;  3H1J G;  1KTM A;  3TYY A;  4DJG A;  1FBM A;  2AEJ A;  3KHU A;  3I55 P;  5CCH C;  2FY8 A;  2YMK A;  1NTK E;  3VMA A;  1RF1 C;  4C7N A;  4HKZ H;  1QL1 A;  1VQ4 P;  1SFC B;  2XKM A;  3L75 J;  2BEZ F;  2OYO A;  1HGV A;  3F5H A;  3H1H J;  1VQO P;  3HTK B;  1N73 A;  3RL0 B;  2HPC B;  5KKZ B;  3RGU A;  1S5L E;  2H8P D;  2JWD A;  2NPS A;  2FFD C;  3EWK A;  5E79 E;  2OTJ P;  3AE8 C;  1KOR A;  5KLI C;  1KQF B;  1Q7Y Q;  3E1I A;  3CPW O;  1IC2 A;  1X0T A;  3H1K G;  3FX0 A;  1M57 D;  4RJT A;  2P67 A;  2ZT9 C;  1PPJ E;  2YIU B;  2C9L Y;  2I1K A;  5CBO A;  4TT3 H;  2H43 A;  1HVV A;  2IX7 C;  2WPR A;  1VQM P;  3MP7 B;  4OH8 B;  1WT6 A;  3MD0 A;  3GF7 A;  1NU1 K;  2KS1 B;  1NYH A;  4L73 A;  1JY3 O;  3N4X A;  1HUC A;  2P10 A;  1IFI A;  3VYI A;  3H1L G;  2BCC J;  1N2D C;  1J1D C;  3L70 G;  3KQG A;  1NWQ A;  1SFC D;  3B5N C;  3AE2 C;  1FJP A;  1LTJ A;  1OXZ A;  2C0W A;  2GUS A;  2OGU A;  2HYN A;  2KXP B;  3RL0 D;  1H0T B;  2QJY C;  3L71 E;  3RK3 C;  5BU8 B;  2Q3E A;  3CMA P;  1S9K E;  1LT9 B;  5H2F H;  3CX5 H;  1YJW P;  4R4M A;  1PL5 A;  3KZI H;  1RE4 C;  1AQT A;  2WPV B;  1L4A A;  3P8M C;  3A2A A;  1LWU B;  4OWF A;  3L72 J;  1BE3 J;  1PIX A;  1CZQ A;  4IFF A;  1MKM A;  1FC2 C;  4D6T E;  1K04 A;  3IR9 A;  1SQB J;  1BDD A;  3VN0 A;  1YQ3 C;  4B86 A;  3L72 D;  2KSJ A;  1BE3 D;  2Q1K A;  4I7Z B;  1G2C B;  2YMY A;  1HJ0 A;  2K9J A;  3WUU A;  1NKZ B;  3L35 A;  1BDC A;  1FS0 E;  1RHZ B;  1SQB D;  1Y9B A;  5GTI E;  2WTY A;  1QVG O;  3KDP B;  2AXT H;  3GHG C;  4U3F J;  1H89 A;  2POH A;  1ZP0 C;  1SQP E;  2LXB A;  1OWA A;  1HTL C;  1IJD B;  1N7S C;  5APY A;  3BVH A;  3L74 E;  1JB0 J;  1E5W A;  4U3F D;  2HFE D;  5TIS H;  1ZXG A;  1SLQ A;  1FZG A;  1BCC G;  3F89 A;  1ZRT D;  1UIX A;  2ZYD A;  3EQ2 A;  2FYU J;  1HBW A;  1NTM E;  1RF1 B;  1VL2 A;  1T8Z A;  3D6Y A;  3TK1 A;  1Q2N A;  3RK2 B;  4UB8 E;  3L72 G;  1BE3 G;  2QG4 A;  2WPS A;  2FYU D;  2Y0D A;  4L75 A;  2XV5 A;  4GOE A;  4JYB A;  1HH0 A;  3P8C E;  1SQQ J;  2ZVN B;  2KLU A;  2PFX A;  1A02 J;  5E79 H;  2WVR A;  2QIW A;  1NTK D;  2JR8 A;  1HF9 A;  2WT7 B;  1NHL A;  1L0L J;  1X8Y A;  4Y99 C;  2E76 B;  2ZYG A;  1LJ2 A;  1ZN5 A;  2HOD B;  1CW5 A;  3BRV B;  2A45 I;  3K5B A;  4RO0 A;  5AW2 B;  1GMJ A;  3C1L A;  4U3F G;  3AEC C;  4NPF X;  1GU4 A;  1AJY A;  3AEB C;  1OVR A;  3VTP C;  5KJ7 C;  4RES B;  1KD1 Q;  3TF5 A;  1GL2 B;  4IFD K;  1AA0 A;  1KZU B;  2ZFC A;  3B5N B;  4H44 B;  2QE7 H;  3RK2 D;  2KZJ A;  3G3Z A;  3AE6 C;  1JY2 O;  1L0L K;  2B87 A;  1NTK G;  3HE4 A;  5KAF E;  1NU1 E;  2L91 A;  2YO3 A;  5KAI H;  1LT1 A;  5EFW B;  4AQR D;  1QGK B;  4JF7 A;  5AVX B;  2E76 D;  5KLV J;  1QX8 A;  5AVT B;  2Z5I A;  2M3B A;  1OMI A;  4IL6 X;  3A5T A;  3JCU E;  2H7H A;  3AE9 C;  3SFD C;  1KMI Z;  2JO1 A;  1YTZ T;  2KP8 A;  2VRS A;  3HD7 A;  1BSN A;  1NKN A;  1S9K D;  1PPJ G;  1USD A;  4WBA A;  1FZE A;  1EZV E;  1S3J A;  1SP4 A;  1R5S A;  1GL2 D;  2KB7 P;  2RMZ A;  1OFC X;  1T6A A;  1OVU A;  5AW8 B;  1KYO I;  3HUS A;  5AVV B;  3B5N D;  5GTI H;  3GW6 A;  4H44 D;  1M1K Q;  3AE5 C;  4D6T D;  3GHG B;  1NAY A;  4XA4 A;  2R3S A;  3BAS A;  3KYQ A;  5KLV K;  1MZ9 A;  4AUW A;  3TNU B;  3T97 A;  1KIL E;  1M1J C;  1PGJ A;  3L73 E;  2OYI C;  4C7R A;  1N7S B;  3HD7 C;  3B8E B;  2QJP C;  3S1K A;  3M0A A;  2XND H;  1UII A;  2Q3I A;  1JCD A;  2QJK B;  1SS1 A;  2KYV A;  3NMD A;  2A45 G;  1T3U A;  3L71 G;  1KV4 A;  3HE5 A;  3L4F A;  3R4Y A;  1S5L X;  4KT0 J;  1SQP D;  3M9Q A;  2KI7 B;  3M0D C;  1NAF A;  3SWF A;  1VQK P;  4H13 C;  4UB8 H;  1NTM J;  2WSC H;  2BEQ D;  2ITA A;  2ZXX A;  2N1T A;  3L74 D;  1JNM A;  2K1A A;  5AVU B;  3SSU A;  1FOS F;  3IF4 A;  2FYN C;  1L0N E;  4JBZ A;  2JJL A;  4D6T G;  3Q5S A;  3H1I E;  3PTZ A;  1CI6 A;  1NTM D;  1EQ7 A;  3PLN A;  1J1E C;  3H1K J;  1FDI A;  2E74 C;  4DT0 A;  2LKM A;  4Y99 B;  5AVW B;  3S9O A;  2Q5U A;  2QM7 A;  1FU1 A;  2KNC A;  2GA1 A;  3AEE C;  1VQ8 P;  3H32 B;  1N7S D;  3P8C D;  2OQQ A;  3NTN A;  2N1T C;  1ZR4 A;  1P84 E;  1SQP G;  1T3J A;  5CCG A;  3D71 A;  1KC8 Q;  3CCJ P;  3CLQ A;  3C8V A;  1S1C X;  3MIW A;  3TSI A;  3E7K A;  3LW5 H;  3H1L J;  3A0B E;  1JM0 A;  3GG2 A;  1NGM B;  3L70 J;  5TIS E;  3Q1M A;  3L74 G;  2J59 M;  1FDM A;  4H0L B;  1A02 F;  2JKV A;  1IK7 A;  4IOI H;  5B66 E;  1FAV A;  3LID A;  2J58 A;  3H1L D;  1Q81 Q;  3V2N A;  1SVF A;  1S2E A;  5KAF H;  1GK6 A;  1NTM G;  3L70 D;  1Y8A A;  4PV1 C;  2O01 H;  3A0H E;  2C9N Y;  1CSB A;  3V6I A;  3CL3 D;  1LP1 A;  2G8Y A;  1W2E A;  2PP6 A;  4BWN A;  2D2C C;  2WMM A;  4W7Y A;  1YI2 P;  1HJB A;  4EDF A;  3AE7 C;  3M06 A;  2PGD A;  1NOH A;  1YQ4 C;  1DIP A;  3JCU H;  2V4H A;  2WSF H;  1SQV E;  1W5C E;  3CWB E;  4RKU J;  1NU1 D;  1FZC A;  4PJ0 E;  1KIL B;  1BSH A;  3E1R A;  4QMA A;  3CC7 P;  1GL2 A;  3CC4 P;  1OVV A;  2FXM A;  2KSE A;  1N73 C;  1URQ A;  5KJ7 D;  3WMM 0;  1GU5 A;  1EDI A;  3N7N A;  1EDK A;  2NPS C;  3CX5 I;  1IO4 A;  4GOD A;  3LIE A;  3D6Z A;  1D7M A;  4H0L D;  4HYT B;  1OW6 A;  2FXP A;  3B71 A;  3FGA D;  2YO2 A;  4BRY B;  3VMY A;  2N9Y B;  2WQY C;  3I5C A;  2OYH B;  3O6Q B;  4TLF A;  3EFF K;  4JQ0 D;  4GIF A;  1K05 A;  1IFJ A;  3MUD A;  1M1J B;  1GW3 A;  3L37 A;  2M5A A;  4WY4 A;  1JTH A;  2WSE H;  3PHL A;  3U1A A;  1EDJ A;  2C0X A;  3GF3 A;  2I1J A;  4W80 A;  1BCC J;  5CHX A;  1M8O B;  1DD3 A;  2QVA A;  5KAI E;  4NPD A;  1KN7 A;  1NU1 G;  2IZ1 A;  4A7P A;  2J5U A;  3G71 P;  1KFM A;  1YIT P;  4JPZ B;  1LTJ C;  1PP9 E;  1KIL D;  1IZN B;  3L73 D;  2KUB A;  1IFD A;  2B88 A;  2B89 A;  3PP5 A;  1BCC D;  3BAT A;  5AVY B;  4ASW A;  3R2P A;  3MGN A;  1SQX E;  2W6B A;  2M8R A;  3BCC E;  2FYN B;  2ZYA A;  2IBZ E;  3CX5 D;  3RK3 E;  4PD4 E;  5AW7 B;  3TNU A;  3B4S A;  1EXI A;  1EZV G;  2E74 B;  4HB1 A;  1EC5 A;  1ZR2 A;  1N8R Q;  2Z4E A;  1L4A C;  1J2J B;  5AW6 B;  1VQ7 P;  1VPC A;  1NTZ E;  4OGQ C;  1P84 H;  1L0N D;  3H1I D;  2YKQ A;  2Q9I A;  1RE3 A;  3HRN A;  1E79 H;  3VMX A;  3A0B H;  2WIT A;  3L73 G;  1VF5 C;  4BXL A;  1SQB K;  3PJS K;  5B66 H;  1YJ9 P;  2JDI H;  4ASV A;  5DJT B;  4EYY Q;  1NTK J;  1P84 D;  2LR2 A;  1MFT A;  3A0H H;  5BU5 A;  1IFM A;  4PV1 B;  5APQ A;  1YHQ P;  2QRX A;  1BGY E;  2YKP A;  1W2B O;  2FFD B;  2JWA A;  2E74 D;  2O1J A;  2RKL A;  1OX3 A;  5KLI B;  1L0N G;  3D70 A;  3H1I G;  1JO5 A;  4PJ0 H;  3FXD A;  3I56 P;  4C7N B;  3WU2 E;  1H88 A;  1JUN A;  4ZNC A;  2ZT9 B;  3CD6 P;  4W7Z A;  2FYU K;  3CXH E;  4K35 A;  1KB9 H;  1N73 B;  2AEF A;  2FYZ A;  3IN6 A;  1NTK K;  1SFC A;  3M9H A;  2IYO A;  2NPS B;  5AW0 B;  4K3A A;  1USE A;  5CCH D;  1PGP A;  1SQV D;  2JEE A;  3FWL A;  2R44 A;  3CWB D;  3HTK A;  1EDL A;  1X9V A;  1PPJ D;  1SQQ K;  1J1D B;  2HG5 D;  2HPC A;  3NFQ A;  1U7M A;  5APT A;  3V4W A;  2E43 A;  3QWO C;  3AEF C;  4PV1 D;  3H6P A;  1RH5 B;  3SWK A;  2K3R A;  2ZJS E;  2BAS A;  2IBZ I;  2DW3 A;  3L75 E;  2B9B A;  2QJY B;  4XFJ A;  3H1H E;  4WVZ A;  1R8E A;  3RK3 B;  5AW9 B;  1KIL A;  5APU A;  3L71 J;  2E42 A;  3V4Q A;  4EIJ A;  2KIK A;  4EOT A;  1KFN A;  2YKO A;  3OJA B;  3RL0 C;  1Z56 A;  3JSV C;  1U7J A;  5KKZ C;  2ZT9 D;  1LTJ B;  1YIJ P;  2KS1 A;  2KOG A;  3WUV A;  2RH0 A;  3L71 D;  2HR3 A;  1GD2 E;  1JY2 N;  4Z1M H;  2OTL P;  1SQV G;  1RQU A;  3II6 A;  1T2K C;  2CPB A;  1G1I A;  2R5D A;  3CWB G;  2GUV A;  3QH9 A;  1NVO A;  4D6T J;  2NPS D;  1SQX J;  4PD4 H;  1PP9 D;  1H0T A;  5APV A;  1Y47 A;  3VOP A;  1L4A B;  2K88 A;  3H25 A;  1SQX D;  2BCC E;  1LT9 A;  1Q82 Q;  2PRR A;  1AVO A;  5AVR B;  3CC2 P;  1SQP J;  1TU3 F;  2IBZ D;  2H89 C;  3RK3 D;  1NTZ J;  4PD4 D;  1QVF O;  1LWU A;  2CK3 H;  1VF5 B;  5DJU B;  3G9R A;  3AEG C;  3L74 J;  4DCK A;  2P1J A;  3HUS C;  2IFN A;  2K9J B;  2UWJ E;  3AEA C;  1N7L A;  1NTZ D;  2Y9Y A;  5AVZ B;  1LT9 C;  1G2C A;  1K8A Q;  2OAR A;  1Q86 Q;  1PP9 G;  2O1K A;  3V2Q A;  2WSC J;  1KQS O;  1LWU C;  3OW2 O;  2V7Q H;  1AQ5 A;  1SQB E;  1SQX G;  4N6J A;  3RBZ A;  3BCC G;  4ZMD A;  1L4A D;  3WU2 H;  1PGQ A;  2XU6 A;  2JP3 A;  2IBZ G;  2H88 C;  5CBN A;  3IAO A;  2NZ2 A;  3CXH H;  4I7Z C;  1S72 P;  1BGY D;  4DZO A;  4AYC A;  1RF1 A;  1VF5 D;  1NTM K;  1NTZ G;  3V5B A;  1GZL A;  3A7O A;  3S4R A;  2W83 C;  1N86 A;  3LW5 J;  3PRJ A;  3CXH D;  2ZXE B;  2FFD A;  3V2R A;  2FYU E;  1EZV I;  1WRG A;  5AW5 B;  2WT7 A;  2P2U A;  2OTK E;  1PV3 A;  5M1B A;  3Q5R A;  2HOD A;  5CCG C;  1NU1 J;  4GDO A;  2O01 J;  2AEM A;  3RK2 C;  1SQQ E;  1BGY G;  1OZH A;  2ZVO B;  1VDF A;  3KPE A;  1DH3 A;  3Q2Y A;  4YXD C;  2Q6Q A;  1GDT A;  1L0L E;  3L75 D;  4L74 A;  2A06 E;  2B87 B;  3H1H D;  3SWY A;  2WSF J;  3Q5P A;  4MN4 C;  3HE4 B;  2QSI A;  2O3J A;  2E76 C;  3B5N A;  1KB9 E;  3CCU P;  4M3L A;  1H8A A;  4I2L C;  2IFM A;  2WSS H;  1AV1 A;  3AE4 C;  4YPC A;  1RY3 A;  3MTU E;  2K9Y A;  3VMZ A;  2W90 A;  3CCE P;  1KQG B;  1FZC C;  1OW7 A;  1EZV D;  1GL2 C;  2OYI B;  1RF0 A;  1RE4 A;  3HD7 B;  1Q90 D;  1URQ C;  2QJP B;  4H44 C;  3L73 J;  3NXS A;  4CPG A;  1JOC A;  4N78 E;  2QEX P;  1G1J A;  1JY3 N;  4N3Y B;  3L75 G;  3MZW B;  1K9M Q;  1FDO A;  1IFP A;  2WSE J;  3H1H G;  3HUS B;  2BCC D;  3A3Y B;  4WB4 A;  2WPQ A;  1LTG C;  4L76 A;  2IPP A;  2KLV A;  2P7J A;  1VQN P;  4DOJ A;  5KLV E;  1P84 I;  4H13 B;  3VP8 A;  1S4X A;  2MJZ A;  1T2K D;  1R5L A;  4O9B A;  2MKV A;  3MUD C;  3T97 B;  2FXO A;  2YNY A;  4KHX A;  1RF0 C;  1PFI A;  3TDK A;  1JMB A;  1FZA A;  4WY4 C;  3GHG A;  3RL0 g;  1NH4 A;  1LTA C;  3M91 A;  3AED C;  4WWI A;  1OIP A;  3TGU E;  1L0N J;  3G4S P;  1N7S A;  3HE5 B;  3USS A;  1MV8 A;  1J1E B;  3H1I J;  2Y0E A;  4KJM A;  1RQV A;  1MUU A;  3GLM A;  4IL6 H;  3SFE C;  1JEK A;  2E75 C;  4OVN F;  1PGO A;  2Z5H A;  1MFZ A;  3IFM A;  2GM4 A;  4YXW H;  3HD7 D;  2N1T B;  5B5E E;  3GMA A;  1ZLL A;  2L5G B;  2BCC G;  3VP9 A;  2QA4 P;  2RN0 A;  5GTH H;  1CI6 B;  1ZW0 A;  3H1J E;  1VQ5 P;  4IFM A;  4NPE A;  5KTB A;  5APX A;  1JY2 P;  4H13 D;  2KNC B;  2QJK C;  4HJG H;  4GKG A;  1KB9 I;  1L0N K;  2M3E A;  1FZF A;  2Y0C A;  3RBX A;  3Q3D A;  1RE3 C;  1GW4 A;  1IFN A;  1GTW A;  1VQL P;  3W67 A;  2K37 A;  4JYC A;  5C39 A;  3CCS P;  3H32 A;  1KYO E;  2D2C B;  2W6J H;  1LTI C;  3FWN A;  3PH0 A;  2FBW C;  2IYP A;  3UIA A;  1S5L H;  3FXE A;  1M56 D;  5CJ0 A;  1SQB G;  1XTC C;  3H1K E;  5KJ7 A;  2M0B A;  2N1T D;  1ZME C;  1SQV J;  3CWB J;  2KK7 A;  1AFO A;  4UB6 E;  5AW4 B;  3U1C A;  1LP1 B;  4U7J A;  1LTB C;  1SQQ D;  4YTP C;  4GT1 A;  2NRG A;  3BRT B;  1VQ6 P;  1QLE D;  2AXC A;  1L0L D;  4XE5 B;  1L2P A;  1JCC A;  2A06 D;  3H1L E;  2R32 A;  4ZKU A;  1AVY A;  1JMM A;  2XNX A;  3L70 E;  1PZQ A;  2YXR B;  1FZC B;  4ZKP A;  4Y28 J;  3W68 A;  1KB9 D;  3MHV A;  2FKW B;  1YBK A;  3ZDM A;  5CCG D;  3CCV P;  1U57 A;  4H0L C;  4PD4 I;  1LGH B;  1URQ B;  3AE1 C;  2D2C D;  2FYU G;  2PAJ A;  1SQV K;  1SFC C;  2CPS A;  2I8D A;  1HGZ A;  2A45 H;  1FZB A;  4C46 A;  3AE3 C;  3CCM P;  3JC2 2;  1NJI Q;  1X79 B;  5CJ4 A;  1X22 A;  1SQQ G;  1PP9 J;  2G3A A;  4N78 D;  2QM8 A;  5K5G B;  4I1L A;  1L0L G;  2M5A B;  4BRY A;  1IK9 A;  5AVQ B;  4WY4 B;  1JTH B;  2OYH A;  4LC1 A;  3O6Q A;  2A06 G;  3OAK A;  2YIU C;  1KIL C;  2LXC B;  3ITK A;  3BCC J;  2WZ7 A;  5APW A;  5CMZ A;  3CME P;  1M1J A;  2OYI A;  2ZAE B;  5KLV D;  1ZV8 A;  2P58 A;  5AW1 B;  2WWW A;  1DEB A;  3TGU J;  2YXQ B;  5L8R J;  1DD4 A;  2W8Z A;  5AW3 B;  1KQL A;  1FE6 A;  3KXD A;  2E75 B;  3L36 A;  5B5E H;  3BCC D;  5AVS B;  4OGQ B;  1URQ D;  2W6A A;  4LGD E;  3U59 A;  3M0D A;  3TGU D;  1VQP P;  3WUT A;  2OYH C;  3G6E P;  4LLH A;  5TJH A;  1LNQ A;  3V2P A;  1M7L A;  1ZOY C;  3P7K A;  3H1J J;  1BCC E;  1WMK A;  2N9B A;  1SQX K;  3CI9 A;  3CXH I;  1LTT C;  2Y9Z A;  3EFG A;  1HWT C;  2IZ0 A;  4WY4 D;  2E5T A;  5KLV G;  3P32 A;  3H1J D;  3L72 E;  5H2F E;  3CX5 E;  1BE3 E;  1KYO H;  2E5Y A;  1XTG B;  3KZI E;  3CCL P;  4HH2 A;  3ABV C;  1SQP K;  1YJN P;  1VQ9 P;  1BGY J;  2Q7C A;  2XDJ A;  2R5B A;  4EI2 A;  1DX7 A;  1NTZ K;  1QEX A;  5BVZ A;  1YTZ I;  1NO4 A;  1K73 Q;  2V7Q J;  2E75 D;  1GK4 A;  2SPZ A;  3TGU G;  4IL6 E;  3CCQ P;  3O8Z A;  1EXJ A;  4OGQ D;  4UB6 H;  3M9B A;  5APS A;  1FJK A;  1JY3 P;  1LTS C;  4R4L A;  5CCH A;  1KYO D;  1QL2 A;  2R3C A;  4U3F E;  1FOS E;  1OW8 A;  2IDB A;  2XZR A;  1YYC A;  3C9I A;  4I6M C;  3CCR P;  2W27 A;  1ZRT E;  2O01 N;  2AXT E; 
#chains in the Genus database with same CATH homology
 2KIK A;  4ASW A;  2QRX A;  2KS1 B;  4GOF A;  2KZI A;  2OTK E;  3MHV A;  1BDC A;  3MZW B;  4NPF X;  3ZDM A;  1S3J A;  1U7J A;  4HJG H;  2RKL A;  1DEE G;  2LXB A;  1OVR A;  1OVU A;  1OVV A;  2HR3 A;  2I8D A;  3FXD A;  1EDI A;  4ZNC A;  4HB1 A;  1EDK A;  5C39 A;  1EC5 A;  1NVO A;  4GOD A;  4HKZ H;  4ZMD A;  1H0T B;  4K35 A;  1JMB A;  3PH0 A;  1ZXG A;  2B87 B;  4MN4 C;  3FXE A;  5CBN A;  1H0T A;  2KZJ A;  1JM0 A;  3S1K A;  4WWI A;  2B87 A;  1Y47 A;  4K3A A;  5K5G B;  1SS1 A;  2M0B A;  3RGU A;  2M5A B;  2R44 A;  4KJM A;  2JWD A;  1Q2N A;  1EDL A;  1LT1 A;  4IOI H;  2M5A A;  2LXC B;  4BXL A;  5EFW B;  1U7M A;  1LP1 B;  2SPZ A;  1EDJ A;  2KI7 B;  2ZAE B;  4GOE A;  1X0T A;  3QWO C;  2QVA A;  4NPD A;  1FC2 C;  2P58 A;  2K3R A;  1LP1 A;  4ASV A;  5DJT B;  5DJU B;  1BDD A;  4EYY Q;  2LR2 A;  1MFT A;  2WMM A;  5CBO A;  1ZW0 A;  2UWJ E;  4NPE A;  2KUB A;  2Q1K A;  4CPG A;  2B88 A;  2B89 A;  4JBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...