2M0BA

Homodimeric transmembrane domain of the human receptor tyrosine kinase erbb1 (egfr, her1) in micelles
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
44
structure length
44
Chain Sequence
b'EGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFMRRRHIVRKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Left-handed homodimeric transmembrane domain of the human receptor tyrosine kinase ErbB1 (EGFR, HER1)
rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 12
structure length 44
sequence length 44
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2m0bA00
4K3AA 4NPFX 2WMMA 3MZWB 4ZNCA 1EDJA 2K3RA 2R44A 1BDDA 3ZDMA 3FXDA 2QRXA 2LXCB 2M5AA 1EDLA 2KI7B 4HKZH 4HJGH 2UWJE 1ZXGA 5K5GB 5CBNA 1S3JA 1H0TB 4HB1A 4WWIA 1EDIA 1EC5A 2KZJA 4GODA 2B87B 4KJMA 3PH0A 5DJUB 3RGUA 2HR3A 1H0TA 4K35A 4BXLA 1BDCA 1SS1A 4MN4C 2B88A 1OVUA 2LXBA 3QWOC 4EYYQ 2P58A 1NVOA 2LR2A 5EFWB 1EDKA 2SPZA 3MHVA 2JWDA 1OVRA 4ASWA 4NPDA 1LP1B 1MFTA 1JMBA 4GOEA 2B87A 2RKLA 1ZW0A 3S1KA 4CPGA 4ASVA 1OVVA 2KIKA 1LP1A 2ZAEB 2QVAA 4GOFA 2OTKE 2KZIA 5DJTB 5CBOA 4NPEA 1U7JA 1FC2C 4ZMDA 4JBZA 1LT1A 2B89A 2I8DA 2M0BA 1Q2NA 4IOIH 5C39A 3FXEA 2KUBA 1X0TA 1JM0A 1DEEG 2KS1B 2M5AB 1U7MA 1Y47A 2Q1KA
chains in the Genus database with same CATH superfamily
1SFCA 2WMMA 4W7ZA 2W6JH 3H1LE 3UIAA 2QRXA 2FFDA 2KS1A 3CCVP 1JEKA 4I7ZB 4U3FG 1NU1G 3KHUA 4PV1C 1FJPA 2O1KA 4N6JA 4PV1D 3CX5D 2Q3EA 1KFMA 5AVZB 3BCCJ 3CWBJ 1RF1A 2LR2A 2Q5UA 2ITAA 2IFNA 1DX7A 1SQXE 1KB9D 1PFIA 2Y0CA 1QGKB 4PJ0H 2NRGA 4DJGA 4GOEA 2YKOA 2B87A 3H1HE 1OX3A 2AEFA 3CCRP 4PD4D 1LTTC 2W90A 5CBOA 4AYCA 3RK3B 4NPEA 5APTA 3HD7A 2B89A 1NKZB 3Q3DA 3L72D 1PP9J 5GTIE 2KYVA 1ZRTE 3NFQA 1OXZA 4EIJA 1YTZT 1DEEG 1PPJE 3SWFA 3O6QB 1R5LA 1KQSO 1SQBD 1BCCD 1E5WA 2O01N 1N86A 2M5AA 4JF7A 5GTIH 1WRGA 3E7KA 3E1RA 3T97B 1G1JA 1YJWP 2PRRA 1VQ9P 1GK4A 2OYHB 1M1JC 2RMZA 5BVZA 1OW7A 5KTBA 1EXIA 5KLVD 2Z4EA 4O9BA 1BE3E 3AE8C 3F5HA 2H88C 3L72J 4QMAA 4D6TG 1SQXD 4NPDA 1BGYG 1DD4A 3CC2P 1KORA 2ZFCA 3Q1MA 4XE5B 3CPWO 2E5TA 1FZCC 3JC22 1OVVA 3H1HD 2P7JA 1SQBJ 1BCCJ 1VQ4P 1SFCC 3FWNA 5AVQB 3HTKA 3AEAC 2A06G 3JCUH 1VPCA 1SFCD 4IOIH 2QM7A 3H1JE 3KZIE 2KSJA 3V2RA 2KUBA 3B5NB 1ZRTD 3NMDA 3MGNA 5BU5A 1X9VA 2ZYAA 1VQ6P 5AVRB 2QM8A 1IFNA 1PPJD 1AFOA 3CCJP 3HRNA 5KLVJ 1EZVD 3KZIH 1A02J 3CXHI 1DD3A 1YQ3C 1S5LX 2JO1A 2OYOA 1NTZG 2RN0A 3O8ZA 2WSSH 3H1HJ 4OGQB 5CCHC 5KKZC 2W6BA 2AXCA 2OYIC 3GG2A 2E76C 1QVGO 3FGAD 5CCHD 2FYUJ 2E76D 1R8EA 3L75D 3H1LG 3SSUA 3GHGA 3HD7C 1NAYA 3SWYA 4JPZB 4RO0A 1CSBA 2K1AA 3PJSK 2VRSA 2P67A 1LJ2A 1ZW0A 3HD7D 2KIKA 1JY3N 1VQ8P 1FU1A 3MUDA 3EWKA 1YITP 1NHLA 1PIXA 2CPBA 5AW8B 2E42A 2E75C 2AXTE 5CJ4A 2I8DA 1URQA 1SQBK 2E75D 3H1JD 1QLED 3NTNA 3AEEC 2ZYGA 4H44B 2N9BA 1LT9C 4K3AA 2OARA 4NPFX 2KNCB 2WWWA 1RE3A 3NXSA 1MV8A 2YO3A 1ZN5A 2J59M 3L71E 2BCCD 3O6QA 2W83C 1JY2N 1HH0A 3L75J 2QJKC 4WWIA 3TSIA 1N73C 5APVA 1AJYA 3P8MC 5KLVK 3S9OA 2IPPA 2QJYC 5DJUB 2NZ2A 3R2PA 4EOTA 1VF5B 3IR9A 2B88A 2H43A 2QG4A 2HLOA 3U1AA 2OYHA 1NKNA 3L73D 1PGPA 1FAVA 1T3UA 3H1JJ 1M7LA 1J2JB 1JMBA 2PFXA 1KMIZ 2WVRA 4OVNF 3WU2E 2FYUK 3PP5A 4UB6E 2Z5HA 2OTKE 3IFMA 1W5CE 1S9KD 3V6IA 3VMXA 1VQNP 2BCCJ 3GF7A 3PRJA 4GDOA 2N1TB 5B5EE 1LTIC 5AVTB 1QEXA 3USSA 3BCCE 1X0TA 1BE3G 3G4SP 3W67A 5AW6B 4UB6H 3SWKA 3CMEP 4I7ZC 2R44A 3B5NA 2FKWB 4Z1MH 1OWAA 3C8VA 5AVXB 5B5EH 1J1EC 1VL2A 3L73J 5K5GB 5KLIC 2IX7C 2R3SA 3W68A 2IZ1A 2KLVA 1OFCX 3E1IA 2ZT9B 3KYQA 3GHGC 1HVVA 1SS1A 3CCEP 2ZJSE 1QL2A 1SQQG 1L4AB 2M3BA 3H1IJ 1PP9E 5AVVB 3K5BA 3VP9A 1S5LE 1KFNA 3G71P 1ZR4A 3CX5E 3P8CE 2WPSA 4AUWA 1LWUB 1QX8A 1URQC 5APYA 3RK2C 2IYPA 4ASVA 5AW9B 3RK3C 1XTGB 1URQD 4AQRD 3RK2D 1QVFO 1S5LH 1NYHA 4ZKPA 1N7SB 3MP7B 3RK3D 3D6YA 2ZYDA 2YO2A 2QJPC 1Q2NA 5C39A 5L8RJ 4PD4E 1NTKG 2FYNB 1MUUA 3I5CA 2J5UA 1Y9BA 1EDJA 3ZDMA 3FXDA 3L72E 4I6MC 3MTUE 1RF0C 2C0WA 1FDIA 1S3JA 3CX5I 4L75A 2K9YA 2OYHC 2OGUA 5AW4B 3OW2O 4GODA 4PD4H 1AVYA 3L74E 2PP6A 3HE4B 3MIWA 1NTMG 1SQBE 1BCCE 2FXOA 3P32A 3Q5RA 2XNXA 1ZP0C 2A45I 3H1KG 2CPSA 1JB0J 1KB9I 1HBWA 2IBZE 1PP9D 2SPZA 3P8CD 1QL1A 3L71G 1KILB 4PJ0E 3KQGA 2ZXEB 1HJ0A 2R3CA 4PD4I 1L2PA 2HPCA 3RL0g 2JR8A 5KLVE 1JOCA 1IK7A 1SQPG 4OWFA 1JNMA 1FDOA 1W2BO 4JBZA 3B5NC 1G2CB 1CW5A 3A7OA 3M9QA 2P2UA 3OAKA 1L0NG 3VMAA 3B5ND 5AW3B 4H13C 1OMIA 3M0AA 3RL0B 3BRTB 1Y47A 1NU1K 2N1TA 4H13D 3AE7C 3GMAA 3D71A 2XZRA 3GW6A 2FYUE 2LXCB 2K88A 2I1JA 2Y0EA 4Y99B 5AW7B 4WY4C 1LTBC 3EFGA 3L74D 4WY4D 1RE4A 4HH2A 2ZXXA 1LTJB 2H89C 3ABVC 1USEA 1EZVE 2P58A 3BCCG 2D2CB 3CWBG 1IFMA 5EFWB 3OA7A 1HGVA 1GW4A 2IBZD 5AVYB 2JWAA 2E43A 4GT1A 1L4AA 2NPSB 5BU8B 3IAOA 2Q9IA 2CK3H 1E79H 2H7HA 1JTHB 1SQVD 3Q5SA 1AV1A 2YNYA 5APSA 3FX0A 1LWUA 3QH9A 3L36A 3TYYA 2POHA 3L75E 4UB8E 1LT1A 1KQGB 3CCQP 2E5YA 3JCUE 3F89A 1GL2B 5CCGA 3TNUA 1N7SA 3L74J 2YMYA 1IFJA 4DCKA 1FOSE 2M3EA 1IJDB 4YXDC 4PV1B 1EZVI 4UB8H 1ZR2A 1M90Q 2FFDC 2FYUD 3TK1A 2I1KA 2Q3IA 2OQQA 2A45G 4WB4A 2JJLA 3LIEA 3PH0A 3VMYA 1DEBA 5M1BA 1NJIQ 2XDJA 2HR3A 1SQVJ 3HUSA 2BCCE 1RF1C 3HE4A 1J1DC 1PZQA 5B66E 2YKQA 1OVRA 5AW1B 4XA4A 1K04A 3L72G 3BASA 2IYOA 1RHZB 3JSVC 4H0LB 1NOHA 3WMM0 3VMZA 1P84H 3H32B 1W2EA 4I2LC 3L73E 5B66H 1KILA 2WT7B 1MFZA 1SQBG 1BCCG 3U59A 2FXMA 2C0XA 1Q82Q 1FOSF 1YYCA 1JO5A 3C9IA 3V5BA 2M0BA 4EDFA 3G6EP 1FJKA 3PLNA 2C9LY 2R5BA 3BVHA 2MJZA 1G2CA 3L70E 1NAFA 1S9KE 2IZ0A 3B4SA 1Y8AA 1RE4C 3H1IE 2YKPA 4ZNCA 1H8AA 3AEGC 2K3RA 3Q5PA 1YTZI 1RY3A 1YIJP 3PTZA 1S4XA 5KLVG 5KAIE 4HB1A 1ZV8A 4N78D 1SQXG 4KJMA 1OIPA 4EI2A 2E74B 2W8ZA 3CCLP 1EQ7A 2KSEA 4BXLA 4R4MA 2C9NY 1HWTC 1GK6A 3H1HG 1X22A 1PGOA 5KAIH 1HGZA 3CD6P 3TGUD 1P84D 4L76A 3TF5A 1NU1E 1LTJA 3C1LA 1FZCB 2BEQD 1SQVK 4U7JA 2P10A 1Z56A 2JWDA 4ASWA 1L0LD 4YXWH 3T97A 2FY8A 1LGHB 5CCGC 1K73Q 5CJ0A 4C7RA 1K05A 1KQLA 2HFED 2NPSA 4GOFA 3GF3A 1PPJG 2Y0DA 2RH0A 5CCGD 1VQ5P 2KZIA 2J58A 1JUNA 4ZMDA 1JTHA 1EZVG 1VQOP 3AE2C 3V4WA 2B9BA 2O1JA 5E79H 2Q1KA 1XTCC 3RK3E 1YBKA 3L70D 1GL2A 3KPEA 1BSHA 1FE6A 3TGUJ 3H1ID 2XNDH 4BRYB 1VQKP 4TT3H 2XKMA 4A7PA 3HUSC 1AA0A 1SQQJ 3OJAB 1L0LJ 1JCCA 2B87B 2G8YA 4IL6X 3L75G 5KKZB 2OYIB 1N8RQ 2E76B 4LGDE 2H8PD 3B71A 1ZMEC 1AQ5A 2FBWC 3IF4A 2P1JA 4EYYQ 4IFMA 4M3LA 4JQ0D 4U3FD 1NU1D 1KYOD 1WMKA 1FZAA 1K9MQ 1PGQA 2WZ7A 3II6A 1YQ4C 5CHXA 2KK7A 2LKMA 3AEDC 3H1JG 5AVUB 1YJ9P 2WPRA 1KTMA 3S1KA 2E75B 1SP4A 2W6AA 3L70J 1GU5A 1R5SA 1M8OB 2V7QJ 1IFPA 2YMKA 1AQTA 3MUDC 3AE4C 3U1CA 2IFMA 3H32A 4IFFA 1VQLP 1LT9B 4C7NB 2Y9YA 2BCCG 1KD1Q 2WQYC 5H2FE 2WT7A 2JDIH 2Q7CA 3AE5C 1JM0A 2O01J 3VP8A 1GW3A 2K37A 3A2AA 1N73B 3CC7P 1NO4A 4RJTA 1RE3C 1WT6A 2K9JB 3H1KJ 2A06E 1AVOA 2KI7B 1NU1J 4U3FJ 1MKMA 4HJGH 1M1KQ 1ZXGA 2QJYB 5H2FH 2ZVNB 3CMAP 3A0BH 3L73G 3V2PA 1LTJC 1T8ZA 5KAFE 1YI2P 1SQQK 2D2CC 2N9YB 3RGUA 2OTJP 1FZGA 1NGMB 1L0LK 4DZOA 1OVUA 2LXBA 2D2CD 4DOJA 3GLMA 2Z5IA 2KNCA 1FZEA 5KAFH 2GUVA 2GUSA 3CL3D 1FZFA 3VTPC 1FZCA 1OW6A 2RKLA 1IFDA 1G1IA 1JY3O 1IZNB 1DH3A 1X8YA 5DJTB 1GL2C 4WVZA 1GTWA 1NTKK 4D6TD 1BGYD 3FXEA 1GL2D 2V4HA 1PL5A 4W80A 1SQVE 1SVFA 2JKVA 1J1EB 5KLIB 1EDLA 4HKZH 2XV5A 1NTMK 2UWJE 2A06D 1FS0E 3V2QA 3SFEC 3GHGB 1H0TB 3D70A 1JY2O 1X79B 3I56P 3CCUP 3AECC 4BRYA 3G9RA 1LTAC 3D6ZA 1M56D 3CLQA 4ZKUA 4K35A 2HG5D 3L37A 1BDCA 4MN4C 2ZVOB 3L35A 2IBZI 3AEBC 5CCHA 1KN7A 5AW0B 2OYIA 3WUTA 1URQB 3I55P 4H0LC 3RK2B 4D6TJ 1BGYJ 4OGQC 1T6AA 4IL6E 3RBZA 3A5TA 1NTZD 2YXRB 1S2EA 1UIIA 4H0LD 5GTHE 4OGQD 2AEJA 5TISE 1SQPK 2QE7H 5AVWB 4CPGA 2WITA 2QJPB 3A0HE 1FZBA 1L0NK 1YHQP 4IL6H 3B8EB 1U7JA 2YIUB 2WSEH 5GTHH 5APWA 3H1LD 5TISH 1A02F 3PHLA 1BSNA 3VYIA 3A0HH 1LT9A 3FWLA 1RH5B 5AW2B 1U7MA 4C7NA 2BASA 2JP3A 3Q2YA 3AE3C 1HJBA 2L5GB 4H44C 3AE1C 2BEZF 1PP9G 1NTZJ 2E74C 2WPVB 1N73A 1EC5A 4H44D 1LTGC 2K9JA 3SFDC 3M0DA 2HYNA 2R5DA 3CXHE 2FYZA 2E74D 1Q7YQ 4YTPC 5TJHA 1CZQA 2Q6QA 1SLQA 2KOGA 2O3JA 4N78E 2G3AA 3CXHH 3H1LJ 1NH4A 1VF5C 1LNQA 5KJ7A 1LP1B 4IFDK 1VF5D 3TGUE 1P84E 5AW5B 3G3ZA 1SQQE 1N7LA 3AEFC 2QVAA 3AE9C 4OH8B 1VQMP 1H88A 4H13B 3CCSP 1L0LE 1FC2C 3V4QA 1GZLA 3HE5B 5APUA 2GA1A 3N4XA 3VN0A 1FBMA 1TU3F 1SQXJ 1ZOYC 1KZUB 3L74G 1FDMA 3MD0A 2KP8A 4LLHA 4WY4B 1GD2E 2N1TC 1JY3P 1JMMA 2WTYA 2M8RA 1M57D 2QEXP 2N1TD 4YPCA 5CBNA 2IBZG 5APQA 2WSFH 2KXPB 3L4FA 2PAJA 1BE3D 2WSEJ 3WUUA 1NTKE 2YXQB 4BWNA 3CXHD 3R4YA 1GU4A 1HUCA 2FXPA 1P84I 1H0TA 1N2DC 1NTZK 1CI6B 1Q90D 1UIXA 1SQVG 2HODB 1M1JB 2ZT9C 3CCMP 4XFJA 1JY2P 1KQFB 2V7QH 2QA4P 2KLUA 4GIFA 1NTME 2ZT9D 3BATA 1L4AC 2AEMA 1IK9A 2QSIA 3H1KE 1USDA 3M9BA 1L4AD 4U3FE 2ZAEB 1HF9A 3LW5H 1KYOE 1LWUC 1SQQD 2WSCH 4W7YA 2O01H 2AXTH 1KILE 2FYUG 1SFCB 1BE3J 1S72P 5AVSB 1N7SC 1IFIA 2FFDB 2KS1B 3EFFK 1KYOH 3M0DC 2XU6A 5E79E 1N7SD 3MZWB 1SQPE 2R32A 1HTLC 4LC1A 1SQXK 4C46A 4JYCA 1T3JA 4Y28J 1ZLLA 1RF0A 3N7NA 2GM4A 1L0NE 2FYNC 4B86A 4DT0A 3IN6A 4RESB 4R4LA 1RF1B 4TLFA 2HPCB 1J1DB 4HYTB 3V2NA 1NTKD 1YJNP 5KJ7C 2PGDA 1RQVA 3QWOC 3TDKA 5KJ7D 1KYOI 1PGJA 2MKVA 1EDKA 3M9HA 3WUVA 3ITKA 3BRVB 2JEEA 1NTMD 1RQUA 1OZHA 1KV4A 2WSFJ 3WU2H 3LIDA 3HD7B 2KB7P 3CWBE 1LP1A 3H1KD 1GDTA 1KILC 2OTLP 3S4RA 2DW3A 1T2KC 3KXDA 4JYBA 3M06A 5APXA 1KILD 3L71D 1LTSC 1IO4A 1T2KD 1NTKJ 3HE5A 2M5AB 4I1LA 1U57A 4KT0J 4D6TE 1SQPD 1BGYE 4KHXA 1BDDA 3CC4P 2Y9ZA 1JCDA 4L74A 3TGUG 1VQPP 3A3YB 3RL0C 3LW5J 4WY4A 2WSCJ 5CMZA 1L0ND 3A0BE 1EDIA 2KZJA 3RL0D 1NTMJ 2W27A 1L0LG 1VQ7P 4Y99C 2QJKB 3KDPB 1K8AQ 4L73A 1PV3A 1NVOA 1VDFA 2QIWA 4GKGA 1H89A 2IDBA 1KB9E 3TNUB 3CX5H 3MHVA 3RBXA 1Q86Q 1CI6A 1IC2A 3L71J 2HODA 4WBAA 1MFTA 3CI9A 3P7KA 4N3YB 3M91A 4RKUJ 1S1CX 1M1JA 1KC8Q 2L91A 3HTKB 1OW8A 3BCCD 3VOPA 2YIUC 1NWQA 1SQPJ 2A45H 3CWBD 1GMJA 3L70G 1KB9H 2NPSC 3H1IG 1NTZE 1EXJA 1D7MA 3H6PA 2WPQA 2NPSD 1L0NJ 1Q81Q 1MZ9A 3EQ2A 3H25A 3HUSB 3AE6C 1DIPA
chains in the Genus database with same CATH topology
4K3AA 4NPFX 2WMMA 3MZWB 4ZNCA 1EDJA 2K3RA 2R44A 1BDDA 3ZDMA 3FXDA 2QRXA 2LXCB 2M5AA 1EDLA 2KI7B 4HKZH 4HJGH 2UWJE 1ZXGA 5K5GB 5CBNA 1S3JA 1H0TB 4HB1A 4WWIA 1EDIA 1EC5A 2KZJA 4GODA 2B87B 4KJMA 3PH0A 5DJUB 3RGUA 2HR3A 1H0TA 4K35A 4BXLA 1BDCA 1SS1A 4MN4C 2B88A 1OVUA 2LXBA 3QWOC 4EYYQ 2P58A 1NVOA 2LR2A 5EFWB 1EDKA 2SPZA 3MHVA 2JWDA 1OVRA 4ASWA 4NPDA 1LP1B 1MFTA 1JMBA 4GOEA 2B87A 2RKLA 1ZW0A 3S1KA 4CPGA 4ASVA 1OVVA 2KIKA 1LP1A 2ZAEB 2QVAA 4GOFA 2OTKE 2KZIA 5DJTB 5CBOA 4NPEA 1U7JA 1FC2C 4ZMDA 4JBZA 1LT1A 2B89A 2I8DA 2M0BA 1Q2NA 4IOIH 5C39A 3FXEA 2KUBA 1X0TA 1JM0A 1DEEG 2KS1B 2M5AB 1U7MA 1Y47A 2Q1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K3A A;  4NPF X;  2WMM A;  3MZW B;  4ZNC A;  1EDJ A;  2K3R A;  2R44 A;  1BDD A;  3ZDM A;  3FXD A;  2QRX A;  2LXC B;  2M5A A;  1EDL A;  2KI7 B;  4HKZ H;  4HJG H;  2UWJ E;  1ZXG A;  5K5G B;  5CBN A;  1S3J A;  1H0T B;  4HB1 A;  4WWI A;  1EDI A;  1EC5 A;  2KZJ A;  4GOD A;  2B87 B;  4KJM A;  3PH0 A;  5DJU B;  3RGU A;  2HR3 A;  1H0T A;  4K35 A;  4BXL A;  1BDC A;  1SS1 A;  4MN4 C;  2B88 A;  1OVU A;  2LXB A;  3QWO C;  4EYY Q;  2P58 A;  1NVO A;  2LR2 A;  5EFW B;  1EDK A;  2SPZ A;  3MHV A;  2JWD A;  1OVR A;  4ASW A;  4NPD A;  1LP1 B;  1MFT A;  1JMB A;  4GOE A;  2B87 A;  2RKL A;  1ZW0 A;  3S1K A;  4CPG A;  4ASV A;  1OVV A;  2KIK A;  1LP1 A;  2ZAE B;  2QVA A;  4GOF A;  2OTK E;  2KZI A;  5DJT B;  5CBO A;  4NPE A;  1U7J A;  1FC2 C;  4ZMD A;  4JBZ A;  1LT1 A;  2B89 A;  2I8D A;  2M0B A;  1Q2N A;  4IOI H;  5C39 A;  3FXE A;  2KUB A;  1X0T A;  1JM0 A;  1DEE G;  2KS1 B;  2M5A B;  1U7M A;  1Y47 A;  2Q1K A; 
#chains in the Genus database with same CATH topology
 1SFC A;  2WMM A;  4W7Z A;  2W6J H;  3H1L E;  3UIA A;  2QRX A;  2FFD A;  2KS1 A;  3CCV P;  1JEK A;  4I7Z B;  4U3F G;  1NU1 G;  3KHU A;  4PV1 C;  1FJP A;  2O1K A;  4N6J A;  4PV1 D;  3CX5 D;  2Q3E A;  1KFM A;  5AVZ B;  3BCC J;  3CWB J;  1RF1 A;  2LR2 A;  2Q5U A;  2ITA A;  2IFN A;  1DX7 A;  1SQX E;  1KB9 D;  1PFI A;  2Y0C A;  1QGK B;  4PJ0 H;  2NRG A;  4DJG A;  4GOE A;  2YKO A;  2B87 A;  3H1H E;  1OX3 A;  2AEF A;  3CCR P;  4PD4 D;  1LTT C;  2W90 A;  5CBO A;  4AYC A;  3RK3 B;  4NPE A;  5APT A;  3HD7 A;  2B89 A;  1NKZ B;  3Q3D A;  3L72 D;  1PP9 J;  5GTI E;  2KYV A;  1ZRT E;  3NFQ A;  1OXZ A;  4EIJ A;  1YTZ T;  1DEE G;  1PPJ E;  3SWF A;  3O6Q B;  1R5L A;  1KQS O;  1SQB D;  1BCC D;  1E5W A;  2O01 N;  1N86 A;  2M5A A;  4JF7 A;  5GTI H;  1WRG A;  3E7K A;  3E1R A;  3T97 B;  1G1J A;  1YJW P;  2PRR A;  1VQ9 P;  1GK4 A;  2OYH B;  1M1J C;  2RMZ A;  5BVZ A;  1OW7 A;  5KTB A;  1EXI A;  5KLV D;  2Z4E A;  4O9B A;  1BE3 E;  3AE8 C;  3F5H A;  2H88 C;  3L72 J;  4QMA A;  4D6T G;  1SQX D;  4NPD A;  1BGY G;  1DD4 A;  3CC2 P;  1KOR A;  2ZFC A;  3Q1M A;  4XE5 B;  3CPW O;  2E5T A;  1FZC C;  3JC2 2;  1OVV A;  3H1H D;  2P7J A;  1SQB J;  1BCC J;  1VQ4 P;  1SFC C;  3FWN A;  5AVQ B;  3HTK A;  3AEA C;  2A06 G;  3JCU H;  1VPC A;  1SFC D;  4IOI H;  2QM7 A;  3H1J E;  3KZI E;  2KSJ A;  3V2R A;  2KUB A;  3B5N B;  1ZRT D;  3NMD A;  3MGN A;  5BU5 A;  1X9V A;  2ZYA A;  1VQ6 P;  5AVR B;  2QM8 A;  1IFN A;  1PPJ D;  1AFO A;  3CCJ P;  3HRN A;  5KLV J;  1EZV D;  3KZI H;  1A02 J;  3CXH I;  1DD3 A;  1YQ3 C;  1S5L X;  2JO1 A;  2OYO A;  1NTZ G;  2RN0 A;  3O8Z A;  2WSS H;  3H1H J;  4OGQ B;  5CCH C;  5KKZ C;  2W6B A;  2AXC A;  2OYI C;  3GG2 A;  2E76 C;  1QVG O;  3FGA D;  5CCH D;  2FYU J;  2E76 D;  1R8E A;  3L75 D;  3H1L G;  3SSU A;  3GHG A;  3HD7 C;  1NAY A;  3SWY A;  4JPZ B;  4RO0 A;  1CSB A;  2K1A A;  3PJS K;  2VRS A;  2P67 A;  1LJ2 A;  1ZW0 A;  3HD7 D;  2KIK A;  1JY3 N;  1VQ8 P;  1FU1 A;  3MUD A;  3EWK A;  1YIT P;  1NHL A;  1PIX A;  2CPB A;  5AW8 B;  2E42 A;  2E75 C;  2AXT E;  5CJ4 A;  2I8D A;  1URQ A;  1SQB K;  2E75 D;  3H1J D;  1QLE D;  3NTN A;  3AEE C;  2ZYG A;  4H44 B;  2N9B A;  1LT9 C;  4K3A A;  2OAR A;  4NPF X;  2KNC B;  2WWW A;  1RE3 A;  3NXS A;  1MV8 A;  2YO3 A;  1ZN5 A;  2J59 M;  3L71 E;  2BCC D;  3O6Q A;  2W83 C;  1JY2 N;  1HH0 A;  3L75 J;  2QJK C;  4WWI A;  3TSI A;  1N73 C;  5APV A;  1AJY A;  3P8M C;  5KLV K;  3S9O A;  2IPP A;  2QJY C;  5DJU B;  2NZ2 A;  3R2P A;  4EOT A;  1VF5 B;  3IR9 A;  2B88 A;  2H43 A;  2QG4 A;  2HLO A;  3U1A A;  2OYH A;  1NKN A;  3L73 D;  1PGP A;  1FAV A;  1T3U A;  3H1J J;  1M7L A;  1J2J B;  1JMB A;  2PFX A;  1KMI Z;  2WVR A;  4OVN F;  3WU2 E;  2FYU K;  3PP5 A;  4UB6 E;  2Z5H A;  2OTK E;  3IFM A;  1W5C E;  1S9K D;  3V6I A;  3VMX A;  1VQN P;  2BCC J;  3GF7 A;  3PRJ A;  4GDO A;  2N1T B;  5B5E E;  1LTI C;  5AVT B;  1QEX A;  3USS A;  3BCC E;  1X0T A;  1BE3 G;  3G4S P;  3W67 A;  5AW6 B;  4UB6 H;  3SWK A;  3CME P;  4I7Z C;  2R44 A;  3B5N A;  2FKW B;  4Z1M H;  1OWA A;  3C8V A;  5AVX B;  5B5E H;  1J1E C;  1VL2 A;  3L73 J;  5K5G B;  5KLI C;  2IX7 C;  2R3S A;  3W68 A;  2IZ1 A;  2KLV A;  1OFC X;  3E1I A;  2ZT9 B;  3KYQ A;  3GHG C;  1HVV A;  1SS1 A;  3CCE P;  2ZJS E;  1QL2 A;  1SQQ G;  1L4A B;  2M3B A;  3H1I J;  1PP9 E;  5AVV B;  3K5B A;  3VP9 A;  1S5L E;  1KFN A;  3G71 P;  1ZR4 A;  3CX5 E;  3P8C E;  2WPS A;  4AUW A;  1LWU B;  1QX8 A;  1URQ C;  5APY A;  3RK2 C;  2IYP A;  4ASV A;  5AW9 B;  3RK3 C;  1XTG B;  1URQ D;  4AQR D;  3RK2 D;  1QVF O;  1S5L H;  1NYH A;  4ZKP A;  1N7S B;  3MP7 B;  3RK3 D;  3D6Y A;  2ZYD A;  2YO2 A;  2QJP C;  1Q2N A;  5C39 A;  5L8R J;  4PD4 E;  1NTK G;  2FYN B;  1MUU A;  3I5C A;  2J5U A;  1Y9B A;  1EDJ A;  3ZDM A;  3FXD A;  3L72 E;  4I6M C;  3MTU E;  1RF0 C;  2C0W A;  1FDI A;  1S3J A;  3CX5 I;  4L75 A;  2K9Y A;  2OYH C;  2OGU A;  5AW4 B;  3OW2 O;  4GOD A;  4PD4 H;  1AVY A;  3L74 E;  2PP6 A;  3HE4 B;  3MIW A;  1NTM G;  1SQB E;  1BCC E;  2FXO A;  3P32 A;  3Q5R A;  2XNX A;  1ZP0 C;  2A45 I;  3H1K G;  2CPS A;  1JB0 J;  1KB9 I;  1HBW A;  2IBZ E;  1PP9 D;  2SPZ A;  3P8C D;  1QL1 A;  3L71 G;  1KIL B;  4PJ0 E;  3KQG A;  2ZXE B;  1HJ0 A;  2R3C A;  4PD4 I;  1L2P A;  2HPC A;  3RL0 g;  2JR8 A;  5KLV E;  1JOC A;  1IK7 A;  1SQP G;  4OWF A;  1JNM A;  1FDO A;  1W2B O;  4JBZ A;  3B5N C;  1G2C B;  1CW5 A;  3A7O A;  3M9Q A;  2P2U A;  3OAK A;  1L0N G;  3VMA A;  3B5N D;  5AW3 B;  4H13 C;  1OMI A;  3M0A A;  3RL0 B;  3BRT B;  1Y47 A;  1NU1 K;  2N1T A;  4H13 D;  3AE7 C;  3GMA A;  3D71 A;  2XZR A;  3GW6 A;  2FYU E;  2LXC B;  2K88 A;  2I1J A;  2Y0E A;  4Y99 B;  5AW7 B;  4WY4 C;  1LTB C;  3EFG A;  3L74 D;  4WY4 D;  1RE4 A;  4HH2 A;  2ZXX A;  1LTJ B;  2H89 C;  3ABV C;  1USE A;  1EZV E;  2P58 A;  3BCC G;  2D2C B;  3CWB G;  1IFM A;  5EFW B;  3OA7 A;  1HGV A;  1GW4 A;  2IBZ D;  5AVY B;  2JWA A;  2E43 A;  4GT1 A;  1L4A A;  2NPS B;  5BU8 B;  3IAO A;  2Q9I A;  2CK3 H;  1E79 H;  2H7H A;  1JTH B;  1SQV D;  3Q5S A;  1AV1 A;  2YNY A;  5APS A;  3FX0 A;  1LWU A;  3QH9 A;  3L36 A;  3TYY A;  2POH A;  3L75 E;  4UB8 E;  1LT1 A;  1KQG B;  3CCQ P;  2E5Y A;  3JCU E;  3F89 A;  1GL2 B;  5CCG A;  3TNU A;  1N7S A;  3L74 J;  2YMY A;  1IFJ A;  4DCK A;  1FOS E;  2M3E A;  1IJD B;  4YXD C;  4PV1 B;  1EZV I;  4UB8 H;  1ZR2 A;  1M90 Q;  2FFD C;  2FYU D;  3TK1 A;  2I1K A;  2Q3I A;  2OQQ A;  2A45 G;  4WB4 A;  2JJL A;  3LIE A;  3PH0 A;  3VMY A;  1DEB A;  5M1B A;  1NJI Q;  2XDJ A;  2HR3 A;  1SQV J;  3HUS A;  2BCC E;  1RF1 C;  3HE4 A;  1J1D C;  1PZQ A;  5B66 E;  2YKQ A;  1OVR A;  5AW1 B;  4XA4 A;  1K04 A;  3L72 G;  3BAS A;  2IYO A;  1RHZ B;  3JSV C;  4H0L B;  1NOH A;  3WMM 0;  3VMZ A;  1P84 H;  3H32 B;  1W2E A;  4I2L C;  3L73 E;  5B66 H;  1KIL A;  2WT7 B;  1MFZ A;  1SQB G;  1BCC G;  3U59 A;  2FXM A;  2C0X A;  1Q82 Q;  1FOS F;  1YYC A;  1JO5 A;  3C9I A;  3V5B A;  2M0B A;  4EDF A;  3G6E P;  1FJK A;  3PLN A;  2C9L Y;  2R5B A;  3BVH A;  2MJZ A;  1G2C A;  3L70 E;  1NAF A;  1S9K E;  2IZ0 A;  3B4S A;  1Y8A A;  1RE4 C;  3H1I E;  2YKP A;  4ZNC A;  1H8A A;  3AEG C;  2K3R A;  3Q5P A;  1YTZ I;  1RY3 A;  1YIJ P;  3PTZ A;  1S4X A;  5KLV G;  5KAI E;  4HB1 A;  1ZV8 A;  4N78 D;  1SQX G;  4KJM A;  1OIP A;  4EI2 A;  2E74 B;  2W8Z A;  3CCL P;  1EQ7 A;  2KSE A;  4BXL A;  4R4M A;  2C9N Y;  1HWT C;  1GK6 A;  3H1H G;  1X22 A;  1PGO A;  5KAI H;  1HGZ A;  3CD6 P;  3TGU D;  1P84 D;  4L76 A;  3TF5 A;  1NU1 E;  1LTJ A;  3C1L A;  1FZC B;  2BEQ D;  1SQV K;  4U7J A;  2P10 A;  1Z56 A;  2JWD A;  4ASW A;  1L0L D;  4YXW H;  3T97 A;  2FY8 A;  1LGH B;  5CCG C;  1K73 Q;  5CJ0 A;  4C7R A;  1K05 A;  1KQL A;  2HFE D;  2NPS A;  4GOF A;  3GF3 A;  1PPJ G;  2Y0D A;  2RH0 A;  5CCG D;  1VQ5 P;  2KZI A;  2J58 A;  1JUN A;  4ZMD A;  1JTH A;  1EZV G;  1VQO P;  3AE2 C;  3V4W A;  2B9B A;  2O1J A;  5E79 H;  2Q1K A;  1XTC C;  3RK3 E;  1YBK A;  3L70 D;  1GL2 A;  3KPE A;  1BSH A;  1FE6 A;  3TGU J;  3H1I D;  2XND H;  4BRY B;  1VQK P;  4TT3 H;  2XKM A;  4A7P A;  3HUS C;  1AA0 A;  1SQQ J;  3OJA B;  1L0L J;  1JCC A;  2B87 B;  2G8Y A;  4IL6 X;  3L75 G;  5KKZ B;  2OYI B;  1N8R Q;  2E76 B;  4LGD E;  2H8P D;  3B71 A;  1ZME C;  1AQ5 A;  2FBW C;  3IF4 A;  2P1J A;  4EYY Q;  4IFM A;  4M3L A;  4JQ0 D;  4U3F D;  1NU1 D;  1KYO D;  1WMK A;  1FZA A;  1K9M Q;  1PGQ A;  2WZ7 A;  3II6 A;  1YQ4 C;  5CHX A;  2KK7 A;  2LKM A;  3AED C;  3H1J G;  5AVU B;  1YJ9 P;  2WPR A;  1KTM A;  3S1K A;  2E75 B;  1SP4 A;  2W6A A;  3L70 J;  1GU5 A;  1R5S A;  1M8O B;  2V7Q J;  1IFP A;  2YMK A;  1AQT A;  3MUD C;  3AE4 C;  3U1C A;  2IFM A;  3H32 A;  4IFF A;  1VQL P;  1LT9 B;  4C7N B;  2Y9Y A;  2BCC G;  1KD1 Q;  2WQY C;  5H2F E;  2WT7 A;  2JDI H;  2Q7C A;  3AE5 C;  1JM0 A;  2O01 J;  3VP8 A;  1GW3 A;  2K37 A;  3A2A A;  1N73 B;  3CC7 P;  1NO4 A;  4RJT A;  1RE3 C;  1WT6 A;  2K9J B;  3H1K J;  2A06 E;  1AVO A;  2KI7 B;  1NU1 J;  4U3F J;  1MKM A;  4HJG H;  1M1K Q;  1ZXG A;  2QJY B;  5H2F H;  2ZVN B;  3CMA P;  3A0B H;  3L73 G;  3V2P A;  1LTJ C;  1T8Z A;  5KAF E;  1YI2 P;  1SQQ K;  2D2C C;  2N9Y B;  3RGU A;  2OTJ P;  1FZG A;  1NGM B;  1L0L K;  4DZO A;  1OVU A;  2LXB A;  2D2C D;  4DOJ A;  3GLM A;  2Z5I A;  2KNC A;  1FZE A;  5KAF H;  2GUV A;  2GUS A;  3CL3 D;  1FZF A;  3VTP C;  1FZC A;  1OW6 A;  2RKL A;  1IFD A;  1G1I A;  1JY3 O;  1IZN B;  1DH3 A;  1X8Y A;  5DJT B;  1GL2 C;  4WVZ A;  1GTW A;  1NTK K;  4D6T D;  1BGY D;  3FXE A;  1GL2 D;  2V4H A;  1PL5 A;  4W80 A;  1SQV E;  1SVF A;  2JKV A;  1J1E B;  5KLI B;  1EDL A;  4HKZ H;  2XV5 A;  1NTM K;  2UWJ E;  2A06 D;  1FS0 E;  3V2Q A;  3SFE C;  3GHG B;  1H0T B;  3D70 A;  1JY2 O;  1X79 B;  3I56 P;  3CCU P;  3AEC C;  4BRY A;  3G9R A;  1LTA C;  3D6Z A;  1M56 D;  3CLQ A;  4ZKU A;  4K35 A;  2HG5 D;  3L37 A;  1BDC A;  4MN4 C;  2ZVO B;  3L35 A;  2IBZ I;  3AEB C;  5CCH A;  1KN7 A;  5AW0 B;  2OYI A;  3WUT A;  1URQ B;  3I55 P;  4H0L C;  3RK2 B;  4D6T J;  1BGY J;  4OGQ C;  1T6A A;  4IL6 E;  3RBZ A;  3A5T A;  1NTZ D;  2YXR B;  1S2E A;  1UII A;  4H0L D;  5GTH E;  4OGQ D;  2AEJ A;  5TIS E;  1SQP K;  2QE7 H;  5AVW B;  4CPG A;  2WIT A;  2QJP B;  3A0H E;  1FZB A;  1L0N K;  1YHQ P;  4IL6 H;  3B8E B;  1U7J A;  2YIU B;  2WSE H;  5GTH H;  5APW A;  3H1L D;  5TIS H;  1A02 F;  3PHL A;  1BSN A;  3VYI A;  3A0H H;  1LT9 A;  3FWL A;  1RH5 B;  5AW2 B;  1U7M A;  4C7N A;  2BAS A;  2JP3 A;  3Q2Y A;  3AE3 C;  1HJB A;  2L5G B;  4H44 C;  3AE1 C;  2BEZ F;  1PP9 G;  1NTZ J;  2E74 C;  2WPV B;  1N73 A;  1EC5 A;  4H44 D;  1LTG C;  2K9J A;  3SFD C;  3M0D A;  2HYN A;  2R5D A;  3CXH E;  2FYZ A;  2E74 D;  1Q7Y Q;  4YTP C;  5TJH A;  1CZQ A;  2Q6Q A;  1SLQ A;  2KOG A;  2O3J A;  4N78 E;  2G3A A;  3CXH H;  3H1L J;  1NH4 A;  1VF5 C;  1LNQ A;  5KJ7 A;  1LP1 B;  4IFD K;  1VF5 D;  3TGU E;  1P84 E;  5AW5 B;  3G3Z A;  1SQQ E;  1N7L A;  3AEF C;  2QVA A;  3AE9 C;  4OH8 B;  1VQM P;  1H88 A;  4H13 B;  3CCS P;  1L0L E;  1FC2 C;  3V4Q A;  1GZL A;  3HE5 B;  5APU A;  2GA1 A;  3N4X A;  3VN0 A;  1FBM A;  1TU3 F;  1SQX J;  1ZOY C;  1KZU B;  3L74 G;  1FDM A;  3MD0 A;  2KP8 A;  4LLH A;  4WY4 B;  1GD2 E;  2N1T C;  1JY3 P;  1JMM A;  2WTY A;  2M8R A;  1M57 D;  2QEX P;  2N1T D;  4YPC A;  5CBN A;  2IBZ G;  5APQ A;  2WSF H;  2KXP B;  3L4F A;  2PAJ A;  1BE3 D;  2WSE J;  3WUU A;  1NTK E;  2YXQ B;  4BWN A;  3CXH D;  3R4Y A;  1GU4 A;  1HUC A;  2FXP A;  1P84 I;  1H0T A;  1N2D C;  1NTZ K;  1CI6 B;  1Q90 D;  1UIX A;  1SQV G;  2HOD B;  1M1J B;  2ZT9 C;  3CCM P;  4XFJ A;  1JY2 P;  1KQF B;  2V7Q H;  2QA4 P;  2KLU A;  4GIF A;  1NTM E;  2ZT9 D;  3BAT A;  1L4A C;  2AEM A;  1IK9 A;  2QSI A;  3H1K E;  1USD A;  3M9B A;  1L4A D;  4U3F E;  2ZAE B;  1HF9 A;  3LW5 H;  1KYO E;  1LWU C;  1SQQ D;  2WSC H;  4W7Y A;  2O01 H;  2AXT H;  1KIL E;  2FYU G;  1SFC B;  1BE3 J;  1S72 P;  5AVS B;  1N7S C;  1IFI A;  2FFD B;  2KS1 B;  3EFF K;  1KYO H;  3M0D C;  2XU6 A;  5E79 E;  1N7S D;  3MZW B;  1SQP E;  2R32 A;  1HTL C;  4LC1 A;  1SQX K;  4C46 A;  4JYC A;  1T3J A;  4Y28 J;  1ZLL A;  1RF0 A;  3N7N A;  2GM4 A;  1L0N E;  2FYN C;  4B86 A;  4DT0 A;  3IN6 A;  4RES B;  4R4L A;  1RF1 B;  4TLF A;  2HPC B;  1J1D B;  4HYT B;  3V2N A;  1NTK D;  1YJN P;  5KJ7 C;  2PGD A;  1RQV A;  3QWO C;  3TDK A;  5KJ7 D;  1KYO I;  1PGJ A;  2MKV A;  1EDK A;  3M9H A;  3WUV A;  3ITK A;  3BRV B;  2JEE A;  1NTM D;  1RQU A;  1OZH A;  1KV4 A;  2WSF J;  3WU2 H;  3LID A;  3HD7 B;  2KB7 P;  3CWB E;  1LP1 A;  3H1K D;  1GDT A;  1KIL C;  2OTL P;  3S4R A;  2DW3 A;  1T2K C;  3KXD A;  4JYB A;  3M06 A;  5APX A;  1KIL D;  3L71 D;  1LTS C;  1IO4 A;  1T2K D;  1NTK J;  3HE5 A;  2M5A B;  4I1L A;  1U57 A;  4KT0 J;  4D6T E;  1SQP D;  1BGY E;  4KHX A;  1BDD A;  3CC4 P;  2Y9Z A;  1JCD A;  4L74 A;  3TGU G;  1VQP P;  3A3Y B;  3RL0 C;  3LW5 J;  4WY4 A;  2WSC J;  5CMZ A;  1L0N D;  3A0B E;  1EDI A;  2KZJ A;  3RL0 D;  1NTM J;  2W27 A;  1L0L G;  1VQ7 P;  4Y99 C;  2QJK B;  3KDP B;  1K8A Q;  4L73 A;  1PV3 A;  1NVO A;  1VDF A;  2QIW A;  4GKG A;  1H89 A;  2IDB A;  1KB9 E;  3TNU B;  3CX5 H;  3MHV A;  3RBX A;  1Q86 Q;  1CI6 A;  1IC2 A;  3L71 J;  2HOD A;  4WBA A;  1MFT A;  3CI9 A;  3P7K A;  4N3Y B;  3M91 A;  4RKU J;  1S1C X;  1M1J A;  1KC8 Q;  2L91 A;  3HTK B;  1OW8 A;  3BCC D;  3VOP A;  2YIU C;  1NWQ A;  1SQP J;  2A45 H;  3CWB D;  1GMJ A;  3L70 G;  1KB9 H;  2NPS C;  3H1I G;  1NTZ E;  1EXJ A;  1D7M A;  3H6P A;  2WPQ A;  2NPS D;  1L0N J;  1Q81 Q;  1MZ9 A;  3EQ2 A;  3H25 A;  3HUS B;  3AE6 C;  1DIP A; 
#chains in the Genus database with same CATH homology
 4K3A A;  4NPF X;  2WMM A;  3MZW B;  4ZNC A;  1EDJ A;  2K3R A;  2R44 A;  1BDD A;  3ZDM A;  3FXD A;  2QRX A;  2LXC B;  2M5A A;  1EDL A;  2KI7 B;  4HKZ H;  4HJG H;  2UWJ E;  1ZXG A;  5K5G B;  5CBN A;  1S3J A;  1H0T B;  4HB1 A;  4WWI A;  1EDI A;  1EC5 A;  2KZJ A;  4GOD A;  2B87 B;  4KJM A;  3PH0 A;  5DJU B;  3RGU A;  2HR3 A;  1H0T A;  4K35 A;  4BXL A;  1BDC A;  1SS1 A;  4MN4 C;  2B88 A;  1OVU A;  2LXB A;  3QWO C;  4EYY Q;  2P58 A;  1NVO A;  2LR2 A;  5EFW B;  1EDK A;  2SPZ A;  3MHV A;  2JWD A;  1OVR A;  4ASW A;  4NPD A;  1LP1 B;  1MFT A;  1JMB A;  4GOE A;  2B87 A;  2RKL A;  1ZW0 A;  3S1K A;  4CPG A;  4ASV A;  1OVV A;  2KIK A;  1LP1 A;  2ZAE B;  2QVA A;  4GOF A;  2OTK E;  2KZI A;  5DJT B;  5CBO A;  4NPE A;  1U7J A;  1FC2 C;  4ZMD A;  4JBZ A;  1LT1 A;  2B89 A;  2I8D A;  2M0B A;  1Q2N A;  4IOI H;  5C39 A;  3FXE A;  2KUB A;  1X0T A;  1JM0 A;  1DEE G;  2KS1 B;  2M5A B;  1U7M A;  1Y47 A;  2Q1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...