2M0BA

Homodimeric transmembrane domain of the human receptor tyrosine kinase erbb1 (egfr, her1) in micelles
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
44
structure length
44
Chain Sequence
b'EGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFMRRRHIVRKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Left-handed homodimeric transmembrane domain of the human receptor tyrosine kinase ErbB1 (EGFR, HER1)
rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 12
structure length 44
sequence length 44
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2m0bA00
1H0TA 1U7JA 1EDKA 1OVRA 1EC5A 5DJTB 1LP1A 4GODA 1OVVA 2KI7B 5K5GB 4NPFX 2B88A 3QWOC 1Q2NA 1S3JA 5DJUB 4IOIH 3RGUA 2QVAA 2B87A 4ASVA 4CPGA 2KZJA 2K3RA 1U7MA 2Q1KA 4KJMA 1H0TB 2QRXA 1LP1B 2HR3A 2LXCB 4EYYQ 3MZWB 1DEEG 4MN4C 2M5AA 4NPDA 4ZNCA 2B89A 4ASWA 5CBNA 2B87B 4ZMDA 5CBOA 2KUBA 4HKZH 1EDIA 2RKLA 2WMMA 2P58A 1BDDA 3FXEA 2JWDA 2LR2A 2KIKA 3MHVA 1EDJA 4K35A 2UWJE 1JMBA 3S1KA 4HB1A 2R44A 2SPZA 1LT1A 4JBZA 1OVUA 1NVOA 4BXLA 4NPEA 4WWIA 1JM0A 2OTKE 4GOFA 1EDLA 2ZAEB 5C39A 1X0TA 2KS1B 4HJGH 1SS1A 2M5AB 1BDCA 1ZW0A 5EFWB 1FC2C 2LXBA 3FXDA 1MFTA 2I8DA 4GOEA 3PH0A 4K3AA 2KZIA 2M0BA 1ZXGA 1Y47A 3ZDMA
chains in the Genus database with same CATH superfamily
1U57A 5CCGA 2NPSA 1LWUB 3D70A 3L71E 1P84H 2BEZF 2KZJA 2WPRA 2H7HA 3I56P 1AA0A 1LP1B 1YHQP 2HR3A 3L73E 5KLIC 3AE1C 4O9BA 3LIEA 4W7YA 3CCRP 3D6ZA 4DT0A 1J1DC 3VTPC 2KUBA 1P84E 3CD6P 2C0XA 2QJKC 3TGUE 1SQPG 2W6AA 1Q86Q 4AYCA 1A02J 2O1JA 2YIUB 1JMMA 4K35A 1AVOA 3F5HA 2PFXA 5BU5A 2E43A 2RMZA 3KZIH 1KYOD 3N4XA 1RQUA 2C9NY 2YMKA 2J59M 2O3JA 1OW8A 1FBMA 1DD3A 4Y28J 2HYNA 3BRVB 3I5CA 2FYUJ 1IFMA 1UIXA 1BDCA 3EFFK 2IPPA 1SQQJ 1FC2C 3A0HE 3CC7P 5AVXB 3BCCG 3SFEC 2ZXEB 1YJ9P 3SWYA 1GMJA 1H0TA 5TISE 2E5YA 2KSJA 3B71A 1KN7A 4EIJA 5APXA 1FZCC 3LW5J 1L0NJ 4I6MC 1PZQA 5KAIH 2ZT9B 1SFCB 3NMDA 3TSIA 2IX7C 2Q6QA 3K5BA 1PP9E 3GHGA 1QVFO 1X9VA 5APQA 4AUWA 5KLVK 1D7MA 3H1LG 2DW3A 3KHUA 1M8OB 3U1AA 2BCCJ 1NWQA 5KAIE 2D2CD 3AE2C 1NU1G 1JUNA 4RKUJ 5AW8B 2D2CB 2KSEA 4WY4D 5AW9B 1E79H 3L71D 3V5BA 2E74D 1S9KE 3RBZA 2MKVA 1K05A 1ZRTD 4I7ZB 2E74B 3CXHH 2KNCB 1NHLA 4JQ0D 4LGDE 3RK2D 2QJYB 2W6JH 3L73D 3RK2B 5GTIH 2YNYA 3CCLP 3RK3B 2IFNA 2ZYAA 3L75D 3M9BA 2A45G 1NTMJ 1MFTA 1VDFA 1RF1C 2CPSA 2OYIA 2QJPC 3CXHE 1BGYJ 1L0NE 2J5UA 2C9LY 3PP5A 4YTPC 2QM8A 3L4FA 1J1EC 2N1TB 2O01H 1LP1A 1RE4A 1NTKE 2W83C 4U3FJ 1EZVI 1M1JC 1AJYA 2BEQD 2JWAA 4PD4H 1NAFA 4ASVA 1KTMA 1PGPA 1FZBA 3MUDC 4EDFA 2JKVA 3TNUB 1RF0C 2KS1A 2HLOA 4MN4C 2W27A 2ZFCA 4NPDA 4HH2A 4WY4C 1DIPA 3MP7B 2FXMA 5B66E 2WT7B 4H13D 4PD4E 2QSIA 3V6IA 4HKZH 3HTKB 3KXDA 1JY3O 3JCUH 3M0DC 1GDTA 1T2KC 5E79E 1AQTA 4GDOA 1LT1A 5CMZA 5M1BA 1ZMEC 1NVOA 2Z5IA 2JJLA 1BGYE 4L75A 1HUCA 3BASA 1HF9A 5BVZA 2ZAEB 1FJKA 1X0TA 4U3FG 1KILE 4XA4A 2FXPA 2V7QJ 1LTJB 3B5NA 1X8YA 2M0BA 3ZDMA 1BCCE 3H1JG 1OVRA 1SFCA 4C7NB 3G71P 1JY2O 3AE4C 1S9KD 1N7LA 3G9RA 1SQVJ 1CZQA 1CW5A 1RE3A 1N7SD 4H13C 1YQ4C 4OVNF 2BASA 3HUSA 3FX0A 1N73C 2HPCB 2ZYGA 2A06G 1GL2C 3H1HG 4I2LC 1VQMP 4W80A 1S2EA 4ZNCA 4ASWA 1VF5D 4D6TG 3Q3DA 3L72J 1L0ND 1KYOI 3ITKA 1T3UA 3II6A 3SWKA 2NPSD 1NTKD 2ZVNB 3C1LA 1BE3G 1DD4A 2NPSB 2KIKA 1PPJG 2YO2A 3T97A 3CCJP 5AVWB 4H0LD 4IFFA 1IFNA 1RY3A 3H1IG 1M7LA 2BCCD 2KOGA 1GZLA 4NPEA 1EQ7A 1NTZJ 2K9JB 1OX3A 2Y0EA 1SQBJ 5CHXA 2FYNB 1L0LG 3HD7B 5KKZC 1GK4A 3OA7A 3F89A 2KZIA 2XNDH 1MV8A 1QLED 1NOHA 1N7SC 3TNUA 2YMYA 1USDA 3WMM0 3HE4A 5KAFH 4ZKUA 3V2RA 1NTMD 1GW3A 3L70E 4WBAA 1X79B 1BGYD 2E76D 1LJ2A 1KYOH 1VF5C 2Z5HA 3IN6A 2E76B 4L76A 4IL6X 4RJTA 3L36A 2E5TA 4EYYQ 1VQ4P 2FYZA 3L74J 4H0LC 1JEKA 3H25A 3H32A 2QEXP 2HFED 1KQLA 3OAKA 4I1LA 3AEFC 2XKMA 4OGQD 4Y99B 5B5EH 3E1IA 1ZR2A 1SQBE 3CMAP 1L4AD 3Q5RA 2QM7A 4PV1D 2YO3A 1ZOYC 2UWJE 2CK3H 4PV1B 1KORA 3D6YA 5AW0B 3U1CA 4DCKA 2M3BA 3BVHA 1KMIZ 2QIWA 2OTKE 1BSHA 4PJ0H 4C7NA 3I55P 5APUA 3V4QA 3FXDA 1Q82Q 1HJ0A 3C8VA 3PH0A 2Z4EA 1W2BO 2WSFH 5AW6B 1MKMA 1SQPJ 1VQ5P 4GODA 3P8MC 1FOSE 4NPFX 3H1KE 3AEDC 1T3JA 1KILC 1TU3F 1QGKB 5APWA 5CCHA 2YXRB 2K3RA 3NXSA 3PLNA 1IO4A 1FS0E 4OGQC 1SQVD 4C7RA 3E7KA 2M5AA 3IR9A 1L4AC 1CI6B 3EWKA 4ZMDA 5CBOA 2OYIB 5L8RJ 1SQXG 1PFIA 3BCCJ 1EDIA 1RHZB 1ZRTE 4JF7A 2RKLA 1QL2A 1EXJA 3CCEP 1K04A 2K9JA 2L5GB 2JWDA 3L70D 3A3YB 1L0NK 3RK3E 1GU5A 1WMKA 1EDJA 1JMBA 4UB8E 3L72D 3GHGC 3HD7A 1IC2A 1PV3A 3O8ZA 1S5LH 2Y0DA 3L75E 1NTKK 1URQA 2OYHA 1PGJA 3G4SP 2HG5D 3L73G 5C39A 2KS1B 1JB0J 1S72P 3A0HH 1S5LE 3H1LJ 1JCDA 3TGUG 3CPWO 3AE5C 4B86A 1KZUB 3A0BE 1SQBD 1FDOA 5TISH 1NU1J 4OH8B 1LWUC 1HBWA 3RL0g 3USSA 1VQKP 1Y8AA 3CXHI 5AVQB 2H8PD 3R4YA 4EI2A 1NTMK 3VP9A 2WPSA 1N2DC 1CSBA 1RE4C 2WWWA 1PGQA 1YITP 3AE6C 2H88C 1JOCA 2G3AA 1LT9A 3B5NB 2FFDA 2AXCA 3V2PA 4WVZA 1S1CX 1VQNP 3GMAA 5GTHH 3CX5D 2ZT9D 1KD1Q 1SFCD 3C9IA 3H1KD 2Q3IA 1JTHA 2PGDA 3L74D 2YIUC 4H44B 3QH9A 3RL0B 2QA4P 3JSVC 3CI9A 3VMAA 1S4XA 4PD4I 1N86A 3HUSB 2QE7H 1JM0A 3VP8A 5GTHE 1IFJA 1NU1E 2P10A 1PP9G 5AW3B 2FYUE 3CCQP 3AEAC 5AVZB 1SQQE 5AVTB 3CCUP 1JY3N 2POHA 2PRRA 5TJHA 4UB6H 4L73A 3RK3D 1Q90D 3O6QB 1EC5A 1SVFA 5AVYB 2GUVA 3S4RA 1JNMA 3AEGC 1JCCA 3WUVA 2B88A 3T97B 1CI6A 4AQRD 1U7MA 1LGHB 3H6PA 2QG4A 2N1TD 3AEBC 4UB6E 2ZT9C 1SFCC 2R3CA 2Q3EA 5AW1B 2B87B 1XTCC 5B66H 1RE3C 2XU6A 1GTWA 1R8EA 1LTIC 1RH5B 4JPZB 2OTJP 1JY2N 1SQVK 2BCCE 1FAVA 3AE7C 3FXEA 3HE4B 1NTKG 3H1JJ 5E79H 1YBKA 1VQ6P 2D2CC 2ZVOB 3M06A 1LTBC 1HTLC 1FZCA 3BCCD 4I7ZC 2R5DA 2E74C 1AVYA 5APTA 2QJYC 1HGZA 5APYA 3RK2C 1YI2P 3RK3C 3H1HJ 1G1IA 1YYCA 3FGAD 3TDKA 3M0AA 2KLVA 3H32B 2JEEA 4GOEA 4D6TJ 1NTME 3BATA 1Y47A 3IF4A 3CWBG 2WQYC 2N1TC 1BE3J 2KI7B 2NRGA 2E75B 4U3FE 3H1LD 2Q5UA 2XDJA 1NYHA 1SQBK 3H1IJ 2WSEH 2WVRA 3S9OA 4YPCA 4QMAA 2IYOA 1NU1D 1VQ9P 3E1RA 3PRJA 2FYUD 2IBZE 1N8RQ 1DEEG 1SQQD 1IK9A 1L0LJ 1VQOP 1KV4A 3CL3D 3VMYA 2Q9IA 4XE5B 1BCCG 4N6JA 5KLVG 1HVVA 3MD0A 3CLQA 1EZVG 1T8ZA 1FDIA 1M1JA 3B4SA 1ZV8A 4A7PA 3P8CD 1SLQA 4D6TE 3MUDA 3BRTB 1QEXA 1ZP0C 5CCGD 3RBXA 3IFMA 1K73Q 3G6EP 3O6QA 2NZ2A 2YKOA 2M5AB 2I1JA 2GUSA 4WY4A 2J58A 4R4MA 1LTJC 4JYBA 2KLUA 4HYTB 4BRYA 4LLHA 4U7JA 3HD7D 1IFIA 3W67A 1SQVE 1URQD 2B87A 4RO0A 3FWNA 1URQB 2OYHB 3PTZA 4M3LA 2WPQA 1VPCA 2Y0CA 1G1JA 2QRXA 3AE8C 3CX5I 2GA1A 1GK6A 1X22A 4RESB 1KB9D 3CCSP 3L72E 3CCMP 4XFJA 2R5BA 1BDDA 1R5SA 3P32A 3A7OA 3FWLA 5CCGC 4U3FD 1K8AQ 2NPSC 3MHVA 1OW7A 2XZRA 4WB4A 1NH4A 4YXWH 3KQGA 1YIJP 1LTTC 1Y9BA 2ZJSE 1N73A 3GW6A 1NTZE 2IBZD 3WUUA 1GL2A 2WTYA 2FYNC 4W7ZA 3HD7C 1BSNA 2WSCH 1LT9B 3U59A 2FFDB 3NFQA 5CJ0A 1NKNA 4N3YB 1SQXJ 2OYOA 1KQSO 2VRSA 1XTGB 2A06D 3A5TA 3PJSK 1M57D 3H1HD 3CX5H 1EDKA 2R32A 2C0WA 1JTHB 2OTLP 5AVSB 3MTUE 2N9BA 2PAJA 4D6TD 1GD2E 3PHLA 2QVAA 1MUUA 4CPGA 1MZ9A 2Q1KA 4JYCA 2E76C 1BE3D 2P2UA 3V2QA 4EOTA 5KLIB 3L73J 3CX5E 1PPJD 1USEA 3HE5A 3NTNA 2FY8A 3L74E 3H1ID 3W68A 1J1DB 1SP4A 1NU1K 2QJKB 2FYUK 1N7SA 3TGUJ 1G2CB 1NKZB 2Q7CA 1SQQK 3R2PA 3KYQA 1L0LD 3H1KG 4Y99C 4UB8H 2OARA 3TF5A 1PGOA 4GIFA 2IYPA 2LKMA 4PV1C 2P1JA 1Q81Q 1FZEA 4GOFA 3CCVP 2FBWC 2G8YA 2WZ7A 1JY3P 1RQVA 4R4LA 1OMIA 4BWNA 3L71G 4GKGA 4K3AA 2IFMA 3VYIA 2O01N 2H43A 3A0BH 5AW5B 1SQPE 3UIAA 1MFZA 3JC22 1OVVA 2B9BA 1YTZI 5CJ4A 3GF3A 4C46A 3QWOC 5KJ7A 1FZCB 3L75G 1YJNP 3RGUA 1OXZA 1W2EA 2FXOA 1Q7YQ 4IFDK 1NTZD 1ZN5A 5APSA 2HODA 3AE9C 3MZWB 1PP9J 5CBNA 1JY2P 3SSUA 3SWFA 2KB7P 3OW2O 1PL5A 2OYIC 2A45I 1YTZT 3BCCE 2WMMA 2YKPA 1KC8Q 1FDMA 1KILA 3KZIE 4HB1A 1DX7A 3B5ND 4Z1MH 1HWTC 1LNQA 1QVGO 1OVUA 3VOPA 1M56D 1VQ7P 2IZ1A 5AVVB 2ZYDA 4OWFA 2JO1A 4WWIA 3TYYA 1H89A 1YJWP 1EDLA 1NGMB 3KPEA 4H44D 2AXTH 3RL0D 2IZ0A 1GW4A 1L4AA 1ZR4A 2MJZA 2LXBA 1DEBA 1RF1B 2QJPB 2XV5A 1IFPA 2K9YA 3H1LE 4IL6H 1ZXGA 1J1EB 5AW7B 1U7JA 1L2PA 3WUTA 2K1AA 1NTKJ 1M1JB 1FOSF 2AXTE 2KK7A 2ITAA 5DJUB 3CC2P 3D71A 3Q1MA 2A45H 1SQXD 1KB9I 3LW5H 4YXDC 4IL6E 1KQGB 1G2CA 3P7KA 2WITA 1VQPP 1KFNA 2I1KA 2O01J 3LIDA 1E5WA 3TK1A 2FYUG 2JDIH 2K37A 1SQQG 4WY4B 2CPBA 2Y9ZA 2OQQA 1K9MQ 1LTAC 3B5NC 3P8CE 1T2KD 1SQPD 4BRYB 3Q2YA 3CWBJ 2P67A 2L91A 1LWUA 3S1KA 2IBZI 1OWAA 4H44C 1H8AA 3RL0C 1P84D 1JO5A 4JBZA 3TGUD 1L0NG 1L0LK 3GG2A 3HUSC 3AECC 2E42A 5GTIE 2KP8A 1UIIA 1YQ3C 2O1KA 4ZKPA 1T6AA 4LC1A 1KQFB 1KB9H 1WRGA 4GT1A 3Q5SA 2BCCG 1LTGC 1BCCJ 3OJAB 5KLVJ 2ZXXA 4N78E 3KDPB 1M1KQ 5DJTB 1GU4A 2AEJA 5K5GB 3A2AA 5APVA 2IDBA 4TLFA 1KB9E 4H13B 2WSEJ 1DH3A 2YXQB 1N73B 1H88A 1GL2D 3GLMA 1GL2B 3CWBE 2E75D 1IK7A 2V4HA 2KXPB 5AW4B 1VL2A 1NTMG 1NTZK 1QX8A 1OZHA 1BGYG 1FE6A 1OFCX 3MGNA 5AW2B 3G3ZA 3JCUE 1FJPA 1PP9D 3CMEP 3H1JE 1A02F 1ZLLA 3ABVC 1HH0A 2M3EA 1RF1A 1IZNB 3L37A 2W8ZA 5KLVE 2IBZG 1QL1A 2A06E 1W5CE 3HE5B 1EZVE 1FZGA 3M9HA 4HJGH 3H1HE 5KKZB 2W90A 5CCHD 1S5LX 2V7QH 5AVRB 1NJIQ 1N7SB 1J2JB 1NAYA 1RF0A 1FZAA 4KHXA 2JP3A 1BE3E 3L70J 1Q2NA 1PPJE 2E75C 3CXHD 1VF5B 2FKWB 2AEMA 2GM4A 3H1IE 2KNCA 2YKQA 3AE3C 4DZOA 3M0DA 3AEEC 4TT3H 1SQXK 2PP6A 1AQ5A 3MIWA 1L0LE 4H0LB 1Z56A 3EQ2A 3Q5PA 2R3SA 4N78D 2M8RA 2P58A 3V4WA 2N1TA 1FZFA 1HJBA 1HGVA 5KTBA 1KFMA 2LR2A 2WPVB 5KJ7D 1SQVG 4PD4D 2R44A 2SPZA 1SQPK 3SFDC 5CCHC 1IJDB 4BXLA 3CWBD 1R5LA 2RH0A 2HODB 3L70G 1SS1A 1M90Q 2WSCJ 5EFWB 2JR8A 3VMZA 1AFOA 3L72G 3WU2H 4IFMA 2WT7A 1VQ8P 2K88A 3HTKA 3H1JD 1AV1A 5KAFE 3EFGA 1KILD 3H1KJ 2RN0A 1KILB 4L74A 1S3JA 3GF7A 4IOIH 5BU8B 3WU2E 1KYOE 3B8EB 3HRNA 1BCCD 2AEFA 4KT0J 1URQC 5KLVD 4KJMA 2OYHC 1NTZG 2WSFJ 5H2FH 1H0TB 2W6BA 1EZVD 1SQBG 2LXCB 4OGQB 2Y9YA 3M91A 1L4AB 1FU1A 2B89A 5KJ7C 4DOJA 2H89C 3VN0A 1IFDA 1LTJA 3L71J 1EXIA 1P84I 2KYVA 2P7JA 5H2FE 3CC4P 2N9YB 1LTSC 5B5EE 4DJGA 5AVUB 3GHGB 3L35A 2XNXA 1WT6A 3V2NA 3L75J 3VMXA 1NO4A 1PIXA 3M9QA 2WSSH 2HPCA 1OW6A 4PJ0E 3N7NA 3L74G 1ZW0A 2OGUA 3IAOA 2I8DA 1LT9C 2FFDC 1VQLP 1OIPA 1SQXE
chains in the Genus database with same CATH topology
1H0TA 1U7JA 1EDKA 1OVRA 1EC5A 5DJTB 1LP1A 4GODA 1OVVA 2KI7B 5K5GB 4NPFX 2B88A 3QWOC 1Q2NA 1S3JA 5DJUB 4IOIH 3RGUA 2QVAA 2B87A 4ASVA 4CPGA 2KZJA 2K3RA 1U7MA 2Q1KA 4KJMA 1H0TB 2QRXA 1LP1B 2HR3A 2LXCB 4EYYQ 3MZWB 1DEEG 4MN4C 2M5AA 4NPDA 4ZNCA 2B89A 4ASWA 5CBNA 2B87B 4ZMDA 5CBOA 2KUBA 4HKZH 1EDIA 2RKLA 2WMMA 2P58A 1BDDA 3FXEA 2JWDA 2LR2A 2KIKA 3MHVA 1EDJA 4K35A 2UWJE 1JMBA 3S1KA 4HB1A 2R44A 2SPZA 1LT1A 4JBZA 1OVUA 1NVOA 4BXLA 4NPEA 4WWIA 1JM0A 2OTKE 4GOFA 1EDLA 2ZAEB 5C39A 1X0TA 2KS1B 4HJGH 1SS1A 2M5AB 1BDCA 1ZW0A 5EFWB 1FC2C 2LXBA 3FXDA 1MFTA 2I8DA 4GOEA 3PH0A 4K3AA 2KZIA 2M0BA 1ZXGA 1Y47A 3ZDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0T A;  1U7J A;  1EDK A;  1OVR A;  1EC5 A;  5DJT B;  1LP1 A;  4GOD A;  1OVV A;  2KI7 B;  5K5G B;  4NPF X;  2B88 A;  3QWO C;  1Q2N A;  1S3J A;  5DJU B;  4IOI H;  3RGU A;  2QVA A;  2B87 A;  4ASV A;  4CPG A;  2KZJ A;  2K3R A;  1U7M A;  2Q1K A;  4KJM A;  1H0T B;  2QRX A;  1LP1 B;  2HR3 A;  2LXC B;  4EYY Q;  3MZW B;  1DEE G;  4MN4 C;  2M5A A;  4NPD A;  4ZNC A;  2B89 A;  4ASW A;  5CBN A;  2B87 B;  4ZMD A;  5CBO A;  2KUB A;  4HKZ H;  1EDI A;  2RKL A;  2WMM A;  2P58 A;  1BDD A;  3FXE A;  2JWD A;  2LR2 A;  2KIK A;  3MHV A;  1EDJ A;  4K35 A;  2UWJ E;  1JMB A;  3S1K A;  4HB1 A;  2R44 A;  2SPZ A;  1LT1 A;  4JBZ A;  1OVU A;  1NVO A;  4BXL A;  4NPE A;  4WWI A;  1JM0 A;  2OTK E;  4GOF A;  1EDL A;  2ZAE B;  5C39 A;  1X0T A;  2KS1 B;  4HJG H;  1SS1 A;  2M5A B;  1BDC A;  1ZW0 A;  5EFW B;  1FC2 C;  2LXB A;  3FXD A;  1MFT A;  2I8D A;  4GOE A;  3PH0 A;  4K3A A;  2KZI A;  2M0B A;  1ZXG A;  1Y47 A;  3ZDM A; 
#chains in the Genus database with same CATH topology
 1U57 A;  5CCG A;  2NPS A;  1LWU B;  3D70 A;  3L71 E;  1P84 H;  2BEZ F;  2KZJ A;  2WPR A;  2H7H A;  3I56 P;  1AA0 A;  1LP1 B;  1YHQ P;  2HR3 A;  3L73 E;  5KLI C;  3AE1 C;  4O9B A;  3LIE A;  4W7Y A;  3CCR P;  3D6Z A;  4DT0 A;  1J1D C;  3VTP C;  2KUB A;  1P84 E;  3CD6 P;  2C0X A;  2QJK C;  3TGU E;  1SQP G;  2W6A A;  1Q86 Q;  4AYC A;  1A02 J;  2O1J A;  2YIU B;  1JMM A;  4K35 A;  1AVO A;  3F5H A;  2PFX A;  5BU5 A;  2E43 A;  2RMZ A;  3KZI H;  1KYO D;  3N4X A;  1RQU A;  2C9N Y;  2YMK A;  2J59 M;  2O3J A;  1OW8 A;  1FBM A;  1DD3 A;  4Y28 J;  2HYN A;  3BRV B;  3I5C A;  2FYU J;  1IFM A;  1UIX A;  1BDC A;  3EFF K;  2IPP A;  1SQQ J;  1FC2 C;  3A0H E;  3CC7 P;  5AVX B;  3BCC G;  3SFE C;  2ZXE B;  1YJ9 P;  3SWY A;  1GMJ A;  1H0T A;  5TIS E;  2E5Y A;  2KSJ A;  3B71 A;  1KN7 A;  4EIJ A;  5APX A;  1FZC C;  3LW5 J;  1L0N J;  4I6M C;  1PZQ A;  5KAI H;  2ZT9 B;  1SFC B;  3NMD A;  3TSI A;  2IX7 C;  2Q6Q A;  3K5B A;  1PP9 E;  3GHG A;  1QVF O;  1X9V A;  5APQ A;  4AUW A;  5KLV K;  1D7M A;  3H1L G;  2DW3 A;  3KHU A;  1M8O B;  3U1A A;  2BCC J;  1NWQ A;  5KAI E;  2D2C D;  3AE2 C;  1NU1 G;  1JUN A;  4RKU J;  5AW8 B;  2D2C B;  2KSE A;  4WY4 D;  5AW9 B;  1E79 H;  3L71 D;  3V5B A;  2E74 D;  1S9K E;  3RBZ A;  2MKV A;  1K05 A;  1ZRT D;  4I7Z B;  2E74 B;  3CXH H;  2KNC B;  1NHL A;  4JQ0 D;  4LGD E;  3RK2 D;  2QJY B;  2W6J H;  3L73 D;  3RK2 B;  5GTI H;  2YNY A;  3CCL P;  3RK3 B;  2IFN A;  2ZYA A;  3L75 D;  3M9B A;  2A45 G;  1NTM J;  1MFT A;  1VDF A;  1RF1 C;  2CPS A;  2OYI A;  2QJP C;  3CXH E;  1BGY J;  1L0N E;  2J5U A;  2C9L Y;  3PP5 A;  4YTP C;  2QM8 A;  3L4F A;  1J1E C;  2N1T B;  2O01 H;  1LP1 A;  1RE4 A;  1NTK E;  2W83 C;  4U3F J;  1EZV I;  1M1J C;  1AJY A;  2BEQ D;  2JWA A;  4PD4 H;  1NAF A;  4ASV A;  1KTM A;  1PGP A;  1FZB A;  3MUD C;  4EDF A;  2JKV A;  3TNU B;  1RF0 C;  2KS1 A;  2HLO A;  4MN4 C;  2W27 A;  2ZFC A;  4NPD A;  4HH2 A;  4WY4 C;  1DIP A;  3MP7 B;  2FXM A;  5B66 E;  2WT7 B;  4H13 D;  4PD4 E;  2QSI A;  3V6I A;  4HKZ H;  3HTK B;  3KXD A;  1JY3 O;  3JCU H;  3M0D C;  1GDT A;  1T2K C;  5E79 E;  1AQT A;  4GDO A;  1LT1 A;  5CMZ A;  5M1B A;  1ZME C;  1NVO A;  2Z5I A;  2JJL A;  1BGY E;  4L75 A;  1HUC A;  3BAS A;  1HF9 A;  5BVZ A;  2ZAE B;  1FJK A;  1X0T A;  4U3F G;  1KIL E;  4XA4 A;  2FXP A;  2V7Q J;  1LTJ B;  3B5N A;  1X8Y A;  2M0B A;  3ZDM A;  1BCC E;  3H1J G;  1OVR A;  1SFC A;  4C7N B;  3G71 P;  1JY2 O;  3AE4 C;  1S9K D;  1N7L A;  3G9R A;  1SQV J;  1CZQ A;  1CW5 A;  1RE3 A;  1N7S D;  4H13 C;  1YQ4 C;  4OVN F;  2BAS A;  3HUS A;  3FX0 A;  1N73 C;  2HPC B;  2ZYG A;  2A06 G;  1GL2 C;  3H1H G;  4I2L C;  1VQM P;  4W80 A;  1S2E A;  4ZNC A;  4ASW A;  1VF5 D;  4D6T G;  3Q3D A;  3L72 J;  1L0N D;  1KYO I;  3ITK A;  1T3U A;  3II6 A;  3SWK A;  2NPS D;  1NTK D;  2ZVN B;  3C1L A;  1BE3 G;  1DD4 A;  2NPS B;  2KIK A;  1PPJ G;  2YO2 A;  3T97 A;  3CCJ P;  5AVW B;  4H0L D;  4IFF A;  1IFN A;  1RY3 A;  3H1I G;  1M7L A;  2BCC D;  2KOG A;  1GZL A;  4NPE A;  1EQ7 A;  1NTZ J;  2K9J B;  1OX3 A;  2Y0E A;  1SQB J;  5CHX A;  2FYN B;  1L0L G;  3HD7 B;  5KKZ C;  1GK4 A;  3OA7 A;  3F89 A;  2KZI A;  2XND H;  1MV8 A;  1QLE D;  1NOH A;  1N7S C;  3TNU A;  2YMY A;  1USD A;  3WMM 0;  3HE4 A;  5KAF H;  4ZKU A;  3V2R A;  1NTM D;  1GW3 A;  3L70 E;  4WBA A;  1X79 B;  1BGY D;  2E76 D;  1LJ2 A;  1KYO H;  1VF5 C;  2Z5H A;  3IN6 A;  2E76 B;  4L76 A;  4IL6 X;  4RJT A;  3L36 A;  2E5T A;  4EYY Q;  1VQ4 P;  2FYZ A;  3L74 J;  4H0L C;  1JEK A;  3H25 A;  3H32 A;  2QEX P;  2HFE D;  1KQL A;  3OAK A;  4I1L A;  3AEF C;  2XKM A;  4OGQ D;  4Y99 B;  5B5E H;  3E1I A;  1ZR2 A;  1SQB E;  3CMA P;  1L4A D;  3Q5R A;  2QM7 A;  4PV1 D;  2YO3 A;  1ZOY C;  2UWJ E;  2CK3 H;  4PV1 B;  1KOR A;  3D6Y A;  5AW0 B;  3U1C A;  4DCK A;  2M3B A;  3BVH A;  1KMI Z;  2QIW A;  2OTK E;  1BSH A;  4PJ0 H;  4C7N A;  3I55 P;  5APU A;  3V4Q A;  3FXD A;  1Q82 Q;  1HJ0 A;  3C8V A;  3PH0 A;  2Z4E A;  1W2B O;  2WSF H;  5AW6 B;  1MKM A;  1SQP J;  1VQ5 P;  4GOD A;  3P8M C;  1FOS E;  4NPF X;  3H1K E;  3AED C;  1T3J A;  1KIL C;  1TU3 F;  1QGK B;  5APW A;  5CCH A;  2YXR B;  2K3R A;  3NXS A;  3PLN A;  1IO4 A;  1FS0 E;  4OGQ C;  1SQV D;  4C7R A;  3E7K A;  2M5A A;  3IR9 A;  1L4A C;  1CI6 B;  3EWK A;  4ZMD A;  5CBO A;  2OYI B;  5L8R J;  1SQX G;  1PFI A;  3BCC J;  1EDI A;  1RHZ B;  1ZRT E;  4JF7 A;  2RKL A;  1QL2 A;  1EXJ A;  3CCE P;  1K04 A;  2K9J A;  2L5G B;  2JWD A;  3L70 D;  3A3Y B;  1L0N K;  3RK3 E;  1GU5 A;  1WMK A;  1EDJ A;  1JMB A;  4UB8 E;  3L72 D;  3GHG C;  3HD7 A;  1IC2 A;  1PV3 A;  3O8Z A;  1S5L H;  2Y0D A;  3L75 E;  1NTK K;  1URQ A;  2OYH A;  1PGJ A;  3G4S P;  2HG5 D;  3L73 G;  5C39 A;  2KS1 B;  1JB0 J;  1S72 P;  3A0H H;  1S5L E;  3H1L J;  1JCD A;  3TGU G;  3CPW O;  3AE5 C;  4B86 A;  1KZU B;  3A0B E;  1SQB D;  1FDO A;  5TIS H;  1NU1 J;  4OH8 B;  1LWU C;  1HBW A;  3RL0 g;  3USS A;  1VQK P;  1Y8A A;  3CXH I;  5AVQ B;  2H8P D;  3R4Y A;  4EI2 A;  1NTM K;  3VP9 A;  2WPS A;  1N2D C;  1CSB A;  1RE4 C;  2WWW A;  1PGQ A;  1YIT P;  3AE6 C;  2H88 C;  1JOC A;  2G3A A;  1LT9 A;  3B5N B;  2FFD A;  2AXC A;  3V2P A;  4WVZ A;  1S1C X;  1VQN P;  3GMA A;  5GTH H;  3CX5 D;  2ZT9 D;  1KD1 Q;  1SFC D;  3C9I A;  3H1K D;  2Q3I A;  1JTH A;  2PGD A;  3L74 D;  2YIU C;  4H44 B;  3QH9 A;  3RL0 B;  2QA4 P;  3JSV C;  3CI9 A;  3VMA A;  1S4X A;  4PD4 I;  1N86 A;  3HUS B;  2QE7 H;  1JM0 A;  3VP8 A;  5GTH E;  1IFJ A;  1NU1 E;  2P10 A;  1PP9 G;  5AW3 B;  2FYU E;  3CCQ P;  3AEA C;  5AVZ B;  1SQQ E;  5AVT B;  3CCU P;  1JY3 N;  2POH A;  2PRR A;  5TJH A;  4UB6 H;  4L73 A;  3RK3 D;  1Q90 D;  3O6Q B;  1EC5 A;  1SVF A;  5AVY B;  2GUV A;  3S4R A;  1JNM A;  3AEG C;  1JCC A;  3WUV A;  2B88 A;  3T97 B;  1CI6 A;  4AQR D;  1U7M A;  1LGH B;  3H6P A;  2QG4 A;  2N1T D;  3AEB C;  4UB6 E;  2ZT9 C;  1SFC C;  2R3C A;  2Q3E A;  5AW1 B;  2B87 B;  1XTC C;  5B66 H;  1RE3 C;  2XU6 A;  1GTW A;  1R8E A;  1LTI C;  1RH5 B;  4JPZ B;  2OTJ P;  1JY2 N;  1SQV K;  2BCC E;  1FAV A;  3AE7 C;  3FXE A;  3HE4 B;  1NTK G;  3H1J J;  5E79 H;  1YBK A;  1VQ6 P;  2D2C C;  2ZVO B;  3M06 A;  1LTB C;  1HTL C;  1FZC A;  3BCC D;  4I7Z C;  2R5D A;  2E74 C;  1AVY A;  5APT A;  2QJY C;  1HGZ A;  5APY A;  3RK2 C;  1YI2 P;  3RK3 C;  3H1H J;  1G1I A;  1YYC A;  3FGA D;  3TDK A;  3M0A A;  2KLV A;  3H32 B;  2JEE A;  4GOE A;  4D6T J;  1NTM E;  3BAT A;  1Y47 A;  3IF4 A;  3CWB G;  2WQY C;  2N1T C;  1BE3 J;  2KI7 B;  2NRG A;  2E75 B;  4U3F E;  3H1L D;  2Q5U A;  2XDJ A;  1NYH A;  1SQB K;  3H1I J;  2WSE H;  2WVR A;  3S9O A;  4YPC A;  4QMA A;  2IYO A;  1NU1 D;  1VQ9 P;  3E1R A;  3PRJ A;  2FYU D;  2IBZ E;  1N8R Q;  1DEE G;  1SQQ D;  1IK9 A;  1L0L J;  1VQO P;  1KV4 A;  3CL3 D;  3VMY A;  2Q9I A;  4XE5 B;  1BCC G;  4N6J A;  5KLV G;  1HVV A;  3MD0 A;  3CLQ A;  1EZV G;  1T8Z A;  1FDI A;  1M1J A;  3B4S A;  1ZV8 A;  4A7P A;  3P8C D;  1SLQ A;  4D6T E;  3MUD A;  3BRT B;  1QEX A;  1ZP0 C;  5CCG D;  3RBX A;  3IFM A;  1K73 Q;  3G6E P;  3O6Q A;  2NZ2 A;  2YKO A;  2M5A B;  2I1J A;  2GUS A;  4WY4 A;  2J58 A;  4R4M A;  1LTJ C;  4JYB A;  2KLU A;  4HYT B;  4BRY A;  4LLH A;  4U7J A;  3HD7 D;  1IFI A;  3W67 A;  1SQV E;  1URQ D;  2B87 A;  4RO0 A;  3FWN A;  1URQ B;  2OYH B;  3PTZ A;  4M3L A;  2WPQ A;  1VPC A;  2Y0C A;  1G1J A;  2QRX A;  3AE8 C;  3CX5 I;  2GA1 A;  1GK6 A;  1X22 A;  4RES B;  1KB9 D;  3CCS P;  3L72 E;  3CCM P;  4XFJ A;  2R5B A;  1BDD A;  1R5S A;  3P32 A;  3A7O A;  3FWL A;  5CCG C;  4U3F D;  1K8A Q;  2NPS C;  3MHV A;  1OW7 A;  2XZR A;  4WB4 A;  1NH4 A;  4YXW H;  3KQG A;  1YIJ P;  1LTT C;  1Y9B A;  2ZJS E;  1N73 A;  3GW6 A;  1NTZ E;  2IBZ D;  3WUU A;  1GL2 A;  2WTY A;  2FYN C;  4W7Z A;  3HD7 C;  1BSN A;  2WSC H;  1LT9 B;  3U59 A;  2FFD B;  3NFQ A;  5CJ0 A;  1NKN A;  4N3Y B;  1SQX J;  2OYO A;  1KQS O;  2VRS A;  1XTG B;  2A06 D;  3A5T A;  3PJS K;  1M57 D;  3H1H D;  3CX5 H;  1EDK A;  2R32 A;  2C0W A;  1JTH B;  2OTL P;  5AVS B;  3MTU E;  2N9B A;  2PAJ A;  4D6T D;  1GD2 E;  3PHL A;  2QVA A;  1MUU A;  4CPG A;  1MZ9 A;  2Q1K A;  4JYC A;  2E76 C;  1BE3 D;  2P2U A;  3V2Q A;  4EOT A;  5KLI B;  3L73 J;  3CX5 E;  1PPJ D;  1USE A;  3HE5 A;  3NTN A;  2FY8 A;  3L74 E;  3H1I D;  3W68 A;  1J1D B;  1SP4 A;  1NU1 K;  2QJK B;  2FYU K;  1N7S A;  3TGU J;  1G2C B;  1NKZ B;  2Q7C A;  1SQQ K;  3R2P A;  3KYQ A;  1L0L D;  3H1K G;  4Y99 C;  4UB8 H;  2OAR A;  3TF5 A;  1PGO A;  4GIF A;  2IYP A;  2LKM A;  4PV1 C;  2P1J A;  1Q81 Q;  1FZE A;  4GOF A;  3CCV P;  2FBW C;  2G8Y A;  2WZ7 A;  1JY3 P;  1RQV A;  4R4L A;  1OMI A;  4BWN A;  3L71 G;  4GKG A;  4K3A A;  2IFM A;  3VYI A;  2O01 N;  2H43 A;  3A0B H;  5AW5 B;  1SQP E;  3UIA A;  1MFZ A;  3JC2 2;  1OVV A;  2B9B A;  1YTZ I;  5CJ4 A;  3GF3 A;  4C46 A;  3QWO C;  5KJ7 A;  1FZC B;  3L75 G;  1YJN P;  3RGU A;  1OXZ A;  1W2E A;  2FXO A;  1Q7Y Q;  4IFD K;  1NTZ D;  1ZN5 A;  5APS A;  2HOD A;  3AE9 C;  3MZW B;  1PP9 J;  5CBN A;  1JY2 P;  3SSU A;  3SWF A;  2KB7 P;  3OW2 O;  1PL5 A;  2OYI C;  2A45 I;  1YTZ T;  3BCC E;  2WMM A;  2YKP A;  1KC8 Q;  1FDM A;  1KIL A;  3KZI E;  4HB1 A;  1DX7 A;  3B5N D;  4Z1M H;  1HWT C;  1LNQ A;  1QVG O;  1OVU A;  3VOP A;  1M56 D;  1VQ7 P;  2IZ1 A;  5AVV B;  2ZYD A;  4OWF A;  2JO1 A;  4WWI A;  3TYY A;  1H89 A;  1YJW P;  1EDL A;  1NGM B;  3KPE A;  4H44 D;  2AXT H;  3RL0 D;  2IZ0 A;  1GW4 A;  1L4A A;  1ZR4 A;  2MJZ A;  2LXB A;  1DEB A;  1RF1 B;  2QJP B;  2XV5 A;  1IFP A;  2K9Y A;  3H1L E;  4IL6 H;  1ZXG A;  1J1E B;  5AW7 B;  1U7J A;  1L2P A;  3WUT A;  2K1A A;  1NTK J;  1M1J B;  1FOS F;  2AXT E;  2KK7 A;  2ITA A;  5DJU B;  3CC2 P;  3D71 A;  3Q1M A;  2A45 H;  1SQX D;  1KB9 I;  3LW5 H;  4YXD C;  4IL6 E;  1KQG B;  1G2C A;  3P7K A;  2WIT A;  1VQP P;  1KFN A;  2I1K A;  2O01 J;  3LID A;  1E5W A;  3TK1 A;  2FYU G;  2JDI H;  2K37 A;  1SQQ G;  4WY4 B;  2CPB A;  2Y9Z A;  2OQQ A;  1K9M Q;  1LTA C;  3B5N C;  3P8C E;  1T2K D;  1SQP D;  4BRY B;  3Q2Y A;  3CWB J;  2P67 A;  2L91 A;  1LWU A;  3S1K A;  2IBZ I;  1OWA A;  4H44 C;  1H8A A;  3RL0 C;  1P84 D;  1JO5 A;  4JBZ A;  3TGU D;  1L0N G;  1L0L K;  3GG2 A;  3HUS C;  3AEC C;  2E42 A;  5GTI E;  2KP8 A;  1UII A;  1YQ3 C;  2O1K A;  4ZKP A;  1T6A A;  4LC1 A;  1KQF B;  1KB9 H;  1WRG A;  4GT1 A;  3Q5S A;  2BCC G;  1LTG C;  1BCC J;  3OJA B;  5KLV J;  2ZXX A;  4N78 E;  3KDP B;  1M1K Q;  5DJT B;  1GU4 A;  2AEJ A;  5K5G B;  3A2A A;  5APV A;  2IDB A;  4TLF A;  1KB9 E;  4H13 B;  2WSE J;  1DH3 A;  2YXQ B;  1N73 B;  1H88 A;  1GL2 D;  3GLM A;  1GL2 B;  3CWB E;  2E75 D;  1IK7 A;  2V4H A;  2KXP B;  5AW4 B;  1VL2 A;  1NTM G;  1NTZ K;  1QX8 A;  1OZH A;  1BGY G;  1FE6 A;  1OFC X;  3MGN A;  5AW2 B;  3G3Z A;  3JCU E;  1FJP A;  1PP9 D;  3CME P;  3H1J E;  1A02 F;  1ZLL A;  3ABV C;  1HH0 A;  2M3E A;  1RF1 A;  1IZN B;  3L37 A;  2W8Z A;  5KLV E;  2IBZ G;  1QL1 A;  2A06 E;  1W5C E;  3HE5 B;  1EZV E;  1FZG A;  3M9H A;  4HJG H;  3H1H E;  5KKZ B;  2W90 A;  5CCH D;  1S5L X;  2V7Q H;  5AVR B;  1NJI Q;  1N7S B;  1J2J B;  1NAY A;  1RF0 A;  1FZA A;  4KHX A;  2JP3 A;  1BE3 E;  3L70 J;  1Q2N A;  1PPJ E;  2E75 C;  3CXH D;  1VF5 B;  2FKW B;  2AEM A;  2GM4 A;  3H1I E;  2KNC A;  2YKQ A;  3AE3 C;  4DZO A;  3M0D A;  3AEE C;  4TT3 H;  1SQX K;  2PP6 A;  1AQ5 A;  3MIW A;  1L0L E;  4H0L B;  1Z56 A;  3EQ2 A;  3Q5P A;  2R3S A;  4N78 D;  2M8R A;  2P58 A;  3V4W A;  2N1T A;  1FZF A;  1HJB A;  1HGV A;  5KTB A;  1KFM A;  2LR2 A;  2WPV B;  5KJ7 D;  1SQV G;  4PD4 D;  2R44 A;  2SPZ A;  1SQP K;  3SFD C;  5CCH C;  1IJD B;  4BXL A;  3CWB D;  1R5L A;  2RH0 A;  2HOD B;  3L70 G;  1SS1 A;  1M90 Q;  2WSC J;  5EFW B;  2JR8 A;  3VMZ A;  1AFO A;  3L72 G;  3WU2 H;  4IFM A;  2WT7 A;  1VQ8 P;  2K88 A;  3HTK A;  3H1J D;  1AV1 A;  5KAF E;  3EFG A;  1KIL D;  3H1K J;  2RN0 A;  1KIL B;  4L74 A;  1S3J A;  3GF7 A;  4IOI H;  5BU8 B;  3WU2 E;  1KYO E;  3B8E B;  3HRN A;  1BCC D;  2AEF A;  4KT0 J;  1URQ C;  5KLV D;  4KJM A;  2OYH C;  1NTZ G;  2WSF J;  5H2F H;  1H0T B;  2W6B A;  1EZV D;  1SQB G;  2LXC B;  4OGQ B;  2Y9Y A;  3M91 A;  1L4A B;  1FU1 A;  2B89 A;  5KJ7 C;  4DOJ A;  2H89 C;  3VN0 A;  1IFD A;  1LTJ A;  3L71 J;  1EXI A;  1P84 I;  2KYV A;  2P7J A;  5H2F E;  3CC4 P;  2N9Y B;  1LTS C;  5B5E E;  4DJG A;  5AVU B;  3GHG B;  3L35 A;  2XNX A;  1WT6 A;  3V2N A;  3L75 J;  3VMX A;  1NO4 A;  1PIX A;  3M9Q A;  2WSS H;  2HPC A;  1OW6 A;  4PJ0 E;  3N7N A;  3L74 G;  1ZW0 A;  2OGU A;  3IAO A;  2I8D A;  1LT9 C;  2FFD C;  1VQL P;  1OIP A;  1SQX E; 
#chains in the Genus database with same CATH homology
 1H0T A;  1U7J A;  1EDK A;  1OVR A;  1EC5 A;  5DJT B;  1LP1 A;  4GOD A;  1OVV A;  2KI7 B;  5K5G B;  4NPF X;  2B88 A;  3QWO C;  1Q2N A;  1S3J A;  5DJU B;  4IOI H;  3RGU A;  2QVA A;  2B87 A;  4ASV A;  4CPG A;  2KZJ A;  2K3R A;  1U7M A;  2Q1K A;  4KJM A;  1H0T B;  2QRX A;  1LP1 B;  2HR3 A;  2LXC B;  4EYY Q;  3MZW B;  1DEE G;  4MN4 C;  2M5A A;  4NPD A;  4ZNC A;  2B89 A;  4ASW A;  5CBN A;  2B87 B;  4ZMD A;  5CBO A;  2KUB A;  4HKZ H;  1EDI A;  2RKL A;  2WMM A;  2P58 A;  1BDD A;  3FXE A;  2JWD A;  2LR2 A;  2KIK A;  3MHV A;  1EDJ A;  4K35 A;  2UWJ E;  1JMB A;  3S1K A;  4HB1 A;  2R44 A;  2SPZ A;  1LT1 A;  4JBZ A;  1OVU A;  1NVO A;  4BXL A;  4NPE A;  4WWI A;  1JM0 A;  2OTK E;  4GOF A;  1EDL A;  2ZAE B;  5C39 A;  1X0T A;  2KS1 B;  4HJG H;  1SS1 A;  2M5A B;  1BDC A;  1ZW0 A;  5EFW B;  1FC2 C;  2LXB A;  3FXD A;  1MFT A;  2I8D A;  4GOE A;  3PH0 A;  4K3A A;  2KZI A;  2M0B A;  1ZXG A;  1Y47 A;  3ZDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...