2M0BA

Homodimeric transmembrane domain of the human receptor tyrosine kinase erbb1 (egfr, her1) in micelles
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
44
structure length
44
Chain Sequence
EGCPTNGPKIPSIATGMVGALLLLLVVALGIGLFMRRRHIVRKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Left-handed homodimeric transmembrane domain of the human receptor tyrosine kinase ErbB1 (EGFR, HER1)
rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 12
structure length 44
sequence length 44
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2m0bA00
2B88A 3FXDA 1DEEG 1X0TA 5DJTB 1H0TB 1OVUA 2QRXA 1LP1B 2RKLA 1JMBA 1S3JA 2QVAA 2LR2A 4JBZA 4K3AA 4BXLA 2LXBA 2UWJE 3PH0A 1BDDA 5K5GB 1MFTA 4ASVA 1NVOA 1OVRA 2JWDA 1ZW0A 1H0TA 4HKZH 4GODA 2KI7B 1EDJA 4WWIA 4NPDA 1FC2C 2M5AB 2KZJA 4ZMDA 2KZIA 2LXCB 2M0BA 1EDLA 2WMMA 2R44A 2B87B 4HJGH 3MZWB 4KJMA 3QWOC 1EC5A 5DJUB 1LP1A 2ZAEB 2KUBA 5CBOA 5CBNA 4IOIH 3ZDMA 4GOFA 2KS1B 3S1KA 1U7MA 1EDKA 1LT1A 1U7JA 2I8DA 3MHVA 4NPFX 2B87A 1SS1A 4K35A 1ZXGA 1EDIA 1OVVA 2KIKA 1JM0A 5C39A 2K3RA 3RGUA 1BDCA 2M5AA 4ASWA 5EFWB 2HR3A 4CPGA 2SPZA 1Q2NA 4NPEA 2B89A 3FXEA 2OTKE 2Q1KA 2P58A 4EYYQ 1Y47A 4GOEA 4HB1A 4MN4C 4ZNCA
chains in the Genus database with same CATH superfamily
1E5WA 2XNDH 1KYOD 1HWTC 1GL2D 3TGUE 2K37A 2JEEA 3HUSB 5TISE 3KHUA 1FDIA 4RKUJ 3CCJP 2K9JA 5KKZB 3S9OA 4OGQD 3RL0D 3CCQP 1SQXG 3CC2P 2Z5IA 3IFMA 4JPZB 2FFDC 2M5AB 1VQ4P 4Y28J 1FZBA 1CSBA 1VL2A 2A45G 1FZCA 1AVYA 3Q5PA 1SP4A 5KLVJ 2BCCJ 3NMDA 3C9IA 2ZAEB 2KP8A 3P7KA 2HODA 3RBZA 3CXHI 1NU1K 3P8CD 1NTKE 4OGQB 1SS1A 5APSA 1FZFA 1OW6A 5KLVD 2BCCD 2W8ZA 2C9NY 2YIUC 1N7SD 1KILB 5AVXB 3L71G 3KXDA 3EFGA 1YIJP 3H1KJ 4CPGA 2JR8A 3WU2H 4XFJA 1P84E 1KV4A 2K88A 3RK3C 2OTLP 3T97B 1OFCX 5AW9B 2FYNC 1NYHA 1JMMA 4N78E 3HE5B 1J1EB 3WUUA 5KAFE 2FYUG 3PLNA 1NTMG 2OYOA 1NKZB 4I1LA 1P84H 4LLHA 1L0LJ 4YXDC 5APYA 4WY4C 4XE5B 1BCCE 3L71J 2ZYDA 2N1TD 1DH3A 3B5NB 3V6IA 4I6MC 3RK2C 3L37A 4I7ZB 4DOJA 2KUBA 3V2PA 1LT9B 3L70G 3AECC 4JYCA 3JCUE 3M9HA 3M91A 1T2KC 1GW4A 5KAFH 3AE8C 4ZKUA 3L71D 4L76A 4Y99C 3HTKB 4R4LA 2QJKB 3A0HE 1ZR2A 1FZGA 2FKWB 1NO4A 1WMKA 1HVVA 2ZVNB 2R3SA 1S4XA 3SWKA 2WPVB 2FYUJ 2N1TB 3FXEA 2OTKE 3O6QA 2CPBA 1T3UA 2NPSD 3TGUG 5GTIE 3AE5C 4ZNCA 2IPPA 3TDKA 1RH5B 3IR9A 1AJYA 3CI9A 3AEGC 1HGZA 3JCUH 2IFNA 2FYUD 3GHGA 3CL3D 1ZLLA 2YKOA 3CWBE 3AE3C 2MJZA 5AVZB 1FDOA 3A0HH 1CI6A 4IL6X 3V2QA 4PD4E 2DW3A 1WT6A 2Q7CA 3H1JE 4O9BA 1URQD 1S9KD 3WUVA 5AW4B 4RO0A 4JF7A 3P8MC 5AVQB 2OGUA 4RJTA 1BGYE 1IFDA 5GTIH 2QJYC 5CCGD 1IFPA 3AEEC 2XDJA 1IK7A 4HJGH 4KJMA 4DT0A 1NTKG 1VQ8P 1LWUB 5AW0B 3AE2C 1SQBE 1Q86Q 1N73B 4A7PA 4GKGA 1FZCC 1W2EA 2E75B 4K35A 2D2CC 1A02J 2OYHB 2PRRA 3V2RA 4PD4H 1URQB 3MP7B 1HF9A 2O3JA 2K3RA 1LTJA 4I2LC 1SQVJ 1PP9E 1YJNP 1KZUB 2L91A 1NTZE 1SQXK 1HJ0A 1Q2NA 4JYBA 3E1RA 1SFCA 5AW1B 2IX7C 1X9VA 2KB7P 4H44C 1VQOP 1SQVD 1ZOYC 2QRXA 4H13C 3L4FA 1K8AQ 3E1IA 1SQQJ 2ZJSE 1WRGA 3AE7C 3K5BA 1EDJA 3HRNA 1AFOA 3L73J 3GMAA 1HGVA 1FC2C 1W2BO 2E74C 3AE1C 3CCUP 1KQLA 1BCCG 3BATA 2O01H 1LNQA 1EDLA 1VF5D 2R44A 3Q2YA 3L72J 2ZT9C 1FBMA 2FXMA 3H1LE 2N9BA 3L73D 4GOFA 1AV1A 4M3LA 1KFMA 3CXHE 3D71A 4PV1C 3KZIH 3W68A 2FFDB 4TT3H 4UB6E 1OVVA 2ZYGA 3PRJA 3L72D 1BE3E 2E76D 3M06A 3D6ZA 1YITP 2M3BA 3HE4B 1NU1J 1KB9D 1NTMK 1RF0A 1CZQA 5GTHE 3FGAD 1OW8A 2WSFJ 1J1DC 3BCCJ 5AW5B 1ZRTE 3LIEA 3CXHH 3S4RA 1H0TB 1JB0J 3CWBG 3TNUA 2RKLA 1KN7A 4UB6H 2QE7H 2K9YA 1MZ9A 1LTSC 5B5EE 4DJGA 1JEKA 2OYIA 2PFXA 2ZXXA 1SQPE 1G2CA 1BCCD 3H1JG 1QGKB 3D70A 4H0LD 1TU3F 2W83C 3TYYA 1L4AA 3H1IG 4B86A 3M0AA 3R4YA 3GHGC 1L0NE 5GTHH 1Q90D 1KQSO 2WMMA 3D6YA 1NKNA 2QIWA 3SFEC 1S5LX 3N4XA 3AEFC 1JUNA 1DD3A 1M56D 4C7NB 1YQ3C 1SQBG 4R4MA 3E7KA 1U7MA 2GUVA 4U3FJ 2E5TA 5B5EH 1EZVG 1RQUA 3MHVA 2WQYC 1DIPA 2Q9IA 1PGPA 3TK1A 5AVRB 2KS1A 1NTZG 4EDFA 3V2NA 4LC1A 3G4SP 1PGJA 1SVFA 5BVZA 3RK2B 2IBZI 2SPZA 2BEQD 3H1IJ 2YXQB 3CWBD 1KC8Q 1LTJC 1VQKP 2Q5UA 5CJ0A 3CCMP 1RF1A 1ZR4A 1LP1B 1QLED 1NTKK 1Q82Q 1NGMB 3LW5H 2J5UA 1K73Q 1U57A 3H1ID 1SFCC 3L74J 2W6AA 2Y0DA 1GZLA 1T8ZA 1X79B 3VP9A 1FAVA 2WWWA 3Q1MA 3OAKA 2Q3IA 2Y0EA 3ITKA 3CX5D 1LJ2A 2B87B 1EZVD 2HG5D 3H1LG 3L74D 1UIXA 2IDBA 4YXWH 3CD6P 1JY3P 3L75J 5AVVB 1EDKA 1U7JA 1BE3G 1GL2A 1GTWA 4QMAA 1DX7A 1EXJA 1ZXGA 1KILD 3WU2E 3BRTB 5AW8B 1QL2A 2KLUA 2Q6QA 3CMEP 2YKQA 3L75D 1H88A 2QSIA 3QH9A 1AQ5A 1FZCB 3SWFA 2P2UA 2D2CB 1KILA 1R8EA 1X0TA 3BASA 2AXCA 5KTBA 2HODB 2RH0A 1RF0C 1Q7YQ 1SQPG 3CPWO 1MUUA 1SQXJ 1JY2P 1A02F 1BDDA 2V4HA 2FYZA 3T97A 1VQ9P 2JWDA 1L0NG 1VQ7P 1N8RQ 3HE5A 3H1LD 2WITA 3B5ND 1PPJG 3CLQA 2OYIC 1N7SA 1SQXD 2WSEH 1KQFB 2KSJA 1JY3O 3RK3E 3G3ZA 1PGOA 1OZHA 3RL0g 1L4AC 5AVUB 1EC5A 4KHXA 1Z56A 1CW5A 3L36A 3B5NA 2QM8A 2M3EA 2KXPB 5KLIC 3H1HE 2YMYA 1L2PA 3BRVB 1ZRTD 2BASA 1T3JA 2ZT9B 1JTHA 1JNMA 3V5BA 4D6TE 3HTKA 5TJHA 1EQ7A 2I1KA 5AW3B 3Q5SA 2W90A 4WBAA 1D7MA 2KK7A 3HD7B 1M57D 4DZOA 3A7OA 1DEEG 3OW2O 2YXRB 2N1TA 3A2AA 1L0ND 4BXLA 1SQBK 1NTMJ 1KFNA 2A06E 1EXIA 1PZQA 1PPJD 1ZW0A 1AQTA 1Q81Q 1RF1C 3CCSP 2IFMA 1AVOA 1W5CE 2Y0CA 1K05A 3VP8A 3AEAC 3M9QA 1S2EA 1NTZK 2KLVA 2LXCB 1OWAA 1NTMD 3OJAB 3L70J 3L35A 3VMZA 3IAOA 2HPCA 3O6QB 3CCVP 3SFDC 1MV8A 2E75D 5DJUB 2NPSA 2QA4P 2KNCB 5KKZC 3EQ2A 1NHLA 3M0DA 3L70D 5CMZA 1VQLP 3A3YB 1JM0A 3RGUA 1YYCA 1LWUA 2W6BA 1OMIA 4HH2A 3TGUJ 1GL2C 4N6JA 2QJPC 1FZEA 2IBZE 1K04A 1URQA 2P58A 1FU1A 1NOHA 4MN4C 2V7QH 2B9BA 3N7NA 5CCGA 3KDPB 1GDTA 4OGQC 3RL0C 5DJTB 1N2DC 1G1JA 4JQ0D 3V4WA 2POHA 3TGUD 1RHZB 1QX8A 2ZYAA 3MD0A 2LXBA 2Y9ZA 1FS0E 1R5LA 3PH0A 1YJWP 2WSCH 2W27A 1KILC 2WT7A 1S5LE 2KI7B 4WWIA 3II6A 1IJDB 3CCEP 5E79E 1RE4A 4BRYB 3PJSK 1JCCA 3MTUE 2BEZF 2M0BA 1NTKJ 2OTJP 2R5DA 3CC7P 3U1CA 3KZIE 3C1LA 4YTPC 2O1KA 1SFCB 2FY8A 5CBNA 3MUDA 3P8CE 1FJKA 1N7SC 2C0XA 2P10A 3EFFK 1NTKD 1FDMA 5KLVE 2BCCE 1S5LH 1SQPK 1LTGC 1USEA 1BDCA 5E79H 4L74A 1J2JB 1KB9I 4D6TG 2JDIH 2XNXA 3A0BE 5APQA 1L0NK 2Z4EA 2B89A 2OQQA 3B5NC 5CCHD 1GK4A 4EYYQ 2VRSA 1Y47A 2RN0A 1P84D 2RMZA 3VMYA 1PFIA 1FJPA 4BWNA 4L73A 2A06G 3H1KE 2P1JA 4K3AA 1FZAA 4N78D 2GA1A 1BCCJ 1N86A 1NVOA 5CCHA 1H0TA 1VQPP 4XA4A 1KMIZ 4GODA 2N1TC 1MFZA 1USDA 1VDFA 3A0BH 3JSVC 3BVHA 1DD4A 2JP3A 3AE9C 1OIPA 2YIUB 4IFMA 3H32A 1FOSF 1GD2E 1GW3A 2H43A 1G1IA 3OA7A 4C46A 1BGYG 3RK3B 3TNUB 1L0LE 3FX0A 3B8EB 2O1JA 1LTTC 2FYNB 3WUTA 2R32A 3L71E 2KSEA 2A45H 4OH8B 2OYIB 2FXOA 3RK2D 5C39A 1HJBA 4ASWA 2NPSC 3WMM0 3FWNA 5APVA 1ZN5A 2IBZG 2FXPA 1L4AB 1T2KD 2E43A 1M90Q 3M0DC 2Q1KA 3CMAP 3PTZA 3CWBJ 5AW2B 1M1JA 1PP9G 1LWUC 4GOEA 2L5GB 3F89A 4WY4B 1PV3A 2H89C 4PJ0H 4U7JA 1LGHB 5KLIB 2H88C 1KORA 2FYUE 3H1JJ 2ITAA 2QVAA 1URQC 2GUSA 1BGYJ 2R5BA 1JY3N 1OVRA 1KYOI 5CCGC 4KT0J 4HKZH 3PP5A 3C8VA 1S9KE 2JJLA 4PD4D 4Y99B 1IFIA 3GF7A 1IFMA 3H1JD 3CX5I 1GU4A 1Y9BA 2GM4A 1SQBJ 1EZVI 2IYOA 1BGYD 4AYCA 3G71P 5CBOA 1RE4C 1PP9J 1K9MQ 1PIXA 3HUSA 3I56P 1RF1B 3EWKA 1NTZJ 2I8DA 5CHXA 3TSIA 2B87A 1SQBD 1OX3A 2O01J 1LTIC 3H6PA 1VQ5P 1BSHA 3MUDC 2M5AA 1JY2N 1PP9D 5APWA 4W80A 5L8RJ 2D2CD 1NAYA 1NTZD 3AE4C 1GMJA 3VMAA 2R3CA 1SQVE 1JCDA 4OVNF 3H1KG 1GU5A 2B88A 2K9JB 2QJYB 3Q3DA 1IFJA 1HTLC 1E79H 4JBZA 1HUCA 3F5HA 1R5SA 4IFFA 3A5TA 1GL2B 3MGNA 1VF5C 2QJPB 4H44D 4ASVA 2LKMA 4GDOA 4H13D 2WPQA 4NPDA 1QL1A 2KOGA 2QM7A 1KTMA 4IL6E 1YI2P 5TISH 3H1LJ 2O01N 3GG2A 2IYPA 3RL0B 1SQQE 3KPEA 2WTYA 5CCHC 3USSA 2A45I 1BE3J 5AVWB 2E74D 3L73E 3NXSA 1S1CX 1L0LG 2E76C 3RBXA 1T6AA 4IOIH 2G8YA 1M1KQ 1RQVA 3UIAA 4H44B 3CXHD 1KQGB 3L72E 4H13B 5AVSB 2ZT9D 2ZXEB 5APTA 4IL6H 1BE3D 1VPCA 4PV1D 1KB9E 2XU6A 4DCKA 3H1KD 3HD7D 3IN6A 2E74B 1N7SB 1XTGB 2WPRA 1SQPJ 4YPCA 1LT9A 1GK6A 1OVUA 1NU1E 3JC22 4H0LC 2CPSA 1L0NJ 1NH4A 2I1JA 1M1JC 1HBWA 4GIFA 4WVZA 2FBWC 3HD7A 4PV1B 3NTNA 5K5GB 3FWLA 3BCCE 2P7JA 1SQPD 1JY2O 3G9RA 1KB9H 1LTBC 4RESB 4UB8E 2KYVA 2JO1A 3AEDC 3I5CA 1JTHB 1L0LD 2XZRA 1QVGO 2ZFCA 2IZ1A 2NZ2A 3LW5J 2CK3H 1X22A 3VMXA 2Z5HA 1J1DB 3ZDMA 5AW6B 2WSFH 5M1BA 4NPFX 1IZNB 5KJ7D 4OWFA 3B71A 4UB8H 2KNCA 2HYNA 3HUSC 2OARA 4U3FE 3GF3A 3P32A 3VYIA 3G6EP 3LIDA 1RE3A 1SQVG 5APUA 1IK9A 1ZV8A 3GHGB 4IFDK 2AXTE 1NAFA 5KJ7A 3W67A 1NWQA 1CI6B 2HPCB 1N73A 1Y8AA 1JMBA 2LR2A 2NPSB 2WVRA 2H7HA 2NRGA 3H1IE 2OYHA 2UWJE 1QEXA 3VOPA 5KLVK 1MFTA 1OW7A 3CC4P 3PHLA 3KQGA 1KYOE 5H2FE 2W6JH 4EIJA 1SQQG 2KZJA 1IFNA 2XV5A 4Z1MH 2YNYA 2AEJA 1PL5A 1SFCD 4GT1A 3CX5E 2XKMA 1EZVE 2AXTH 3L74E 3L73G 1LTAC 3MZWB 3MIWA 3SWYA 5AVTB 1QVFO 4BRYA 2HFED 1LTJB 4N3YB 1RY3A 3S1KA 3L72G 2C0WA 4W7ZA 1KILE 1YHQP 1X8YA 1EDIA 1VQ6P 1PGQA 1KYOH 5H2FH 2WSEJ 5BU5A 2J58A 5KAIE 3TF5A 2WT7B 1YTZI 3L75E 1J1EC 4LGDE 5AW7B 3CX5H 3CCRP 1JOCA 1IO4A 3IF4A 2MKVA 1P84I 3H1HG 1DEBA 3SSUA 1NU1G 1YQ4C 4HYTB 4W7YA 1UIIA 3M9BA 5APXA 3VN0A 2JWAA 3CCLP 4TLFA 2E42A 2QG4A 1S3JA 2FFDA 4AUWA 1L0LK 3BCCG 5BU8B 1S72P 1SQQD 1YTZT 4I7ZC 2WZ7A 3VTPC 2Q3EA 5KAIH 1FOSE 1LT9C 3HE4A 1FE6A 4ZMDA 1SQXE 2QJKC 3HD7C 2WSSH 1AA0A 4AQRD 1OXZA 3V4QA 1XTCC 3RK3D 3ABVC 3GLMA 3H1HJ 3QWOC 1VF5B 1H89A 1M7LA 4EOTA 2JKVA 4L75A 2FYUK 5AVYB 1SLQA 4EI2A 3KYQA 4D6TJ 2KIKA 3I55P 4U3FG 1L4AD 3NFQA 2PP6A 2IZ0A 2E5YA 3AEBC 3H1HD 1NU1D 2C9LY 3GW6A 4PJ0E 2E76B 1NJIQ 4NPEA 1ZP0C 4WY4D 2G3AA 5CJ4A 4C7NA 4D6TD 4C7RA 3H32B 1JO5A 2HLOA 2N9YB 5B66E 2YKPA 3BCCD 1G2CB 3FXDA 1KD1Q 2QEXP 3O8ZA 1RE3C 3U59A 2YO3A 2M8RA 1IC2A 1M8OB 1PPJE 3H25A 2A06D 4WY4A 3B4SA 2YMKA 1H8AA 5KJ7C 1VQNP 4PD4I 2K1AA 1ZMEC 2Y9YA 1N73C 2V7QJ 2E75C 3Q5RA 1HH0A 3L74G 3R2PA 1NTME 2KZIA 2OYHC 2AEMA 4WB4A 4H0LB 4ZKPA 5B66H 2H8PD 1M1JB 1SQVK 2WSCJ 2WPSA 1LP1A 2PGDA 2PAJA 2KS1B 4U3FD 1LT1A 3L70E 1N7LA 1BSNA 2AEFA 3L75G 2ZVOB 3U1AA 2J59M 1YBKA 5EFWB 3AE6C 5KLVG 2HR3A 2BCCG 2P67A 1SQQK 1MKMA 2YO2A 2IBZD 1VQMP 1YJ9P 4HB1A
chains in the Genus database with same CATH topology
2B88A 3FXDA 1DEEG 1X0TA 5DJTB 1H0TB 1OVUA 2QRXA 1LP1B 2RKLA 1JMBA 1S3JA 2QVAA 2LR2A 4JBZA 4K3AA 4BXLA 2LXBA 2UWJE 3PH0A 1BDDA 5K5GB 1MFTA 4ASVA 1NVOA 1OVRA 2JWDA 1ZW0A 1H0TA 4HKZH 4GODA 2KI7B 1EDJA 4WWIA 4NPDA 1FC2C 2M5AB 2KZJA 4ZMDA 2KZIA 2LXCB 2M0BA 1EDLA 2WMMA 2R44A 2B87B 4HJGH 3MZWB 4KJMA 3QWOC 1EC5A 5DJUB 1LP1A 2ZAEB 2KUBA 5CBOA 5CBNA 4IOIH 3ZDMA 4GOFA 2KS1B 3S1KA 1U7MA 1EDKA 1LT1A 1U7JA 2I8DA 3MHVA 4NPFX 2B87A 1SS1A 4K35A 1ZXGA 1EDIA 1OVVA 2KIKA 1JM0A 5C39A 2K3RA 3RGUA 1BDCA 2M5AA 4ASWA 5EFWB 2HR3A 4CPGA 2SPZA 1Q2NA 4NPEA 2B89A 3FXEA 2OTKE 2Q1KA 2P58A 4EYYQ 1Y47A 4GOEA 4HB1A 4MN4C 4ZNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B88 A;  3FXD A;  1DEE G;  1X0T A;  5DJT B;  1H0T B;  1OVU A;  2QRX A;  1LP1 B;  2RKL A;  1JMB A;  1S3J A;  2QVA A;  2LR2 A;  4JBZ A;  4K3A A;  4BXL A;  2LXB A;  2UWJ E;  3PH0 A;  1BDD A;  5K5G B;  1MFT A;  4ASV A;  1NVO A;  1OVR A;  2JWD A;  1ZW0 A;  1H0T A;  4HKZ H;  4GOD A;  2KI7 B;  1EDJ A;  4WWI A;  4NPD A;  1FC2 C;  2M5A B;  2KZJ A;  4ZMD A;  2KZI A;  2LXC B;  2M0B A;  1EDL A;  2WMM A;  2R44 A;  2B87 B;  4HJG H;  3MZW B;  4KJM A;  3QWO C;  1EC5 A;  5DJU B;  1LP1 A;  2ZAE B;  2KUB A;  5CBO A;  5CBN A;  4IOI H;  3ZDM A;  4GOF A;  2KS1 B;  3S1K A;  1U7M A;  1EDK A;  1LT1 A;  1U7J A;  2I8D A;  3MHV A;  4NPF X;  2B87 A;  1SS1 A;  4K35 A;  1ZXG A;  1EDI A;  1OVV A;  2KIK A;  1JM0 A;  5C39 A;  2K3R A;  3RGU A;  1BDC A;  2M5A A;  4ASW A;  5EFW B;  2HR3 A;  4CPG A;  2SPZ A;  1Q2N A;  4NPE A;  2B89 A;  3FXE A;  2OTK E;  2Q1K A;  2P58 A;  4EYY Q;  1Y47 A;  4GOE A;  4HB1 A;  4MN4 C;  4ZNC A; 
#chains in the Genus database with same CATH topology
 1E5W A;  2XND H;  1KYO D;  1HWT C;  1GL2 D;  3TGU E;  2K37 A;  2JEE A;  3HUS B;  5TIS E;  3KHU A;  1FDI A;  4RKU J;  3CCJ P;  2K9J A;  5KKZ B;  3S9O A;  4OGQ D;  3RL0 D;  3CCQ P;  1SQX G;  3CC2 P;  2Z5I A;  3IFM A;  4JPZ B;  2FFD C;  2M5A B;  1VQ4 P;  4Y28 J;  1FZB A;  1CSB A;  1VL2 A;  2A45 G;  1FZC A;  1AVY A;  3Q5P A;  1SP4 A;  5KLV J;  2BCC J;  3NMD A;  3C9I A;  2ZAE B;  2KP8 A;  3P7K A;  2HOD A;  3RBZ A;  3CXH I;  1NU1 K;  3P8C D;  1NTK E;  4OGQ B;  1SS1 A;  5APS A;  1FZF A;  1OW6 A;  5KLV D;  2BCC D;  2W8Z A;  2C9N Y;  2YIU C;  1N7S D;  1KIL B;  5AVX B;  3L71 G;  3KXD A;  3EFG A;  1YIJ P;  3H1K J;  4CPG A;  2JR8 A;  3WU2 H;  4XFJ A;  1P84 E;  1KV4 A;  2K88 A;  3RK3 C;  2OTL P;  3T97 B;  1OFC X;  5AW9 B;  2FYN C;  1NYH A;  1JMM A;  4N78 E;  3HE5 B;  1J1E B;  3WUU A;  5KAF E;  2FYU G;  3PLN A;  1NTM G;  2OYO A;  1NKZ B;  4I1L A;  1P84 H;  4LLH A;  1L0L J;  4YXD C;  5APY A;  4WY4 C;  4XE5 B;  1BCC E;  3L71 J;  2ZYD A;  2N1T D;  1DH3 A;  3B5N B;  3V6I A;  4I6M C;  3RK2 C;  3L37 A;  4I7Z B;  4DOJ A;  2KUB A;  3V2P A;  1LT9 B;  3L70 G;  3AEC C;  4JYC A;  3JCU E;  3M9H A;  3M91 A;  1T2K C;  1GW4 A;  5KAF H;  3AE8 C;  4ZKU A;  3L71 D;  4L76 A;  4Y99 C;  3HTK B;  4R4L A;  2QJK B;  3A0H E;  1ZR2 A;  1FZG A;  2FKW B;  1NO4 A;  1WMK A;  1HVV A;  2ZVN B;  2R3S A;  1S4X A;  3SWK A;  2WPV B;  2FYU J;  2N1T B;  3FXE A;  2OTK E;  3O6Q A;  2CPB A;  1T3U A;  2NPS D;  3TGU G;  5GTI E;  3AE5 C;  4ZNC A;  2IPP A;  3TDK A;  1RH5 B;  3IR9 A;  1AJY A;  3CI9 A;  3AEG C;  1HGZ A;  3JCU H;  2IFN A;  2FYU D;  3GHG A;  3CL3 D;  1ZLL A;  2YKO A;  3CWB E;  3AE3 C;  2MJZ A;  5AVZ B;  1FDO A;  3A0H H;  1CI6 A;  4IL6 X;  3V2Q A;  4PD4 E;  2DW3 A;  1WT6 A;  2Q7C A;  3H1J E;  4O9B A;  1URQ D;  1S9K D;  3WUV A;  5AW4 B;  4RO0 A;  4JF7 A;  3P8M C;  5AVQ B;  2OGU A;  4RJT A;  1BGY E;  1IFD A;  5GTI H;  2QJY C;  5CCG D;  1IFP A;  3AEE C;  2XDJ A;  1IK7 A;  4HJG H;  4KJM A;  4DT0 A;  1NTK G;  1VQ8 P;  1LWU B;  5AW0 B;  3AE2 C;  1SQB E;  1Q86 Q;  1N73 B;  4A7P A;  4GKG A;  1FZC C;  1W2E A;  2E75 B;  4K35 A;  2D2C C;  1A02 J;  2OYH B;  2PRR A;  3V2R A;  4PD4 H;  1URQ B;  3MP7 B;  1HF9 A;  2O3J A;  2K3R A;  1LTJ A;  4I2L C;  1SQV J;  1PP9 E;  1YJN P;  1KZU B;  2L91 A;  1NTZ E;  1SQX K;  1HJ0 A;  1Q2N A;  4JYB A;  3E1R A;  1SFC A;  5AW1 B;  2IX7 C;  1X9V A;  2KB7 P;  4H44 C;  1VQO P;  1SQV D;  1ZOY C;  2QRX A;  4H13 C;  3L4F A;  1K8A Q;  3E1I A;  1SQQ J;  2ZJS E;  1WRG A;  3AE7 C;  3K5B A;  1EDJ A;  3HRN A;  1AFO A;  3L73 J;  3GMA A;  1HGV A;  1FC2 C;  1W2B O;  2E74 C;  3AE1 C;  3CCU P;  1KQL A;  1BCC G;  3BAT A;  2O01 H;  1LNQ A;  1EDL A;  1VF5 D;  2R44 A;  3Q2Y A;  3L72 J;  2ZT9 C;  1FBM A;  2FXM A;  3H1L E;  2N9B A;  3L73 D;  4GOF A;  1AV1 A;  4M3L A;  1KFM A;  3CXH E;  3D71 A;  4PV1 C;  3KZI H;  3W68 A;  2FFD B;  4TT3 H;  4UB6 E;  1OVV A;  2ZYG A;  3PRJ A;  3L72 D;  1BE3 E;  2E76 D;  3M06 A;  3D6Z A;  1YIT P;  2M3B A;  3HE4 B;  1NU1 J;  1KB9 D;  1NTM K;  1RF0 A;  1CZQ A;  5GTH E;  3FGA D;  1OW8 A;  2WSF J;  1J1D C;  3BCC J;  5AW5 B;  1ZRT E;  3LIE A;  3CXH H;  3S4R A;  1H0T B;  1JB0 J;  3CWB G;  3TNU A;  2RKL A;  1KN7 A;  4UB6 H;  2QE7 H;  2K9Y A;  1MZ9 A;  1LTS C;  5B5E E;  4DJG A;  1JEK A;  2OYI A;  2PFX A;  2ZXX A;  1SQP E;  1G2C A;  1BCC D;  3H1J G;  1QGK B;  3D70 A;  4H0L D;  1TU3 F;  2W83 C;  3TYY A;  1L4A A;  3H1I G;  4B86 A;  3M0A A;  3R4Y A;  3GHG C;  1L0N E;  5GTH H;  1Q90 D;  1KQS O;  2WMM A;  3D6Y A;  1NKN A;  2QIW A;  3SFE C;  1S5L X;  3N4X A;  3AEF C;  1JUN A;  1DD3 A;  1M56 D;  4C7N B;  1YQ3 C;  1SQB G;  4R4M A;  3E7K A;  1U7M A;  2GUV A;  4U3F J;  2E5T A;  5B5E H;  1EZV G;  1RQU A;  3MHV A;  2WQY C;  1DIP A;  2Q9I A;  1PGP A;  3TK1 A;  5AVR B;  2KS1 A;  1NTZ G;  4EDF A;  3V2N A;  4LC1 A;  3G4S P;  1PGJ A;  1SVF A;  5BVZ A;  3RK2 B;  2IBZ I;  2SPZ A;  2BEQ D;  3H1I J;  2YXQ B;  3CWB D;  1KC8 Q;  1LTJ C;  1VQK P;  2Q5U A;  5CJ0 A;  3CCM P;  1RF1 A;  1ZR4 A;  1LP1 B;  1QLE D;  1NTK K;  1Q82 Q;  1NGM B;  3LW5 H;  2J5U A;  1K73 Q;  1U57 A;  3H1I D;  1SFC C;  3L74 J;  2W6A A;  2Y0D A;  1GZL A;  1T8Z A;  1X79 B;  3VP9 A;  1FAV A;  2WWW A;  3Q1M A;  3OAK A;  2Q3I A;  2Y0E A;  3ITK A;  3CX5 D;  1LJ2 A;  2B87 B;  1EZV D;  2HG5 D;  3H1L G;  3L74 D;  1UIX A;  2IDB A;  4YXW H;  3CD6 P;  1JY3 P;  3L75 J;  5AVV B;  1EDK A;  1U7J A;  1BE3 G;  1GL2 A;  1GTW A;  4QMA A;  1DX7 A;  1EXJ A;  1ZXG A;  1KIL D;  3WU2 E;  3BRT B;  5AW8 B;  1QL2 A;  2KLU A;  2Q6Q A;  3CME P;  2YKQ A;  3L75 D;  1H88 A;  2QSI A;  3QH9 A;  1AQ5 A;  1FZC B;  3SWF A;  2P2U A;  2D2C B;  1KIL A;  1R8E A;  1X0T A;  3BAS A;  2AXC A;  5KTB A;  2HOD B;  2RH0 A;  1RF0 C;  1Q7Y Q;  1SQP G;  3CPW O;  1MUU A;  1SQX J;  1JY2 P;  1A02 F;  1BDD A;  2V4H A;  2FYZ A;  3T97 A;  1VQ9 P;  2JWD A;  1L0N G;  1VQ7 P;  1N8R Q;  3HE5 A;  3H1L D;  2WIT A;  3B5N D;  1PPJ G;  3CLQ A;  2OYI C;  1N7S A;  1SQX D;  2WSE H;  1KQF B;  2KSJ A;  1JY3 O;  3RK3 E;  3G3Z A;  1PGO A;  1OZH A;  3RL0 g;  1L4A C;  5AVU B;  1EC5 A;  4KHX A;  1Z56 A;  1CW5 A;  3L36 A;  3B5N A;  2QM8 A;  2M3E A;  2KXP B;  5KLI C;  3H1H E;  2YMY A;  1L2P A;  3BRV B;  1ZRT D;  2BAS A;  1T3J A;  2ZT9 B;  1JTH A;  1JNM A;  3V5B A;  4D6T E;  3HTK A;  5TJH A;  1EQ7 A;  2I1K A;  5AW3 B;  3Q5S A;  2W90 A;  4WBA A;  1D7M A;  2KK7 A;  3HD7 B;  1M57 D;  4DZO A;  3A7O A;  1DEE G;  3OW2 O;  2YXR B;  2N1T A;  3A2A A;  1L0N D;  4BXL A;  1SQB K;  1NTM J;  1KFN A;  2A06 E;  1EXI A;  1PZQ A;  1PPJ D;  1ZW0 A;  1AQT A;  1Q81 Q;  1RF1 C;  3CCS P;  2IFM A;  1AVO A;  1W5C E;  2Y0C A;  1K05 A;  3VP8 A;  3AEA C;  3M9Q A;  1S2E A;  1NTZ K;  2KLV A;  2LXC B;  1OWA A;  1NTM D;  3OJA B;  3L70 J;  3L35 A;  3VMZ A;  3IAO A;  2HPC A;  3O6Q B;  3CCV P;  3SFD C;  1MV8 A;  2E75 D;  5DJU B;  2NPS A;  2QA4 P;  2KNC B;  5KKZ C;  3EQ2 A;  1NHL A;  3M0D A;  3L70 D;  5CMZ A;  1VQL P;  3A3Y B;  1JM0 A;  3RGU A;  1YYC A;  1LWU A;  2W6B A;  1OMI A;  4HH2 A;  3TGU J;  1GL2 C;  4N6J A;  2QJP C;  1FZE A;  2IBZ E;  1K04 A;  1URQ A;  2P58 A;  1FU1 A;  1NOH A;  4MN4 C;  2V7Q H;  2B9B A;  3N7N A;  5CCG A;  3KDP B;  1GDT A;  4OGQ C;  3RL0 C;  5DJT B;  1N2D C;  1G1J A;  4JQ0 D;  3V4W A;  2POH A;  3TGU D;  1RHZ B;  1QX8 A;  2ZYA A;  3MD0 A;  2LXB A;  2Y9Z A;  1FS0 E;  1R5L A;  3PH0 A;  1YJW P;  2WSC H;  2W27 A;  1KIL C;  2WT7 A;  1S5L E;  2KI7 B;  4WWI A;  3II6 A;  1IJD B;  3CCE P;  5E79 E;  1RE4 A;  4BRY B;  3PJS K;  1JCC A;  3MTU E;  2BEZ F;  2M0B A;  1NTK J;  2OTJ P;  2R5D A;  3CC7 P;  3U1C A;  3KZI E;  3C1L A;  4YTP C;  2O1K A;  1SFC B;  2FY8 A;  5CBN A;  3MUD A;  3P8C E;  1FJK A;  1N7S C;  2C0X A;  2P10 A;  3EFF K;  1NTK D;  1FDM A;  5KLV E;  2BCC E;  1S5L H;  1SQP K;  1LTG C;  1USE A;  1BDC A;  5E79 H;  4L74 A;  1J2J B;  1KB9 I;  4D6T G;  2JDI H;  2XNX A;  3A0B E;  5APQ A;  1L0N K;  2Z4E A;  2B89 A;  2OQQ A;  3B5N C;  5CCH D;  1GK4 A;  4EYY Q;  2VRS A;  1Y47 A;  2RN0 A;  1P84 D;  2RMZ A;  3VMY A;  1PFI A;  1FJP A;  4BWN A;  4L73 A;  2A06 G;  3H1K E;  2P1J A;  4K3A A;  1FZA A;  4N78 D;  2GA1 A;  1BCC J;  1N86 A;  1NVO A;  5CCH A;  1H0T A;  1VQP P;  4XA4 A;  1KMI Z;  4GOD A;  2N1T C;  1MFZ A;  1USD A;  1VDF A;  3A0B H;  3JSV C;  3BVH A;  1DD4 A;  2JP3 A;  3AE9 C;  1OIP A;  2YIU B;  4IFM A;  3H32 A;  1FOS F;  1GD2 E;  1GW3 A;  2H43 A;  1G1I A;  3OA7 A;  4C46 A;  1BGY G;  3RK3 B;  3TNU B;  1L0L E;  3FX0 A;  3B8E B;  2O1J A;  1LTT C;  2FYN B;  3WUT A;  2R32 A;  3L71 E;  2KSE A;  2A45 H;  4OH8 B;  2OYI B;  2FXO A;  3RK2 D;  5C39 A;  1HJB A;  4ASW A;  2NPS C;  3WMM 0;  3FWN A;  5APV A;  1ZN5 A;  2IBZ G;  2FXP A;  1L4A B;  1T2K D;  2E43 A;  1M90 Q;  3M0D C;  2Q1K A;  3CMA P;  3PTZ A;  3CWB J;  5AW2 B;  1M1J A;  1PP9 G;  1LWU C;  4GOE A;  2L5G B;  3F89 A;  4WY4 B;  1PV3 A;  2H89 C;  4PJ0 H;  4U7J A;  1LGH B;  5KLI B;  2H88 C;  1KOR A;  2FYU E;  3H1J J;  2ITA A;  2QVA A;  1URQ C;  2GUS A;  1BGY J;  2R5B A;  1JY3 N;  1OVR A;  1KYO I;  5CCG C;  4KT0 J;  4HKZ H;  3PP5 A;  3C8V A;  1S9K E;  2JJL A;  4PD4 D;  4Y99 B;  1IFI A;  3GF7 A;  1IFM A;  3H1J D;  3CX5 I;  1GU4 A;  1Y9B A;  2GM4 A;  1SQB J;  1EZV I;  2IYO A;  1BGY D;  4AYC A;  3G71 P;  5CBO A;  1RE4 C;  1PP9 J;  1K9M Q;  1PIX A;  3HUS A;  3I56 P;  1RF1 B;  3EWK A;  1NTZ J;  2I8D A;  5CHX A;  3TSI A;  2B87 A;  1SQB D;  1OX3 A;  2O01 J;  1LTI C;  3H6P A;  1VQ5 P;  1BSH A;  3MUD C;  2M5A A;  1JY2 N;  1PP9 D;  5APW A;  4W80 A;  5L8R J;  2D2C D;  1NAY A;  1NTZ D;  3AE4 C;  1GMJ A;  3VMA A;  2R3C A;  1SQV E;  1JCD A;  4OVN F;  3H1K G;  1GU5 A;  2B88 A;  2K9J B;  2QJY B;  3Q3D A;  1IFJ A;  1HTL C;  1E79 H;  4JBZ A;  1HUC A;  3F5H A;  1R5S A;  4IFF A;  3A5T A;  1GL2 B;  3MGN A;  1VF5 C;  2QJP B;  4H44 D;  4ASV A;  2LKM A;  4GDO A;  4H13 D;  2WPQ A;  4NPD A;  1QL1 A;  2KOG A;  2QM7 A;  1KTM A;  4IL6 E;  1YI2 P;  5TIS H;  3H1L J;  2O01 N;  3GG2 A;  2IYP A;  3RL0 B;  1SQQ E;  3KPE A;  2WTY A;  5CCH C;  3USS A;  2A45 I;  1BE3 J;  5AVW B;  2E74 D;  3L73 E;  3NXS A;  1S1C X;  1L0L G;  2E76 C;  3RBX A;  1T6A A;  4IOI H;  2G8Y A;  1M1K Q;  1RQV A;  3UIA A;  4H44 B;  3CXH D;  1KQG B;  3L72 E;  4H13 B;  5AVS B;  2ZT9 D;  2ZXE B;  5APT A;  4IL6 H;  1BE3 D;  1VPC A;  4PV1 D;  1KB9 E;  2XU6 A;  4DCK A;  3H1K D;  3HD7 D;  3IN6 A;  2E74 B;  1N7S B;  1XTG B;  2WPR A;  1SQP J;  4YPC A;  1LT9 A;  1GK6 A;  1OVU A;  1NU1 E;  3JC2 2;  4H0L C;  2CPS A;  1L0N J;  1NH4 A;  2I1J A;  1M1J C;  1HBW A;  4GIF A;  4WVZ A;  2FBW C;  3HD7 A;  4PV1 B;  3NTN A;  5K5G B;  3FWL A;  3BCC E;  2P7J A;  1SQP D;  1JY2 O;  3G9R A;  1KB9 H;  1LTB C;  4RES B;  4UB8 E;  2KYV A;  2JO1 A;  3AED C;  3I5C A;  1JTH B;  1L0L D;  2XZR A;  1QVG O;  2ZFC A;  2IZ1 A;  2NZ2 A;  3LW5 J;  2CK3 H;  1X22 A;  3VMX A;  2Z5H A;  1J1D B;  3ZDM A;  5AW6 B;  2WSF H;  5M1B A;  4NPF X;  1IZN B;  5KJ7 D;  4OWF A;  3B71 A;  4UB8 H;  2KNC A;  2HYN A;  3HUS C;  2OAR A;  4U3F E;  3GF3 A;  3P32 A;  3VYI A;  3G6E P;  3LID A;  1RE3 A;  1SQV G;  5APU A;  1IK9 A;  1ZV8 A;  3GHG B;  4IFD K;  2AXT E;  1NAF A;  5KJ7 A;  3W67 A;  1NWQ A;  1CI6 B;  2HPC B;  1N73 A;  1Y8A A;  1JMB A;  2LR2 A;  2NPS B;  2WVR A;  2H7H A;  2NRG A;  3H1I E;  2OYH A;  2UWJ E;  1QEX A;  3VOP A;  5KLV K;  1MFT A;  1OW7 A;  3CC4 P;  3PHL A;  3KQG A;  1KYO E;  5H2F E;  2W6J H;  4EIJ A;  1SQQ G;  2KZJ A;  1IFN A;  2XV5 A;  4Z1M H;  2YNY A;  2AEJ A;  1PL5 A;  1SFC D;  4GT1 A;  3CX5 E;  2XKM A;  1EZV E;  2AXT H;  3L74 E;  3L73 G;  1LTA C;  3MZW B;  3MIW A;  3SWY A;  5AVT B;  1QVF O;  4BRY A;  2HFE D;  1LTJ B;  4N3Y B;  1RY3 A;  3S1K A;  3L72 G;  2C0W A;  4W7Z A;  1KIL E;  1YHQ P;  1X8Y A;  1EDI A;  1VQ6 P;  1PGQ A;  1KYO H;  5H2F H;  2WSE J;  5BU5 A;  2J58 A;  5KAI E;  3TF5 A;  2WT7 B;  1YTZ I;  3L75 E;  1J1E C;  4LGD E;  5AW7 B;  3CX5 H;  3CCR P;  1JOC A;  1IO4 A;  3IF4 A;  2MKV A;  1P84 I;  3H1H G;  1DEB A;  3SSU A;  1NU1 G;  1YQ4 C;  4HYT B;  4W7Y A;  1UII A;  3M9B A;  5APX A;  3VN0 A;  2JWA A;  3CCL P;  4TLF A;  2E42 A;  2QG4 A;  1S3J A;  2FFD A;  4AUW A;  1L0L K;  3BCC G;  5BU8 B;  1S72 P;  1SQQ D;  1YTZ T;  4I7Z C;  2WZ7 A;  3VTP C;  2Q3E A;  5KAI H;  1FOS E;  1LT9 C;  3HE4 A;  1FE6 A;  4ZMD A;  1SQX E;  2QJK C;  3HD7 C;  2WSS H;  1AA0 A;  4AQR D;  1OXZ A;  3V4Q A;  1XTC C;  3RK3 D;  3ABV C;  3GLM A;  3H1H J;  3QWO C;  1VF5 B;  1H89 A;  1M7L A;  4EOT A;  2JKV A;  4L75 A;  2FYU K;  5AVY B;  1SLQ A;  4EI2 A;  3KYQ A;  4D6T J;  2KIK A;  3I55 P;  4U3F G;  1L4A D;  3NFQ A;  2PP6 A;  2IZ0 A;  2E5Y A;  3AEB C;  3H1H D;  1NU1 D;  2C9L Y;  3GW6 A;  4PJ0 E;  2E76 B;  1NJI Q;  4NPE A;  1ZP0 C;  4WY4 D;  2G3A A;  5CJ4 A;  4C7N A;  4D6T D;  4C7R A;  3H32 B;  1JO5 A;  2HLO A;  2N9Y B;  5B66 E;  2YKP A;  3BCC D;  1G2C B;  3FXD A;  1KD1 Q;  2QEX P;  3O8Z A;  1RE3 C;  3U59 A;  2YO3 A;  2M8R A;  1IC2 A;  1M8O B;  1PPJ E;  3H25 A;  2A06 D;  4WY4 A;  3B4S A;  2YMK A;  1H8A A;  5KJ7 C;  1VQN P;  4PD4 I;  2K1A A;  1ZME C;  2Y9Y A;  1N73 C;  2V7Q J;  2E75 C;  3Q5R A;  1HH0 A;  3L74 G;  3R2P A;  1NTM E;  2KZI A;  2OYH C;  2AEM A;  4WB4 A;  4H0L B;  4ZKP A;  5B66 H;  2H8P D;  1M1J B;  1SQV K;  2WSC J;  2WPS A;  1LP1 A;  2PGD A;  2PAJ A;  2KS1 B;  4U3F D;  1LT1 A;  3L70 E;  1N7L A;  1BSN A;  2AEF A;  3L75 G;  2ZVO B;  3U1A A;  2J59 M;  1YBK A;  5EFW B;  3AE6 C;  5KLV G;  2HR3 A;  2BCC G;  2P67 A;  1SQQ K;  1MKM A;  2YO2 A;  2IBZ D;  1VQM P;  1YJ9 P;  4HB1 A; 
#chains in the Genus database with same CATH homology
 2B88 A;  3FXD A;  1DEE G;  1X0T A;  5DJT B;  1H0T B;  1OVU A;  2QRX A;  1LP1 B;  2RKL A;  1JMB A;  1S3J A;  2QVA A;  2LR2 A;  4JBZ A;  4K3A A;  4BXL A;  2LXB A;  2UWJ E;  3PH0 A;  1BDD A;  5K5G B;  1MFT A;  4ASV A;  1NVO A;  1OVR A;  2JWD A;  1ZW0 A;  1H0T A;  4HKZ H;  4GOD A;  2KI7 B;  1EDJ A;  4WWI A;  4NPD A;  1FC2 C;  2M5A B;  2KZJ A;  4ZMD A;  2KZI A;  2LXC B;  2M0B A;  1EDL A;  2WMM A;  2R44 A;  2B87 B;  4HJG H;  3MZW B;  4KJM A;  3QWO C;  1EC5 A;  5DJU B;  1LP1 A;  2ZAE B;  2KUB A;  5CBO A;  5CBN A;  4IOI H;  3ZDM A;  4GOF A;  2KS1 B;  3S1K A;  1U7M A;  1EDK A;  1LT1 A;  1U7J A;  2I8D A;  3MHV A;  4NPF X;  2B87 A;  1SS1 A;  4K35 A;  1ZXG A;  1EDI A;  1OVV A;  2KIK A;  1JM0 A;  5C39 A;  2K3R A;  3RGU A;  1BDC A;  2M5A A;  4ASW A;  5EFW B;  2HR3 A;  4CPG A;  2SPZ A;  1Q2N A;  4NPE A;  2B89 A;  3FXE A;  2OTK E;  2Q1K A;  2P58 A;  4EYY Q;  1Y47 A;  4GOE A;  4HB1 A;  4MN4 C;  4ZNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...