5TISE

Room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
total genus 18
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5tisE00
3JCUE 4UB6E 5KAIE 5TISE 3WU2E 1W5CE 2AXTE 4IL6E 3KZIE 5B5EE 3A0BE 5KAFE 5E79E 4UB8E 5GTHE 1S5LE 5GTIE 3A0HE 5B66E 5H2FE 4PJ0E
chains in the Genus database with same CATH superfamily
1HTLC 1LTJB 1BDDA 3HUSC 5TJHA 3F89A 3CWBE 2P2UA 1RE4A 2QM7A 1SQQG 2PFXA 4PJ0H 2JJLA 1SS1A 3H1LD 3AE1C 5APYA 1OVVA 2ZYAA 4WBAA 1W2BO 3VMZA 1NH4A 1OIPA 1LWUB 4ASVA 4WVZA 3N7NA 4MN4C 5AW6B 1YJWP 5BU5A 1WT6A 2JDIH 2W83C 1KN7A 1ZP0C 2BCCJ 2YMYA 2FFDC 1IO4A 4AQRD 3HE5A 3L70E 5GTIH 4LC1A 1E5WA 1LWUA 3H1JD 2E75D 2XU6A 2Y0CA 5KAFE 2E42A 5AW0B 1R5SA 3H1LG 4RESB 2W6AA 1CZQA 2FYUK 3V4QA 1YTZT 1MUUA 1NTKJ 3RK3B 3H1IE 4OVNF 1JY3P 1L0NE 5TISH 2XKMA 1J1EC 2KLUA 1NYHA 5C39A 5KAIE 3TNUB 2ZAEB 2POHA 3EFFK 5B66H 4U3FD 3H1JG 1YI2P 3ABVC 1PP9J 2ZT9C 1KQGB 1KILE 4AYCA 3MGNA 1Z56A 4IOIH 5CBNA 1HJ0A 3L75D 2QJPB 3L4FA 1JY2N 2L91A 2Q3IA 5AW4B 1NGMB 3CX5H 3CCLP 2FYNB 3H1HJ 3EWKA 2QA4P 1NKNA 1JB0J 1MV8A 1L4AB 4M3LA 1BSNA 3IF4A 2IYOA 1NTME 2IZ1A 2H88C 2UWJE 3QH9A 2OYIA 4DT0A 2PP6A 1S2EA 1S5LX 4EOTA 4U3FG 2JWAA 1SQXJ 1KQSO 5APVA 2PGDA 3HUSA 3L75G 3WU2H 3V6IA 3BASA 3Q1MA 1Q81Q 1ZXGA 3CX5I 2I1JA 1K9MQ 1RF0C 4OH8B 3D6ZA 2FFDB 2XDJA 2OYHC 2YMKA 3F5HA 2J58A 1OFCX 2IFMA 4Y28J 2Q6QA 5AVUB 4N78E 3RK3D 5DJTB 1JEKA 1CW5A 3GW6A 1RY3A 1YITP 3E1RA 2B88A 1KB9D 1KTMA 2J5UA 1GL2D 1GW3A 4HH2A 2RMZA 2WSFJ 3S4RA 1IK7A 2NPSC 2E74C 4NPEA 3TK1A 1P84D 4BRYA 1QGKB 1CI6B 2GUSA 2KIKA 1BE3J 2KS1A 2FYZA 1FDIA 1JM0A 1J1EB 3L71E 4LGDE 2HPCB 3VOPA 3L72E 1YQ4C 2IYPA 1URQB 2YNYA 2C0XA 1FZCC 4RO0A 3V2RA 4A7PA 5AW2B 2WSFH 2NRGA 1H0TA 1L4AD 2HODB 1EZVE 1JUNA 1QLED 2HPCA 1RE3A 1N7SC 5AVWB 1ZOYC 2RN0A 1N86A 3H25A 3G6EP 2K88A 4C7NB 1LTGC 1Y47A 1S5LH 2HODA 2WTYA 1PGPA 2M3BA 4EYYQ 5BVZA 2M8RA 2BCCD 3AE7C 1ZRTE 3GF7A 3BCCJ 3O8ZA 4XE5B 2JWDA 4UB8H 2WSCJ 3CCVP 5K5GB 3AE4C 2IFNA 4HJGH 2BEZF 2HYNA 1OW8A 2QJKC 1KFNA 5DJUB 1L0LK 3AE9C 4IL6X 2R32A 4GODA 1N73C 3HTKA 1NTKD 2KSEA 2V7QH 2K1AA 2P10A 4DJGA 1BCCJ 4ZMDA 1FJKA 1YJNP 2BCCG 2Z4EA 2B87A 1NU1K 1RF0A 3CX5D 4C46A 3H1KE 2OYHA 1SQXK 2W90A 5APTA 5CJ4A 4U7JA 1OVRA 1M1KQ 1A02J 1KYOE 2MKVA 1PP9D 2NPSB 3L35A 2E74B 3L36A 2KZIA 3CCMP 3W67A 2R44A 1URQD 5KKZC 2E43A 4PV1C 1G1IA 3QWOC 4IFFA 1NTKG 3H1HD 1AVOA 3VMYA 3M06A 1RQUA 3P8CE 1LTJC 3WMM0 4HB1A 3CC4P 5AVZB 1ZLLA 3PRJA 5KLVD 3KPEA 4KHXA 2FYUE 4W80A 1X79B 2M5AB 1X8YA 1PP9G 1SQXD 1FZCA 1EC5A 3H32B 5KJ7D 1SQQK 3D71A 1N7SA 3H1HG 2ZFCA 5GTHE 1EDIA 3GF3A 2C9NY 3GHGB 2GM4A 4IL6H 1G1JA 2FKWB 3V5BA 1K04A 5KLVG 1NTZD 1W5CE 5AVQB 4JF7A 1SQXG 3VP9A 1N73B 1JO5A 3B5ND 2Q1KA 1K73Q 2WT7A 2NPSD 2E74D 3JCUE 3BVHA 2C9LY 1BE3D 1AQ5A 3WUUA 3RL0g 3G71P 3L74E 1CSBA 1IK9A 3WUTA 1HH0A 1SQPE 3I56P 1GL2C 5CCHD 2MJZA 1SP4A 1N73A 3FWLA 2A06E 3P8MC 5KTBA 1T2KD 5KLIB 1NTZG 1XTGB 4I7ZB 4PV1B 1BGYE 2QJPC 2Y9ZA 3HE4B 5AW5B 3U59A 3A0HE 1K8AQ 1JOCA 2H43A 3G3ZA 2Y9YA 1USDA 4UB6H 2FYNC 1AJYA 3NFQA 1JTHA 4IFMA 1OZHA 1S9KD 1BE3G 1T6AA 1L4AC 2N1TB 3N4XA 2YXQB 3PLNA 2KUBA 1HJBA 1ZN5A 1WMKA 3BCCD 4JPZB 1LTJA 2PRRA 2JP3A 3KZIE 1G2CB 2ZYDA 4RKUJ 3SWKA 1FZFA 4N3YB 3CWBJ 3O6QB 3E7KA 4L76A 2WZ7A 1H88A 1BCCD 2LXCB 4WY4B 2W6JH 3I55P 3I5CA 3MP7B 3PJSK 2QIWA 2P67A 1VQNP 1GMJA 2KP8A 1J2JB 3O6QA 5AVSB 3BCCG 1J1DC 5L8RJ 2BEQD 2V4HA 4XFJA 3L70J 1PPJE 4Y99C 4N6JA 1EQ7A 1LTTC 4R4LA 1R5LA 1KQFB 4PV1D 1GL2B 2ZJSE 3Q5SA 1NVOA 1BCCG 2HG5D 2CPBA 2XZRA 4OGQB 1KQLA 5CHXA 1PIXA 1URQC 3H1IJ 4D6TE 2OTJP 2IBZE 2N1TD 3AEFC 1L0LE 1KZUB 1GL2A 4KJMA 1YTZI 4GDOA 1L0NJ 5AVYB 5KAFH 4PD4E 2WITA 3TNUA 1RHZB 1LP1B 2KOGA 3A0BE 2KK7A 4ASWA 2QVAA 3M9BA 3CCQP 1D7MA 1NU1E 1R8EA 1IFNA 1SQVE 3Q3DA 1HF9A 2I1KA 3L73E 5KLVJ 1RF1B 1VQ7P 4GOEA 2P7JA 1LP1A 5EFWB 1GZLA 2N9BA 2WPVB 3L37A 2OARA 3Q2YA 1L4AA 1U7MA 5KAIH 4WY4D 3CXHE 1W2EA 5KJ7C 1Q86Q 1JMMA 1IFMA 4K3AA 4I2LC 1KMIZ 1NTMJ 2WPRA 1PGOA 3AE2C 3RGUA 3OAKA 1HVVA 1VQ9P 2O01J 1EDLA 1TU3F 4H44B 1JY3O 4WWIA 1YQ3C 3SSUA 2HR3A 1NTZJ 3LW5J 1OW7A 3M9QA 3TGUE 1J1DB 2HLOA 2FFDA 3E1IA 2ZVNB 2ZXEB 3B5NC 1NOHA 1AA0A 1FJPA 2N9YB 1GU5A 1OX3A 4OGQD 3SFDC 2O01H 1MZ9A 1FBMA 4Y99B 2SPZA 4ZKUA 1SQQE 2WPSA 2R5DA 4R4MA 5CCHC 2RKLA 3A5TA 4L74A 3LW5H 3Q5PA 4XA4A 5AW3B 1AQTA 2WSSH 1T2KC 3LIDA 2NZ2A 1FAVA 4YPCA 2YIUB 4KT0J 1CI6A 5B5EE 3HD7B 1VDFA 1SFCC 1SQBD 1E79H 3GG2A 1ZMEC 1M57D 1NTKK 3L71J 2AEMA 2K9JB 1URQA 3L72J 1KILB 2E5YA 3M0DC 1Y8AA 1DH3A 3H1LE 3CWBD 3IR9A 3U1AA 2V7QJ 1VPCA 2O1KA 3A3YB 1U7JA 4C7NA 3GHGC 4RJTA 3P32A 2Y0EA 3AEGC 4H44D 1SQBG 4H13B 2XNDH 3FXDA 2P58A 2Q5UA 3B4SA 3H1JE 1NWQA 2KNCB 5APWA 2RH0A 2W27A 3L70D 2YKQA 1LT9B 5KJ7A 1X0TA 1IC2A 1JY2P 3RK2B 1GD2E 5KLVK 3CWBG 3M9HA 1N7LA 1QL2A 1OVUA 1Y9BA 2GA1A 1KORA 2AXTE 3B5NB 3S9OA 3IAOA 1MFZA 1SVFA 2Q9IA 3JC22 3H1ID 1IFJA 3P7KA 1DD4A 3C9IA 2FBWC 1NTMK 5KLIC 1ZW0A 3PTZA 1DEBA 4I7ZC 1EZVI 1L0ND 3HD7D 3CCUP 1S1CX 3A7OA 3W68A 4U3FE 3B5NA 3H1KJ 3GLMA 3L70G 1YHQP 4ZKPA 2NPSA 5APSA 1USEA 3L75E 1M56D 1NTZK 2P1JA 2N1TC 1EDJA 1KILD 1RE4C 1FC2C 5CCHA 1SFCB 2A45H 2D2CC 1LTAC 2J59M 3CCEP 1IJDB 1VQOP 5AVVB 3TF5A 4EDFA 3G4SP 3H1IG 5AW7B 2LR2A 3D6YA 2YO2A 1KYOH 1VQLP 1X9VA 3CC2P 1L0NG 2FY8A 1NTMD 4H13D 1NO4A 2M5AA 2M3EA 2FYUJ 3FGAD 2L5GB 3PH0A 2OTKE 3CCJP 4WY4C 2A45I 1LNQA 2O3JA 3EQ2A 3H32A 3HRNA 5CJ0A 3II6A 1HUCA 1H89A 3RK2D 5E79E 3VTPC 1QVGO 3SWFA 1KYOI 4JBZA 1PFIA 3RK3E 4H0LB 3GHGA 3MIWA 3H6PA 2YKOA 1FOSE 1Q90D 4IFDK 1NTMG 4JQ0D 4N78D 1KB9E 3FX0A 2XNXA 2ZVOB 3NTNA 2H8PD 2Q7CA 2FXPA 2GUVA 3T97B 1PL5A 1P84E 4OGQC 4PJ0E 2KSJA 1FE6A 1VF5B 4JYBA 1PV3A 1OWAA 2B9BA 1QL1A 5GTHH 3NXSA 2VRSA 2IX7C 4QMAA 2Y0DA 3L74J 1SFCD 1M1JC 3L71D 3T97A 1SQPJ 2CK3H 1VQ5P 3L72D 2YO3A 5M1BA 1LTSC 3VN0A 3B8EB 3PHLA 1X22A 1GDTA 1ZV8A 1PZQA 3R4YA 2CPSA 3ZDMA 5CCGD 4NPFX 3CMEP 5GTIE 3HE4A 1LJ2A 3VYIA 2XV5A 4NPDA 1EZVD 1XTCC 2D2CB 3V4WA 1BGYJ 1SQBJ 3VMAA 3JCUH 3D70A 1RF1C 5AW9B 1KB9H 2IDBA 3AE8C 1S3JA 5APQA 2LXBA 1RQVA 3KYQA 1YYCA 3IFMA 4GKGA 1YJ9P 4GT1A 2N1TA 2BCCE 4JYCA 2QJYB 4YXWH 1P84H 3CMAP 3OJAB 2FXMA 1FDMA 3L71G 1FU1A 3RBZA 3HE5B 1GK6A 3L72G 2YKPA 5TISE 2KB7P 1ZRTD 3A0HH 4H44C 1FZGA 1DX7A 4H0LD 2JR8A 1G2CA 1FDOA 5B66E 1KB9I 1EZVG 1ZR4A 1NTKE 2OTLP 5BU8B 4YTPC 1QX8A 1P84I 4WY4A 1KC8Q 3JSVC 2KXPB 1M8OB 3CX5E 1DIPA 3AEEC 1VF5D 4GOFA 1OXZA 3RL0B 3KZIH 1NAYA 1NAFA 2BASA 1PP9E 3H1KD 1LGHB 3EFGA 4BXLA 2JEEA 3FXEA 2QSIA 1KYOD 1FOSF 3LIEA 2YIUC 2IPPA 1PGQA 3MHVA 4ZNCA 5CBOA 3B71A 3HD7C 3C8VA 2WQYC 1VQPP 3H1HE 1RE3C 3WU2E 1AV1A 3BRTB 1M1JB 2C0WA 1KD1Q 2D2CD 1HGVA 4W7YA 1T3UA 1FZBA 3MUDC 2JO1A 2A45G 1GW4A 2KZJA 3P8CD 1KILC 1ZR2A 3TYYA 5KLVE 1Q82Q 1T8ZA 2G3AA 2QG4A 2OYIB 2KLVA 4D6TJ 3H1KG 1FS0E 2AXCA 1SQXE 5AVXB 1M1JA 1NHLA 1L0LJ 2FYUD 3MZWB 3CL3D 3AE3C 3HUSB 2AEJA 3TSIA 1Q7YQ 4H13C 1GTWA 1SQPK 1KFMA 1NU1J 1VQ4P 1RF1A 1SQVJ 1T3JA 3L73J 2KI7B 3FWNA 1FZEA 3CD6P 3WUVA 4EIJA 1MKMA 3OW2O 1GU4A 2E5TA 1NTZE 4PD4H 1LT9C 2E76C 5AVRB 3VP8A 3A0BH 4DCKA 1SQBK 1SLQA 3RK2C 2JKVA 4L73A 3RL0D 2FYUG 4I1LA 4AUWA 2LKMA 1BE3E 3K5BA 4BRYB 3A2AA 3U1CA 1VQMP 1Q2NA 4YXDC 1PGJA 5CMZA 2OQQA 3TDKA 4GIFA 2KS1B 2IBZI 3VMXA 2DW3A 3L74D 2ZYGA 1S5LE 1VQKP 3PP5A 1YIJP 2ITAA 3SFEC 3CXHH 1S72P 1SQPD 3KHUA 4PD4I 3UIAA 4TT3H 1VQ6P 3TGUJ 3S1KA 4DOJA 2QRXA 2W6BA 3CC7P 2A06D 1QVFO 5APUA 1H0TB 1IFDA 2AEFA 4UB8E 2K37A 1BGYD 2W8ZA 1SQQJ 1AVYA 3CLQA 3AE6C 1S9KE 1IZNB 2ZT9B 2QEXP 3V2PA 3OA7A 5CCGC 1M7LA 3CXHI 1EXIA 3HD7A 3L74G 1OMIA 3BCCE 1SQPG 2Q3EA 2H89C 3MTUE 4Z1MH 2YXRB 4TLFA 1FZAA 4CPGA 1UIIA 2A06G 2K9JA 2Z5IA 3MUDA 1KILA 1H8AA 1S4XA 1L0NK 1BGYG 3M0AA 1NJIQ 4BWNA 3C1LA 1BCCE 3H1LJ 3HTKB 5B5EH 4HYTB 2FXOA 4I6MC 3AE5C 1MFTA 2K9YA 4H0LC 3AECC 1EDKA 4W7ZA 2R3CA 2E76B 1NKZB 2B87B 2OGUA 2R3SA 4OWFA 2OYHB 2M0BA 1VL2A 2E75C 1HBWA 2QE7H 1L2PA 2KNCA 2PAJA 3H1JJ 3AEAC 1LT9A 2WSCH 1VF5C 3KXDA 1PPJD 2WPQA 1BDCA 3USSA 1SQVK 1JCDA 3RBXA 3GMAA 2O01N 2WWWA 1LTBC 1N8RQ 2WVRA 2ZT9D 3ITKA 2IZ0A 5AW8B 2I8DA 1HGZA 4EI2A 4L75A 4D6TD 4LLHA 3KQGA 1QEXA 2IBZD 1DD3A 2B89A 3AEBC 4IL6E 1L0LD 1LT1A 4PD4D 3G9RA 1FZCB 4U3FJ 1IFIA 1N2DC 2WMMA 3M91A 5H2FE 1JY3N 1PPJG 2AXTH 1JCCA 3L75J 2QJYC 2WSEJ 1NU1D 1SFCA 1N7SB 3CI9A 1SQVD 4HKZH 2H7HA 4B86A 3L73D 3BRVB 1LTIC 4K35A 3V2QA 1LWUC 1M90Q 1OW6A 2QM8A 3BATA 3M0DA 5CCGA 1JY2O 4D6TG 1U57A 3CXHD 2E76D 2IBZG 1L0LG 2WSEH 3NMDA 1DEEG 3CCRP 3V2NA 1UIXA 1VQ8P 2WT7B 1HWTC 4C7RA 1RH5B 1BSHA 4UB6E 5APXA 3SWYA 2QJKB 1NU1G 1K05A 1SQVG 3RL0C 3L73G 5H2FH 3TGUD 3AEDC 2E75B 4WB4A 3RK3C 1AFOA 2R5BA 1JMBA 3IN6A 1EXJA 2HFED 3MD0A 1WRGA 2O1JA 1A02F 1YBKA 1KV4A 1SQQD 4O9BA 3CPWO 2ZXXA 2G8YA 1JTHB 3R2PA 3CCSP 3Q5RA 1IFPA 2Z5HA 5E79H 5KKZB 1SQBE 5AVTB 2OYOA 2KYVA 2K3RA 5AW1B 2OYIC 1GK4A 3TGUG 1N7SD 1JNMA 3KDPB 4DZOA
chains in the Genus database with same CATH topology
3JCUE 4UB6E 5KAIE 5TISE 3WU2E 1W5CE 2AXTE 4IL6E 3KZIE 5B5EE 3A0BE 5KAFE 5E79E 4UB8E 5GTHE 1S5LE 5GTIE 3A0HE 5B66E 5H2FE 4PJ0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCU E;  4UB6 E;  5KAI E;  5TIS E;  3WU2 E;  1W5C E;  2AXT E;  4IL6 E;  3KZI E;  5B5E E;  3A0B E;  5KAF E;  5E79 E;  4UB8 E;  5GTH E;  1S5L E;  5GTI E;  3A0H E;  5B66 E;  5H2F E;  4PJ0 E; 
#chains in the Genus database with same CATH topology
 1HTL C;  1LTJ B;  1BDD A;  3HUS C;  5TJH A;  3F89 A;  3CWB E;  2P2U A;  1RE4 A;  2QM7 A;  1SQQ G;  2PFX A;  4PJ0 H;  2JJL A;  1SS1 A;  3H1L D;  3AE1 C;  5APY A;  1OVV A;  2ZYA A;  4WBA A;  1W2B O;  3VMZ A;  1NH4 A;  1OIP A;  1LWU B;  4ASV A;  4WVZ A;  3N7N A;  4MN4 C;  5AW6 B;  1YJW P;  5BU5 A;  1WT6 A;  2JDI H;  2W83 C;  1KN7 A;  1ZP0 C;  2BCC J;  2YMY A;  2FFD C;  1IO4 A;  4AQR D;  3HE5 A;  3L70 E;  5GTI H;  4LC1 A;  1E5W A;  1LWU A;  3H1J D;  2E75 D;  2XU6 A;  2Y0C A;  5KAF E;  2E42 A;  5AW0 B;  1R5S A;  3H1L G;  4RES B;  2W6A A;  1CZQ A;  2FYU K;  3V4Q A;  1YTZ T;  1MUU A;  1NTK J;  3RK3 B;  3H1I E;  4OVN F;  1JY3 P;  1L0N E;  5TIS H;  2XKM A;  1J1E C;  2KLU A;  1NYH A;  5C39 A;  5KAI E;  3TNU B;  2ZAE B;  2POH A;  3EFF K;  5B66 H;  4U3F D;  3H1J G;  1YI2 P;  3ABV C;  1PP9 J;  2ZT9 C;  1KQG B;  1KIL E;  4AYC A;  3MGN A;  1Z56 A;  4IOI H;  5CBN A;  1HJ0 A;  3L75 D;  2QJP B;  3L4F A;  1JY2 N;  2L91 A;  2Q3I A;  5AW4 B;  1NGM B;  3CX5 H;  3CCL P;  2FYN B;  3H1H J;  3EWK A;  2QA4 P;  1NKN A;  1JB0 J;  1MV8 A;  1L4A B;  4M3L A;  1BSN A;  3IF4 A;  2IYO A;  1NTM E;  2IZ1 A;  2H88 C;  2UWJ E;  3QH9 A;  2OYI A;  4DT0 A;  2PP6 A;  1S2E A;  1S5L X;  4EOT A;  4U3F G;  2JWA A;  1SQX J;  1KQS O;  5APV A;  2PGD A;  3HUS A;  3L75 G;  3WU2 H;  3V6I A;  3BAS A;  3Q1M A;  1Q81 Q;  1ZXG A;  3CX5 I;  2I1J A;  1K9M Q;  1RF0 C;  4OH8 B;  3D6Z A;  2FFD B;  2XDJ A;  2OYH C;  2YMK A;  3F5H A;  2J58 A;  1OFC X;  2IFM A;  4Y28 J;  2Q6Q A;  5AVU B;  4N78 E;  3RK3 D;  5DJT B;  1JEK A;  1CW5 A;  3GW6 A;  1RY3 A;  1YIT P;  3E1R A;  2B88 A;  1KB9 D;  1KTM A;  2J5U A;  1GL2 D;  1GW3 A;  4HH2 A;  2RMZ A;  2WSF J;  3S4R A;  1IK7 A;  2NPS C;  2E74 C;  4NPE A;  3TK1 A;  1P84 D;  4BRY A;  1QGK B;  1CI6 B;  2GUS A;  2KIK A;  1BE3 J;  2KS1 A;  2FYZ A;  1FDI A;  1JM0 A;  1J1E B;  3L71 E;  4LGD E;  2HPC B;  3VOP A;  3L72 E;  1YQ4 C;  2IYP A;  1URQ B;  2YNY A;  2C0X A;  1FZC C;  4RO0 A;  3V2R A;  4A7P A;  5AW2 B;  2WSF H;  2NRG A;  1H0T A;  1L4A D;  2HOD B;  1EZV E;  1JUN A;  1QLE D;  2HPC A;  1RE3 A;  1N7S C;  5AVW B;  1ZOY C;  2RN0 A;  1N86 A;  3H25 A;  3G6E P;  2K88 A;  4C7N B;  1LTG C;  1Y47 A;  1S5L H;  2HOD A;  2WTY A;  1PGP A;  2M3B A;  4EYY Q;  5BVZ A;  2M8R A;  2BCC D;  3AE7 C;  1ZRT E;  3GF7 A;  3BCC J;  3O8Z A;  4XE5 B;  2JWD A;  4UB8 H;  2WSC J;  3CCV P;  5K5G B;  3AE4 C;  2IFN A;  4HJG H;  2BEZ F;  2HYN A;  1OW8 A;  2QJK C;  1KFN A;  5DJU B;  1L0L K;  3AE9 C;  4IL6 X;  2R32 A;  4GOD A;  1N73 C;  3HTK A;  1NTK D;  2KSE A;  2V7Q H;  2K1A A;  2P10 A;  4DJG A;  1BCC J;  4ZMD A;  1FJK A;  1YJN P;  2BCC G;  2Z4E A;  2B87 A;  1NU1 K;  1RF0 A;  3CX5 D;  4C46 A;  3H1K E;  2OYH A;  1SQX K;  2W90 A;  5APT A;  5CJ4 A;  4U7J A;  1OVR A;  1M1K Q;  1A02 J;  1KYO E;  2MKV A;  1PP9 D;  2NPS B;  3L35 A;  2E74 B;  3L36 A;  2KZI A;  3CCM P;  3W67 A;  2R44 A;  1URQ D;  5KKZ C;  2E43 A;  4PV1 C;  1G1I A;  3QWO C;  4IFF A;  1NTK G;  3H1H D;  1AVO A;  3VMY A;  3M06 A;  1RQU A;  3P8C E;  1LTJ C;  3WMM 0;  4HB1 A;  3CC4 P;  5AVZ B;  1ZLL A;  3PRJ A;  5KLV D;  3KPE A;  4KHX A;  2FYU E;  4W80 A;  1X79 B;  2M5A B;  1X8Y A;  1PP9 G;  1SQX D;  1FZC A;  1EC5 A;  3H32 B;  5KJ7 D;  1SQQ K;  3D71 A;  1N7S A;  3H1H G;  2ZFC A;  5GTH E;  1EDI A;  3GF3 A;  2C9N Y;  3GHG B;  2GM4 A;  4IL6 H;  1G1J A;  2FKW B;  3V5B A;  1K04 A;  5KLV G;  1NTZ D;  1W5C E;  5AVQ B;  4JF7 A;  1SQX G;  3VP9 A;  1N73 B;  1JO5 A;  3B5N D;  2Q1K A;  1K73 Q;  2WT7 A;  2NPS D;  2E74 D;  3JCU E;  3BVH A;  2C9L Y;  1BE3 D;  1AQ5 A;  3WUU A;  3RL0 g;  3G71 P;  3L74 E;  1CSB A;  1IK9 A;  3WUT A;  1HH0 A;  1SQP E;  3I56 P;  1GL2 C;  5CCH D;  2MJZ A;  1SP4 A;  1N73 A;  3FWL A;  2A06 E;  3P8M C;  5KTB A;  1T2K D;  5KLI B;  1NTZ G;  1XTG B;  4I7Z B;  4PV1 B;  1BGY E;  2QJP C;  2Y9Z A;  3HE4 B;  5AW5 B;  3U59 A;  3A0H E;  1K8A Q;  1JOC A;  2H43 A;  3G3Z A;  2Y9Y A;  1USD A;  4UB6 H;  2FYN C;  1AJY A;  3NFQ A;  1JTH A;  4IFM A;  1OZH A;  1S9K D;  1BE3 G;  1T6A A;  1L4A C;  2N1T B;  3N4X A;  2YXQ B;  3PLN A;  2KUB A;  1HJB A;  1ZN5 A;  1WMK A;  3BCC D;  4JPZ B;  1LTJ A;  2PRR A;  2JP3 A;  3KZI E;  1G2C B;  2ZYD A;  4RKU J;  3SWK A;  1FZF A;  4N3Y B;  3CWB J;  3O6Q B;  3E7K A;  4L76 A;  2WZ7 A;  1H88 A;  1BCC D;  2LXC B;  4WY4 B;  2W6J H;  3I55 P;  3I5C A;  3MP7 B;  3PJS K;  2QIW A;  2P67 A;  1VQN P;  1GMJ A;  2KP8 A;  1J2J B;  3O6Q A;  5AVS B;  3BCC G;  1J1D C;  5L8R J;  2BEQ D;  2V4H A;  4XFJ A;  3L70 J;  1PPJ E;  4Y99 C;  4N6J A;  1EQ7 A;  1LTT C;  4R4L A;  1R5L A;  1KQF B;  4PV1 D;  1GL2 B;  2ZJS E;  3Q5S A;  1NVO A;  1BCC G;  2HG5 D;  2CPB A;  2XZR A;  4OGQ B;  1KQL A;  5CHX A;  1PIX A;  1URQ C;  3H1I J;  4D6T E;  2OTJ P;  2IBZ E;  2N1T D;  3AEF C;  1L0L E;  1KZU B;  1GL2 A;  4KJM A;  1YTZ I;  4GDO A;  1L0N J;  5AVY B;  5KAF H;  4PD4 E;  2WIT A;  3TNU A;  1RHZ B;  1LP1 B;  2KOG A;  3A0B E;  2KK7 A;  4ASW A;  2QVA A;  3M9B A;  3CCQ P;  1D7M A;  1NU1 E;  1R8E A;  1IFN A;  1SQV E;  3Q3D A;  1HF9 A;  2I1K A;  3L73 E;  5KLV J;  1RF1 B;  1VQ7 P;  4GOE A;  2P7J A;  1LP1 A;  5EFW B;  1GZL A;  2N9B A;  2WPV B;  3L37 A;  2OAR A;  3Q2Y A;  1L4A A;  1U7M A;  5KAI H;  4WY4 D;  3CXH E;  1W2E A;  5KJ7 C;  1Q86 Q;  1JMM A;  1IFM A;  4K3A A;  4I2L C;  1KMI Z;  1NTM J;  2WPR A;  1PGO A;  3AE2 C;  3RGU A;  3OAK A;  1HVV A;  1VQ9 P;  2O01 J;  1EDL A;  1TU3 F;  4H44 B;  1JY3 O;  4WWI A;  1YQ3 C;  3SSU A;  2HR3 A;  1NTZ J;  3LW5 J;  1OW7 A;  3M9Q A;  3TGU E;  1J1D B;  2HLO A;  2FFD A;  3E1I A;  2ZVN B;  2ZXE B;  3B5N C;  1NOH A;  1AA0 A;  1FJP A;  2N9Y B;  1GU5 A;  1OX3 A;  4OGQ D;  3SFD C;  2O01 H;  1MZ9 A;  1FBM A;  4Y99 B;  2SPZ A;  4ZKU A;  1SQQ E;  2WPS A;  2R5D A;  4R4M A;  5CCH C;  2RKL A;  3A5T A;  4L74 A;  3LW5 H;  3Q5P A;  4XA4 A;  5AW3 B;  1AQT A;  2WSS H;  1T2K C;  3LID A;  2NZ2 A;  1FAV A;  4YPC A;  2YIU B;  4KT0 J;  1CI6 A;  5B5E E;  3HD7 B;  1VDF A;  1SFC C;  1SQB D;  1E79 H;  3GG2 A;  1ZME C;  1M57 D;  1NTK K;  3L71 J;  2AEM A;  2K9J B;  1URQ A;  3L72 J;  1KIL B;  2E5Y A;  3M0D C;  1Y8A A;  1DH3 A;  3H1L E;  3CWB D;  3IR9 A;  3U1A A;  2V7Q J;  1VPC A;  2O1K A;  3A3Y B;  1U7J A;  4C7N A;  3GHG C;  4RJT A;  3P32 A;  2Y0E A;  3AEG C;  4H44 D;  1SQB G;  4H13 B;  2XND H;  3FXD A;  2P58 A;  2Q5U A;  3B4S A;  3H1J E;  1NWQ A;  2KNC B;  5APW A;  2RH0 A;  2W27 A;  3L70 D;  2YKQ A;  1LT9 B;  5KJ7 A;  1X0T A;  1IC2 A;  1JY2 P;  3RK2 B;  1GD2 E;  5KLV K;  3CWB G;  3M9H A;  1N7L A;  1QL2 A;  1OVU A;  1Y9B A;  2GA1 A;  1KOR A;  2AXT E;  3B5N B;  3S9O A;  3IAO A;  1MFZ A;  1SVF A;  2Q9I A;  3JC2 2;  3H1I D;  1IFJ A;  3P7K A;  1DD4 A;  3C9I A;  2FBW C;  1NTM K;  5KLI C;  1ZW0 A;  3PTZ A;  1DEB A;  4I7Z C;  1EZV I;  1L0N D;  3HD7 D;  3CCU P;  1S1C X;  3A7O A;  3W68 A;  4U3F E;  3B5N A;  3H1K J;  3GLM A;  3L70 G;  1YHQ P;  4ZKP A;  2NPS A;  5APS A;  1USE A;  3L75 E;  1M56 D;  1NTZ K;  2P1J A;  2N1T C;  1EDJ A;  1KIL D;  1RE4 C;  1FC2 C;  5CCH A;  1SFC B;  2A45 H;  2D2C C;  1LTA C;  2J59 M;  3CCE P;  1IJD B;  1VQO P;  5AVV B;  3TF5 A;  4EDF A;  3G4S P;  3H1I G;  5AW7 B;  2LR2 A;  3D6Y A;  2YO2 A;  1KYO H;  1VQL P;  1X9V A;  3CC2 P;  1L0N G;  2FY8 A;  1NTM D;  4H13 D;  1NO4 A;  2M5A A;  2M3E A;  2FYU J;  3FGA D;  2L5G B;  3PH0 A;  2OTK E;  3CCJ P;  4WY4 C;  2A45 I;  1LNQ A;  2O3J A;  3EQ2 A;  3H32 A;  3HRN A;  5CJ0 A;  3II6 A;  1HUC A;  1H89 A;  3RK2 D;  5E79 E;  3VTP C;  1QVG O;  3SWF A;  1KYO I;  4JBZ A;  1PFI A;  3RK3 E;  4H0L B;  3GHG A;  3MIW A;  3H6P A;  2YKO A;  1FOS E;  1Q90 D;  4IFD K;  1NTM G;  4JQ0 D;  4N78 D;  1KB9 E;  3FX0 A;  2XNX A;  2ZVO B;  3NTN A;  2H8P D;  2Q7C A;  2FXP A;  2GUV A;  3T97 B;  1PL5 A;  1P84 E;  4OGQ C;  4PJ0 E;  2KSJ A;  1FE6 A;  1VF5 B;  4JYB A;  1PV3 A;  1OWA A;  2B9B A;  1QL1 A;  5GTH H;  3NXS A;  2VRS A;  2IX7 C;  4QMA A;  2Y0D A;  3L74 J;  1SFC D;  1M1J C;  3L71 D;  3T97 A;  1SQP J;  2CK3 H;  1VQ5 P;  3L72 D;  2YO3 A;  5M1B A;  1LTS C;  3VN0 A;  3B8E B;  3PHL A;  1X22 A;  1GDT A;  1ZV8 A;  1PZQ A;  3R4Y A;  2CPS A;  3ZDM A;  5CCG D;  4NPF X;  3CME P;  5GTI E;  3HE4 A;  1LJ2 A;  3VYI A;  2XV5 A;  4NPD A;  1EZV D;  1XTC C;  2D2C B;  3V4W A;  1BGY J;  1SQB J;  3VMA A;  3JCU H;  3D70 A;  1RF1 C;  5AW9 B;  1KB9 H;  2IDB A;  3AE8 C;  1S3J A;  5APQ A;  2LXB A;  1RQV A;  3KYQ A;  1YYC A;  3IFM A;  4GKG A;  1YJ9 P;  4GT1 A;  2N1T A;  2BCC E;  4JYC A;  2QJY B;  4YXW H;  1P84 H;  3CMA P;  3OJA B;  2FXM A;  1FDM A;  3L71 G;  1FU1 A;  3RBZ A;  3HE5 B;  1GK6 A;  3L72 G;  2YKP A;  5TIS E;  2KB7 P;  1ZRT D;  3A0H H;  4H44 C;  1FZG A;  1DX7 A;  4H0L D;  2JR8 A;  1G2C A;  1FDO A;  5B66 E;  1KB9 I;  1EZV G;  1ZR4 A;  1NTK E;  2OTL P;  5BU8 B;  4YTP C;  1QX8 A;  1P84 I;  4WY4 A;  1KC8 Q;  3JSV C;  2KXP B;  1M8O B;  3CX5 E;  1DIP A;  3AEE C;  1VF5 D;  4GOF A;  1OXZ A;  3RL0 B;  3KZI H;  1NAY A;  1NAF A;  2BAS A;  1PP9 E;  3H1K D;  1LGH B;  3EFG A;  4BXL A;  2JEE A;  3FXE A;  2QSI A;  1KYO D;  1FOS F;  3LIE A;  2YIU C;  2IPP A;  1PGQ A;  3MHV A;  4ZNC A;  5CBO A;  3B71 A;  3HD7 C;  3C8V A;  2WQY C;  1VQP P;  3H1H E;  1RE3 C;  3WU2 E;  1AV1 A;  3BRT B;  1M1J B;  2C0W A;  1KD1 Q;  2D2C D;  1HGV A;  4W7Y A;  1T3U A;  1FZB A;  3MUD C;  2JO1 A;  2A45 G;  1GW4 A;  2KZJ A;  3P8C D;  1KIL C;  1ZR2 A;  3TYY A;  5KLV E;  1Q82 Q;  1T8Z A;  2G3A A;  2QG4 A;  2OYI B;  2KLV A;  4D6T J;  3H1K G;  1FS0 E;  2AXC A;  1SQX E;  5AVX B;  1M1J A;  1NHL A;  1L0L J;  2FYU D;  3MZW B;  3CL3 D;  3AE3 C;  3HUS B;  2AEJ A;  3TSI A;  1Q7Y Q;  4H13 C;  1GTW A;  1SQP K;  1KFM A;  1NU1 J;  1VQ4 P;  1RF1 A;  1SQV J;  1T3J A;  3L73 J;  2KI7 B;  3FWN A;  1FZE A;  3CD6 P;  3WUV A;  4EIJ A;  1MKM A;  3OW2 O;  1GU4 A;  2E5T A;  1NTZ E;  4PD4 H;  1LT9 C;  2E76 C;  5AVR B;  3VP8 A;  3A0B H;  4DCK A;  1SQB K;  1SLQ A;  3RK2 C;  2JKV A;  4L73 A;  3RL0 D;  2FYU G;  4I1L A;  4AUW A;  2LKM A;  1BE3 E;  3K5B A;  4BRY B;  3A2A A;  3U1C A;  1VQM P;  1Q2N A;  4YXD C;  1PGJ A;  5CMZ A;  2OQQ A;  3TDK A;  4GIF A;  2KS1 B;  2IBZ I;  3VMX A;  2DW3 A;  3L74 D;  2ZYG A;  1S5L E;  1VQK P;  3PP5 A;  1YIJ P;  2ITA A;  3SFE C;  3CXH H;  1S72 P;  1SQP D;  3KHU A;  4PD4 I;  3UIA A;  4TT3 H;  1VQ6 P;  3TGU J;  3S1K A;  4DOJ A;  2QRX A;  2W6B A;  3CC7 P;  2A06 D;  1QVF O;  5APU A;  1H0T B;  1IFD A;  2AEF A;  4UB8 E;  2K37 A;  1BGY D;  2W8Z A;  1SQQ J;  1AVY A;  3CLQ A;  3AE6 C;  1S9K E;  1IZN B;  2ZT9 B;  2QEX P;  3V2P A;  3OA7 A;  5CCG C;  1M7L A;  3CXH I;  1EXI A;  3HD7 A;  3L74 G;  1OMI A;  3BCC E;  1SQP G;  2Q3E A;  2H89 C;  3MTU E;  4Z1M H;  2YXR B;  4TLF A;  1FZA A;  4CPG A;  1UII A;  2A06 G;  2K9J A;  2Z5I A;  3MUD A;  1KIL A;  1H8A A;  1S4X A;  1L0N K;  1BGY G;  3M0A A;  1NJI Q;  4BWN A;  3C1L A;  1BCC E;  3H1L J;  3HTK B;  5B5E H;  4HYT B;  2FXO A;  4I6M C;  3AE5 C;  1MFT A;  2K9Y A;  4H0L C;  3AEC C;  1EDK A;  4W7Z A;  2R3C A;  2E76 B;  1NKZ B;  2B87 B;  2OGU A;  2R3S A;  4OWF A;  2OYH B;  2M0B A;  1VL2 A;  2E75 C;  1HBW A;  2QE7 H;  1L2P A;  2KNC A;  2PAJ A;  3H1J J;  3AEA C;  1LT9 A;  2WSC H;  1VF5 C;  3KXD A;  1PPJ D;  2WPQ A;  1BDC A;  3USS A;  1SQV K;  1JCD A;  3RBX A;  3GMA A;  2O01 N;  2WWW A;  1LTB C;  1N8R Q;  2WVR A;  2ZT9 D;  3ITK A;  2IZ0 A;  5AW8 B;  2I8D A;  1HGZ A;  4EI2 A;  4L75 A;  4D6T D;  4LLH A;  3KQG A;  1QEX A;  2IBZ D;  1DD3 A;  2B89 A;  3AEB C;  4IL6 E;  1L0L D;  1LT1 A;  4PD4 D;  3G9R A;  1FZC B;  4U3F J;  1IFI A;  1N2D C;  2WMM A;  3M91 A;  5H2F E;  1JY3 N;  1PPJ G;  2AXT H;  1JCC A;  3L75 J;  2QJY C;  2WSE J;  1NU1 D;  1SFC A;  1N7S B;  3CI9 A;  1SQV D;  4HKZ H;  2H7H A;  4B86 A;  3L73 D;  3BRV B;  1LTI C;  4K35 A;  3V2Q A;  1LWU C;  1M90 Q;  1OW6 A;  2QM8 A;  3BAT A;  3M0D A;  5CCG A;  1JY2 O;  4D6T G;  1U57 A;  3CXH D;  2E76 D;  2IBZ G;  1L0L G;  2WSE H;  3NMD A;  1DEE G;  3CCR P;  3V2N A;  1UIX A;  1VQ8 P;  2WT7 B;  1HWT C;  4C7R A;  1RH5 B;  1BSH A;  4UB6 E;  5APX A;  3SWY A;  2QJK B;  1NU1 G;  1K05 A;  1SQV G;  3RL0 C;  3L73 G;  5H2F H;  3TGU D;  3AED C;  2E75 B;  4WB4 A;  3RK3 C;  1AFO A;  2R5B A;  1JMB A;  3IN6 A;  1EXJ A;  2HFE D;  3MD0 A;  1WRG A;  2O1J A;  1A02 F;  1YBK A;  1KV4 A;  1SQQ D;  4O9B A;  3CPW O;  2ZXX A;  2G8Y A;  1JTH B;  3R2P A;  3CCS P;  3Q5R A;  1IFP A;  2Z5H A;  5E79 H;  5KKZ B;  1SQB E;  5AVT B;  2OYO A;  2KYV A;  2K3R A;  5AW1 B;  2OYI C;  1GK4 A;  3TGU G;  1N7S D;  1JNM A;  3KDP B;  4DZO A; 
#chains in the Genus database with same CATH homology
 3JCU E;  4UB6 E;  5KAI E;  5TIS E;  3WU2 E;  1W5C E;  2AXT E;  4IL6 E;  3KZI E;  5B5E E;  3A0B E;  5KAF E;  5E79 E;  4UB8 E;  5GTH E;  1S5L E;  5GTI E;  3A0H E;  5B66 E;  5H2F E;  4PJ0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...