5TISE

Room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 18
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5tisE00
5B5EE 3A0BE 5GTIE 3JCUE 3WU2E 5KAIE 5KAFE 2AXTE 4IL6E 3A0HE 5E79E 5B66E 4UB8E 1W5CE 4UB6E 5H2FE 4PJ0E 5GTHE 5TISE 3KZIE 1S5LE
chains in the Genus database with same CATH superfamily
4LGDE 5AVTB 3M0AA 3N4XA 2BCCG 1WT6A 1JO5A 1EDKA 1HTLC 2OYIC 3A0BE 3A0HH 2YKPA 1SQVE 1KYOI 3H6PA 4EIJA 3H1KJ 3A0HE 2ZYDA 1N8RQ 3FX0A 4TLFA 3WUTA 3M9BA 3L70J 2N1TB 2ZYAA 3TSIA 1SQPG 1KORA 2L5GB 2V7QJ 4U3FJ 1MV8A 1BDCA 3D6ZA 5KTBA 1BE3D 5H2FH 1KYOD 2N1TA 4HJGH 5B66E 1QVFO 1BGYG 5H2FE 3U1CA 3AEDC 3R2PA 4AUWA 4TT3H 4H44B 3TDKA 1VQ9P 4PD4I 1EQ7A 1RF0A 1QL2A 2H43A 1DEBA 4DT0A 1U7JA 3CCEP 2QIWA 5EFWB 1LTIC 2FYUG 1VQ6P 1URQB 3L74J 3M9HA 3WMM0 4CPGA 3RBXA 1JB0J 1OW8A 2NRGA 3JCUE 4JYBA 3HE5B 3H1IG 3FXDA 2AEJA 2FYUK 3CXHD 5CJ4A 4L76A 2N1TC 2N1TD 3B4SA 3CWBJ 3Q2YA 3RL0C 1SS1A 3RL0D 1YI2P 2FYUD 1JMBA 3HE5A 1M1KQ 1QGKB 3E1RA 2QJKB 3H1ID 1RF0C 1AFOA 3SFDC 1EDJA 1T3JA 4H44C 4H44D 3V2NA 1QX8A 3TGUJ 5B5EE 2QM7A 2OYOA 1GMJA 2PAJA 3M9QA 1NGMB 2NZ2A 3AEAC 1EXJA 3IFMA 1MZ9A 3NXSA 1PP9D 3L71J 3A7OA 2KIKA 3L75E 2P10A 3H1KG 1NJIQ 1LNQA 4I6MC 1FJKA 2CPBA 2VRSA 3HE4B 3L70G 1L2PA 1VDFA 2HODB 1RHZB 5AVXB 2FY8A 3H1KD 1LTJB 2O3JA 3H1JE 2HODA 2KS1B 1OVRA 1N73B 3MIWA 1IJDB 2PFXA 2M5AA 4YTPC 5AW9B 3GHGB 2WSCH 4KT0J 4U3FD 1LTJA 4GODA 2Q1KA 4AYCA 3V5BA 2KI7B 2IFNA 2KS1A 5GTIE 1SLQA 3G6EP 2YMKA 3O8ZA 3ABVC 5BU8B 2ZAEB 3L74G 1FJPA 2KSEA 2Q5UA 3L37A 2KSJA 2QRXA 3D70A 1KFMA 1EZVD 1A02J 5C39A 5KKZB 2AXCA 1M1JB 3CWBG 2QVAA 3V2QA 3B71A 1CI6B 3MHVA 2IX7C 3WUVA 1IFPA 2W6JH 1M1JA 1CI6A 1WRGA 1ZV8A 1NTME 2WSSH 4I1LA 3TF5A 1YJWP 2WZ7A 1IFNA 3TGUG 2K37A 3HTKB 1DEEG 2WMMA 1J1EC 4DZOA 5CHXA 2P67A 2POHA 2W90A 1YTZI 4ZNCA 3L71G 2Y0DA 3SWYA 3KPEA 3L36A 3HTKA 1JY2P 1X0TA 5APYA 1FC2C 4GOEA 3TGUD 4R4LA 3IR9A 4UB6E 5KKZC 3G3ZA 1HJ0A 2Q3EA 1GU4A 3H1JD 2FXPA 1Q86Q 2XNDH 4LC1A 5E79H 3V2PA 1M1JC 5CCHA 4BRYA 3H1HE 1GW4A 1T2KC 1AVOA 1T2KD 3Q5SA 3C1LA 4D6TJ 3Q5RA 3I5CA 4WBAA 1NKNA 1G1IA 2XZRA 3BCCJ 3II6A 1SQXJ 3PH0A 3D71A 3SFEC 1FOSF 2Z5HA 3PRJA 3C8VA 1JM0A 1FAVA 4W7ZA 3HUSB 1CZQA 2H89C 1QEXA 3VN0A 1NKZB 1AA0A 2H8PD 3S4RA 3C9IA 5CCHC 3HUSA 5CCHD 1S5LX 1YIJP 1ZMEC 3L73E 1VPCA 2GA1A 5AW3B 1W5CE 5L8RJ 2L91A 2G8YA 5KLVJ 2FYNB 4EDFA 1L4AB 2QG4A 1BCCJ 1NTZJ 2E75B 3ITKA 1Y47A 1W2EA 5GTHH 4A7PA 3H1LJ 2Q7CA 1OW7A 1N86A 1L4AA 1OVUA 5GTHE 1EDIA 4NPDA 1RE3A 1Q81Q 2YMYA 3HUSC 2O01N 2B88A 4N6JA 1YTZT 4RJTA 5AW7B 1JY3O 1OMIA 2E76B 4OWFA 4I2LC 3K5BA 2A45G 2BCCE 1Y9BA 2FKWB 1PGPA 3GMAA 3FWLA 4ZKUA 2B89A 2CK3H 1JTHB 4BXLA 1Q2NA 1L4AC 3T97A 1OXZA 2IYPA 1KC8Q 4C7RA 2IBZD 2E75C 4D6TG 2M3BA 2E75D 1X8YA 1RE3C 1SQPE 2OYIB 3BCCG 3TYYA 3RK3B 1JTHA 4YXDC 1SQXG 2WSFJ 3PTZA 1ZLLA 1J1DC 3KYQA 1CSBA 1BGYE 1NTKJ 2K9YA 1YHQP 1SQXK 2UWJE 1HH0A 4D6TD 1GDTA 4W7YA 3L73D 1R5SA 3BCCD 2YXQB 1G2CB 4EYYQ 4XE5B 4OVNF 4ZMDA 1SQQJ 2FYUE 1G2CA 2C0WA 1R5LA 2MKVA 5KLVG 1VQKP 3F89A 1G1JA 1BCCG 3H1IE 1NTZG 2QEXP 4ASVA 1GZLA 1L0NJ 1BDDA 5APXA 2FXMA 4DJGA 5KLVK 3H1LG 2KLVA 2H7HA 3RK3C 3RK3D 1NTZK 2JKVA 3MD0A 4RO0A 3B8EB 5KLVD 1UIIA 4IOIH 3JC22 4GIFA 3W68A 2R5BA 1BCCD 5M1BA 2M8RA 1VQPP 2BCCD 3CCUP 1PP9E 1KN7A 1IO4A 3RL0B 3H1LD 1NAYA 1TU3F 1UIXA 3G9RA 1R8EA 5AVUB 2C0XA 1SQPK 2JR8A 2E43A 1HWTC 1VQ5P 1LT1A 1BSHA 3MZWB 2KK7A 1SQPD 5CBOA 3H1KE 3Q3DA 3MTUE 3QH9A 2KUBA 3CXHI 4EOTA 3P8CD 2V7QH 1FS0E 1E5WA 1H8AA 3CC2P 1K05A 4XA4A 3L70E 4YPCA 3SSUA 3HRNA 1BGYD 2QJYB 2WQYC 1USDA 4U3FE 1ZW0A 2W6BA 2FYZA 1KTMA 2HYNA 1NTKG 4JBZA 2SPZA 1SFCB 3AE1C 5TJHA 1EZVE 2J5UA 5K5GB 2KP8A 1NTKK 3TNUB 2WPVB 1PGJA 3PLNA 1SFCA 3A3YB 5AW1B 1SQQG 1JOCA 1FZAA 2RMZA 1LTTC 2RN0A 1LJ2A 3TNUA 4HB1A 2HFED 4ZKPA 3BVHA 1PGQA 1SQQK 1HBWA 1GTWA 3CC7P 1PGOA 1L0NG 3CCVP 1L0LJ 1FDIA 2P7JA 2YXRB 3CWBE 2QJYC 1SQQD 3P8MC 4W80A 4BWNA 2E42A 1L0NK 2ZXEB 3GG2A 1ZP0C 1SFCC 3CL3D 1SFCD 5TISH 3RBZA 3TGUE 4WY4A 2M5AB 1PZQA 3NMDA 5TISE 3AEGC 4AQRD 2W27A 4XFJA 1NU1J 2Q3IA 1XTGB 1IFMA 3L70D 4U7JA 3L71E 1KILD 1T6AA 4H0LB 1ZN5A 1EZVI 2QA4P 3N7NA 1CW5A 1AVYA 1T3UA 3FXEA 1EDLA 1J1EB 4NPEA 2B87B 4C7NB 2JP3A 2AEFA 3VTPC 1DIPA 5AVRB 2P2UA 5AW8B 3CCSP 3R4YA 4WY4C 4WY4D 2B87A 3MGNA 1P84D 4C7NA 1S3JA 1DH3A 2KXPB 2I1JA 3G71P 3L74D 3BRVB 1SQBJ 1ZRTD 2KZIA 2B9BA 1YQ4C 1S9KE 3AE8C 2O01J 1PIXA 4GKGA 2WSEJ 2WVRA 4H0LC 4N78D 4H0LD 3LW5J 3CWBD 2ZFCA 5AW6B 4PJ0H 3KDPB 5APSA 2YKOA 1GU5A 1NH4A 4KHXA 2XDJA 2WPSA 3VMAA 1K04A 3FWNA 4PJ0E 4RESB 1EXIA 3O6QB 1L0LG 1VQ7P 4IL6H 2JDIH 3CMAP 1JEKA 1KB9H 4IL6E 2O01H 3AEEC 4BRYB 2JWAA 1L0LK 3P32A 3O6QA 1KB9E 1LP1B 5AVWB 3MP7B 2LXBA 3GW6A 2WT7A 3D6YA 2ZYGA 1VQ8P 1USEA 1S2EA 1FZFA 1W2BO 4I7ZB 2LKMA 2KB7P 3L71D 3AE9C 4EI2A 5E79E 1LP1A 4HKZH 3L72J 1NU1G 4PV1C 4JYCA 4PV1D 2A45H 5KAFH 2P58A 1U57A 2JO1A 1KQFB 1N2DC 2IBZE 2IYOA 1KMIZ 1NU1K 1ZOYC 5KAFE 2OQQA 3OAKA 3CX5H 4HYTB 1MFTA 3M0DC 3IN6A 3CX5E 1DD3A 1KQGB 1IFDA 1AQTA 1FZEA 2CPSA 5AVQB 3B5NA 5CCGA 3OJAB 5KLIB 4D6TE 3BCCE 1S9KD 1Z56A 2K3RA 1SQXE 1NTMG 4B86A 2M0BA 1KZUB 1QLED 1YBKA 4I7ZC 4L75A 3QWOC 2W8ZA 5AW0B 1RF1B 1SQBG 3V4WA 1KB9I 2IZ1A 4WWIA 1SQBK 2WTYA 1RF1A 1DX7A 2FFDB 2PP6A 1AV1A 3VMYA 1J1DB 4Z1MH 4DOJA 1FDMA 2HLOA 1X22A 1VQNP 5BU5A 4O9BA 1SQBD 1FDOA 1JY2O 3B5NC 5CCGC 3CCLP 3B5ND 5CCGD 3RK3E 2Q9IA 1KB9D 5KLVE 2PRRA 1BE3J 2FFDA 3EFFK 2QJPB 1Y8AA 2IBZI 3CCQP 2A45I 3H1HG 1BCCE 2JEEA 1NTZE 3CCRP 2AXTH 5KLIC 3T97B 2M3EA 3BASA 2YIUC 3H1LE 2AXTE 3CX5I 1VF5B 2W83C 4GOFA 1E79H 2HPCA 2E74B 2OARA 3L4FA 1RF1C 1NAFA 1YJNP 3CMEP 3L72G 3OA7A 1RY3A 1PPJG 3NTNA 3CX5D 3MUDA 1OIPA 3H32B 3P8CE 3RK2C 3RK2D 2FFDC 1OFCX 3F5HA 1OWAA 1ZR4A 2HR3A 3Q1MA 1M7LA 3L72D 2WPRA 4RKUJ 3H32A 3SWFA 2J58A 2QJPC 1FU1A 4R4MA 1SQXD 1HUCA 3AE2C 1D7MA 3OW2O 2WSFH 1VF5C 4PD4H 4HH2A 1VF5D 2ZJSE 3A2AA 1SQVJ 3CPWO 1JMMA 1RQUA 2LXCB 2E74C 1NYHA 2JJLA 3MUDC 2E74D 1U7MA 1FOSE 3AECC 2YKQA 1PP9J 4JQ0D 1NTKE 3WU2H 1VL2A 2O1KA 3WU2E 3V4QA 1JY3N 4JPZB 2OYHB 1YQ3C 3AE6C 1KD1Q 3AEFC 3CCMP 3A0BH 1NTZD 3RGUA 1SQQE 2OYHA 1KQSO 1BE3G 3BRTB 5APQA 3U59A 4GT1A 1YJ9P 5AW4B 2N9YB 3VP8A 1NO4A 1JCDA 5DJTB 5AVYB 1L0NE 1HF9A 3LIEA 2V4HA 4OGQB 4MN4C 3GF7A 5B66H 4Y28J 2R44A 2YO2A 2RKLA 1X9VA 2Z4EA 3VYIA 4KJMA 2C9LY 1BSNA 3VP9A 2QM8A 5APUA 2A06G 4IFDK 1KILE 5AW2B 3VMXA 3CC4P 3VMZA 2OYHC 2IZ0A 3WUUA 2N9BA 1Q7YQ 2A06D 3JCUH 2YNYA 2R3SA 5DJUB 1A02F 1P84H 1OX3A 4OH8B 1H0TB 4PD4D 1P84E 1URQA 3H25A 1NVOA 3V2RA 4OGQC 3KZIH 4OGQD 1ZXGA 1KILB 1NTKD 2ZT9B 3L74E 1SQVG 1ZRTE 3L75J 3KZIE 1RE4A 1M90Q 1H0TA 2AEMA 1LT9B 1LTBC 1GL2B 2P1JA 1VQ4P 2XNXA 1PP9G 1JNMA 3S9OA 2R32A 1KILA 4Y99B 1SQVK 1MKMA 4N78E 3UIAA 5AVSB 5B5EH 1SP4A 1LT9A 1SQVD 2H88C 3E1IA 1GL2A 1QVGO 4WY4B 1IFIA 3H1JJ 4WB4A 3IF4A 1OZHA 1HGZA 2GUVA 1FBMA 3P7KA 1L0ND 1URQC 3U1AA 1URQD 1LWUB 1EC5A 1VQOP 4K3AA 1IK9A 3A5TA 1RE4C 2WSCJ 3Q5PA 3AE5C 1L0LE 3FGAD 1AJYA 1LWUA 2DW3A 3CLQA 2I1KA 1KILC 4U3FG 1MUUA 2ZT9C 2ZT9D 3V6IA 1QL1A 3HE4A 1LT9C 1P84I 2BEQD 2QJKC 1GL2C 1GL2D 3AE4C 5KJ7A 2XU6A 4Y99C 4UB8H 1EZVG 4QMAA 2FBWC 1GK6A 1K9MQ 1KV4A 4UB8E 5GTIH 1Q90D 2MJZA 1HGVA 1IC2A 1PL5A 5APVA 1NU1E 1LTSC 1N73A 2K9JB 1FE6A 1NWQA 3GHGA 1NTMJ 1LWUC 3CI9A 2ZVNB 2O1JA 5CMZA 1S5LH 1H88A 4K35A 4YXWH 2E5TA 2K9JA 1S5LE 4PV1B 2FXOA 3EWKA 1FZGA 5CJ0A 5APTA 3AE3C 3M91A 5KJ7C 5KJ7D 1XTCC 3L75G 1N7SB 2D2CB 2Y0CA 4JF7A 4DCKA 1LTJC 2WITA 2IPPA 1OW6A 1S1CX 3I56P 1N73C 2JWDA 2ZXXA 2WT7B 1N7SA 1SVFA 2KYVA 1GK4A 3GHGC 3H1HJ 1SQBE 3EFGA 3M0DA 3L75D 3IAOA 3USSA 2Q6QA 2WSEH 3H1JG 1JCCA 3CCJP 2IFMA 3AEBC 5KAIH 3LW5H 1LTGC 2KNCB 1L0LD 4NPFX 3HD7B 3M06A 1RQVA 5KAIE 4UB6H 1RH5B 1FZCB 2OTJP 3LIDA 1M8OB 1JY3P 1FZBA 3SWKA 2KNCA 3HD7A 2QE7H 2RH0A 3S1KA 1PV3A 3W67A 2C9NY 1NHLA 1FZCA 3CD6P 1M57D 1N7SC 1VQLP 2D2CC 1N7SD 2D2CD 3G4SP 3B5NB 3L73J 3KQGA 2NPSB 3PHLA 4LLHA 3BATA 2ITAA 1NU1D 1X79B 1S72P 2KLUA 2ZVOB 1PFIA 1S4XA 1JUNA 2OGUA 2GUSA 1AQ5A 1MFZA 5AVVB 2IDBA 1LTAC 1K8AQ 3VOPA 5AVZB 2NPSA 2LR2A 2E5YA 3L72E 5APWA 2YIUB 2Y9ZA 1PPJE 3KXDA 1DD4A 2YO3A 2KZJA 1Q82Q 3KHUA 3HD7C 3HD7D 2K88A 1LGHB 2Y0EA 1FZCC 4ASWA 2QSIA 1H89A 1NTMK 2HG5D 1ZR2A 1YITP 1WMKA 3RK2B 1KQLA 1NTMD 2BCCJ 2WWWA 4H13B 3GF3A 1M56D 4L73A 1J2JB 2NPSC 2NPSD 2Y9YA 2G3AA 3TK1A 2WPQA 4IL6X 1HVVA 1K73Q 4L74A 3ZDMA 3EQ2A 2Z5IA 2HPCB 2W6AA 2J59M 1SQPJ 3GLMA 3PP5A 1OVVA 2KOGA 2XV5A 2IBZG 2OTLP 4N3YB 3I55P 2R3CA 3H1HD 1BGYJ 5AW5B 4C46A 1KYOH 4WVZA 1BE3E 1GW3A 3AE7C 2FYNC 1KYOE 1N7LA 1VQMP 1L4AD 4IFFA 1T8ZA 4IFMA 1HJBA 1IK7A 1IZNB 3PJSK 4H13C 3L73G 4H13D 2FYUJ 5BVZA 2BASA 2OTKE 1PPJD 4M3LA 1KFNA 2I8DA 3H1IJ 2OYIA 2BEZF 2A06E 2GM4A 2K1AA 2PGDA 3E7KA 3L35A 3CXHH 5CBNA 3RL0g 2R5DA 3NFQA 2E76C 4PD4E 1GD2E 2E76D 3CXHE 2XKMA 3JSVC 4GDOA 1NOHA 1YYCA 1JY2N 1IFJA
chains in the Genus database with same CATH topology
5B5EE 3A0BE 5GTIE 3JCUE 3WU2E 5KAIE 5KAFE 2AXTE 4IL6E 3A0HE 5E79E 5B66E 4UB8E 1W5CE 4UB6E 5H2FE 4PJ0E 5GTHE 5TISE 3KZIE 1S5LE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B5E E;  3A0B E;  5GTI E;  3JCU E;  3WU2 E;  5KAI E;  5KAF E;  2AXT E;  4IL6 E;  3A0H E;  5E79 E;  5B66 E;  4UB8 E;  1W5C E;  4UB6 E;  5H2F E;  4PJ0 E;  5GTH E;  5TIS E;  3KZI E;  1S5L E; 
#chains in the Genus database with same CATH topology
 4LGD E;  5AVT B;  3M0A A;  3N4X A;  2BCC G;  1WT6 A;  1JO5 A;  1EDK A;  1HTL C;  2OYI C;  3A0B E;  3A0H H;  2YKP A;  1SQV E;  1KYO I;  3H6P A;  4EIJ A;  3H1K J;  3A0H E;  2ZYD A;  1N8R Q;  3FX0 A;  4TLF A;  3WUT A;  3M9B A;  3L70 J;  2N1T B;  2ZYA A;  3TSI A;  1SQP G;  1KOR A;  2L5G B;  2V7Q J;  4U3F J;  1MV8 A;  1BDC A;  3D6Z A;  5KTB A;  1BE3 D;  5H2F H;  1KYO D;  2N1T A;  4HJG H;  5B66 E;  1QVF O;  1BGY G;  5H2F E;  3U1C A;  3AED C;  3R2P A;  4AUW A;  4TT3 H;  4H44 B;  3TDK A;  1VQ9 P;  4PD4 I;  1EQ7 A;  1RF0 A;  1QL2 A;  2H43 A;  1DEB A;  4DT0 A;  1U7J A;  3CCE P;  2QIW A;  5EFW B;  1LTI C;  2FYU G;  1VQ6 P;  1URQ B;  3L74 J;  3M9H A;  3WMM 0;  4CPG A;  3RBX A;  1JB0 J;  1OW8 A;  2NRG A;  3JCU E;  4JYB A;  3HE5 B;  3H1I G;  3FXD A;  2AEJ A;  2FYU K;  3CXH D;  5CJ4 A;  4L76 A;  2N1T C;  2N1T D;  3B4S A;  3CWB J;  3Q2Y A;  3RL0 C;  1SS1 A;  3RL0 D;  1YI2 P;  2FYU D;  1JMB A;  3HE5 A;  1M1K Q;  1QGK B;  3E1R A;  2QJK B;  3H1I D;  1RF0 C;  1AFO A;  3SFD C;  1EDJ A;  1T3J A;  4H44 C;  4H44 D;  3V2N A;  1QX8 A;  3TGU J;  5B5E E;  2QM7 A;  2OYO A;  1GMJ A;  2PAJ A;  3M9Q A;  1NGM B;  2NZ2 A;  3AEA C;  1EXJ A;  3IFM A;  1MZ9 A;  3NXS A;  1PP9 D;  3L71 J;  3A7O A;  2KIK A;  3L75 E;  2P10 A;  3H1K G;  1NJI Q;  1LNQ A;  4I6M C;  1FJK A;  2CPB A;  2VRS A;  3HE4 B;  3L70 G;  1L2P A;  1VDF A;  2HOD B;  1RHZ B;  5AVX B;  2FY8 A;  3H1K D;  1LTJ B;  2O3J A;  3H1J E;  2HOD A;  2KS1 B;  1OVR A;  1N73 B;  3MIW A;  1IJD B;  2PFX A;  2M5A A;  4YTP C;  5AW9 B;  3GHG B;  2WSC H;  4KT0 J;  4U3F D;  1LTJ A;  4GOD A;  2Q1K A;  4AYC A;  3V5B A;  2KI7 B;  2IFN A;  2KS1 A;  5GTI E;  1SLQ A;  3G6E P;  2YMK A;  3O8Z A;  3ABV C;  5BU8 B;  2ZAE B;  3L74 G;  1FJP A;  2KSE A;  2Q5U A;  3L37 A;  2KSJ A;  2QRX A;  3D70 A;  1KFM A;  1EZV D;  1A02 J;  5C39 A;  5KKZ B;  2AXC A;  1M1J B;  3CWB G;  2QVA A;  3V2Q A;  3B71 A;  1CI6 B;  3MHV A;  2IX7 C;  3WUV A;  1IFP A;  2W6J H;  1M1J A;  1CI6 A;  1WRG A;  1ZV8 A;  1NTM E;  2WSS H;  4I1L A;  3TF5 A;  1YJW P;  2WZ7 A;  1IFN A;  3TGU G;  2K37 A;  3HTK B;  1DEE G;  2WMM A;  1J1E C;  4DZO A;  5CHX A;  2P67 A;  2POH A;  2W90 A;  1YTZ I;  4ZNC A;  3L71 G;  2Y0D A;  3SWY A;  3KPE A;  3L36 A;  3HTK A;  1JY2 P;  1X0T A;  5APY A;  1FC2 C;  4GOE A;  3TGU D;  4R4L A;  3IR9 A;  4UB6 E;  5KKZ C;  3G3Z A;  1HJ0 A;  2Q3E A;  1GU4 A;  3H1J D;  2FXP A;  1Q86 Q;  2XND H;  4LC1 A;  5E79 H;  3V2P A;  1M1J C;  5CCH A;  4BRY A;  3H1H E;  1GW4 A;  1T2K C;  1AVO A;  1T2K D;  3Q5S A;  3C1L A;  4D6T J;  3Q5R A;  3I5C A;  4WBA A;  1NKN A;  1G1I A;  2XZR A;  3BCC J;  3II6 A;  1SQX J;  3PH0 A;  3D71 A;  3SFE C;  1FOS F;  2Z5H A;  3PRJ A;  3C8V A;  1JM0 A;  1FAV A;  4W7Z A;  3HUS B;  1CZQ A;  2H89 C;  1QEX A;  3VN0 A;  1NKZ B;  1AA0 A;  2H8P D;  3S4R A;  3C9I A;  5CCH C;  3HUS A;  5CCH D;  1S5L X;  1YIJ P;  1ZME C;  3L73 E;  1VPC A;  2GA1 A;  5AW3 B;  1W5C E;  5L8R J;  2L91 A;  2G8Y A;  5KLV J;  2FYN B;  4EDF A;  1L4A B;  2QG4 A;  1BCC J;  1NTZ J;  2E75 B;  3ITK A;  1Y47 A;  1W2E A;  5GTH H;  4A7P A;  3H1L J;  2Q7C A;  1OW7 A;  1N86 A;  1L4A A;  1OVU A;  5GTH E;  1EDI A;  4NPD A;  1RE3 A;  1Q81 Q;  2YMY A;  3HUS C;  2O01 N;  2B88 A;  4N6J A;  1YTZ T;  4RJT A;  5AW7 B;  1JY3 O;  1OMI A;  2E76 B;  4OWF A;  4I2L C;  3K5B A;  2A45 G;  2BCC E;  1Y9B A;  2FKW B;  1PGP A;  3GMA A;  3FWL A;  4ZKU A;  2B89 A;  2CK3 H;  1JTH B;  4BXL A;  1Q2N A;  1L4A C;  3T97 A;  1OXZ A;  2IYP A;  1KC8 Q;  4C7R A;  2IBZ D;  2E75 C;  4D6T G;  2M3B A;  2E75 D;  1X8Y A;  1RE3 C;  1SQP E;  2OYI B;  3BCC G;  3TYY A;  3RK3 B;  1JTH A;  4YXD C;  1SQX G;  2WSF J;  3PTZ A;  1ZLL A;  1J1D C;  3KYQ A;  1CSB A;  1BGY E;  1NTK J;  2K9Y A;  1YHQ P;  1SQX K;  2UWJ E;  1HH0 A;  4D6T D;  1GDT A;  4W7Y A;  3L73 D;  1R5S A;  3BCC D;  2YXQ B;  1G2C B;  4EYY Q;  4XE5 B;  4OVN F;  4ZMD A;  1SQQ J;  2FYU E;  1G2C A;  2C0W A;  1R5L A;  2MKV A;  5KLV G;  1VQK P;  3F89 A;  1G1J A;  1BCC G;  3H1I E;  1NTZ G;  2QEX P;  4ASV A;  1GZL A;  1L0N J;  1BDD A;  5APX A;  2FXM A;  4DJG A;  5KLV K;  3H1L G;  2KLV A;  2H7H A;  3RK3 C;  3RK3 D;  1NTZ K;  2JKV A;  3MD0 A;  4RO0 A;  3B8E B;  5KLV D;  1UII A;  4IOI H;  3JC2 2;  4GIF A;  3W68 A;  2R5B A;  1BCC D;  5M1B A;  2M8R A;  1VQP P;  2BCC D;  3CCU P;  1PP9 E;  1KN7 A;  1IO4 A;  3RL0 B;  3H1L D;  1NAY A;  1TU3 F;  1UIX A;  3G9R A;  1R8E A;  5AVU B;  2C0X A;  1SQP K;  2JR8 A;  2E43 A;  1HWT C;  1VQ5 P;  1LT1 A;  1BSH A;  3MZW B;  2KK7 A;  1SQP D;  5CBO A;  3H1K E;  3Q3D A;  3MTU E;  3QH9 A;  2KUB A;  3CXH I;  4EOT A;  3P8C D;  2V7Q H;  1FS0 E;  1E5W A;  1H8A A;  3CC2 P;  1K05 A;  4XA4 A;  3L70 E;  4YPC A;  3SSU A;  3HRN A;  1BGY D;  2QJY B;  2WQY C;  1USD A;  4U3F E;  1ZW0 A;  2W6B A;  2FYZ A;  1KTM A;  2HYN A;  1NTK G;  4JBZ A;  2SPZ A;  1SFC B;  3AE1 C;  5TJH A;  1EZV E;  2J5U A;  5K5G B;  2KP8 A;  1NTK K;  3TNU B;  2WPV B;  1PGJ A;  3PLN A;  1SFC A;  3A3Y B;  5AW1 B;  1SQQ G;  1JOC A;  1FZA A;  2RMZ A;  1LTT C;  2RN0 A;  1LJ2 A;  3TNU A;  4HB1 A;  2HFE D;  4ZKP A;  3BVH A;  1PGQ A;  1SQQ K;  1HBW A;  1GTW A;  3CC7 P;  1PGO A;  1L0N G;  3CCV P;  1L0L J;  1FDI A;  2P7J A;  2YXR B;  3CWB E;  2QJY C;  1SQQ D;  3P8M C;  4W80 A;  4BWN A;  2E42 A;  1L0N K;  2ZXE B;  3GG2 A;  1ZP0 C;  1SFC C;  3CL3 D;  1SFC D;  5TIS H;  3RBZ A;  3TGU E;  4WY4 A;  2M5A B;  1PZQ A;  3NMD A;  5TIS E;  3AEG C;  4AQR D;  2W27 A;  4XFJ A;  1NU1 J;  2Q3I A;  1XTG B;  1IFM A;  3L70 D;  4U7J A;  3L71 E;  1KIL D;  1T6A A;  4H0L B;  1ZN5 A;  1EZV I;  2QA4 P;  3N7N A;  1CW5 A;  1AVY A;  1T3U A;  3FXE A;  1EDL A;  1J1E B;  4NPE A;  2B87 B;  4C7N B;  2JP3 A;  2AEF A;  3VTP C;  1DIP A;  5AVR B;  2P2U A;  5AW8 B;  3CCS P;  3R4Y A;  4WY4 C;  4WY4 D;  2B87 A;  3MGN A;  1P84 D;  4C7N A;  1S3J A;  1DH3 A;  2KXP B;  2I1J A;  3G71 P;  3L74 D;  3BRV B;  1SQB J;  1ZRT D;  2KZI A;  2B9B A;  1YQ4 C;  1S9K E;  3AE8 C;  2O01 J;  1PIX A;  4GKG A;  2WSE J;  2WVR A;  4H0L C;  4N78 D;  4H0L D;  3LW5 J;  3CWB D;  2ZFC A;  5AW6 B;  4PJ0 H;  3KDP B;  5APS A;  2YKO A;  1GU5 A;  1NH4 A;  4KHX A;  2XDJ A;  2WPS A;  3VMA A;  1K04 A;  3FWN A;  4PJ0 E;  4RES B;  1EXI A;  3O6Q B;  1L0L G;  1VQ7 P;  4IL6 H;  2JDI H;  3CMA P;  1JEK A;  1KB9 H;  4IL6 E;  2O01 H;  3AEE C;  4BRY B;  2JWA A;  1L0L K;  3P32 A;  3O6Q A;  1KB9 E;  1LP1 B;  5AVW B;  3MP7 B;  2LXB A;  3GW6 A;  2WT7 A;  3D6Y A;  2ZYG A;  1VQ8 P;  1USE A;  1S2E A;  1FZF A;  1W2B O;  4I7Z B;  2LKM A;  2KB7 P;  3L71 D;  3AE9 C;  4EI2 A;  5E79 E;  1LP1 A;  4HKZ H;  3L72 J;  1NU1 G;  4PV1 C;  4JYC A;  4PV1 D;  2A45 H;  5KAF H;  2P58 A;  1U57 A;  2JO1 A;  1KQF B;  1N2D C;  2IBZ E;  2IYO A;  1KMI Z;  1NU1 K;  1ZOY C;  5KAF E;  2OQQ A;  3OAK A;  3CX5 H;  4HYT B;  1MFT A;  3M0D C;  3IN6 A;  3CX5 E;  1DD3 A;  1KQG B;  1IFD A;  1AQT A;  1FZE A;  2CPS A;  5AVQ B;  3B5N A;  5CCG A;  3OJA B;  5KLI B;  4D6T E;  3BCC E;  1S9K D;  1Z56 A;  2K3R A;  1SQX E;  1NTM G;  4B86 A;  2M0B A;  1KZU B;  1QLE D;  1YBK A;  4I7Z C;  4L75 A;  3QWO C;  2W8Z A;  5AW0 B;  1RF1 B;  1SQB G;  3V4W A;  1KB9 I;  2IZ1 A;  4WWI A;  1SQB K;  2WTY A;  1RF1 A;  1DX7 A;  2FFD B;  2PP6 A;  1AV1 A;  3VMY A;  1J1D B;  4Z1M H;  4DOJ A;  1FDM A;  2HLO A;  1X22 A;  1VQN P;  5BU5 A;  4O9B A;  1SQB D;  1FDO A;  1JY2 O;  3B5N C;  5CCG C;  3CCL P;  3B5N D;  5CCG D;  3RK3 E;  2Q9I A;  1KB9 D;  5KLV E;  2PRR A;  1BE3 J;  2FFD A;  3EFF K;  2QJP B;  1Y8A A;  2IBZ I;  3CCQ P;  2A45 I;  3H1H G;  1BCC E;  2JEE A;  1NTZ E;  3CCR P;  2AXT H;  5KLI C;  3T97 B;  2M3E A;  3BAS A;  2YIU C;  3H1L E;  2AXT E;  3CX5 I;  1VF5 B;  2W83 C;  4GOF A;  1E79 H;  2HPC A;  2E74 B;  2OAR A;  3L4F A;  1RF1 C;  1NAF A;  1YJN P;  3CME P;  3L72 G;  3OA7 A;  1RY3 A;  1PPJ G;  3NTN A;  3CX5 D;  3MUD A;  1OIP A;  3H32 B;  3P8C E;  3RK2 C;  3RK2 D;  2FFD C;  1OFC X;  3F5H A;  1OWA A;  1ZR4 A;  2HR3 A;  3Q1M A;  1M7L A;  3L72 D;  2WPR A;  4RKU J;  3H32 A;  3SWF A;  2J58 A;  2QJP C;  1FU1 A;  4R4M A;  1SQX D;  1HUC A;  3AE2 C;  1D7M A;  3OW2 O;  2WSF H;  1VF5 C;  4PD4 H;  4HH2 A;  1VF5 D;  2ZJS E;  3A2A A;  1SQV J;  3CPW O;  1JMM A;  1RQU A;  2LXC B;  2E74 C;  1NYH A;  2JJL A;  3MUD C;  2E74 D;  1U7M A;  1FOS E;  3AEC C;  2YKQ A;  1PP9 J;  4JQ0 D;  1NTK E;  3WU2 H;  1VL2 A;  2O1K A;  3WU2 E;  3V4Q A;  1JY3 N;  4JPZ B;  2OYH B;  1YQ3 C;  3AE6 C;  1KD1 Q;  3AEF C;  3CCM P;  3A0B H;  1NTZ D;  3RGU A;  1SQQ E;  2OYH A;  1KQS O;  1BE3 G;  3BRT B;  5APQ A;  3U59 A;  4GT1 A;  1YJ9 P;  5AW4 B;  2N9Y B;  3VP8 A;  1NO4 A;  1JCD A;  5DJT B;  5AVY B;  1L0N E;  1HF9 A;  3LIE A;  2V4H A;  4OGQ B;  4MN4 C;  3GF7 A;  5B66 H;  4Y28 J;  2R44 A;  2YO2 A;  2RKL A;  1X9V A;  2Z4E A;  3VYI A;  4KJM A;  2C9L Y;  1BSN A;  3VP9 A;  2QM8 A;  5APU A;  2A06 G;  4IFD K;  1KIL E;  5AW2 B;  3VMX A;  3CC4 P;  3VMZ A;  2OYH C;  2IZ0 A;  3WUU A;  2N9B A;  1Q7Y Q;  2A06 D;  3JCU H;  2YNY A;  2R3S A;  5DJU B;  1A02 F;  1P84 H;  1OX3 A;  4OH8 B;  1H0T B;  4PD4 D;  1P84 E;  1URQ A;  3H25 A;  1NVO A;  3V2R A;  4OGQ C;  3KZI H;  4OGQ D;  1ZXG A;  1KIL B;  1NTK D;  2ZT9 B;  3L74 E;  1SQV G;  1ZRT E;  3L75 J;  3KZI E;  1RE4 A;  1M90 Q;  1H0T A;  2AEM A;  1LT9 B;  1LTB C;  1GL2 B;  2P1J A;  1VQ4 P;  2XNX A;  1PP9 G;  1JNM A;  3S9O A;  2R32 A;  1KIL A;  4Y99 B;  1SQV K;  1MKM A;  4N78 E;  3UIA A;  5AVS B;  5B5E H;  1SP4 A;  1LT9 A;  1SQV D;  2H88 C;  3E1I A;  1GL2 A;  1QVG O;  4WY4 B;  1IFI A;  3H1J J;  4WB4 A;  3IF4 A;  1OZH A;  1HGZ A;  2GUV A;  1FBM A;  3P7K A;  1L0N D;  1URQ C;  3U1A A;  1URQ D;  1LWU B;  1EC5 A;  1VQO P;  4K3A A;  1IK9 A;  3A5T A;  1RE4 C;  2WSC J;  3Q5P A;  3AE5 C;  1L0L E;  3FGA D;  1AJY A;  1LWU A;  2DW3 A;  3CLQ A;  2I1K A;  1KIL C;  4U3F G;  1MUU A;  2ZT9 C;  2ZT9 D;  3V6I A;  1QL1 A;  3HE4 A;  1LT9 C;  1P84 I;  2BEQ D;  2QJK C;  1GL2 C;  1GL2 D;  3AE4 C;  5KJ7 A;  2XU6 A;  4Y99 C;  4UB8 H;  1EZV G;  4QMA A;  2FBW C;  1GK6 A;  1K9M Q;  1KV4 A;  4UB8 E;  5GTI H;  1Q90 D;  2MJZ A;  1HGV A;  1IC2 A;  1PL5 A;  5APV A;  1NU1 E;  1LTS C;  1N73 A;  2K9J B;  1FE6 A;  1NWQ A;  3GHG A;  1NTM J;  1LWU C;  3CI9 A;  2ZVN B;  2O1J A;  5CMZ A;  1S5L H;  1H88 A;  4K35 A;  4YXW H;  2E5T A;  2K9J A;  1S5L E;  4PV1 B;  2FXO A;  3EWK A;  1FZG A;  5CJ0 A;  5APT A;  3AE3 C;  3M91 A;  5KJ7 C;  5KJ7 D;  1XTC C;  3L75 G;  1N7S B;  2D2C B;  2Y0C A;  4JF7 A;  4DCK A;  1LTJ C;  2WIT A;  2IPP A;  1OW6 A;  1S1C X;  3I56 P;  1N73 C;  2JWD A;  2ZXX A;  2WT7 B;  1N7S A;  1SVF A;  2KYV A;  1GK4 A;  3GHG C;  3H1H J;  1SQB E;  3EFG A;  3M0D A;  3L75 D;  3IAO A;  3USS A;  2Q6Q A;  2WSE H;  3H1J G;  1JCC A;  3CCJ P;  2IFM A;  3AEB C;  5KAI H;  3LW5 H;  1LTG C;  2KNC B;  1L0L D;  4NPF X;  3HD7 B;  3M06 A;  1RQV A;  5KAI E;  4UB6 H;  1RH5 B;  1FZC B;  2OTJ P;  3LID A;  1M8O B;  1JY3 P;  1FZB A;  3SWK A;  2KNC A;  3HD7 A;  2QE7 H;  2RH0 A;  3S1K A;  1PV3 A;  3W67 A;  2C9N Y;  1NHL A;  1FZC A;  3CD6 P;  1M57 D;  1N7S C;  1VQL P;  2D2C C;  1N7S D;  2D2C D;  3G4S P;  3B5N B;  3L73 J;  3KQG A;  2NPS B;  3PHL A;  4LLH A;  3BAT A;  2ITA A;  1NU1 D;  1X79 B;  1S72 P;  2KLU A;  2ZVO B;  1PFI A;  1S4X A;  1JUN A;  2OGU A;  2GUS A;  1AQ5 A;  1MFZ A;  5AVV B;  2IDB A;  1LTA C;  1K8A Q;  3VOP A;  5AVZ B;  2NPS A;  2LR2 A;  2E5Y A;  3L72 E;  5APW A;  2YIU B;  2Y9Z A;  1PPJ E;  3KXD A;  1DD4 A;  2YO3 A;  2KZJ A;  1Q82 Q;  3KHU A;  3HD7 C;  3HD7 D;  2K88 A;  1LGH B;  2Y0E A;  1FZC C;  4ASW A;  2QSI A;  1H89 A;  1NTM K;  2HG5 D;  1ZR2 A;  1YIT P;  1WMK A;  3RK2 B;  1KQL A;  1NTM D;  2BCC J;  2WWW A;  4H13 B;  3GF3 A;  1M56 D;  4L73 A;  1J2J B;  2NPS C;  2NPS D;  2Y9Y A;  2G3A A;  3TK1 A;  2WPQ A;  4IL6 X;  1HVV A;  1K73 Q;  4L74 A;  3ZDM A;  3EQ2 A;  2Z5I A;  2HPC B;  2W6A A;  2J59 M;  1SQP J;  3GLM A;  3PP5 A;  1OVV A;  2KOG A;  2XV5 A;  2IBZ G;  2OTL P;  4N3Y B;  3I55 P;  2R3C A;  3H1H D;  1BGY J;  5AW5 B;  4C46 A;  1KYO H;  4WVZ A;  1BE3 E;  1GW3 A;  3AE7 C;  2FYN C;  1KYO E;  1N7L A;  1VQM P;  1L4A D;  4IFF A;  1T8Z A;  4IFM A;  1HJB A;  1IK7 A;  1IZN B;  3PJS K;  4H13 C;  3L73 G;  4H13 D;  2FYU J;  5BVZ A;  2BAS A;  2OTK E;  1PPJ D;  4M3L A;  1KFN A;  2I8D A;  3H1I J;  2OYI A;  2BEZ F;  2A06 E;  2GM4 A;  2K1A A;  2PGD A;  3E7K A;  3L35 A;  3CXH H;  5CBN A;  3RL0 g;  2R5D A;  3NFQ A;  2E76 C;  4PD4 E;  1GD2 E;  2E76 D;  3CXH E;  2XKM A;  3JSV C;  4GDO A;  1NOH A;  1YYC A;  1JY2 N;  1IFJ A; 
#chains in the Genus database with same CATH homology
 5B5E E;  3A0B E;  5GTI E;  3JCU E;  3WU2 E;  5KAI E;  5KAF E;  2AXT E;  4IL6 E;  3A0H E;  5E79 E;  5B66 E;  4UB8 E;  1W5C E;  4UB6 E;  5H2F E;  4PJ0 E;  5GTH E;  5TIS E;  3KZI E;  1S5L E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...