5TISE

Room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 18
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5tisE00
1S5LE 3A0HE 1W5CE 3JCUE 4PJ0E 3A0BE 3KZIE 5KAIE 5H2FE 5GTIE 5GTHE 5KAFE 3WU2E 5B5EE 5B66E 5E79E 4IL6E 4UB8E 2AXTE 5TISE 4UB6E
chains in the Genus database with same CATH superfamily
3L73G 2P67A 1Y47A 2Y0DA 1YYCA 1U7MA 2Y0CA 4H44D 1PGJA 1CW5A 5AW9B 1EDKA 4YXDC 1BCCJ 2ZAEB 1BCCG 3I5CA 5AVTB 3L72D 1RF1C 3L71D 4GOFA 1NKZB 4NPFX 1KQGB 2W27A 1NWQA 1FZFA 2JKVA 2P7JA 3VMZA 1RQUA 1KQFB 1KFMA 3OJAB 3V6IA 1N73A 1DIPA 2Q3IA 3AE2C 1K04A 2B9BA 3SWYA 3H1HE 4AUWA 1UIIA 2WSEJ 3HTKA 3RBZA 1FBMA 4PJ0H 1VF5B 1N86A 2FFDA 2B87B 3Q2YA 1OVUA 1SQVD 3Q5PA 3PRJA 1R5LA 2N1TD 2P58A 1BGYD 3BRVB 3FXDA 5AW7B 1L0NK 2DW3A 2BCCD 3CCEP 1S4XA 2YMKA 4HJGH 4XA4A 3MUDC 4HB1A 1JB0J 1SQBJ 1X0TA 2I8DA 4WY4C 2J58A 1SQBG 5KAFH 1NOHA 2NPSA 2J59M 2YXRB 3WUUA 2PAJA 1EZVG 2L5GB 2VRSA 1AA0A 3L4FA 2QG4A 3CL3D 2MKVA 1Q86Q 4PJ0E 2D2CD 3CXHE 4OGQC 1NYHA 5H2FE 1FZBA 3Q1MA 4OGQB 5C39A 5AW4B 3D6YA 1L0LD 1PV3A 3A3YB 4L75A 1SQXG 2H89C 5AVXB 2IZ1A 3O6QB 3R2PA 1VQ4P 3AE8C 2OYIC 4L74A 3TNUA 3EFFK 4GKGA 3Q5SA 1S5LH 2E5YA 4GIFA 2OYIB 1PP9J 2O3JA 1OW7A 3II6A 1ZP0C 1PP9G 3CWBE 1BSHA 3BATA 2FKWB 4A7PA 3L72J 3L71J 2FYUD 2KP8A 2YKPA 1GK4A 3L72G 4AQRD 3GG2A 3L71G 2KNCB 2A45I 3G71P 5KLVE 3W68A 1IFJA 1L0ND 4RKUJ 2C9LY 1VQKP 3A0HE 5AW2B 2E5TA 3ITKA 3CX5D 1J2JB 1KV4A 3TDKA 1JTHA 2Q9IA 2Z5IA 1PPJE 2CPSA 1KQLA 1NTZE 1S9KE 1M8OB 4IFMA 5TJHA 3BCCD 5AW5B 5KAIH 2B88A 3H1IJ 3FGAD 2ITAA 2ZT9D 1SQVJ 3CCVP 3H1IG 1NKNA 2WSFJ 5KLIC 1SQVG 4I7ZC 2L91A 1VQPP 2BCCJ 4UB8E 5KLIB 2WZ7A 4I7ZB 2BCCG 1PFIA 3EQ2A 3BRTB 1URQC 1RHZB 1RE4A 2B89A 2W6BA 2W90A 5CJ0A 1LWUA 5AVQB 1URQB 3L73E 3BASA 1QVGO 1GW3A 1LT9C 1KN7A 2A45G 2AEMA 4O9BA 5AW3B 1LT9B 3V2PA 5BU5A 1M90Q 3GHGA 2G8YA 2WPQA 4W7ZA 3MIWA 2KYVA 1IK9A 3HE5B 1OX3A 2JWDA 5CBNA 1IFMA 1JO5A 1NTKK 3GLMA 2AEFA 2W6AA 1FE6A 4JYCA 3U1CA 2YXQB 5B5EH 1IK7A 2Q7CA 1L4AC 1P84H 1NGMB 3WUVA 2Q5UA 1L4AB 4BRYA 1KYOE 1GTWA 5APTA 1BDCA 3LIDA 4H0LD 3KQGA 2PP6A 3VMXA 2HODB 1HVVA 1KQSO 2JJLA 1PL5A 4PD4D 1L0NJ 4WY4D 3TSIA 1L0NG 2IPPA 2QVAA 3B5NA 1DH3A 2M3EA 1OW6A 3ABVC 3V2RA 1JY2O 2XNDH 1GMJA 2GUSA 4N78E 5APSA 1T2KC 5AVVB 3L74D 1KB9D 3A7OA 3CCSP 1H89A 3M91A 1LTSC 1M56D 1EZVE 4OGQD 1HUCA 2LXBA 1VPCA 3S9OA 4GOEA 3SSUA 1VQ6P 2IBZD 1LTTC 1BCCD 2PFXA 1NH4A 3KPEA 1FZGA 2V4HA 1SQPK 1NU1K 3HE4B 2E76C 2QSIA 3SWFA 2Z4EA 1NTKD 2QJYC 2KZJA 2E76B 1G1JA 1SQXK 1H0TB 2Q1KA 2QJYB 1RE3A 2RMZA 3A2AA 1J1EC 5CCHC 1DEBA 4C7RA 1J1EB 1X9VA 1KILC 1K9MQ 1SFCA 4I6MC 4OVNF 1PGQA 2QRXA 3M9QA 3CCQP 3VOPA 3KZIH 3L72E 5AVWB 4NPDA 3L71E 1CI6A 1FZAA 4DCKA 3L70D 1Q7YQ 2KLVA 1GZLA 4QMAA 1MFZA 1SP4A 2AXTE 2Y9YA 5TISE 3ZDMA 2IBZI 1SQBD 3RK2C 1Q2NA 1KORA 4YXWH 3RK2B 1E79H 2OYOA 1FAVA 2KS1A 4I2LC 2KZIA 5BU8B 1GL2A 3L35A 1WMKA 4KJMA 3VN0A 1SQVE 2KK7A 2QM8A 1YJWP 1LJ2A 1FS0E 1BGYE 1FZEA 2QM7A 2BCCE 1SQPD 3H32B 1AVYA 1OWAA 2ZT9B 1VQ5P 1X8YA 1OVRA 4ASVA 5CCGA 3L74J 3L37A 1SQXD 3BVHA 1ZR4A 5K5GB 2R44A 2O01J 3L74G 2H8PD 1X22A 2XKMA 1K8AQ 1G2CA 1YQ3C 1YQ4C 2KIKA 1HBWA 1ZLLA 1PP9D 5AW1B 3C9IA 1DEEG 1X79B 2IBZG 3WMM0 4C7NB 1FJKA 1NTKJ 3KHUA 3OW2O 3FX0A 1AVOA 3OAKA 1L4AD 1BDDA 3LW5J 5GTIE 1NTKG 1RF1B 1L0LE 4HKZH 3Q5RA 1UIXA 3AE9C 5AVYB 1KC8Q 3IR9A 1PGPA 2LKMA 1USEA 1P84I 1JM0A 1N73C 4CPGA 2WPSA 2YMYA 1HWTC 3MTUE 1N73B 1RH5B 1ZOYC 1LTJA 2NZ2A 4LC1A 2FYNC 1YTZT 3CXHH 3P8CD 4XE5B 1HJBA 2MJZA 5H2FH 3H1ID 2FYUE 2XNXA 2FFDC 1D7MA 5KJ7A 3CC4P 3HTKB 4H0LC 1RF0A 1YJ9P 3FWNA 2FFDB 1L0NE 2LR2A 3L70J 1IFNA 4H0LB 1T2KD 2FXOA 4H13C 3L70G 4WBAA 2WITA 3NMDA 3H1JG 1EDIA 3CX5E 1MZ9A 4WY4B 2Y9ZA 5AW0B 3CCJP 3VP9A 3EWKA 3M06A 2W6JH 1JNMA 2NPSC 1ZN5A 2JP3A 3BCCE 3QWOC 3U59A 2WSCH 2R32A 2NPSB 2E76D 3A0BE 4NPEA 3GMAA 1SQPJ 1NU1J 1OVVA 1FOSE 1KZUB 1SQPG 2C0XA 4IL6E 1NU1G 3A0HH 2IZ0A 2JEEA 2OYHC 3AEDC 1SQXJ 3KDPB 4EIJA 2OYHB 1JEKA 1ZXGA 5CCHD 2XZRA 1AJYA 1FZCA 1KILD 3O6QA 2JR8A 5E79E 1YJNP 1JUNA 4GODA 4YPCA 1BE3D 2PGDA 1JY3P 2JDIH 4U7JA 1A02J 3G4SP 5L8RJ 3CCUP 3TNUB 3NTNA 1FOSF 2E75C 4ZNCA 4UB8H 3N4XA 3CCMP 3CD6P 4Y99C 2QE7H 1JY3N 1R5SA 4R4LA 2WPVB 3H1LD 1NTMK 4Y99B 1N7SA 2HR3A 3RK2D 4GDOA 4C46A 3LIEA 4RESB 3CC7P 2O1KA 4LLHA 2HG5D 4RJTA 2M8RA 5AW6B 3H1KD 5KLVK 2M0BA 2XDJA 3U1AA 1SLQA 5AW8B 5CMZA 1YIJP 3RL0g 1YTZI 2WSSH 2QJKC 2WWWA 2H43A 1JTHB 2QJKB 2BASA 2K37A 1HH0A 3D70A 2FXMA 2R5BA 4PD4E 5APQA 3PTZA 2V7QJ 3USSA 4DZOA 1OMIA 1SQQK 2K9JA 3Q3DA 4KT0J 1LP1B 4N6JA 1RE4C 4DT0A 1OW8A 3L74E 1URQA 1KYOH 2H7HA 1L2PA 1KB9E 4UB6E 3GW6A 3HD7A 2KOGA 2OGUA 2WSEH 2IYOA 2QEXP 2IDBA 3V4QA 2RKLA 4I1LA 3AE6C 1K73Q 2IBZE 3GHGC 2WT7A 1IFPA 1LGHB 3V2QA 1BCCE 1YITP 1NO4A 3GHGB 3T97A 1KMIZ 1NTKE 2WTYA 1NTMD 2HLOA 2UWJE 3AECC 4DOJA 1K05A 3JC22 1GW4A 5CJ4A 3M0AA 3WU2E 2Q6QA 1N8RQ 2R3SA 4IFDK 2KB7P 1BE3J 2CK3H 5AVRB 1PIXA 1BE3G 3V2NA 4B86A 3RK3C 2GA1A 1LTIC 3H6PA 1G1IA 3RK3B 1Q90D 3B8EB 3O8ZA 1Q82Q 3CXHI 2HYNA 3H1LJ 4H13D 1QGKB 2HODA 4MN4C 1JMMA 3H1LG 3IF4A 1T3UA 2W83C 2YIUC 1SQQD 3P32A 2YO2A 3F5HA 3L70E 1QVFO 3H1KJ 3B5NC 1KD1Q 3H1KG 1SQBE 2NPSD 1JCDA 3B5NB 3TGUD 3AEEC 2M5AA 1E5WA 4IL6X 2N1TA 2GM4A 2BEZF 2ZYGA 1EXJA 2KUBA 4D6TD 1QEXA 1VQMP 4JYBA 1CZQA 5B66E 1AV1A 2E74C 1LNQA 3W67A 1USDA 4K3AA 1OZHA 3IAOA 3P8MC 3SFEC 3H25A 1SQPE 3S1KA 4YTPC 2A06D 2AXTH 2KSJA 4ZMDA 1NVOA 2R3CA 5TISH 2POHA 1SQXE 3RL0C 2O01N 1MFTA 2P1JA 5APWA 3PJSK 3N7NA 2O1JA 5M1BA 3K5BA 2E75D 4WB4A 3E1RA 1RE3C 2FXPA 3M9HA 3CCRP 1IFDA 4OWFA 3HUSC 2ZVNB 1PP9E 3HUSB 2WSFH 1S1CX 1KILB 1SFCC 4EI2A 1TU3F 1LTAC 3PHLA 4PV1C 1W5CE 1OIPA 1IO4A 1NTMJ 1SFCB 1NTMG 4R4MA 1GU5A 1GK6A 3EFGA 1CI6B 3G3ZA 2A45H 3H1JD 5KLVJ 2JWAA 4JQ0D 2WPRA 5KLVG 4Y28J 4W7YA 1M1JA 1EDLA 2YKOA 3B71A 1ZRTD 3M0DA 4ZKPA 3P8CE 3H1IE 3E1IA 1P84D 5GTIH 1GL2C 1KFNA 3C1LA 1H8AA 2KS1B 4XFJA 2ZVOB 2HPCA 1XTCC 2K3RA 3D6ZA 1EXIA 1SQQJ 1U7JA 1NU1D 1GL2B 1S3JA 1SQQG 1IZNB 3H32A 1MV8A 2I1KA 1FDMA 3MGNA 1OFCX 3D71A 3TGUJ 1QX8A 1FJPA 3TGUG 5CCGC 3RGUA 1KYOI 3AEAC 3AE1C 4D6TJ 2Y0EA 1JY2P 4D6TG 1S2EA 1W2BO 1G2CB 2AEJA 4BXLA 3OA7A 3E7KA 5AVZB 3JCUE 3FWLA 1JY2N 1RQVA 1VQLP 1Y9BA 4C7NA 1MUUA 2YNYA 5BVZA 1FDOA 4U3FD 2A06G 3VYIA 4L73A 3CX5H 1RF1A 4RO0A 1H88A 1EDJA 1VQ9P 1ZR2A 3RK3D 4TLFA 3L36A 1KILE 2IX7C 1Y8AA 1ZW0A 1EZVI 1VQNP 1L0LK 5EFWB 1BE3E 2GUVA 2KXPB 5KTBA 3L75D 3A0BH 1HTLC 1M7LA 1LTJC 3SWKA 1M1KQ 3G9RA 2FYNB 2B87A 4IL6H 1LTJB 1BSNA 1T3JA 1VF5C 3H1LE 3CPWO 3B5ND 1WRGA 5KJ7C 3NFQA 1RF0C 3H1JJ 1NAYA 2FYUK 2R5DA 1N7LA 1R8EA 3I56P 4H13B 2E43A 3H1KE 1EQ7A 1N2DC 5E79H 1LTGC 3V5BA 2K88A 3PP5A 3MUDA 3IN6A 1HGZA 1MKMA 2E74D 2OARA 4WY4A 2QJPC 2PRRA 1FDIA 1SS1A 2YO3A 3MP7B 1RY3A 2QJPB 3QH9A 3S4RA 4JPZB 3RL0D 3P7KA 2ZXEB 4OH8B 2LXCB 2G3AA 1HJ0A 5KKZC 2CPBA 3B4SA 3M9BA 2P2UA 1SVFA 2OYHA 5KKZB 1FZCC 2C9NY 1KTMA 1SFCD 3VMAA 4DJGA 2OYIA 4PV1D 3CI9A 2FY8A 1FZCB 4PD4H 1VQOP 1NJIQ 3AE3C 5KAFE 1IFIA 3GF3A 2E75B 4U3FJ 3H1HD 4Z1MH 3JSVC 4JBZA 1YHQP 4U3FG 1NTME 2KNCA 4HYTB 3AE7C 3PLNA 2H88C 1ZV8A 1N7SC 4L76A 2JO1A 1KB9H 1Q81Q 2K9YA 3AE4C 1LTBC 2O01H 4UB6H 1N7SB 1FC2C 4AYCA 2N9BA 1IJDB 3C8VA 3L75J 1YBKA 1ZMEC 3MZWB 3L75G 3TF5A 2WMMA 1GL2D 4IOIH 3KXDA 2IFNA 2Z5HA 2FYZA 4KHXA 1PZQA 2ZFCA 1NAFA 3MD0A 1VQ7P 1NTZK 3LW5H 1VL2A 1S5LE 3CMEP 1DD4A 1SQQE 5CCGD 2M3BA 1HF9A 3TYYA 3WU2H 2IYPA 3FXEA 3SFDC 1BGYJ 3AEFC 2SPZA 1OXZA 1LP1A 3CXHD 2QIWA 1BGYG 3TGUE 1LWUC 2K9JB 2YKQA 1T8ZA 4W80A 4EDFA 1LWUB 4D6TE 1AFOA 3HD7C 1FU1A 1LT9A 1CSBA 1QL2A 3HD7B 1U57A 3VMYA 1EC5A 2FBWC 3HE5A 1GU4A 2BEQD 2OTKE 1DD3A 2A06E 3VP8A 2Q3EA 3CWBD 2WT7B 5APYA 5KAIE 4H44C 3CX5I 4LGDE 3AEGC 3T97B 4H44B 1QL1A 1L0LJ 5KLVD 1L0LG 1L4AA 1QLED 3CMAP 5B66H 1JMBA 4WVZA 1VF5D 1GD2E 3AE5C 1DX7A 2ZYDA 5KJ7D 4BRYB 5APXA 1AQ5A 1HGVA 2OTLP 3H1HJ 1LT1A 2ZYAA 3H1HG 1PPJD 1NTZD 1S9KD 2FYUJ 3G6EP 4EOTA 2OTJP 2ZJSE 4IFFA 2FYUG 2YIUB 3H1JE 4EYYQ 1IC2A 1WT6A 2J5UA 2K1AA 2HFED 1YI2P 3TK1A 1Z56A 2KLUA 1ZRTE 2XV5A 2N1TC 4HH2A 2M5AB 5B5EE 1SQBK 3L73D 2IFMA 2N1TB 1P84E 2OQQA 3BCCJ 3PH0A 2E74B 3CCLP 3BCCG 1NU1E 2N9YB 5CBOA 3HE4A 5AVSB 1XTGB 1GDTA 2ZXXA 3HRNA 1H0TA 3AEBC 3CLQA 5APUA 3VTPC 3RL0B 2D2CC 1AQTA 2NRGA 5DJTB 2RH0A 2D2CB 3I55P 2C0WA 4ASWA 3GF7A 1JCCA 3HUSA 3NXSA 5CCHA 2KSEA 2I1JA 4PD4I 3V4WA 1KILA 1J1DC 2AXCA 2V7QH 1N7SD 2WVRA 1KYOD 3CWBJ 5AVUB 2P10A 4U3FE 1VQ8P 3CWBG 4PV1B 1J1DB 5DJUB 1JOCA 5CHXA 3A5TA 4GT1A 2XU6A 2WSCJ 4ZKUA 1T6AA 3RK3E 3CC2P 2W8ZA 3R4YA 1KB9I 5GTHH 4JF7A 1NHLA 2WQYC 1S5LX 3WUTA 1A02F 1PGOA 3L75E 2E42A 3KYQA 1S72P 4N3YB 1M1JC 3JCUH 4N78D 4M3LA 3M0DC 5APVA 3UIAA 1W2EA 1M1JB 1NTZJ 4K35A 3IFMA 1PPJG 1NTZG 2KI7B 1EZVD 4BWNA 3F89A 4WWIA 1SQVK 1URQD 3MHVA 2HPCB 2QA4P 3RBXA 3HD7D 2ZT9C 3KZIE 2RN0A 5GTHE 1M57D 4TT3H 1VDFA 3L73J 1JY3O
chains in the Genus database with same CATH topology
1S5LE 3A0HE 1W5CE 3JCUE 4PJ0E 3A0BE 3KZIE 5KAIE 5H2FE 5GTIE 5GTHE 5KAFE 3WU2E 5B5EE 5B66E 5E79E 4IL6E 4UB8E 2AXTE 5TISE 4UB6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5L E;  3A0H E;  1W5C E;  3JCU E;  4PJ0 E;  3A0B E;  3KZI E;  5KAI E;  5H2F E;  5GTI E;  5GTH E;  5KAF E;  3WU2 E;  5B5E E;  5B66 E;  5E79 E;  4IL6 E;  4UB8 E;  2AXT E;  5TIS E;  4UB6 E; 
#chains in the Genus database with same CATH topology
 3L73 G;  2P67 A;  1Y47 A;  2Y0D A;  1YYC A;  1U7M A;  2Y0C A;  4H44 D;  1PGJ A;  1CW5 A;  5AW9 B;  1EDK A;  4YXD C;  1BCC J;  2ZAE B;  1BCC G;  3I5C A;  5AVT B;  3L72 D;  1RF1 C;  3L71 D;  4GOF A;  1NKZ B;  4NPF X;  1KQG B;  2W27 A;  1NWQ A;  1FZF A;  2JKV A;  2P7J A;  3VMZ A;  1RQU A;  1KQF B;  1KFM A;  3OJA B;  3V6I A;  1N73 A;  1DIP A;  2Q3I A;  3AE2 C;  1K04 A;  2B9B A;  3SWY A;  3H1H E;  4AUW A;  1UII A;  2WSE J;  3HTK A;  3RBZ A;  1FBM A;  4PJ0 H;  1VF5 B;  1N86 A;  2FFD A;  2B87 B;  3Q2Y A;  1OVU A;  1SQV D;  3Q5P A;  3PRJ A;  1R5L A;  2N1T D;  2P58 A;  1BGY D;  3BRV B;  3FXD A;  5AW7 B;  1L0N K;  2DW3 A;  2BCC D;  3CCE P;  1S4X A;  2YMK A;  4HJG H;  4XA4 A;  3MUD C;  4HB1 A;  1JB0 J;  1SQB J;  1X0T A;  2I8D A;  4WY4 C;  2J58 A;  1SQB G;  5KAF H;  1NOH A;  2NPS A;  2J59 M;  2YXR B;  3WUU A;  2PAJ A;  1EZV G;  2L5G B;  2VRS A;  1AA0 A;  3L4F A;  2QG4 A;  3CL3 D;  2MKV A;  1Q86 Q;  4PJ0 E;  2D2C D;  3CXH E;  4OGQ C;  1NYH A;  5H2F E;  1FZB A;  3Q1M A;  4OGQ B;  5C39 A;  5AW4 B;  3D6Y A;  1L0L D;  1PV3 A;  3A3Y B;  4L75 A;  1SQX G;  2H89 C;  5AVX B;  2IZ1 A;  3O6Q B;  3R2P A;  1VQ4 P;  3AE8 C;  2OYI C;  4L74 A;  3TNU A;  3EFF K;  4GKG A;  3Q5S A;  1S5L H;  2E5Y A;  4GIF A;  2OYI B;  1PP9 J;  2O3J A;  1OW7 A;  3II6 A;  1ZP0 C;  1PP9 G;  3CWB E;  1BSH A;  3BAT A;  2FKW B;  4A7P A;  3L72 J;  3L71 J;  2FYU D;  2KP8 A;  2YKP A;  1GK4 A;  3L72 G;  4AQR D;  3GG2 A;  3L71 G;  2KNC B;  2A45 I;  3G71 P;  5KLV E;  3W68 A;  1IFJ A;  1L0N D;  4RKU J;  2C9L Y;  1VQK P;  3A0H E;  5AW2 B;  2E5T A;  3ITK A;  3CX5 D;  1J2J B;  1KV4 A;  3TDK A;  1JTH A;  2Q9I A;  2Z5I A;  1PPJ E;  2CPS A;  1KQL A;  1NTZ E;  1S9K E;  1M8O B;  4IFM A;  5TJH A;  3BCC D;  5AW5 B;  5KAI H;  2B88 A;  3H1I J;  3FGA D;  2ITA A;  2ZT9 D;  1SQV J;  3CCV P;  3H1I G;  1NKN A;  2WSF J;  5KLI C;  1SQV G;  4I7Z C;  2L91 A;  1VQP P;  2BCC J;  4UB8 E;  5KLI B;  2WZ7 A;  4I7Z B;  2BCC G;  1PFI A;  3EQ2 A;  3BRT B;  1URQ C;  1RHZ B;  1RE4 A;  2B89 A;  2W6B A;  2W90 A;  5CJ0 A;  1LWU A;  5AVQ B;  1URQ B;  3L73 E;  3BAS A;  1QVG O;  1GW3 A;  1LT9 C;  1KN7 A;  2A45 G;  2AEM A;  4O9B A;  5AW3 B;  1LT9 B;  3V2P A;  5BU5 A;  1M90 Q;  3GHG A;  2G8Y A;  2WPQ A;  4W7Z A;  3MIW A;  2KYV A;  1IK9 A;  3HE5 B;  1OX3 A;  2JWD A;  5CBN A;  1IFM A;  1JO5 A;  1NTK K;  3GLM A;  2AEF A;  2W6A A;  1FE6 A;  4JYC A;  3U1C A;  2YXQ B;  5B5E H;  1IK7 A;  2Q7C A;  1L4A C;  1P84 H;  1NGM B;  3WUV A;  2Q5U A;  1L4A B;  4BRY A;  1KYO E;  1GTW A;  5APT A;  1BDC A;  3LID A;  4H0L D;  3KQG A;  2PP6 A;  3VMX A;  2HOD B;  1HVV A;  1KQS O;  2JJL A;  1PL5 A;  4PD4 D;  1L0N J;  4WY4 D;  3TSI A;  1L0N G;  2IPP A;  2QVA A;  3B5N A;  1DH3 A;  2M3E A;  1OW6 A;  3ABV C;  3V2R A;  1JY2 O;  2XND H;  1GMJ A;  2GUS A;  4N78 E;  5APS A;  1T2K C;  5AVV B;  3L74 D;  1KB9 D;  3A7O A;  3CCS P;  1H89 A;  3M91 A;  1LTS C;  1M56 D;  1EZV E;  4OGQ D;  1HUC A;  2LXB A;  1VPC A;  3S9O A;  4GOE A;  3SSU A;  1VQ6 P;  2IBZ D;  1LTT C;  1BCC D;  2PFX A;  1NH4 A;  3KPE A;  1FZG A;  2V4H A;  1SQP K;  1NU1 K;  3HE4 B;  2E76 C;  2QSI A;  3SWF A;  2Z4E A;  1NTK D;  2QJY C;  2KZJ A;  2E76 B;  1G1J A;  1SQX K;  1H0T B;  2Q1K A;  2QJY B;  1RE3 A;  2RMZ A;  3A2A A;  1J1E C;  5CCH C;  1DEB A;  4C7R A;  1J1E B;  1X9V A;  1KIL C;  1K9M Q;  1SFC A;  4I6M C;  4OVN F;  1PGQ A;  2QRX A;  3M9Q A;  3CCQ P;  3VOP A;  3KZI H;  3L72 E;  5AVW B;  4NPD A;  3L71 E;  1CI6 A;  1FZA A;  4DCK A;  3L70 D;  1Q7Y Q;  2KLV A;  1GZL A;  4QMA A;  1MFZ A;  1SP4 A;  2AXT E;  2Y9Y A;  5TIS E;  3ZDM A;  2IBZ I;  1SQB D;  3RK2 C;  1Q2N A;  1KOR A;  4YXW H;  3RK2 B;  1E79 H;  2OYO A;  1FAV A;  2KS1 A;  4I2L C;  2KZI A;  5BU8 B;  1GL2 A;  3L35 A;  1WMK A;  4KJM A;  3VN0 A;  1SQV E;  2KK7 A;  2QM8 A;  1YJW P;  1LJ2 A;  1FS0 E;  1BGY E;  1FZE A;  2QM7 A;  2BCC E;  1SQP D;  3H32 B;  1AVY A;  1OWA A;  2ZT9 B;  1VQ5 P;  1X8Y A;  1OVR A;  4ASV A;  5CCG A;  3L74 J;  3L37 A;  1SQX D;  3BVH A;  1ZR4 A;  5K5G B;  2R44 A;  2O01 J;  3L74 G;  2H8P D;  1X22 A;  2XKM A;  1K8A Q;  1G2C A;  1YQ3 C;  1YQ4 C;  2KIK A;  1HBW A;  1ZLL A;  1PP9 D;  5AW1 B;  3C9I A;  1DEE G;  1X79 B;  2IBZ G;  3WMM 0;  4C7N B;  1FJK A;  1NTK J;  3KHU A;  3OW2 O;  3FX0 A;  1AVO A;  3OAK A;  1L4A D;  1BDD A;  3LW5 J;  5GTI E;  1NTK G;  1RF1 B;  1L0L E;  4HKZ H;  3Q5R A;  1UIX A;  3AE9 C;  5AVY B;  1KC8 Q;  3IR9 A;  1PGP A;  2LKM A;  1USE A;  1P84 I;  1JM0 A;  1N73 C;  4CPG A;  2WPS A;  2YMY A;  1HWT C;  3MTU E;  1N73 B;  1RH5 B;  1ZOY C;  1LTJ A;  2NZ2 A;  4LC1 A;  2FYN C;  1YTZ T;  3CXH H;  3P8C D;  4XE5 B;  1HJB A;  2MJZ A;  5H2F H;  3H1I D;  2FYU E;  2XNX A;  2FFD C;  1D7M A;  5KJ7 A;  3CC4 P;  3HTK B;  4H0L C;  1RF0 A;  1YJ9 P;  3FWN A;  2FFD B;  1L0N E;  2LR2 A;  3L70 J;  1IFN A;  4H0L B;  1T2K D;  2FXO A;  4H13 C;  3L70 G;  4WBA A;  2WIT A;  3NMD A;  3H1J G;  1EDI A;  3CX5 E;  1MZ9 A;  4WY4 B;  2Y9Z A;  5AW0 B;  3CCJ P;  3VP9 A;  3EWK A;  3M06 A;  2W6J H;  1JNM A;  2NPS C;  1ZN5 A;  2JP3 A;  3BCC E;  3QWO C;  3U59 A;  2WSC H;  2R32 A;  2NPS B;  2E76 D;  3A0B E;  4NPE A;  3GMA A;  1SQP J;  1NU1 J;  1OVV A;  1FOS E;  1KZU B;  1SQP G;  2C0X A;  4IL6 E;  1NU1 G;  3A0H H;  2IZ0 A;  2JEE A;  2OYH C;  3AED C;  1SQX J;  3KDP B;  4EIJ A;  2OYH B;  1JEK A;  1ZXG A;  5CCH D;  2XZR A;  1AJY A;  1FZC A;  1KIL D;  3O6Q A;  2JR8 A;  5E79 E;  1YJN P;  1JUN A;  4GOD A;  4YPC A;  1BE3 D;  2PGD A;  1JY3 P;  2JDI H;  4U7J A;  1A02 J;  3G4S P;  5L8R J;  3CCU P;  3TNU B;  3NTN A;  1FOS F;  2E75 C;  4ZNC A;  4UB8 H;  3N4X A;  3CCM P;  3CD6 P;  4Y99 C;  2QE7 H;  1JY3 N;  1R5S A;  4R4L A;  2WPV B;  3H1L D;  1NTM K;  4Y99 B;  1N7S A;  2HR3 A;  3RK2 D;  4GDO A;  4C46 A;  3LIE A;  4RES B;  3CC7 P;  2O1K A;  4LLH A;  2HG5 D;  4RJT A;  2M8R A;  5AW6 B;  3H1K D;  5KLV K;  2M0B A;  2XDJ A;  3U1A A;  1SLQ A;  5AW8 B;  5CMZ A;  1YIJ P;  3RL0 g;  1YTZ I;  2WSS H;  2QJK C;  2WWW A;  2H43 A;  1JTH B;  2QJK B;  2BAS A;  2K37 A;  1HH0 A;  3D70 A;  2FXM A;  2R5B A;  4PD4 E;  5APQ A;  3PTZ A;  2V7Q J;  3USS A;  4DZO A;  1OMI A;  1SQQ K;  2K9J A;  3Q3D A;  4KT0 J;  1LP1 B;  4N6J A;  1RE4 C;  4DT0 A;  1OW8 A;  3L74 E;  1URQ A;  1KYO H;  2H7H A;  1L2P A;  1KB9 E;  4UB6 E;  3GW6 A;  3HD7 A;  2KOG A;  2OGU A;  2WSE H;  2IYO A;  2QEX P;  2IDB A;  3V4Q A;  2RKL A;  4I1L A;  3AE6 C;  1K73 Q;  2IBZ E;  3GHG C;  2WT7 A;  1IFP A;  1LGH B;  3V2Q A;  1BCC E;  1YIT P;  1NO4 A;  3GHG B;  3T97 A;  1KMI Z;  1NTK E;  2WTY A;  1NTM D;  2HLO A;  2UWJ E;  3AEC C;  4DOJ A;  1K05 A;  3JC2 2;  1GW4 A;  5CJ4 A;  3M0A A;  3WU2 E;  2Q6Q A;  1N8R Q;  2R3S A;  4IFD K;  2KB7 P;  1BE3 J;  2CK3 H;  5AVR B;  1PIX A;  1BE3 G;  3V2N A;  4B86 A;  3RK3 C;  2GA1 A;  1LTI C;  3H6P A;  1G1I A;  3RK3 B;  1Q90 D;  3B8E B;  3O8Z A;  1Q82 Q;  3CXH I;  2HYN A;  3H1L J;  4H13 D;  1QGK B;  2HOD A;  4MN4 C;  1JMM A;  3H1L G;  3IF4 A;  1T3U A;  2W83 C;  2YIU C;  1SQQ D;  3P32 A;  2YO2 A;  3F5H A;  3L70 E;  1QVF O;  3H1K J;  3B5N C;  1KD1 Q;  3H1K G;  1SQB E;  2NPS D;  1JCD A;  3B5N B;  3TGU D;  3AEE C;  2M5A A;  1E5W A;  4IL6 X;  2N1T A;  2GM4 A;  2BEZ F;  2ZYG A;  1EXJ A;  2KUB A;  4D6T D;  1QEX A;  1VQM P;  4JYB A;  1CZQ A;  5B66 E;  1AV1 A;  2E74 C;  1LNQ A;  3W67 A;  1USD A;  4K3A A;  1OZH A;  3IAO A;  3P8M C;  3SFE C;  3H25 A;  1SQP E;  3S1K A;  4YTP C;  2A06 D;  2AXT H;  2KSJ A;  4ZMD A;  1NVO A;  2R3C A;  5TIS H;  2POH A;  1SQX E;  3RL0 C;  2O01 N;  1MFT A;  2P1J A;  5APW A;  3PJS K;  3N7N A;  2O1J A;  5M1B A;  3K5B A;  2E75 D;  4WB4 A;  3E1R A;  1RE3 C;  2FXP A;  3M9H A;  3CCR P;  1IFD A;  4OWF A;  3HUS C;  2ZVN B;  1PP9 E;  3HUS B;  2WSF H;  1S1C X;  1KIL B;  1SFC C;  4EI2 A;  1TU3 F;  1LTA C;  3PHL A;  4PV1 C;  1W5C E;  1OIP A;  1IO4 A;  1NTM J;  1SFC B;  1NTM G;  4R4M A;  1GU5 A;  1GK6 A;  3EFG A;  1CI6 B;  3G3Z A;  2A45 H;  3H1J D;  5KLV J;  2JWA A;  4JQ0 D;  2WPR A;  5KLV G;  4Y28 J;  4W7Y A;  1M1J A;  1EDL A;  2YKO A;  3B71 A;  1ZRT D;  3M0D A;  4ZKP A;  3P8C E;  3H1I E;  3E1I A;  1P84 D;  5GTI H;  1GL2 C;  1KFN A;  3C1L A;  1H8A A;  2KS1 B;  4XFJ A;  2ZVO B;  2HPC A;  1XTC C;  2K3R A;  3D6Z A;  1EXI A;  1SQQ J;  1U7J A;  1NU1 D;  1GL2 B;  1S3J A;  1SQQ G;  1IZN B;  3H32 A;  1MV8 A;  2I1K A;  1FDM A;  3MGN A;  1OFC X;  3D71 A;  3TGU J;  1QX8 A;  1FJP A;  3TGU G;  5CCG C;  3RGU A;  1KYO I;  3AEA C;  3AE1 C;  4D6T J;  2Y0E A;  1JY2 P;  4D6T G;  1S2E A;  1W2B O;  1G2C B;  2AEJ A;  4BXL A;  3OA7 A;  3E7K A;  5AVZ B;  3JCU E;  3FWL A;  1JY2 N;  1RQV A;  1VQL P;  1Y9B A;  4C7N A;  1MUU A;  2YNY A;  5BVZ A;  1FDO A;  4U3F D;  2A06 G;  3VYI A;  4L73 A;  3CX5 H;  1RF1 A;  4RO0 A;  1H88 A;  1EDJ A;  1VQ9 P;  1ZR2 A;  3RK3 D;  4TLF A;  3L36 A;  1KIL E;  2IX7 C;  1Y8A A;  1ZW0 A;  1EZV I;  1VQN P;  1L0L K;  5EFW B;  1BE3 E;  2GUV A;  2KXP B;  5KTB A;  3L75 D;  3A0B H;  1HTL C;  1M7L A;  1LTJ C;  3SWK A;  1M1K Q;  3G9R A;  2FYN B;  2B87 A;  4IL6 H;  1LTJ B;  1BSN A;  1T3J A;  1VF5 C;  3H1L E;  3CPW O;  3B5N D;  1WRG A;  5KJ7 C;  3NFQ A;  1RF0 C;  3H1J J;  1NAY A;  2FYU K;  2R5D A;  1N7L A;  1R8E A;  3I56 P;  4H13 B;  2E43 A;  3H1K E;  1EQ7 A;  1N2D C;  5E79 H;  1LTG C;  3V5B A;  2K88 A;  3PP5 A;  3MUD A;  3IN6 A;  1HGZ A;  1MKM A;  2E74 D;  2OAR A;  4WY4 A;  2QJP C;  2PRR A;  1FDI A;  1SS1 A;  2YO3 A;  3MP7 B;  1RY3 A;  2QJP B;  3QH9 A;  3S4R A;  4JPZ B;  3RL0 D;  3P7K A;  2ZXE B;  4OH8 B;  2LXC B;  2G3A A;  1HJ0 A;  5KKZ C;  2CPB A;  3B4S A;  3M9B A;  2P2U A;  1SVF A;  2OYH A;  5KKZ B;  1FZC C;  2C9N Y;  1KTM A;  1SFC D;  3VMA A;  4DJG A;  2OYI A;  4PV1 D;  3CI9 A;  2FY8 A;  1FZC B;  4PD4 H;  1VQO P;  1NJI Q;  3AE3 C;  5KAF E;  1IFI A;  3GF3 A;  2E75 B;  4U3F J;  3H1H D;  4Z1M H;  3JSV C;  4JBZ A;  1YHQ P;  4U3F G;  1NTM E;  2KNC A;  4HYT B;  3AE7 C;  3PLN A;  2H88 C;  1ZV8 A;  1N7S C;  4L76 A;  2JO1 A;  1KB9 H;  1Q81 Q;  2K9Y A;  3AE4 C;  1LTB C;  2O01 H;  4UB6 H;  1N7S B;  1FC2 C;  4AYC A;  2N9B A;  1IJD B;  3C8V A;  3L75 J;  1YBK A;  1ZME C;  3MZW B;  3L75 G;  3TF5 A;  2WMM A;  1GL2 D;  4IOI H;  3KXD A;  2IFN A;  2Z5H A;  2FYZ A;  4KHX A;  1PZQ A;  2ZFC A;  1NAF A;  3MD0 A;  1VQ7 P;  1NTZ K;  3LW5 H;  1VL2 A;  1S5L E;  3CME P;  1DD4 A;  1SQQ E;  5CCG D;  2M3B A;  1HF9 A;  3TYY A;  3WU2 H;  2IYP A;  3FXE A;  3SFD C;  1BGY J;  3AEF C;  2SPZ A;  1OXZ A;  1LP1 A;  3CXH D;  2QIW A;  1BGY G;  3TGU E;  1LWU C;  2K9J B;  2YKQ A;  1T8Z A;  4W80 A;  4EDF A;  1LWU B;  4D6T E;  1AFO A;  3HD7 C;  1FU1 A;  1LT9 A;  1CSB A;  1QL2 A;  3HD7 B;  1U57 A;  3VMY A;  1EC5 A;  2FBW C;  3HE5 A;  1GU4 A;  2BEQ D;  2OTK E;  1DD3 A;  2A06 E;  3VP8 A;  2Q3E A;  3CWB D;  2WT7 B;  5APY A;  5KAI E;  4H44 C;  3CX5 I;  4LGD E;  3AEG C;  3T97 B;  4H44 B;  1QL1 A;  1L0L J;  5KLV D;  1L0L G;  1L4A A;  1QLE D;  3CMA P;  5B66 H;  1JMB A;  4WVZ A;  1VF5 D;  1GD2 E;  3AE5 C;  1DX7 A;  2ZYD A;  5KJ7 D;  4BRY B;  5APX A;  1AQ5 A;  1HGV A;  2OTL P;  3H1H J;  1LT1 A;  2ZYA A;  3H1H G;  1PPJ D;  1NTZ D;  1S9K D;  2FYU J;  3G6E P;  4EOT A;  2OTJ P;  2ZJS E;  4IFF A;  2FYU G;  2YIU B;  3H1J E;  4EYY Q;  1IC2 A;  1WT6 A;  2J5U A;  2K1A A;  2HFE D;  1YI2 P;  3TK1 A;  1Z56 A;  2KLU A;  1ZRT E;  2XV5 A;  2N1T C;  4HH2 A;  2M5A B;  5B5E E;  1SQB K;  3L73 D;  2IFM A;  2N1T B;  1P84 E;  2OQQ A;  3BCC J;  3PH0 A;  2E74 B;  3CCL P;  3BCC G;  1NU1 E;  2N9Y B;  5CBO A;  3HE4 A;  5AVS B;  1XTG B;  1GDT A;  2ZXX A;  3HRN A;  1H0T A;  3AEB C;  3CLQ A;  5APU A;  3VTP C;  3RL0 B;  2D2C C;  1AQT A;  2NRG A;  5DJT B;  2RH0 A;  2D2C B;  3I55 P;  2C0W A;  4ASW A;  3GF7 A;  1JCC A;  3HUS A;  3NXS A;  5CCH A;  2KSE A;  2I1J A;  4PD4 I;  3V4W A;  1KIL A;  1J1D C;  2AXC A;  2V7Q H;  1N7S D;  2WVR A;  1KYO D;  3CWB J;  5AVU B;  2P10 A;  4U3F E;  1VQ8 P;  3CWB G;  4PV1 B;  1J1D B;  5DJU B;  1JOC A;  5CHX A;  3A5T A;  4GT1 A;  2XU6 A;  2WSC J;  4ZKU A;  1T6A A;  3RK3 E;  3CC2 P;  2W8Z A;  3R4Y A;  1KB9 I;  5GTH H;  4JF7 A;  1NHL A;  2WQY C;  1S5L X;  3WUT A;  1A02 F;  1PGO A;  3L75 E;  2E42 A;  3KYQ A;  1S72 P;  4N3Y B;  1M1J C;  3JCU H;  4N78 D;  4M3L A;  3M0D C;  5APV A;  3UIA A;  1W2E A;  1M1J B;  1NTZ J;  4K35 A;  3IFM A;  1PPJ G;  1NTZ G;  2KI7 B;  1EZV D;  4BWN A;  3F89 A;  4WWI A;  1SQV K;  1URQ D;  3MHV A;  2HPC B;  2QA4 P;  3RBX A;  3HD7 D;  2ZT9 C;  3KZI E;  2RN0 A;  5GTH E;  1M57 D;  4TT3 H;  1VDF A;  3L73 J;  1JY3 O; 
#chains in the Genus database with same CATH homology
 1S5L E;  3A0H E;  1W5C E;  3JCU E;  4PJ0 E;  3A0B E;  3KZI E;  5KAI E;  5H2F E;  5GTI E;  5GTH E;  5KAF E;  3WU2 E;  5B5E E;  5B66 E;  5E79 E;  4IL6 E;  4UB8 E;  2AXT E;  5TIS E;  4UB6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...