5TISE

Room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
total genus 18
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5tisE00
3A0HE 1S5LE 5KAFE 5GTHE 1W5CE 2AXTE 5KAIE 5GTIE 5B5EE 5TISE 3JCUE 5E79E 4PJ0E 4IL6E 4UB8E 3KZIE 3A0BE 4UB6E 5H2FE 3WU2E 5B66E
chains in the Genus database with same CATH superfamily
4H0LD 1ZV8A 1ZP0C 1NWQA 1PP9J 4H13D 4BXLA 2KS1B 3D6ZA 1K04A 1JTHA 2B87B 2UWJE 1WRGA 1IK7A 5AW6B 2D2CC 3UIAA 1VQLP 1E79H 1SQPD 2KOGA 3WUUA 1FZAA 2N1TC 3H1IG 4RESB 2Y0EA 1Q81Q 2E74B 1URQA 4L76A 2KYVA 1DX7A 2M0BA 1SQPK 1L0LD 3M9QA 1MV8A 1SP4A 2R5DA 1QVGO 1UIIA 3O6QA 3OJAB 3CC7P 3JCUH 1K05A 1J1EB 1NHLA 1XTGB 4U3FJ 3CCQP 1ZMEC 2W6AA 3O6QB 5CBNA 5KAFH 3L73D 1WT6A 1OMIA 3L72G 1NTZD 5CMZA 3H1JJ 1W2EA 1BE3G 3TF5A 1SQXK 2FYUG 1JEKA 2ZT9D 3V5BA 1KZUB 3H32A 1JOCA 2W83C 2E75B 5AVVB 4R4LA 4WY4D 2J5UA 4TLFA 2XDJA 3IR9A 3G6EP 1H8AA 1BCCJ 1KYOH 3B71A 3SWKA 5APVA 2IBZG 2RN0A 3RK2B 2P7JA 3TSIA 1ZR4A 3BCCG 3WUVA 3M9BA 2HPCB 1JCDA 1R8EA 3A0HH 3AE7C 1NTKJ 2E74C 2ZT9C 3AEGC 3BCCJ 3N7NA 1NU1D 3NMDA 4M3LA 4PD4I 4D6TE 1VF5B 1NTKG 2OYOA 1AA0A 1RF0A 1LTJB 1OVVA 1SQVE 5AVSB 1RQVA 5TJHA 3ITKA 4L73A 5AW8B 1RE3A 1N8RQ 4N3YB 1IJDB 1G1JA 3GHGC 1SFCB 1GU4A 3V2NA 3EFFK 1SQXD 5AW3B 3AE4C 3OAKA 5KJ7D 1LTJC 1N73B 3HD7D 1RHZB 4C7NA 2IFMA 4GDOA 4W80A 2ZFCA 1MZ9A 2QA4P 3B5NB 3MZWB 4L75A 1PP9G 3GMAA 3L70J 1Q2NA 4H44C 1L4AB 3BASA 5AW2B 1HVVA 1VQNP 1PL5A 2ITAA 3MUDA 2WT7B 1SFCA 5KAIE 1JUNA 1VDFA 3L70E 3SWFA 2QVAA 4ASWA 2Q3EA 4H13C 1KILE 1GL2D 3CLQA 1DD3A 1PGQA 3TDKA 3AE9C 5AVQB 1GZLA 4JF7A 2G3AA 1G1IA 2OYIB 1CI6A 3E1RA 4IOIH 4WWIA 3H1KG 2QM8A 1GU5A 5KJ7A 2Z5IA 3CX5E 4EDFA 1JNMA 3CCLP 3H1KJ 2AEJA 2BEQD 3CX5H 2C0WA 1SQVD 2GUVA 3FX0A 3L71E 3N4XA 3P8MC 4H0LC 3AE2C 3HD7C 1HTLC 1OWAA 4JYCA 1FDOA 3V2QA 2K9JA 3Q3DA 3V2RA 2Z4EA 1BGYE 3L36A 2Q7CA 1EZVE 2V7QH 3P7KA 2FYUJ 1LNQA 1BCCG 2N1TB 2N1TA 3KXDA 2R3SA 1FC2C 3SFEC 1FZCC 3AEAC 2HFED 3RK3B 2E76B 3VN0A 1VQOP 1EQ7A 1CSBA 2KI7B 3LIDA 4HYTB 2B89A 5CCGC 2YKQA 1FAVA 2FFDC 2A06E 2KZIA 4EI2A 1QLED 1GL2C 5E79E 1GDTA 2AEMA 2WSCJ 5KKZB 1VQPP 2BCCE 5KLIB 2FYZA 2IFNA 3TK1A 2B9BA 1SQQG 3NTNA 4I2LC 3K5BA 1LWUC 4KJMA 4KHXA 1NYHA 2G8YA 4K3AA 1H88A 3A3YB 4GODA 1NTZG 3HRNA 3PLNA 5M1BA 2JDIH 1M57D 2OGUA 2YXRB 3WMM0 1GTWA 2XU6A 3CCSP 5B66E 1NAFA 1L0NG 4EOTA 2IBZI 3H1LJ 1JB0J 3C9IA 3C1LA 3Q2YA 1M1JA 1MFTA 1OX3A 1J1DC 3PTZA 3TGUJ 5GTHE 2K9JB 2Q1KA 2QM7A 1S9KE 1GMJA 1ZRTE 2WZ7A 3HE5B 3Q1MA 3JSVC 4HKZH 2WPSA 2ZYGA 2M3BA 3E7KA 3PH0A 1DEBA 3RK3C 4ZKPA 3HE4A 1J2JB 1VF5C 3BRVB 3JCUE 2R32A 1VQ8P 3RGUA 1N73A 4Z1MH 1RE4A 3I55P 2RKLA 1A02F 2R5BA 3CPWO 2XNXA 1NU1J 1KFMA 1ZN5A 1EXJA 2OYIA 1NTKD 4H0LB 1LP1A 1EDJA 1CW5A 1GL2A 1NU1G 1ZXGA 3SFDC 3CWBG 1SQXG 1IFPA 2JO1A 4NPEA 4UB8H 1RQUA 1VQMP 3D6YA 1LP1B 2E75C 1K73Q 1KB9D 1HJ0A 2V4HA 3L75E 3H25A 1L0LG 1NKNA 2OYIC 3RBZA 5APWA 3CXHE 3E1IA 3GF3A 2H88C 4W7YA 1BE3J 2YMKA 4UB6H 3A0HE 1PPJE 1SQQD 3H1HJ 2V7QJ 3B4SA 1ZOYC 1YJNP 4XE5B 1ZLLA 3R4YA 5BVZA 5AW7B 3HTKB 3H1KD 1M1JB 1KYOI 1YBKA 3H1LD 5KLVK 4KT0J 1VQ5P 1YHQP 1YI2P 2CPSA 3HUSB 4U3FE 5K5GB 1Q82Q 1SQPE 1EDKA 2JKVA 3L74E 3D71A 4IL6X 4U7JA 2A45I 3AECC 3PP5A 4EIJA 2HR3A 2GUSA 1KYOE 1BE3D 5AVXB 4RO0A 2E5TA 2WSSH 1KD1Q 3CC4P 3G3ZA 2DW3A 3LIEA 4QMAA 3BVHA 1T3JA 1XTCC 1JY3N 1NKZB 1NTZJ 3B5NA 3GHGB 3KDPB 2O01N 2YIUB 2K1AA 2YNYA 4GKGA 2JWDA 1Q86Q 3D70A 4UB6E 2W6JH 3CXHI 3RK2D 4JBZA 3GW6A 1NTME 2Y0CA 2ZT9B 2XKMA 1SQBD 2Q3IA 1P84D 2ZAEB 4GOEA 3H32B 1JMMA 1L0NJ 2OQQA 2YO3A 3FWLA 2JJLA 1BSHA 3GG2A 3CMEP 1T2KC 1YQ3C 2FYUE 1E5WA 4LLHA 1Y9BA 3TNUB 1SFCD 2BCCD 1IFMA 2W6BA 1KQSO 2NPSA 4NPFX 2H43A 4WB4A 1AQTA 1KFNA 4XFJA 3H1KE 3TNUA 1MFZA 1URQC 4BRYA 3A0BH 2N9BA 2HLOA 4I7ZC 2IBZE 2OARA 5KLVE 1NVOA 1S4XA 2M5AB 3CWBJ 3BCCE 1SQBG 4OH8B 3I56P 2ZXEB 1LTSC 5EFWB 1NGMB 2P1JA 3MD0A 3AEFC 5KLVJ 2O01H 2I1KA 2RMZA 1AV1A 1CI6B 1KQLA 1EZVG 1LT9C 3AE6C 3CL3D 3H1JG 5AW0B 1DD4A 3EFGA 4LC1A 2IZ1A 2WVRA 1Q90D 3H1ID 3PRJA 1QEXA 3L73E 4A7PA 4DOJA 2IYPA 2O3JA 2WSEJ 3HD7B 4BRYB 5APUA 3VOPA 1S5LE 5CJ4A 2C9NY 1N2DC 2E5YA 2D2CD 4L74A 3ZDMA 3CCVP 1FDIA 2AEFA 2D2CB 1KILD 3M0DC 1GW4A 2K9YA 3S4RA 5B5EE 1PIXA 5TISE 1YJWP 5H2FH 3CMAP 5L8RJ 1PPJD 1SQQE 2FXPA 2ZVNB 4JYBA 1JY3P 4IFMA 3VYIA 1ZW0A 4ASVA 3P32A 1VQ6P 2R44A 2Q6QA 2Y9ZA 2B88A 1Y47A 2P2UA 1P84H 2AXCA 2OTKE 1PGPA 4OGQB 1L4AC 3AEDC 1LWUB 1T3UA 2KP8A 3GHGA 1RE3C 1SQVK 3KZIE 3LW5H 1HF9A 3AE3C 3M9HA 3WUTA 5KLIC 2QJKC 4JQ0D 2H7HA 1OW6A 2ZYDA 4WBAA 2PFXA 3GF7A 5E79H 2FFDA 1TU3F 1HGVA 1GW3A 5AVZB 3G4SP 2HPCA 1KQFB 1RE4C 3M0AA 1QL1A 1N73C 1NTKK 2WPVB 3B8EB 1FS0E 1HUCA 2YIUC 2WSCH 3HUSA 3VMZA 1FOSE 5KAIH 2LKMA 2QJYC 3AEBC 2AXTE 3NXSA 1FZCB 1OZHA 4O9BA 3W67A 4YTPC 2FKWB 3M91A 1N7SD 3SWYA 1MKMA 2ZYAA 3RK3E 5KTBA 1VL2A 4PJ0E 1N7SC 5APYA 3KZIH 2NZ2A 3L37A 2KNCB 3L75G 1RF1C 4R4MA 3RL0C 1U7MA 2KSEA 1LT9B 5APTA 5KKZC 1JMBA 3L72J 1DEEG 3L74J 5AVYB 1S72P 1LT1A 2QG4A 3PJSK 3V6IA 3VMAA 1KB9H 3CD6P 4N78E 2O1KA 5BU8B 1FU1A 5APXA 1FE6A 2FYNC 1EC5A 2FYNB 2W8ZA 1LTIC 3FXDA 3OA7A 4JPZB 5CHXA 5H2FE 5APSA 1KN7A 3FWNA 3CI9A 2JEEA 2PRRA 2SPZA 1OW8A 5AW4B 3VMXA 1JY3O 1EXIA 3M06A 1LTBC 2KIKA 1U7JA 3USSA 1J1EC 2E42A 1FZGA 1CZQA 1L0NE 3TGUG 2J59M 4RJTA 3L74D 2L5GB 1S1CX 1NTKE 1GK6A 3B5NC 3RL0g 1R5LA 1HH0A 1IZNB 3H1HE 3LW5J 1GD2E 1H0TB 2YO2A 1Q7YQ 4OWFA 5GTIH 4Y28J 2NPSB 4PV1D 1PZQA 3H1IE 2WSFH 3W68A 1NTMJ 3CCEP 1X0TA 2KLUA 2KLVA 1PFIA 1FJKA 1P84E 1KILB 3P8CD 1KILC 1QVFO 3V4QA 1YQ4C 4OVNF 1PV3A 5GTHH 1FZFA 1VQKP 1M90Q 3H1LG 2NPSC 3HE4B 2KZJA 3S9OA 1IO4A 1KQGB 3P8CE 5AVUB 1AVOA 1X8YA 2KB7P 2M5AA 3HE5A 4YXWH 3L70G 3CCJP 3A7OA 4YXDC 4ZMDA 2A06G 1HBWA 1S5LX 1S3JA 2H89C 1M1JC 1IK9A 2L91A 2YKPA 3CWBD 4IL6H 2I8DA 4PD4D 4MN4C 5AW9B 1YITP 1NJIQ 5GTIE 3Q5RA 1IFNA 3EWKA 3HD7A 3JC22 2NRGA 1KMIZ 2Z5HA 2Y0DA 1ZRTD 1L0ND 4GIFA 3KPEA 3AE8C 2C0XA 1SVFA 1PP9D 2FXOA 3MTUE 1K9MQ 3O8ZA 1USEA 2WSFJ 4U3FG 3L71G 4WVZA 2QJPB 1N86A 1JY2P 1QX8A 1PGOA 2E76C 2O1JA 2XV5A 3S1KA 4D6TG 3FGAD 3BRTB 5AW1B 3RL0B 1M7LA 2R3CA 2FBWC 2WITA 3A0BE 1OFCX 1S9KD 1BCCE 2POHA 1N7SB 1KB9E 2HODB 3II6A 2OYHA 2GA1A 2I1JA 3R2PA 2JR8A 2K88A 3B5ND 1T6AA 3WU2E 1IFIA 1NU1K 3CC2P 1AJYA 2A45G 2WSEH 2M3EA 3FXEA 1L4AD 1DIPA 1FJPA 2E76D 1X79B 2Q5UA 2QJYB 3IFMA 4Y99C 3RK3D 3L73J 5CCHD 1EDIA 1RF1A 2OYHC 1LT9A 1J1DB 1N7SA 2LXCB 2IBZD 2LR2A 2P58A 2Y9YA 4I7ZB 4D6TD 2GM4A 3CWBE 5BU5A 3L35A 4PD4E 4XA4A 4N6JA 1RF0C 4B86A 1EZVI 3EQ2A 1S5LH 2XNDH 4N78D 1FDMA 2KXPB 4OGQD 4AUWA 1FZBA 2IPPA 1LTAC 4IFDK 4NPDA 1BGYD 3BATA 1D7MA 2HYNA 3H6PA 2BCCJ 2YXQB 1SQQJ 4H44B 2KSJA 3CX5I 4OGQC 1X22A 3L72D 2IX7C 1HWTC 1S2EA 2IZ0A 4DZOA 2BASA 1SS1A 1LGHB 4AQRD 1GL2B 5CBOA 2RH0A 3H1JE 5APQA 1NTZE 2FFDB 1USDA 3F89A 3Q5SA 5CCHC 2OYHB 1GK4A 2KNCA 4W7ZA 1SFCC 1W5CE 5CCGD 1KORA 2E75D 3MUDC 1BGYG 1T2KD 2PAJA 1FBMA 1BGYJ 1IFDA 1NU1E 2KK7A 1LTGC 4GOFA 3V4WA 3H1IJ 1T8ZA 3RBXA 3G71P 1Z56A 2P10A 1K8AQ 2XZRA 4K35A 1JY2O 2ZVOB 1KILA 4IL6E 2WPRA 3OW2O 1JTHB 1MUUA 3L71D 4UB8E 3RK2C 1VF5D 3U1AA 2KS1A 3WU2H 4D6TJ 4DT0A 1AQ5A 3ABVC 3L71J 4CPGA 3TGUD 1FZEA 1SLQA 1IC2A 1L0LJ 2QJPC 4LGDE 4EYYQ 1IFJA 2CK3H 1M1KQ 1KV4A 2WMMA 4GT1A 3CXHH 2HODA 1SQXE 2K37A 3IN6A 4C7RA 3L4FA 5AW5B 2IYOA 2IDBA 3V2PA 2A06D 3L72E 4H13B 5KAFE 4DCKA 1RY3A 1OW7A 1BDDA 3C8VA 3MGNA 2K3RA 3H1HG 1SQPG 1BE3E 3L70D 2QEXP 1LJ2A 3RL0D 5AVWB 1L0NK 3CCMP 2W27A 4IFFA 1RF1B 2QRXA 1L2PA 2B87A 3A5TA 3IF4A 3SSUA 1PGJA 3KQGA 1OVRA 2Q9IA 2NPSD 3Q5PA 1YTZT 1X9VA 2FYUD 4PD4H 4TT3H 5AVRB 4ZNCA 1OVUA 1OIPA 1H89A 2ZXXA 4AYCA 1BCCD 1SQQK 4PV1B 1KTMA 1FOSF 2N1TD 3CCRP 2MKVA 1VPCA 2BEZF 1KC8Q 1NTMG 1JCCA 5B5EH 3CXHD 1LWUA 2PP6A 1N7LA 4ZKUA 1ZR2A 3BCCD 4PV1C 1SQVG 1EZVD 3AE1C 1URQD 1EDLA 1KYOD 1YTZI 3GLMA 3IAOA 1SQVJ 4C7NB 3MIWA 1QGKB 2E74D 3TGUE 1BDCA 3U59A 2QJKB 4HJGH 1FZCA 1NO4A 2OTLP 2JP3A 3HUSC 4U3FD 1L0LE 4RKUJ 1AFOA 5CCGA 2AXTH 2H8PD 3CCUP 1LTJA 2QIWA 3QH9A 1A02J 5CJ0A 1PP9E 1NAYA 1H0TA 2A45H 1JY2N 1VQ7P 2O01J 3MP7B 4BWNA 1M56D 1SQBJ 2W90A 3G9RA 4C46A 2FXMA 3KYQA 3L75D 3U1CA 1HJBA 1SQBK 3AEEC 4WY4A 1AVYA 2YKOA 3L74G 1P84I 4Y99B 2OTJP 2FY8A 3L75J 4I1LA 2LXBA 4YPCA 2ZJSE 1SQXJ 2N9YB 1Y8AA 5KLVG 2QSIA 1YIJP 4H44D 3VTPC 3I5CA 5AVTB 2WTYA 3CX5D 1R5SA 2CPBA 5DJTB 2M8RA 2WPQA 1M8OB 2KUBA 4PJ0H 2C9LY 3VMYA 3VP9A 4DJGA 2PGDA 1SQPJ 3AE5C 1DH3A 2WT7A 1YJ9P 1HGZA 1BSNA 2FYUK 2P67A 5KJ7C 3L73G 1L4AA 3H1LE 1JO5A 2YMYA 1L0LK 1VQ9P 3MHVA 4HB1A 4HH2A 2JWAA 3VP8A 3QWOC 2QE7H 1W2BO 1JM0A 3T97B 1RH5B 2J58A 5KLVD 1LTTC 2MJZA 5TISH 4I6MC 1URQB 2VRSA 1OXZA 1WMKA 3A2AA 3H1HD 5B66H 1U57A 1G2CB 1G2CA 3HTKA 3KHUA 3F5HA 4WY4B 1NOHA 2WWWA 3H1JD 1NTMD 1NH4A 3NFQA 3PHLA 3TYYA 1VQ4P 2E43A 3T97A 5CCHA 1PPJG 1YYCA 3M0DA 4WY4C 5C39A 2BCCG 1UIXA 1SQBE 1KB9I 1NTZK 2HG5D 2WQYC 1NTMK 5DJUB 1QL2A
chains in the Genus database with same CATH topology
3A0HE 1S5LE 5KAFE 5GTHE 1W5CE 2AXTE 5KAIE 5GTIE 5B5EE 5TISE 3JCUE 5E79E 4PJ0E 4IL6E 4UB8E 3KZIE 3A0BE 4UB6E 5H2FE 3WU2E 5B66E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H E;  1S5L E;  5KAF E;  5GTH E;  1W5C E;  2AXT E;  5KAI E;  5GTI E;  5B5E E;  5TIS E;  3JCU E;  5E79 E;  4PJ0 E;  4IL6 E;  4UB8 E;  3KZI E;  3A0B E;  4UB6 E;  5H2F E;  3WU2 E;  5B66 E; 
#chains in the Genus database with same CATH topology
 4H0L D;  1ZV8 A;  1ZP0 C;  1NWQ A;  1PP9 J;  4H13 D;  4BXL A;  2KS1 B;  3D6Z A;  1K04 A;  1JTH A;  2B87 B;  2UWJ E;  1WRG A;  1IK7 A;  5AW6 B;  2D2C C;  3UIA A;  1VQL P;  1E79 H;  1SQP D;  2KOG A;  3WUU A;  1FZA A;  2N1T C;  3H1I G;  4RES B;  2Y0E A;  1Q81 Q;  2E74 B;  1URQ A;  4L76 A;  2KYV A;  1DX7 A;  2M0B A;  1SQP K;  1L0L D;  3M9Q A;  1MV8 A;  1SP4 A;  2R5D A;  1QVG O;  1UII A;  3O6Q A;  3OJA B;  3CC7 P;  3JCU H;  1K05 A;  1J1E B;  1NHL A;  1XTG B;  4U3F J;  3CCQ P;  1ZME C;  2W6A A;  3O6Q B;  5CBN A;  5KAF H;  3L73 D;  1WT6 A;  1OMI A;  3L72 G;  1NTZ D;  5CMZ A;  3H1J J;  1W2E A;  1BE3 G;  3TF5 A;  1SQX K;  2FYU G;  1JEK A;  2ZT9 D;  3V5B A;  1KZU B;  3H32 A;  1JOC A;  2W83 C;  2E75 B;  5AVV B;  4R4L A;  4WY4 D;  2J5U A;  4TLF A;  2XDJ A;  3IR9 A;  3G6E P;  1H8A A;  1BCC J;  1KYO H;  3B71 A;  3SWK A;  5APV A;  2IBZ G;  2RN0 A;  3RK2 B;  2P7J A;  3TSI A;  1ZR4 A;  3BCC G;  3WUV A;  3M9B A;  2HPC B;  1JCD A;  1R8E A;  3A0H H;  3AE7 C;  1NTK J;  2E74 C;  2ZT9 C;  3AEG C;  3BCC J;  3N7N A;  1NU1 D;  3NMD A;  4M3L A;  4PD4 I;  4D6T E;  1VF5 B;  1NTK G;  2OYO A;  1AA0 A;  1RF0 A;  1LTJ B;  1OVV A;  1SQV E;  5AVS B;  1RQV A;  5TJH A;  3ITK A;  4L73 A;  5AW8 B;  1RE3 A;  1N8R Q;  4N3Y B;  1IJD B;  1G1J A;  3GHG C;  1SFC B;  1GU4 A;  3V2N A;  3EFF K;  1SQX D;  5AW3 B;  3AE4 C;  3OAK A;  5KJ7 D;  1LTJ C;  1N73 B;  3HD7 D;  1RHZ B;  4C7N A;  2IFM A;  4GDO A;  4W80 A;  2ZFC A;  1MZ9 A;  2QA4 P;  3B5N B;  3MZW B;  4L75 A;  1PP9 G;  3GMA A;  3L70 J;  1Q2N A;  4H44 C;  1L4A B;  3BAS A;  5AW2 B;  1HVV A;  1VQN P;  1PL5 A;  2ITA A;  3MUD A;  2WT7 B;  1SFC A;  5KAI E;  1JUN A;  1VDF A;  3L70 E;  3SWF A;  2QVA A;  4ASW A;  2Q3E A;  4H13 C;  1KIL E;  1GL2 D;  3CLQ A;  1DD3 A;  1PGQ A;  3TDK A;  3AE9 C;  5AVQ B;  1GZL A;  4JF7 A;  2G3A A;  1G1I A;  2OYI B;  1CI6 A;  3E1R A;  4IOI H;  4WWI A;  3H1K G;  2QM8 A;  1GU5 A;  5KJ7 A;  2Z5I A;  3CX5 E;  4EDF A;  1JNM A;  3CCL P;  3H1K J;  2AEJ A;  2BEQ D;  3CX5 H;  2C0W A;  1SQV D;  2GUV A;  3FX0 A;  3L71 E;  3N4X A;  3P8M C;  4H0L C;  3AE2 C;  3HD7 C;  1HTL C;  1OWA A;  4JYC A;  1FDO A;  3V2Q A;  2K9J A;  3Q3D A;  3V2R A;  2Z4E A;  1BGY E;  3L36 A;  2Q7C A;  1EZV E;  2V7Q H;  3P7K A;  2FYU J;  1LNQ A;  1BCC G;  2N1T B;  2N1T A;  3KXD A;  2R3S A;  1FC2 C;  3SFE C;  1FZC C;  3AEA C;  2HFE D;  3RK3 B;  2E76 B;  3VN0 A;  1VQO P;  1EQ7 A;  1CSB A;  2KI7 B;  3LID A;  4HYT B;  2B89 A;  5CCG C;  2YKQ A;  1FAV A;  2FFD C;  2A06 E;  2KZI A;  4EI2 A;  1QLE D;  1GL2 C;  5E79 E;  1GDT A;  2AEM A;  2WSC J;  5KKZ B;  1VQP P;  2BCC E;  5KLI B;  2FYZ A;  2IFN A;  3TK1 A;  2B9B A;  1SQQ G;  3NTN A;  4I2L C;  3K5B A;  1LWU C;  4KJM A;  4KHX A;  1NYH A;  2G8Y A;  4K3A A;  1H88 A;  3A3Y B;  4GOD A;  1NTZ G;  3HRN A;  3PLN A;  5M1B A;  2JDI H;  1M57 D;  2OGU A;  2YXR B;  3WMM 0;  1GTW A;  2XU6 A;  3CCS P;  5B66 E;  1NAF A;  1L0N G;  4EOT A;  2IBZ I;  3H1L J;  1JB0 J;  3C9I A;  3C1L A;  3Q2Y A;  1M1J A;  1MFT A;  1OX3 A;  1J1D C;  3PTZ A;  3TGU J;  5GTH E;  2K9J B;  2Q1K A;  2QM7 A;  1S9K E;  1GMJ A;  1ZRT E;  2WZ7 A;  3HE5 B;  3Q1M A;  3JSV C;  4HKZ H;  2WPS A;  2ZYG A;  2M3B A;  3E7K A;  3PH0 A;  1DEB A;  3RK3 C;  4ZKP A;  3HE4 A;  1J2J B;  1VF5 C;  3BRV B;  3JCU E;  2R32 A;  1VQ8 P;  3RGU A;  1N73 A;  4Z1M H;  1RE4 A;  3I55 P;  2RKL A;  1A02 F;  2R5B A;  3CPW O;  2XNX A;  1NU1 J;  1KFM A;  1ZN5 A;  1EXJ A;  2OYI A;  1NTK D;  4H0L B;  1LP1 A;  1EDJ A;  1CW5 A;  1GL2 A;  1NU1 G;  1ZXG A;  3SFD C;  3CWB G;  1SQX G;  1IFP A;  2JO1 A;  4NPE A;  4UB8 H;  1RQU A;  1VQM P;  3D6Y A;  1LP1 B;  2E75 C;  1K73 Q;  1KB9 D;  1HJ0 A;  2V4H A;  3L75 E;  3H25 A;  1L0L G;  1NKN A;  2OYI C;  3RBZ A;  5APW A;  3CXH E;  3E1I A;  3GF3 A;  2H88 C;  4W7Y A;  1BE3 J;  2YMK A;  4UB6 H;  3A0H E;  1PPJ E;  1SQQ D;  3H1H J;  2V7Q J;  3B4S A;  1ZOY C;  1YJN P;  4XE5 B;  1ZLL A;  3R4Y A;  5BVZ A;  5AW7 B;  3HTK B;  3H1K D;  1M1J B;  1KYO I;  1YBK A;  3H1L D;  5KLV K;  4KT0 J;  1VQ5 P;  1YHQ P;  1YI2 P;  2CPS A;  3HUS B;  4U3F E;  5K5G B;  1Q82 Q;  1SQP E;  1EDK A;  2JKV A;  3L74 E;  3D71 A;  4IL6 X;  4U7J A;  2A45 I;  3AEC C;  3PP5 A;  4EIJ A;  2HR3 A;  2GUS A;  1KYO E;  1BE3 D;  5AVX B;  4RO0 A;  2E5T A;  2WSS H;  1KD1 Q;  3CC4 P;  3G3Z A;  2DW3 A;  3LIE A;  4QMA A;  3BVH A;  1T3J A;  1XTC C;  1JY3 N;  1NKZ B;  1NTZ J;  3B5N A;  3GHG B;  3KDP B;  2O01 N;  2YIU B;  2K1A A;  2YNY A;  4GKG A;  2JWD A;  1Q86 Q;  3D70 A;  4UB6 E;  2W6J H;  3CXH I;  3RK2 D;  4JBZ A;  3GW6 A;  1NTM E;  2Y0C A;  2ZT9 B;  2XKM A;  1SQB D;  2Q3I A;  1P84 D;  2ZAE B;  4GOE A;  3H32 B;  1JMM A;  1L0N J;  2OQQ A;  2YO3 A;  3FWL A;  2JJL A;  1BSH A;  3GG2 A;  3CME P;  1T2K C;  1YQ3 C;  2FYU E;  1E5W A;  4LLH A;  1Y9B A;  3TNU B;  1SFC D;  2BCC D;  1IFM A;  2W6B A;  1KQS O;  2NPS A;  4NPF X;  2H43 A;  4WB4 A;  1AQT A;  1KFN A;  4XFJ A;  3H1K E;  3TNU A;  1MFZ A;  1URQ C;  4BRY A;  3A0B H;  2N9B A;  2HLO A;  4I7Z C;  2IBZ E;  2OAR A;  5KLV E;  1NVO A;  1S4X A;  2M5A B;  3CWB J;  3BCC E;  1SQB G;  4OH8 B;  3I56 P;  2ZXE B;  1LTS C;  5EFW B;  1NGM B;  2P1J A;  3MD0 A;  3AEF C;  5KLV J;  2O01 H;  2I1K A;  2RMZ A;  1AV1 A;  1CI6 B;  1KQL A;  1EZV G;  1LT9 C;  3AE6 C;  3CL3 D;  3H1J G;  5AW0 B;  1DD4 A;  3EFG A;  4LC1 A;  2IZ1 A;  2WVR A;  1Q90 D;  3H1I D;  3PRJ A;  1QEX A;  3L73 E;  4A7P A;  4DOJ A;  2IYP A;  2O3J A;  2WSE J;  3HD7 B;  4BRY B;  5APU A;  3VOP A;  1S5L E;  5CJ4 A;  2C9N Y;  1N2D C;  2E5Y A;  2D2C D;  4L74 A;  3ZDM A;  3CCV P;  1FDI A;  2AEF A;  2D2C B;  1KIL D;  3M0D C;  1GW4 A;  2K9Y A;  3S4R A;  5B5E E;  1PIX A;  5TIS E;  1YJW P;  5H2F H;  3CMA P;  5L8R J;  1PPJ D;  1SQQ E;  2FXP A;  2ZVN B;  4JYB A;  1JY3 P;  4IFM A;  3VYI A;  1ZW0 A;  4ASV A;  3P32 A;  1VQ6 P;  2R44 A;  2Q6Q A;  2Y9Z A;  2B88 A;  1Y47 A;  2P2U A;  1P84 H;  2AXC A;  2OTK E;  1PGP A;  4OGQ B;  1L4A C;  3AED C;  1LWU B;  1T3U A;  2KP8 A;  3GHG A;  1RE3 C;  1SQV K;  3KZI E;  3LW5 H;  1HF9 A;  3AE3 C;  3M9H A;  3WUT A;  5KLI C;  2QJK C;  4JQ0 D;  2H7H A;  1OW6 A;  2ZYD A;  4WBA A;  2PFX A;  3GF7 A;  5E79 H;  2FFD A;  1TU3 F;  1HGV A;  1GW3 A;  5AVZ B;  3G4S P;  2HPC A;  1KQF B;  1RE4 C;  3M0A A;  1QL1 A;  1N73 C;  1NTK K;  2WPV B;  3B8E B;  1FS0 E;  1HUC A;  2YIU C;  2WSC H;  3HUS A;  3VMZ A;  1FOS E;  5KAI H;  2LKM A;  2QJY C;  3AEB C;  2AXT E;  3NXS A;  1FZC B;  1OZH A;  4O9B A;  3W67 A;  4YTP C;  2FKW B;  3M91 A;  1N7S D;  3SWY A;  1MKM A;  2ZYA A;  3RK3 E;  5KTB A;  1VL2 A;  4PJ0 E;  1N7S C;  5APY A;  3KZI H;  2NZ2 A;  3L37 A;  2KNC B;  3L75 G;  1RF1 C;  4R4M A;  3RL0 C;  1U7M A;  2KSE A;  1LT9 B;  5APT A;  5KKZ C;  1JMB A;  3L72 J;  1DEE G;  3L74 J;  5AVY B;  1S72 P;  1LT1 A;  2QG4 A;  3PJS K;  3V6I A;  3VMA A;  1KB9 H;  3CD6 P;  4N78 E;  2O1K A;  5BU8 B;  1FU1 A;  5APX A;  1FE6 A;  2FYN C;  1EC5 A;  2FYN B;  2W8Z A;  1LTI C;  3FXD A;  3OA7 A;  4JPZ B;  5CHX A;  5H2F E;  5APS A;  1KN7 A;  3FWN A;  3CI9 A;  2JEE A;  2PRR A;  2SPZ A;  1OW8 A;  5AW4 B;  3VMX A;  1JY3 O;  1EXI A;  3M06 A;  1LTB C;  2KIK A;  1U7J A;  3USS A;  1J1E C;  2E42 A;  1FZG A;  1CZQ A;  1L0N E;  3TGU G;  2J59 M;  4RJT A;  3L74 D;  2L5G B;  1S1C X;  1NTK E;  1GK6 A;  3B5N C;  3RL0 g;  1R5L A;  1HH0 A;  1IZN B;  3H1H E;  3LW5 J;  1GD2 E;  1H0T B;  2YO2 A;  1Q7Y Q;  4OWF A;  5GTI H;  4Y28 J;  2NPS B;  4PV1 D;  1PZQ A;  3H1I E;  2WSF H;  3W68 A;  1NTM J;  3CCE P;  1X0T A;  2KLU A;  2KLV A;  1PFI A;  1FJK A;  1P84 E;  1KIL B;  3P8C D;  1KIL C;  1QVF O;  3V4Q A;  1YQ4 C;  4OVN F;  1PV3 A;  5GTH H;  1FZF A;  1VQK P;  1M90 Q;  3H1L G;  2NPS C;  3HE4 B;  2KZJ A;  3S9O A;  1IO4 A;  1KQG B;  3P8C E;  5AVU B;  1AVO A;  1X8Y A;  2KB7 P;  2M5A A;  3HE5 A;  4YXW H;  3L70 G;  3CCJ P;  3A7O A;  4YXD C;  4ZMD A;  2A06 G;  1HBW A;  1S5L X;  1S3J A;  2H89 C;  1M1J C;  1IK9 A;  2L91 A;  2YKP A;  3CWB D;  4IL6 H;  2I8D A;  4PD4 D;  4MN4 C;  5AW9 B;  1YIT P;  1NJI Q;  5GTI E;  3Q5R A;  1IFN A;  3EWK A;  3HD7 A;  3JC2 2;  2NRG A;  1KMI Z;  2Z5H A;  2Y0D A;  1ZRT D;  1L0N D;  4GIF A;  3KPE A;  3AE8 C;  2C0X A;  1SVF A;  1PP9 D;  2FXO A;  3MTU E;  1K9M Q;  3O8Z A;  1USE A;  2WSF J;  4U3F G;  3L71 G;  4WVZ A;  2QJP B;  1N86 A;  1JY2 P;  1QX8 A;  1PGO A;  2E76 C;  2O1J A;  2XV5 A;  3S1K A;  4D6T G;  3FGA D;  3BRT B;  5AW1 B;  3RL0 B;  1M7L A;  2R3C A;  2FBW C;  2WIT A;  3A0B E;  1OFC X;  1S9K D;  1BCC E;  2POH A;  1N7S B;  1KB9 E;  2HOD B;  3II6 A;  2OYH A;  2GA1 A;  2I1J A;  3R2P A;  2JR8 A;  2K88 A;  3B5N D;  1T6A A;  3WU2 E;  1IFI A;  1NU1 K;  3CC2 P;  1AJY A;  2A45 G;  2WSE H;  2M3E A;  3FXE A;  1L4A D;  1DIP A;  1FJP A;  2E76 D;  1X79 B;  2Q5U A;  2QJY B;  3IFM A;  4Y99 C;  3RK3 D;  3L73 J;  5CCH D;  1EDI A;  1RF1 A;  2OYH C;  1LT9 A;  1J1D B;  1N7S A;  2LXC B;  2IBZ D;  2LR2 A;  2P58 A;  2Y9Y A;  4I7Z B;  4D6T D;  2GM4 A;  3CWB E;  5BU5 A;  3L35 A;  4PD4 E;  4XA4 A;  4N6J A;  1RF0 C;  4B86 A;  1EZV I;  3EQ2 A;  1S5L H;  2XND H;  4N78 D;  1FDM A;  2KXP B;  4OGQ D;  4AUW A;  1FZB A;  2IPP A;  1LTA C;  4IFD K;  4NPD A;  1BGY D;  3BAT A;  1D7M A;  2HYN A;  3H6P A;  2BCC J;  2YXQ B;  1SQQ J;  4H44 B;  2KSJ A;  3CX5 I;  4OGQ C;  1X22 A;  3L72 D;  2IX7 C;  1HWT C;  1S2E A;  2IZ0 A;  4DZO A;  2BAS A;  1SS1 A;  1LGH B;  4AQR D;  1GL2 B;  5CBO A;  2RH0 A;  3H1J E;  5APQ A;  1NTZ E;  2FFD B;  1USD A;  3F89 A;  3Q5S A;  5CCH C;  2OYH B;  1GK4 A;  2KNC A;  4W7Z A;  1SFC C;  1W5C E;  5CCG D;  1KOR A;  2E75 D;  3MUD C;  1BGY G;  1T2K D;  2PAJ A;  1FBM A;  1BGY J;  1IFD A;  1NU1 E;  2KK7 A;  1LTG C;  4GOF A;  3V4W A;  3H1I J;  1T8Z A;  3RBX A;  3G71 P;  1Z56 A;  2P10 A;  1K8A Q;  2XZR A;  4K35 A;  1JY2 O;  2ZVO B;  1KIL A;  4IL6 E;  2WPR A;  3OW2 O;  1JTH B;  1MUU A;  3L71 D;  4UB8 E;  3RK2 C;  1VF5 D;  3U1A A;  2KS1 A;  3WU2 H;  4D6T J;  4DT0 A;  1AQ5 A;  3ABV C;  3L71 J;  4CPG A;  3TGU D;  1FZE A;  1SLQ A;  1IC2 A;  1L0L J;  2QJP C;  4LGD E;  4EYY Q;  1IFJ A;  2CK3 H;  1M1K Q;  1KV4 A;  2WMM A;  4GT1 A;  3CXH H;  2HOD A;  1SQX E;  2K37 A;  3IN6 A;  4C7R A;  3L4F A;  5AW5 B;  2IYO A;  2IDB A;  3V2P A;  2A06 D;  3L72 E;  4H13 B;  5KAF E;  4DCK A;  1RY3 A;  1OW7 A;  1BDD A;  3C8V A;  3MGN A;  2K3R A;  3H1H G;  1SQP G;  1BE3 E;  3L70 D;  2QEX P;  1LJ2 A;  3RL0 D;  5AVW B;  1L0N K;  3CCM P;  2W27 A;  4IFF A;  1RF1 B;  2QRX A;  1L2P A;  2B87 A;  3A5T A;  3IF4 A;  3SSU A;  1PGJ A;  3KQG A;  1OVR A;  2Q9I A;  2NPS D;  3Q5P A;  1YTZ T;  1X9V A;  2FYU D;  4PD4 H;  4TT3 H;  5AVR B;  4ZNC A;  1OVU A;  1OIP A;  1H89 A;  2ZXX A;  4AYC A;  1BCC D;  1SQQ K;  4PV1 B;  1KTM A;  1FOS F;  2N1T D;  3CCR P;  2MKV A;  1VPC A;  2BEZ F;  1KC8 Q;  1NTM G;  1JCC A;  5B5E H;  3CXH D;  1LWU A;  2PP6 A;  1N7L A;  4ZKU A;  1ZR2 A;  3BCC D;  4PV1 C;  1SQV G;  1EZV D;  3AE1 C;  1URQ D;  1EDL A;  1KYO D;  1YTZ I;  3GLM A;  3IAO A;  1SQV J;  4C7N B;  3MIW A;  1QGK B;  2E74 D;  3TGU E;  1BDC A;  3U59 A;  2QJK B;  4HJG H;  1FZC A;  1NO4 A;  2OTL P;  2JP3 A;  3HUS C;  4U3F D;  1L0L E;  4RKU J;  1AFO A;  5CCG A;  2AXT H;  2H8P D;  3CCU P;  1LTJ A;  2QIW A;  3QH9 A;  1A02 J;  5CJ0 A;  1PP9 E;  1NAY A;  1H0T A;  2A45 H;  1JY2 N;  1VQ7 P;  2O01 J;  3MP7 B;  4BWN A;  1M56 D;  1SQB J;  2W90 A;  3G9R A;  4C46 A;  2FXM A;  3KYQ A;  3L75 D;  3U1C A;  1HJB A;  1SQB K;  3AEE C;  4WY4 A;  1AVY A;  2YKO A;  3L74 G;  1P84 I;  4Y99 B;  2OTJ P;  2FY8 A;  3L75 J;  4I1L A;  2LXB A;  4YPC A;  2ZJS E;  1SQX J;  2N9Y B;  1Y8A A;  5KLV G;  2QSI A;  1YIJ P;  4H44 D;  3VTP C;  3I5C A;  5AVT B;  2WTY A;  3CX5 D;  1R5S A;  2CPB A;  5DJT B;  2M8R A;  2WPQ A;  1M8O B;  2KUB A;  4PJ0 H;  2C9L Y;  3VMY A;  3VP9 A;  4DJG A;  2PGD A;  1SQP J;  3AE5 C;  1DH3 A;  2WT7 A;  1YJ9 P;  1HGZ A;  1BSN A;  2FYU K;  2P67 A;  5KJ7 C;  3L73 G;  1L4A A;  3H1L E;  1JO5 A;  2YMY A;  1L0L K;  1VQ9 P;  3MHV A;  4HB1 A;  4HH2 A;  2JWA A;  3VP8 A;  3QWO C;  2QE7 H;  1W2B O;  1JM0 A;  3T97 B;  1RH5 B;  2J58 A;  5KLV D;  1LTT C;  2MJZ A;  5TIS H;  4I6M C;  1URQ B;  2VRS A;  1OXZ A;  1WMK A;  3A2A A;  3H1H D;  5B66 H;  1U57 A;  1G2C B;  1G2C A;  3HTK A;  3KHU A;  3F5H A;  4WY4 B;  1NOH A;  2WWW A;  3H1J D;  1NTM D;  1NH4 A;  3NFQ A;  3PHL A;  3TYY A;  1VQ4 P;  2E43 A;  3T97 A;  5CCH A;  1PPJ G;  1YYC A;  3M0D A;  4WY4 C;  5C39 A;  2BCC G;  1UIX A;  1SQB E;  1KB9 I;  1NTZ K;  2HG5 D;  2WQY C;  1NTM K;  5DJU B;  1QL2 A; 
#chains in the Genus database with same CATH homology
 3A0H E;  1S5L E;  5KAF E;  5GTH E;  1W5C E;  2AXT E;  5KAI E;  5GTI E;  5B5E E;  5TIS E;  3JCU E;  5E79 E;  4PJ0 E;  4IL6 E;  4UB8 E;  3KZI E;  3A0B E;  4UB6 E;  5H2F E;  3WU2 E;  5B66 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...