5TISE

Room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
b'TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 18
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5tisE00
3A0HE 1S5LE 4UB6E 4UB8E 3A0BE 5KAIE 5KAFE 3WU2E 5H2FE 5GTIE 5GTHE 5TISE 4PJ0E 5B5EE 2AXTE 4IL6E 5B66E 3KZIE 1W5CE 3JCUE 5E79E
chains in the Genus database with same CATH superfamily
1NU1J 3CX5E 1RF0A 4L75A 2H88C 2XZRA 4L76A 1GW4A 2W6JH 3D6ZA 2LR2A 1HWTC 1PPJG 5C39A 3HTKA 1VQ6P 4NPFX 1JOCA 3JCUE 1FZFA 4PD4D 3O6QA 1X0TA 3CCRP 1HJ0A 1SFCD 2QM8A 4R4MA 4KT0J 5BVZA 3A2AA 5TISE 3AECC 1OFCX 3GF3A 3S9OA 1EDLA 2QJKB 2IPPA 3GG2A 1VF5D 2R5BA 1A02J 1M1KQ 4ZKPA 2E42A 2K9YA 5H2FH 2I1JA 4UB8E 2P67A 2I1KA 1OW7A 2QIWA 4N78D 2C9NY 1N73B 5B5EH 5KKZC 4DT0A 1QL1A 4BRYB 1LTJB 2HODA 2H43A 5DJUB 2KLVA 1NU1D 5B66H 1SFCB 1OVUA 3IAOA 1FDIA 1ZLLA 1DIPA 1M1JA 1J2JB 2Q9IA 1HGVA 3V4QA 1VF5B 1L2PA 2LXCB 2IFMA 4EI2A 3S1KA 1KZUB 1NAYA 2ZAEB 3C8VA 3H1HE 3CC7P 1EXIA 3A0BH 1ZRTD 1SQBE 1JY3P 3TK1A 1KB9I 1GMJA 1N86A 3OAKA 1EDIA 3HD7C 1WMKA 4AQRD 1HVVA 1FZCA 3OJAB 3D71A 2GA1A 2K37A 3ZDMA 1GL2B 1G2CA 2ZT9D 3CXHE 1OVRA 1LGHB 2KNCA 3USSA 3B5NA 3SWKA 3MUDA 4M3LA 1IO4A 2Z4EA 4JBZA 1HBWA 1NTKK 1SQBJ 1NTKG 1S3JA 1M90Q 2N1TC 2P2UA 2XU6A 2NPSA 3KQGA 4EYYQ 5AVYB 1L0NG 3L73G 3K5BA 1S5LH 1PIXA 2ZT9B 1K8AQ 3S4RA 3KXDA 2HYNA 1KILD 3FWLA 3VMZA 2HODB 1X79B 2JP3A 1AQTA 2C0XA 2M5AA 1LT9C 1M1JB 4OGQC 1KFMA 3MGNA 1OX3A 2A06E 1Q7YQ 1FDOA 3AE8C 1NVOA 1VPCA 2ITAA 2L91A 3PRJA 1BGYE 5H2FE 4D6TE 1KILB 2P7JA 1VQPP 2JJLA 2NPSD 3CMAP 4UB6H 1FZCB 4XFJA 3AE2C 3HUSC 1L4AA 1JMMA 1NTZJ 2NRGA 2Q7CA 1BSNA 4KHXA 1G2CB 2OYHC 2FYUE 3RGUA 1PP9J 2KNCB 1BGYJ 4D6TJ 4HYTB 1W2EA 2KB7P 1K73Q 1Z56A 5DJTB 4YPCA 2NPSB 2ZYDA 5KAIE 2WSEJ 3RL0g 5CHXA 2HPCA 1FZAA 3AE4C 1NOHA 1IFPA 1LTJC 3KZIH 4GOFA 4N6JA 3B71A 1SQPD 1JY2P 1LP1B 3A0HE 3LIEA 2M5AB 2WMMA 2JO1A 1EQ7A 1BCCE 1L4AD 1FOSF 1MFZA 2RKLA 4IFFA 1T6AA 1NTZD 3TSIA 1OW6A 1VQ8P 1PP9D 3M06A 3FXDA 3FXEA 1SQQK 3IR9A 1SLQA 3H1HG 1GL2C 1L4AB 3Q5SA 5KLVE 5E79H 3FX0A 1SQBG 1SQXK 5L8RJ 5AW2B 3L72E 4RJTA 4WVZA 1YBKA 3M9BA 2GUSA 2CPSA 1KMIZ 1M57D 1IK9A 2QJPB 1SQVE 3CL3D 1QGKB 3VP8A 5KLVJ 2ZT9C 2OYIC 1EZVE 3H6PA 1KQLA 1BSHA 3VYIA 3AEDC 2IBZD 1FAVA 2WSSH 1L0LD 2WSFH 4TT3H 3CWBJ 4IOIH 1QLED 1K04A 2E43A 3V2NA 2YIUC 2C0WA 1GK6A 1LT1A 1SQVJ 2LKMA 1H0TB 2Y0EA 4ZKUA 3HD7A 5BU5A 1KILC 3RK3E 4C46A 1KB9H 2A06G 5APQA 2W90A 1BGYG 4U3FD 4D6TG 2Q3IA 1U7MA 1CSBA 1ZMEC 3P32A 3C1LA 3ITKA 2FFDB 2NZ2A 3A3YB 1FC2C 2N1TA 1XTCC 1BE3E 1N7SC 2K3RA 1PGPA 3U1CA 1QVGO 3CX5H 2V4HA 3CWBD 5AW3B 2FYUG 2QM7A 3SWYA 3LIDA 5APUA 5KKZB 2WPSA 1HTLC 1S4XA 1IFDA 2ZXXA 1ZV8A 1ZR4A 3N4XA 2CK3H 3HD7D 1LT9A 1NTMD 3JCUH 3VMXA 4N3YB 2JDIH 2V7QJ 4PV1C 5TISH 4YXDC 3P8MC 1YJ9P 1LWUC 2WPVB 3TDKA 2KXPB 2E5TA 2UWJE 1N2DC 4UB8H 2K9JA 2M8RA 2N1TD 3WUUA 3HD7B 1Q86Q 1EZVI 2FXMA 2JKVA 1BCCG 3HUSA 4PD4E 2Q5UA 2KSJA 4YXWH 2YXQB 2OYHA 2O3JA 1NO4A 5APTA 1HJBA 3L35A 5EFWB 3VP9A 3SWFA 2W83C 2FKWB 3MD0A 2N1TB 1VQOP 3M0DC 3PP5A 4N78E 3I5CA 1NHLA 5KLVG 2QJPC 2PP6A 2Y0CA 2OYOA 1LTJA 1AVOA 1EDKA 3E7KA 1VL2A 3L72G 2YXRB 3CXHH 4K3AA 4CPGA 1QL2A 2BCCJ 5CMZA 1SQVG 3E1RA 1NKZB 3CCVP 1PFIA 3Q5PA 1EZVG 1USEA 5KJ7C 1ZRTE 5AVWB 2OTLP 1Q2NA 2XV5A 3H1KD 2LXBA 2K9JB 2N9YB 1PL5A 2WT7B 1P84D 3CC2P 1GL2A 3HUSB 4KJMA 2R3SA 3AE7C 5AVUB 2YO3A 5AW7B 2OYHB 3SFEC 3CCUP 1EXJA 2RH0A 1GZLA 1AJYA 4RESB 3RBZA 2B87B 2FFDC 2ZYGA 1S1CX 1BDDA 2MJZA 3T97B 3LW5J 1VQ7P 2BCCD 3CCEP 1JMBA 1FS0E 4OVNF 1JY3N 3EFGA 3AEEC 2KZJA 2AEJA 1GU4A 1KILE 2OYIA 2A45G 2W6BA 1BE3G 2WSEH 3BRTB 3G4SP 2YMKA 3V5BA 1G1JA 4Z1MH 1IFNA 3PLNA 3FWNA 3VOPA 1GL2D 1JNMA 2PAJA 2C9LY 1HH0A 2Q3EA 1AFOA 1KQSO 1OXZA 1FJPA 1KILA 3I56P 3GW6A 5KAIH 2GM4A 1HF9A 1E5WA 2B88A 1KYOD 3VMAA 4RKUJ 2WITA 2XNXA 1AQ5A 1E79H 1NKNA 2FYNC 2E74C 3A0HH 1LTTC 3PTZA 2H89C 5CBOA 1N7SA 3CX5I 3IF4A 4GOEA 3PH0A 1A02F 4H0LD 3L75J 3L36A 3IFMA 3RBXA 1EC5A 2R32A 1SQQJ 4I7ZC 1L0NK 1M7LA 1Y47A 1LTSC 1S9KD 2OYIB 3TNUA 1VQNP 4JPZB 1SQPE 1R8EA 1LP1A 1IC2A 4XA4A 3GF7A 4H0LB 1R5LA 1NU1K 2YIUB 1NU1G 1J1DC 1JCDA 1LWUA 1NTZE 2BEZF 3Q5RA 3ABVC 3BCCE 3NMDA 1T2KC 1PP9E 5APVA 1FE6A 4GDOA 1N7SD 3FGAD 1YJNP 1SQPJ 4ASWA 3A7OA 1AA0A 3MTUE 3V6IA 3BRVB 1VDFA 3L75D 4GT1A 2BASA 4GIFA 3GHGC 3CLQA 2D2CC 1SQQD 3NTNA 1H88A 1W2BO 5AW6B 1JY2N 5CCGC 3BCCJ 3V2QA 3KDPB 3CCMP 1N7SB 3O8ZA 1SQXD 3M0DA 5AVQB 1ZOYC 4ASVA 4PV1D 3VMYA 5M1BA 3RL0C 3JC22 3MP7B 1PZQA 4JYCA 2W27A 4GKGA 3R4YA 4GODA 2IBZE 1RE3C 3CXHI 1N7LA 1FZEA 1L0LE 3TNUB 3OA7A 3AEFC 4W80A 2O01J 3H1JJ 5BU8B 1RE4A 2XNDH 2K88A 1OIPA 4PV1B 3EWKA 2A45H 1NWQA 1LWUB 1MFTA 4WBAA 1H0TA 2V7QH 2AEFA 3B4SA 3BCCD 1L0LJ 4H44C 4O9BA 3G9RA 3WU2E 2Z5IA 1VQ5P 1GD2E 4U7JA 1K9MQ 3M91A 4U3FE 5AW8B 1HGZA 2JWAA 2G3AA 1SQBK 2FFDA 2P1JA 1RY3A 3AE6C 4RO0A 3L74J 1VQLP 3CWBE 1VQMP 4ZNCA 3NXSA 1YJWP 3H1JD 5KJ7D 1GU5A 5AW4B 3HE4A 4IL6E 1DEBA 4U3FJ 3L71J 3V2PA 1GW3A 3Q1MA 3P8CD 3H1IJ 1NTME 2IYPA 1T8ZA 3RK2C 3SSUA 4PD4H 3AE5C 3TF5A 2Y9ZA 5CJ0A 1KFNA 1H8AA 3PJSK 4ZMDA 4H0LC 3V2RA 1VQKP 4L73A 1JB0J 2KYVA 4L74A 4DZOA 3WMM0 1NTMJ 1U57A 2E76C 2VRSA 2OGUA 2Q6QA 4PJ0E 2ZVOB 3L74D 2O1JA 1NTZG 2FBWC 4WWIA 4HH2A 1PP9G 3L70D 3CCSP 3U59A 4EOTA 5CJ4A 3L71D 1GDTA 2YKQA 3V4WA 2POHA 3H1ID 2QA4P 2OARA 3AE1C 3JSVC 2YMYA 2BEQD 5AVSB 4LGDE 3H1LD 2Z5HA 2YKPA 3TGUD 1RF1C 2FYUK 3HE4B 2W6AA 1PV3A 3MIWA 1Q82Q 2AXTE 1KC8Q 2QJYB 3VTPC 1KV4A 2E74D 4B86A 1L0LG 1MZ9A 3H1KE 1LTAC 2AEMA 2W8ZA 1P84E 4I1LA 2WT7A 4W7YA 2IX7C 1KD1Q 3H25A 4Y28J 3GHGA 2WSCJ 1PPJD 1JO5A 5CCGA 2FYNB 2E74B 1YQ4C 1YTZI 3G71P 1JCCA 3H1KJ 3D70A 2B87A 1X8YA 2P10A 3T97A 1NTKE 2BCCE 1VQ9P 1OZHA 4I7ZB 5KLVK 1T2KD 1G1IA 1IFIA 1RE3A 2M3BA 2QE7H 5TJHA 2H7HA 1LNQA 1FJKA 3CWBG 2R44A 2GUVA 1NTKJ 2A45I 4IL6X 3TYYA 4DCKA 2D2CD 1J1DB 1SQVK 5AVVB 5CCGD 1NTMG 2HR3A 2YKOA 5KLIC 2KK7A 3VN0A 1GTWA 1HUCA 4DJGA 2WTYA 3M9HA 1KYOE 3L37A 5AVRB 3F5HA 3CD6P 3M0AA 1ZW0A 3RL0D 2Y0DA 2QG4A 3CI9A 1H89A 2MKVA 3GHGB 2D2CB 2KSEA 1IK7A 2H8PD 5KTBA 3AE3C 4WY4D 5APXA 1R5SA 5CCHC 4WB4A 3CCLP 3CCJP 2QSIA 2JEEA 2FYZA 1W5CE 3RL0B 2FY8A 2YO2A 2J5UA 1NTKD 1P84I 3WUVA 1T3JA 2KS1A 4I6MC 3AEAC 2K1AA 1TU3F 1S9KE 1DEEG 4PD4I 1L0ND 3L73D 4H44D 4Y99C 1QEXA 1JTHA 4WY4B 1MKMA 1S72P 2QJYC 1FDMA 4BXLA 2E75D 4LC1A 2XKMA 2WWWA 3B8EB 2FXOA 2O01H 4LLHA 1JY2O 4A7PA 1KB9D 1YIJP 4H44B 2HLOA 1OVVA 3L75E 2WZ7A 2R3CA 5AVXB 4YTPC 3EQ2A 1SQQE 3BATA 1D7MA 1URQC 2E75B 3RK2D 3H1KG 1JM0A 3CX5D 1IZNB 1LTIC 1SQXE 1NYHA 5KAFE 3HTKB 3P7KA 1DD4A 1RF1A 5GTIE 1KYOI 3AEGC 1LJ2A 3IN6A 3O6QB 1GK4A 2KS1B 3H1HJ 1SS1A 2PFXA 3RK2B 3WU2H 2E76D 3MZWB 1U7JA 4NPDA 1SQXJ 2IZ0A 4HKZH 2QVAA 2BCCG 2WPQA 1JTHB 1FU1A 1X22A 2B9BA 1YQ3C 3OW2O 2AXCA 1FOSE 3RK3C 1MUUA 5AW0B 4H13D 2P58A 1KQFB 1NAFA 1VQ4P 2XDJA 1MV8A 1FBMA 2E76B 1SVFA 2IYOA 2DW3A 1FZGA 3D6YA 3AEBC 2KUBA 4IL6H 5AW1B 1QVFO 1DH3A 4BWNA 1SP4A 4OWFA 1PGQA 3B5ND 4C7NA 2Q1KA 2OQQA 4H13B 1ZR2A 1KTMA 3H32A 3H1HD 4I2LC 5B5EE 1N8RQ 3BASA 1SQBD 1XTGB 1LTBC 3G3ZA 3MHVA 5B66E 3H1JE 1IFMA 1NJIQ 3GLMA 1AVYA 1RF1B 3QH9A 2IZ1A 3P8CE 1Y9BA 3CXHD 3B5NB 4PJ0H 4NPEA 1UIXA 4TLFA 3U1AA 1OWAA 2ZYAA 2QJKC 2FXPA 2RMZA 4WY4C 3Q3DA 1NH4A 3A0BE 1USDA 4EIJA 1J1EB 2RN0A 1N73C 4JYBA 1M8OB 5KJ7A 2FYUJ 5AVZB 5AW5B 2KZIA 1SFCC 1YI2P 4JF7A 1NGMB 3L74E 1K05A 1RQUA 1Y8AA 1Q90D 1VF5C 2O1KA 3R2PA 2WQYC 1OMIA 3L70E 3A5TA 2OTJP 2AXTH 3L71E 2JR8A 2A06D 4C7NB 2E75C 3H1IE 5CCHA 2WSCH 1RF0C 2KLUA 3C9IA 1WRGA 3H32B 1S5LE 1BGYD 3L75G 4D6TD 3H1LE 5AW9B 1YITP 1CW5A 1SQQG 1IFJA 3QWOC 3TGUE 1BCCJ 3L70J 4OH8B 2M0BA 1Q81Q 5CBNA 4AUWA 3CPWO 1RHZB 3E1IA 3SFDC 2O01N 1PGJA 3CC4P 3BVHA 1P84H 1SQXG 2IFNA 2I8DA 2FYUD 2Y9YA 1FZBA 4R4LA 1YTZT 2JWDA 3HRNA 2SPZA 3EFFK 1X9VA 3H1LJ 3TGUJ 4EDFA 2ZFCA 1DX7A 2ZJSE 2WVRA 2HPCB 1JEKA 5KLIB 4UB6E 5CCHD 1SQPK 1SQPG 3Q2YA 4W7ZA 1CZQA 3L72J 5K5GB 2IBZI 3CMEP 1RQVA 1M1JC 1PPJE 3L4FA 1NTZK 1LTGC 1EDJA 1URQA 5APSA 3G6EP 2QEXP 2QRXA 3BCCG 2R5DA 1BCCD 1UIIA 2IDBA 3GMAA 4H13C 5AVTB 5APWA 1ZP0C 4MN4C 4DOJA 3KZIE 3AE9C 1CI6A 1FZCC 4JQ0D 1QX8A 4IFMA 5GTHH 1KYOH 1S2EA 4K35A 1KN7A 3B5NC 5KLVD 2M3EA 3MUDC 3LW5H 3NFQA 1KQGB 4Y99B 2J59M 2OTKE 3H1JG 2CPBA 1ZN5A 1YYCA 1AV1A 2KOGA 3L72D 2YNYA 2NPSC 1URQD 1J1EC 1OW8A 2IBZG 1RH5B 2HG5D 1SQVD 1KORA 1L0LK 3UIAA 3I55P 2G8YA 2B89A 1EZVD 4QMAA 3HE5A 1BE3J 1DD3A 1BDCA 5E79E 2WPRA 1T3UA 2KI7B 2L5GB 4HJGH 1URQB 3WUTA 1PGOA 1JY3O 2ZXEB 1YHQP 4IFDK 4XE5B 2PRRA 3L74G 1ZXGA 3F89A 3KPEA 3CCQP 3L70G 2N9BA 4AYCA 3RK3D 4U3FG 3L71G 1CI6B 3PHLA 1IJDB 1WT6A 2KP8A 1L0NE 3H1IG 3L73E 1L4AC 2J58A 3II6A 1S5LX 2PGDA 4HB1A 3W67A 2ZVNB 3H1LG 4WY4A 3TGUG 4OGQD 2HFED 1BE3D 2KIKA 1N73A 3M9QA 3RK3B 4BRYA 1NU1E 3KHUA 2WSFJ 3KYQA 5KAFH 1NTMK 1L0NJ 3L73J 1JUNA 1KB9E 1SFCA 2E5YA 5GTIH 3W68A 1LT9B 1M56D 5GTHE 3HE5B 3N7NA 4OGQB 5APYA 1RE4C 4C7RA
chains in the Genus database with same CATH topology
3A0HE 1S5LE 4UB6E 4UB8E 3A0BE 5KAIE 5KAFE 3WU2E 5H2FE 5GTIE 5GTHE 5TISE 4PJ0E 5B5EE 2AXTE 4IL6E 5B66E 3KZIE 1W5CE 3JCUE 5E79E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H E;  1S5L E;  4UB6 E;  4UB8 E;  3A0B E;  5KAI E;  5KAF E;  3WU2 E;  5H2F E;  5GTI E;  5GTH E;  5TIS E;  4PJ0 E;  5B5E E;  2AXT E;  4IL6 E;  5B66 E;  3KZI E;  1W5C E;  3JCU E;  5E79 E; 
#chains in the Genus database with same CATH topology
 1NU1 J;  3CX5 E;  1RF0 A;  4L75 A;  2H88 C;  2XZR A;  4L76 A;  1GW4 A;  2W6J H;  3D6Z A;  2LR2 A;  1HWT C;  1PPJ G;  5C39 A;  3HTK A;  1VQ6 P;  4NPF X;  1JOC A;  3JCU E;  1FZF A;  4PD4 D;  3O6Q A;  1X0T A;  3CCR P;  1HJ0 A;  1SFC D;  2QM8 A;  4R4M A;  4KT0 J;  5BVZ A;  3A2A A;  5TIS E;  3AEC C;  1OFC X;  3GF3 A;  3S9O A;  1EDL A;  2QJK B;  2IPP A;  3GG2 A;  1VF5 D;  2R5B A;  1A02 J;  1M1K Q;  4ZKP A;  2E42 A;  2K9Y A;  5H2F H;  2I1J A;  4UB8 E;  2P67 A;  2I1K A;  1OW7 A;  2QIW A;  4N78 D;  2C9N Y;  1N73 B;  5B5E H;  5KKZ C;  4DT0 A;  1QL1 A;  4BRY B;  1LTJ B;  2HOD A;  2H43 A;  5DJU B;  2KLV A;  1NU1 D;  5B66 H;  1SFC B;  1OVU A;  3IAO A;  1FDI A;  1ZLL A;  1DIP A;  1M1J A;  1J2J B;  2Q9I A;  1HGV A;  3V4Q A;  1VF5 B;  1L2P A;  2LXC B;  2IFM A;  4EI2 A;  3S1K A;  1KZU B;  1NAY A;  2ZAE B;  3C8V A;  3H1H E;  3CC7 P;  1EXI A;  3A0B H;  1ZRT D;  1SQB E;  1JY3 P;  3TK1 A;  1KB9 I;  1GMJ A;  1N86 A;  3OAK A;  1EDI A;  3HD7 C;  1WMK A;  4AQR D;  1HVV A;  1FZC A;  3OJA B;  3D71 A;  2GA1 A;  2K37 A;  3ZDM A;  1GL2 B;  1G2C A;  2ZT9 D;  3CXH E;  1OVR A;  1LGH B;  2KNC A;  3USS A;  3B5N A;  3SWK A;  3MUD A;  4M3L A;  1IO4 A;  2Z4E A;  4JBZ A;  1HBW A;  1NTK K;  1SQB J;  1NTK G;  1S3J A;  1M90 Q;  2N1T C;  2P2U A;  2XU6 A;  2NPS A;  3KQG A;  4EYY Q;  5AVY B;  1L0N G;  3L73 G;  3K5B A;  1S5L H;  1PIX A;  2ZT9 B;  1K8A Q;  3S4R A;  3KXD A;  2HYN A;  1KIL D;  3FWL A;  3VMZ A;  2HOD B;  1X79 B;  2JP3 A;  1AQT A;  2C0X A;  2M5A A;  1LT9 C;  1M1J B;  4OGQ C;  1KFM A;  3MGN A;  1OX3 A;  2A06 E;  1Q7Y Q;  1FDO A;  3AE8 C;  1NVO A;  1VPC A;  2ITA A;  2L91 A;  3PRJ A;  1BGY E;  5H2F E;  4D6T E;  1KIL B;  2P7J A;  1VQP P;  2JJL A;  2NPS D;  3CMA P;  4UB6 H;  1FZC B;  4XFJ A;  3AE2 C;  3HUS C;  1L4A A;  1JMM A;  1NTZ J;  2NRG A;  2Q7C A;  1BSN A;  4KHX A;  1G2C B;  2OYH C;  2FYU E;  3RGU A;  1PP9 J;  2KNC B;  1BGY J;  4D6T J;  4HYT B;  1W2E A;  2KB7 P;  1K73 Q;  1Z56 A;  5DJT B;  4YPC A;  2NPS B;  2ZYD A;  5KAI E;  2WSE J;  3RL0 g;  5CHX A;  2HPC A;  1FZA A;  3AE4 C;  1NOH A;  1IFP A;  1LTJ C;  3KZI H;  4GOF A;  4N6J A;  3B71 A;  1SQP D;  1JY2 P;  1LP1 B;  3A0H E;  3LIE A;  2M5A B;  2WMM A;  2JO1 A;  1EQ7 A;  1BCC E;  1L4A D;  1FOS F;  1MFZ A;  2RKL A;  4IFF A;  1T6A A;  1NTZ D;  3TSI A;  1OW6 A;  1VQ8 P;  1PP9 D;  3M06 A;  3FXD A;  3FXE A;  1SQQ K;  3IR9 A;  1SLQ A;  3H1H G;  1GL2 C;  1L4A B;  3Q5S A;  5KLV E;  5E79 H;  3FX0 A;  1SQB G;  1SQX K;  5L8R J;  5AW2 B;  3L72 E;  4RJT A;  4WVZ A;  1YBK A;  3M9B A;  2GUS A;  2CPS A;  1KMI Z;  1M57 D;  1IK9 A;  2QJP B;  1SQV E;  3CL3 D;  1QGK B;  3VP8 A;  5KLV J;  2ZT9 C;  2OYI C;  1EZV E;  3H6P A;  1KQL A;  1BSH A;  3VYI A;  3AED C;  2IBZ D;  1FAV A;  2WSS H;  1L0L D;  2WSF H;  4TT3 H;  3CWB J;  4IOI H;  1QLE D;  1K04 A;  2E43 A;  3V2N A;  2YIU C;  2C0W A;  1GK6 A;  1LT1 A;  1SQV J;  2LKM A;  1H0T B;  2Y0E A;  4ZKU A;  3HD7 A;  5BU5 A;  1KIL C;  3RK3 E;  4C46 A;  1KB9 H;  2A06 G;  5APQ A;  2W90 A;  1BGY G;  4U3F D;  4D6T G;  2Q3I A;  1U7M A;  1CSB A;  1ZME C;  3P32 A;  3C1L A;  3ITK A;  2FFD B;  2NZ2 A;  3A3Y B;  1FC2 C;  2N1T A;  1XTC C;  1BE3 E;  1N7S C;  2K3R A;  1PGP A;  3U1C A;  1QVG O;  3CX5 H;  2V4H A;  3CWB D;  5AW3 B;  2FYU G;  2QM7 A;  3SWY A;  3LID A;  5APU A;  5KKZ B;  2WPS A;  1HTL C;  1S4X A;  1IFD A;  2ZXX A;  1ZV8 A;  1ZR4 A;  3N4X A;  2CK3 H;  3HD7 D;  1LT9 A;  1NTM D;  3JCU H;  3VMX A;  4N3Y B;  2JDI H;  2V7Q J;  4PV1 C;  5TIS H;  4YXD C;  3P8M C;  1YJ9 P;  1LWU C;  2WPV B;  3TDK A;  2KXP B;  2E5T A;  2UWJ E;  1N2D C;  4UB8 H;  2K9J A;  2M8R A;  2N1T D;  3WUU A;  3HD7 B;  1Q86 Q;  1EZV I;  2FXM A;  2JKV A;  1BCC G;  3HUS A;  4PD4 E;  2Q5U A;  2KSJ A;  4YXW H;  2YXQ B;  2OYH A;  2O3J A;  1NO4 A;  5APT A;  1HJB A;  3L35 A;  5EFW B;  3VP9 A;  3SWF A;  2W83 C;  2FKW B;  3MD0 A;  2N1T B;  1VQO P;  3M0D C;  3PP5 A;  4N78 E;  3I5C A;  1NHL A;  5KLV G;  2QJP C;  2PP6 A;  2Y0C A;  2OYO A;  1LTJ A;  1AVO A;  1EDK A;  3E7K A;  1VL2 A;  3L72 G;  2YXR B;  3CXH H;  4K3A A;  4CPG A;  1QL2 A;  2BCC J;  5CMZ A;  1SQV G;  3E1R A;  1NKZ B;  3CCV P;  1PFI A;  3Q5P A;  1EZV G;  1USE A;  5KJ7 C;  1ZRT E;  5AVW B;  2OTL P;  1Q2N A;  2XV5 A;  3H1K D;  2LXB A;  2K9J B;  2N9Y B;  1PL5 A;  2WT7 B;  1P84 D;  3CC2 P;  1GL2 A;  3HUS B;  4KJM A;  2R3S A;  3AE7 C;  5AVU B;  2YO3 A;  5AW7 B;  2OYH B;  3SFE C;  3CCU P;  1EXJ A;  2RH0 A;  1GZL A;  1AJY A;  4RES B;  3RBZ A;  2B87 B;  2FFD C;  2ZYG A;  1S1C X;  1BDD A;  2MJZ A;  3T97 B;  3LW5 J;  1VQ7 P;  2BCC D;  3CCE P;  1JMB A;  1FS0 E;  4OVN F;  1JY3 N;  3EFG A;  3AEE C;  2KZJ A;  2AEJ A;  1GU4 A;  1KIL E;  2OYI A;  2A45 G;  2W6B A;  1BE3 G;  2WSE H;  3BRT B;  3G4S P;  2YMK A;  3V5B A;  1G1J A;  4Z1M H;  1IFN A;  3PLN A;  3FWN A;  3VOP A;  1GL2 D;  1JNM A;  2PAJ A;  2C9L Y;  1HH0 A;  2Q3E A;  1AFO A;  1KQS O;  1OXZ A;  1FJP A;  1KIL A;  3I56 P;  3GW6 A;  5KAI H;  2GM4 A;  1HF9 A;  1E5W A;  2B88 A;  1KYO D;  3VMA A;  4RKU J;  2WIT A;  2XNX A;  1AQ5 A;  1E79 H;  1NKN A;  2FYN C;  2E74 C;  3A0H H;  1LTT C;  3PTZ A;  2H89 C;  5CBO A;  1N7S A;  3CX5 I;  3IF4 A;  4GOE A;  3PH0 A;  1A02 F;  4H0L D;  3L75 J;  3L36 A;  3IFM A;  3RBX A;  1EC5 A;  2R32 A;  1SQQ J;  4I7Z C;  1L0N K;  1M7L A;  1Y47 A;  1LTS C;  1S9K D;  2OYI B;  3TNU A;  1VQN P;  4JPZ B;  1SQP E;  1R8E A;  1LP1 A;  1IC2 A;  4XA4 A;  3GF7 A;  4H0L B;  1R5L A;  1NU1 K;  2YIU B;  1NU1 G;  1J1D C;  1JCD A;  1LWU A;  1NTZ E;  2BEZ F;  3Q5R A;  3ABV C;  3BCC E;  3NMD A;  1T2K C;  1PP9 E;  5APV A;  1FE6 A;  4GDO A;  1N7S D;  3FGA D;  1YJN P;  1SQP J;  4ASW A;  3A7O A;  1AA0 A;  3MTU E;  3V6I A;  3BRV B;  1VDF A;  3L75 D;  4GT1 A;  2BAS A;  4GIF A;  3GHG C;  3CLQ A;  2D2C C;  1SQQ D;  3NTN A;  1H88 A;  1W2B O;  5AW6 B;  1JY2 N;  5CCG C;  3BCC J;  3V2Q A;  3KDP B;  3CCM P;  1N7S B;  3O8Z A;  1SQX D;  3M0D A;  5AVQ B;  1ZOY C;  4ASV A;  4PV1 D;  3VMY A;  5M1B A;  3RL0 C;  3JC2 2;  3MP7 B;  1PZQ A;  4JYC A;  2W27 A;  4GKG A;  3R4Y A;  4GOD A;  2IBZ E;  1RE3 C;  3CXH I;  1N7L A;  1FZE A;  1L0L E;  3TNU B;  3OA7 A;  3AEF C;  4W80 A;  2O01 J;  3H1J J;  5BU8 B;  1RE4 A;  2XND H;  2K88 A;  1OIP A;  4PV1 B;  3EWK A;  2A45 H;  1NWQ A;  1LWU B;  1MFT A;  4WBA A;  1H0T A;  2V7Q H;  2AEF A;  3B4S A;  3BCC D;  1L0L J;  4H44 C;  4O9B A;  3G9R A;  3WU2 E;  2Z5I A;  1VQ5 P;  1GD2 E;  4U7J A;  1K9M Q;  3M91 A;  4U3F E;  5AW8 B;  1HGZ A;  2JWA A;  2G3A A;  1SQB K;  2FFD A;  2P1J A;  1RY3 A;  3AE6 C;  4RO0 A;  3L74 J;  1VQL P;  3CWB E;  1VQM P;  4ZNC A;  3NXS A;  1YJW P;  3H1J D;  5KJ7 D;  1GU5 A;  5AW4 B;  3HE4 A;  4IL6 E;  1DEB A;  4U3F J;  3L71 J;  3V2P A;  1GW3 A;  3Q1M A;  3P8C D;  3H1I J;  1NTM E;  2IYP A;  1T8Z A;  3RK2 C;  3SSU A;  4PD4 H;  3AE5 C;  3TF5 A;  2Y9Z A;  5CJ0 A;  1KFN A;  1H8A A;  3PJS K;  4ZMD A;  4H0L C;  3V2R A;  1VQK P;  4L73 A;  1JB0 J;  2KYV A;  4L74 A;  4DZO A;  3WMM 0;  1NTM J;  1U57 A;  2E76 C;  2VRS A;  2OGU A;  2Q6Q A;  4PJ0 E;  2ZVO B;  3L74 D;  2O1J A;  1NTZ G;  2FBW C;  4WWI A;  4HH2 A;  1PP9 G;  3L70 D;  3CCS P;  3U59 A;  4EOT A;  5CJ4 A;  3L71 D;  1GDT A;  2YKQ A;  3V4W A;  2POH A;  3H1I D;  2QA4 P;  2OAR A;  3AE1 C;  3JSV C;  2YMY A;  2BEQ D;  5AVS B;  4LGD E;  3H1L D;  2Z5H A;  2YKP A;  3TGU D;  1RF1 C;  2FYU K;  3HE4 B;  2W6A A;  1PV3 A;  3MIW A;  1Q82 Q;  2AXT E;  1KC8 Q;  2QJY B;  3VTP C;  1KV4 A;  2E74 D;  4B86 A;  1L0L G;  1MZ9 A;  3H1K E;  1LTA C;  2AEM A;  2W8Z A;  1P84 E;  4I1L A;  2WT7 A;  4W7Y A;  2IX7 C;  1KD1 Q;  3H25 A;  4Y28 J;  3GHG A;  2WSC J;  1PPJ D;  1JO5 A;  5CCG A;  2FYN B;  2E74 B;  1YQ4 C;  1YTZ I;  3G71 P;  1JCC A;  3H1K J;  3D70 A;  2B87 A;  1X8Y A;  2P10 A;  3T97 A;  1NTK E;  2BCC E;  1VQ9 P;  1OZH A;  4I7Z B;  5KLV K;  1T2K D;  1G1I A;  1IFI A;  1RE3 A;  2M3B A;  2QE7 H;  5TJH A;  2H7H A;  1LNQ A;  1FJK A;  3CWB G;  2R44 A;  2GUV A;  1NTK J;  2A45 I;  4IL6 X;  3TYY A;  4DCK A;  2D2C D;  1J1D B;  1SQV K;  5AVV B;  5CCG D;  1NTM G;  2HR3 A;  2YKO A;  5KLI C;  2KK7 A;  3VN0 A;  1GTW A;  1HUC A;  4DJG A;  2WTY A;  3M9H A;  1KYO E;  3L37 A;  5AVR B;  3F5H A;  3CD6 P;  3M0A A;  1ZW0 A;  3RL0 D;  2Y0D A;  2QG4 A;  3CI9 A;  1H89 A;  2MKV A;  3GHG B;  2D2C B;  2KSE A;  1IK7 A;  2H8P D;  5KTB A;  3AE3 C;  4WY4 D;  5APX A;  1R5S A;  5CCH C;  4WB4 A;  3CCL P;  3CCJ P;  2QSI A;  2JEE A;  2FYZ A;  1W5C E;  3RL0 B;  2FY8 A;  2YO2 A;  2J5U A;  1NTK D;  1P84 I;  3WUV A;  1T3J A;  2KS1 A;  4I6M C;  3AEA C;  2K1A A;  1TU3 F;  1S9K E;  1DEE G;  4PD4 I;  1L0N D;  3L73 D;  4H44 D;  4Y99 C;  1QEX A;  1JTH A;  4WY4 B;  1MKM A;  1S72 P;  2QJY C;  1FDM A;  4BXL A;  2E75 D;  4LC1 A;  2XKM A;  2WWW A;  3B8E B;  2FXO A;  2O01 H;  4LLH A;  1JY2 O;  4A7P A;  1KB9 D;  1YIJ P;  4H44 B;  2HLO A;  1OVV A;  3L75 E;  2WZ7 A;  2R3C A;  5AVX B;  4YTP C;  3EQ2 A;  1SQQ E;  3BAT A;  1D7M A;  1URQ C;  2E75 B;  3RK2 D;  3H1K G;  1JM0 A;  3CX5 D;  1IZN B;  1LTI C;  1SQX E;  1NYH A;  5KAF E;  3HTK B;  3P7K A;  1DD4 A;  1RF1 A;  5GTI E;  1KYO I;  3AEG C;  1LJ2 A;  3IN6 A;  3O6Q B;  1GK4 A;  2KS1 B;  3H1H J;  1SS1 A;  2PFX A;  3RK2 B;  3WU2 H;  2E76 D;  3MZW B;  1U7J A;  4NPD A;  1SQX J;  2IZ0 A;  4HKZ H;  2QVA A;  2BCC G;  2WPQ A;  1JTH B;  1FU1 A;  1X22 A;  2B9B A;  1YQ3 C;  3OW2 O;  2AXC A;  1FOS E;  3RK3 C;  1MUU A;  5AW0 B;  4H13 D;  2P58 A;  1KQF B;  1NAF A;  1VQ4 P;  2XDJ A;  1MV8 A;  1FBM A;  2E76 B;  1SVF A;  2IYO A;  2DW3 A;  1FZG A;  3D6Y A;  3AEB C;  2KUB A;  4IL6 H;  5AW1 B;  1QVF O;  1DH3 A;  4BWN A;  1SP4 A;  4OWF A;  1PGQ A;  3B5N D;  4C7N A;  2Q1K A;  2OQQ A;  4H13 B;  1ZR2 A;  1KTM A;  3H32 A;  3H1H D;  4I2L C;  5B5E E;  1N8R Q;  3BAS A;  1SQB D;  1XTG B;  1LTB C;  3G3Z A;  3MHV A;  5B66 E;  3H1J E;  1IFM A;  1NJI Q;  3GLM A;  1AVY A;  1RF1 B;  3QH9 A;  2IZ1 A;  3P8C E;  1Y9B A;  3CXH D;  3B5N B;  4PJ0 H;  4NPE A;  1UIX A;  4TLF A;  3U1A A;  1OWA A;  2ZYA A;  2QJK C;  2FXP A;  2RMZ A;  4WY4 C;  3Q3D A;  1NH4 A;  3A0B E;  1USD A;  4EIJ A;  1J1E B;  2RN0 A;  1N73 C;  4JYB A;  1M8O B;  5KJ7 A;  2FYU J;  5AVZ B;  5AW5 B;  2KZI A;  1SFC C;  1YI2 P;  4JF7 A;  1NGM B;  3L74 E;  1K05 A;  1RQU A;  1Y8A A;  1Q90 D;  1VF5 C;  2O1K A;  3R2P A;  2WQY C;  1OMI A;  3L70 E;  3A5T A;  2OTJ P;  2AXT H;  3L71 E;  2JR8 A;  2A06 D;  4C7N B;  2E75 C;  3H1I E;  5CCH A;  2WSC H;  1RF0 C;  2KLU A;  3C9I A;  1WRG A;  3H32 B;  1S5L E;  1BGY D;  3L75 G;  4D6T D;  3H1L E;  5AW9 B;  1YIT P;  1CW5 A;  1SQQ G;  1IFJ A;  3QWO C;  3TGU E;  1BCC J;  3L70 J;  4OH8 B;  2M0B A;  1Q81 Q;  5CBN A;  4AUW A;  3CPW O;  1RHZ B;  3E1I A;  3SFD C;  2O01 N;  1PGJ A;  3CC4 P;  3BVH A;  1P84 H;  1SQX G;  2IFN A;  2I8D A;  2FYU D;  2Y9Y A;  1FZB A;  4R4L A;  1YTZ T;  2JWD A;  3HRN A;  2SPZ A;  3EFF K;  1X9V A;  3H1L J;  3TGU J;  4EDF A;  2ZFC A;  1DX7 A;  2ZJS E;  2WVR A;  2HPC B;  1JEK A;  5KLI B;  4UB6 E;  5CCH D;  1SQP K;  1SQP G;  3Q2Y A;  4W7Z A;  1CZQ A;  3L72 J;  5K5G B;  2IBZ I;  3CME P;  1RQV A;  1M1J C;  1PPJ E;  3L4F A;  1NTZ K;  1LTG C;  1EDJ A;  1URQ A;  5APS A;  3G6E P;  2QEX P;  2QRX A;  3BCC G;  2R5D A;  1BCC D;  1UII A;  2IDB A;  3GMA A;  4H13 C;  5AVT B;  5APW A;  1ZP0 C;  4MN4 C;  4DOJ A;  3KZI E;  3AE9 C;  1CI6 A;  1FZC C;  4JQ0 D;  1QX8 A;  4IFM A;  5GTH H;  1KYO H;  1S2E A;  4K35 A;  1KN7 A;  3B5N C;  5KLV D;  2M3E A;  3MUD C;  3LW5 H;  3NFQ A;  1KQG B;  4Y99 B;  2J59 M;  2OTK E;  3H1J G;  2CPB A;  1ZN5 A;  1YYC A;  1AV1 A;  2KOG A;  3L72 D;  2YNY A;  2NPS C;  1URQ D;  1J1E C;  1OW8 A;  2IBZ G;  1RH5 B;  2HG5 D;  1SQV D;  1KOR A;  1L0L K;  3UIA A;  3I55 P;  2G8Y A;  2B89 A;  1EZV D;  4QMA A;  3HE5 A;  1BE3 J;  1DD3 A;  1BDC A;  5E79 E;  2WPR A;  1T3U A;  2KI7 B;  2L5G B;  4HJG H;  1URQ B;  3WUT A;  1PGO A;  1JY3 O;  2ZXE B;  1YHQ P;  4IFD K;  4XE5 B;  2PRR A;  3L74 G;  1ZXG A;  3F89 A;  3KPE A;  3CCQ P;  3L70 G;  2N9B A;  4AYC A;  3RK3 D;  4U3F G;  3L71 G;  1CI6 B;  3PHL A;  1IJD B;  1WT6 A;  2KP8 A;  1L0N E;  3H1I G;  3L73 E;  1L4A C;  2J58 A;  3II6 A;  1S5L X;  2PGD A;  4HB1 A;  3W67 A;  2ZVN B;  3H1L G;  4WY4 A;  3TGU G;  4OGQ D;  2HFE D;  1BE3 D;  2KIK A;  1N73 A;  3M9Q A;  3RK3 B;  4BRY A;  1NU1 E;  3KHU A;  2WSF J;  3KYQ A;  5KAF H;  1NTM K;  1L0N J;  3L73 J;  1JUN A;  1KB9 E;  1SFC A;  2E5Y A;  5GTI H;  3W68 A;  1LT9 B;  1M56 D;  5GTH E;  3HE5 B;  3N7N A;  4OGQ B;  5APY A;  1RE4 C;  4C7R A; 
#chains in the Genus database with same CATH homology
 3A0H E;  1S5L E;  4UB6 E;  4UB8 E;  3A0B E;  5KAI E;  5KAF E;  3WU2 E;  5H2F E;  5GTI E;  5GTH E;  5TIS E;  4PJ0 E;  5B5E E;  2AXT E;  4IL6 E;  5B66 E;  3KZI E;  1W5C E;  3JCU E;  5E79 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...