1LTBC

2.6 angstroms crystal structure of partially-activated e. coli heat-labile enterotoxin (lt)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
41
structure length
41
Chain Sequence
GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
publication title Structure of partially-activated E. coli heat-labile enterotoxin (LT) at 2.6 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 16
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1993-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltbC00
1HTLC 1XTCC 1LTBC 1LTTC 1LTGC 1LTIC 1LTAC 1LTSC
chains in the Genus database with same CATH superfamily
3M06A 3P32A 1IFNA 3VMXA 1HGVA 4YTPC 1SQQD 3L74D 2M3BA 3AE2C 2B88A 4HKZH 3MUDA 1SQBD 2LXBA 3M9HA 1DD3A 1PPJD 4EDFA 2KNCB 1EZVI 3L71E 2Q3EA 3H1KE 2QVAA 1NHLA 1LT9A 3L37A 1X8YA 3AE4C 2WWWA 1X79B 2QG4A 1CZQA 3QH9A 4GOFA 3EFGA 1VQNP 1U7MA 2H8PD 1R5SA 1JY2N 1G1JA 3L70G 3WU2H 4KJMA 1NTMD 2H89C 2QJPB 4GKGA 4D6TE 2DW3A 2N1TB 2AXCA 2KZJA 1OIPA 3CXHD 2G3AA 1QGKB 1KZUB 1OVVA 2QRXA 1YQ3C 2NPSB 2WVRA 1J1DB 1PIXA 3VP8A 4RO0A 5L8RJ 4BWNA 2RH0A 4MN4C 1IO4A 5KLIB 3BCCE 3CLQA 1OFCX 1DEEG 5AW1B 5CCHA 5KKZB 1SQQK 4DZOA 2BCCJ 3B5NA 3H1LG 4TT3H 2FBWC 1KYOI 5AW6B 1K04A 1P84D 1IK7A 1N7LA 3L73E 1SQPE 2FYUD 1SQBK 1BCCJ 1RE4A 1BGYD 3G6EP 3PHLA 4JYBA 4DJGA 4UB8H 1YTZT 4LC1A 3IN6A 4HH2A 2WSCH 3FXDA 1USDA 3H1IE 2Y0CA 2WZ7A 2B9BA 2AEJA 4N6JA 4IL6H 1R8EA 1VQMP 3RL0B 1LT9B 3P8CD 1G2CB 1A02J 1PZQA 2W6JH 5AVUB 5KAIH 3B4SA 4ASWA 3P8MC 2E75B 2B87A 2E74C 3AEGC 3KPEA 1IFMA 1LTJC 1S5LE 4WB4A 4WY4D 1NTMK 2ZAEB 1QL2A 1ZRTE 1RF1C 4OGQC 2C0XA 4C7NA 5K5GB 1URQC 1Q82Q 3PTZA 5KLVD 3E1RA 1JEKA 1PGQA 1SFCC 1BDCA 2GUSA 3H6PA 3V2RA 1L4AB 3CWBG 2O01N 5AVZB 1N2DC 2E76B 2V4HA 1GW4A 2W6AA 1N7SC 2A06E 2IX7C 3L71D 3H1KD 2C0WA 1VQLP 1JUNA 3G71P 5AVRB 3RK2B 2M5AB 2FYUK 3I56P 1QL1A 1VDFA 2ZXEB 1IJDB 1CI6B 1EZVD 2WPRA 3BRVB 1VF5C 5AW3B 3CMEP 2ZT9B 2QM7A 2WT7A 1VQ9P 1LTTC 1XTGB 3MIWA 3GMAA 2YKPA 2XKMA 1KMIZ 4U3FG 3RL0g 2KP8A 4H44C 2IBZG 3D71A 5CBOA 1Q86Q 3CX5E 2B87B 1SQXE 1NAFA 4AYCA 2QEXP 2Z5HA 3HD7C 4EI2A 1GD2E 2A45I 4RKUJ 3AEDC 5KLVK 3BCCD 3Q5SA 3UIAA 1Q7YQ 2WSEH 4C7NB 3HE4B 1FZFA 5E79E 1BCCE 3EWKA 2K88A 5H2FE 3N7NA 1VPCA 3L73D 1SQPD 3KQGA 3L75G 2IFMA 2JDIH 3CCJP 2IPPA 3RK3B 3SWFA 1YQ4C 2OYHC 1KYOD 1NKZB 2O01J 2WSFH 3FWLA 4N3YB 3BASA 2JJLA 3H1ID 3TGUE 1T2KD 3NTNA 1EXIA 1DH3A 2A45H 2HR3A 3L35A 1T6AA 1L0NE 1OMIA 3JCUE 3SSUA 3MGNA 1IK9A 5KAFE 1LWUC 2FYNC 2WT7B 2QJYB 1KFMA 5CCGD 2HODA 2E5TA 3CCSP 2JO1A 4W7ZA 1FDIA 2YNYA 2WPSA 1BE3J 2I8DA 2OGUA 1ZRTD 2M0BA 3H1HJ 5GTIE 4BXLA 2ZXXA 5APWA 3KHUA 1FDOA 2W8ZA 1M1JC 1RY3A 5B5EE 1IZNB 1EDLA 4RJTA 4NPEA 3MD0A 1USEA 1OXZA 2VRSA 2FXMA 3KDPB 2N9BA 1VQ5P 2A06D 5AW4B 1TU3F 2KB7P 1YITP 4HYTB 4GT1A 2Q1KA 1SQPK 4IFDK 3A0HE 1N8RQ 3Q5RA 2Q3IA 3CWBJ 1ZXGA 1JY3P 3L4FA 3E1IA 2ZYGA 4WY4A 1KN7A 1W2BO 4A7PA 1GU4A 3A3YB 4B86A 4L73A 1EDKA 1YJ9P 3CCQP 2IYPA 1JMMA 2W90A 3C1LA 5AVWB 4PV1C 1DEBA 2D2CC 1YJNP 3CXHH 3KZIE 4EYYQ 1LJ2A 1EQ7A 2A45G 1SQXD 2P7JA 1FZCC 3H1JE 3CCMP 1LTSC 4DCKA 1S3JA 3L70E 3Q2YA 5AW7B 1T3UA 4R4MA 2HODB 1KV4A 3WUTA 1WRGA 3NXSA 1NTKJ 4IFFA 2CK3H 2WSCJ 1GL2C 2UWJE 4H0LC 3GW6A 1Q81Q 1U57A 1LNQA 1JY3N 1BCCD 2AXTH 1NOHA 2ZJSE 1HTLC 3AE5C 1KB9E 1P84H 4N78E 2KI7B 4H13D 2LR2A 1SQQG 3L74G 5B66E 2FYZA 3CCUP 3H1LE 3L72G 4Z1MH 2QM8A 1S1CX 4PD4H 1SQBG 1W5CE 5AVVB 3TGUD 2M8RA 3TSIA 3V4QA 1PPJG 2OYIA 2C9LY 1PGOA 4PV1D 2KZIA 1L0ND 1J1EC 1KQSO 2Y0EA 3AE8C 2KOGA 1JY2P 3L75J 2H7HA 3CCVP 2E5YA 1EDIA 3PJSK 4WY4B 2ZFCA 1CSBA 2H43A 1E5WA 2AEFA 3TYYA 2K9YA 5M1BA 4NPFX 1S9KE 1SVFA 3R4YA 1N73A 1SQXK 4M3LA 4AUWA 1G2CA 1FJKA 1Z56A 3A0BH 1FZEA 3WUVA 2GA1A 4JF7A 1MFZA 3G9RA 4DT0A 5TISH 1ZP0C 3A5TA 3AEBC 2KYVA 3VMAA 1H89A 5TJHA 2RN0A 5APSA 3CWBE 1IC2A 1VQ8P 3VN0A 1NTZD 4I7ZC 3TNUA 5CCGA 5AW9B 1RF0A 2K9JA 1NGMB 3HUSA 1NKNA 1PP9J 1L4AA 4KHXA 1BGYG 3AEEC 3V2QA 2O1KA 2Q5UA 1KILC 1L0NK 1LP1A 2JEEA 3Q5PA 2OYIB 3AEFC 3M9QA 2HFED 3AE3C 1ZMEC 1LTBC 2WSEJ 1VL2A 2M5AA 1RE3C 1H88A 3GHGA 4UB8E 2RMZA 3H1JD 1MZ9A 4K35A 3L70D 1CI6A 1L0LD 4U3FE 2IBZE 4L76A 1M8OB 3CD6P 4IL6E 5KJ7C 1KQGB 1NJIQ 1NU1D 4IL6X 2WSFJ 1S4XA 2R5DA 5KAIE 1N73B 5AW8B 3RGUA 1HJ0A 1BE3G 2O1JA 1FZGA 2XNXA 1D7MA 3H1HG 2FXOA 1SQVG 2QSIA 2XV5A 3M9BA 1KB9D 4ZNCA 1CW5A 1SLQA 2WPQA 2J59M 1ZLLA 3CL3D 2Y0DA 3NFQA 3B71A 1EC5A 1KYOH 3H1LD 5AVTB 1JM0A 2C9NY 1VQ7P 1U7JA 4I1LA 3AE9C 1AQTA 1NTZK 1BDDA 1QVFO 1GMJA 3CC2P 2QJPC 2N1TC 2GUVA 3L71G 3OAKA 3HE4A 3D6YA 3TNUB 3MZWB 1GW3A 5KTBA 2SPZA 2K9JB 4PJ0E 1SP4A 3HUSB 1SQQJ 2NPSC 3L74J 5AW5B 1J1DC 1EZVG 3L72J 4UB6H 5APYA 1S5LH 1SQBJ 1DD4A 1LP1B 2FFDC 1M56D 2YIUB 2QA4P 5KKZC 2WTYA 3TDKA 3O8ZA 3BATA 4ASVA 1L0LK 3GHGB 2YO2A 1W2EA 2HLOA 1KQLA 3MUDC 1X0TA 2OYHB 2E74D 3SWYA 1NU1K 2NRGA 3QWOC 2Z4EA 2JWAA 5APUA 3KXDA 4RESB 1LTAC 4WWIA 3CX5I 2W6BA 3RL0C 1LT9C 2JKVA 1NTMJ 1NTKG 3LIDA 2WQYC 4D6TD 3BCCG 4OGQD 1LWUB 5DJTB 1S72P 2E75C 1DIPA 1URQD 3TK1A 3V4WA 1SFCD 2XU6A 3PRJA 3U1AA 2W83C 2BEQD 1FJPA 1SQPG 3SFDC 3CCEP 3WMM0 1S2EA 2BCCE 1M1JB 1N7SD 1GK4A 4Y28J 3CCLP 4JYCA 5AVYB 3IF4A 3KYQA 1KQFB 2QJKB 4JBZA 3MHVA 3IFMA 2FYUJ 1QX8A 1VF5D 4U3FD 1BGYJ 4JQ0D 2WSSH 4L74A 3CC7P 1M57D 3Q3DA 4R4LA 2E76C 1OW6A 2I1JA 1HH0A 2KS1A 1KTMA 3G3ZA 5CCHC 3S1KA 3USSA 2KSJA 2FY8A 5H2FH 4K3AA 3RK2C 3B5NC 4JPZB 1EXJA 4H13B 5AW2B 4H44D 1OW8A 4C7RA 4I2LC 4WVZA 5GTHE 1GTWA 1HJBA 1RE4C 5BU8B 2ZT9C 4W80A 1LTGC 2K1AA 3HD7D 4W7YA 4PV1B 3W68A 1NAYA 2AEMA 1SQQE 1SQVJ 2A06G 3JCUH 2HPCB 3VMZA 2E43A 1HBWA 3AE7C 3L72E 4Y99B 4QMAA 5KLVJ 3ABVC 3CPWO 4GOEA 4BRYA 2IDBA 1OWAA 1PPJE 2P67A 1PP9G 2XDJA 1A02F 3II6A 2L91A 3K5BA 1MV8A 3L71J 3M0DA 3H1KJ 1AA0A 1KFNA 1K8AQ 3A7OA 1NYHA 3PP5A 2PGDA 2WITA 5BVZA 1YYCA 1AV1A 3T97A 1R5LA 3RK3C 1SQXG 5C39A 2Y9ZA 3A2AA 1KD1Q 1IFJA 4CPGA 2KS1B 3C8VA 3OA7A 3V2PA 2K37A 1YBKA 2R3CA 3CX5D 1LT1A 2QJYC 2QE7H 1M90Q 3U59A 2AXTE 2BCCD 1M1KQ 1KB9I 3AE6C 2MKVA 4EIJA 3BCCJ 1P84E 4LLHA 3HRNA 1RQVA 1E79H 3KZIH 1BGYE 2M3EA 1L0NG 4BRYB 2KSEA 1SQPJ 5CBNA 1LTJA 4PD4E 3EQ2A 4ZKUA 2V7QH 4YPCA 3P8CE 2Q7CA 1DX7A 1RF1A 3H1IJ 1KILE 1URQA 1ZOYC 1T3JA 1K9MQ 3H25A 1SFCA 1BSHA 2D2CD 2O3JA 1KB9H 1JTHA 3T97B 3WUUA 2YKQA 3SWKA 2Z5IA 1BE3E 2PP6A 1VQ6P 4C46A 3H1HE 1EDJA 1GK6A 1SQVE 1N7SA 3VOPA 3MP7B 4AQRD 1GL2D 4ZKPA 1YI2P 4H0LD 5CMZA 3A0BE 1MKMA 2YMYA 3L72D 1Y8AA 1NTMG 2HG5D 1NTZG 5TISE 1HGZA 2PFXA 1NO4A 2JP3A 4OH8B 2P58A 3WU2E 2N9YB 5AVXB 2R32A 1ZW0A 1EZVE 4GDOA 3CC4P 3E7KA 2KIKA 2E74B 2CPSA 1KORA 3P7KA 2OTLP 2E42A 3S9OA 1PFIA 1JY3O 3HD7A 1LTJB 3FX0A 3H1JG 1HVVA 1AVYA 2FYUG 1L0LG 3D6ZA 1NWQA 3TF5A 3M0DC 1JMBA 2OTKE 1RF1B 1VQKP 4OGQB 2KLUA 1LGHB 1L2PA 4TLFA 1URQB 1NU1G 1SFCB 3B8EB 2L5GB 1YIJP 2IBZI 3V5BA 4GODA 1G1IA 1JTHB 2JWDA 1AVOA 2GM4A 1SQXJ 4XE5B 4WY4C 3FXEA 1NTKE 2OYHA 3VMYA 2FFDB 1N7SB 4EOTA 2K3RA 2HYNA 2KXPB 3F89A 2PRRA 1FU1A 5APQA 1K05A 1VF5B 1LWUA 1OVRA 4N78D 2BEZF 1KYOE 1K73Q 5KLVG 5BU5A 3CMAP 1VQPP 4PD4D 5DJUB 4OVNF 2IZ1A 2YXRB 1VQ4P 2OYOA 1FDMA 4H44B 1KILD 3TGUJ 3IR9A 4NPDA 3L75E 2XNDH 4KT0J 1M1JA 2OQQA 2WMMA 3VTPC 1L0NJ 3M91A 3H1KG 1JY2O 1FE6A 3OW2O 3FWNA 3V2NA 1JNMA 1OVUA 4UB6E 3D70A 1FAVA 3HD7B 1YTZI 3G4SP 3O6QA 1AFOA 1S5LX 1BE3D 3H1HD 1OW7A 1SQVD 3RBZA 2B89A 5KJ7D 2KK7A 4I6MC 2OYIC 5KLIC 1FS0E 1S9KD 3BRTB 2ZVOB 5AVSB 3FGAD 4OWFA 3GLMA 1LTIC 4PJ0H 4D6TG 4U7JA 4IFMA 3B5NB 3LW5J 1N73C 3LIEA 1WT6A 2LKMA 3CWBD 2J5UA 2LXCB 3BVHA 2ZVNB 1NTZJ 2R44A 2HPCA 2N1TD 3HTKA 1FZCA 2ITAA 1PP9E 1UIIA 2FYNB 1AQ5A 3JSVC 5AVQB 1IFIA 2R3SA 2NPSD 1T2KC 3L73G 2YKOA 1M7LA 1GL2A 2H88C 2Q6QA 4HJGH 1OX3A 1RQUA 3GF3A 3H1IG 1NH4A 5CCGC 1RF0C 3CX5H 4ZMDA 3HUSC 2FKWB 3H1JJ 1Y47A 3O6QB 1XTCC 3AEAC 3L70J 1SQVK 3RBXA 1L4AC 3M0AA 3N4XA 1BSNA 1L0LJ 1NTKD 1PGJA 2FXPA 3RK3E 2IBZD 1FC2C 1MUUA 3NMDA 1PV3A 1FOSE 4L75A 2V7QJ 1NU1J 2YIUC 3F5HA 2WPVB 4GIFA 2R5BA 3Q1MA 2YXQB 3EFFK 5E79H 3RL0D 1YJWP 3GHGC 1GZLA 1ZV8A 2J58A 5CJ4A 1UIXA 1Y9BA 2E75D 1ZR4A 1HF9A 2P10A 2OTJP 3I55P 1X22A 3H1LJ 3W67A 2D2CB 1NVOA 1T8ZA 3L75D 3L74E 1GU5A 1JOCA 3HTKB 1FZCB 1WMKA 5GTHH 2MJZA 2IZ0A 1MFTA 1QLED 5KAFH 1KC8Q 1SQBE 4WBAA 2YMKA 4LGDE 1L4AD 1HWTC 3L36A 4YXWH 1PGPA 1GL2B 1FOSF 1JO5A 1ZR2A 4H0LB 2E76D 2G8YA 1HUCA 1Q2NA 1IFDA 4O9BA 5EFWB 5CCHD 5GTIH 2OARA 3RK2D 3B5ND 3OJAB 2QJKC 2XZRA 5B5EH 4DOJA 1NTKK 3HE5A 1QVGO 1QEXA 1OZHA 3CXHI 3IAOA 1FZAA 2ZT9D 3AE1C 3H32A 3AECC 1KILA 1H0TA 1NTME 1NTZE 3SFEC 2NZ2A 3LW5H 1J1EB 3CXHE 5APTA 5AW0B 1N86A 3S4RA 3CCRP 2YO3A 4H13C 2BCCG 1RE3A 1GDTA 2PAJA 4D6TJ 3A0HH 1PP9D 2POHA 3C9IA 1BCCG 1J2JB 3PLNA 4XFJA 2KLVA 1X9VA 5KJ7A 1VQOP 1P84I 2KNCA 2JR8A 3VYIA 5CHXA 3ZDMA 3I5CA 1FBMA 4Y99C 1ZN5A 1JCDA 2FYUE 3TGUG 1L0LE 4PD4I 2Q9IA 2ZYDA 1JCCA 5APVA 1FZBA 2I1KA 4XA4A 3L73J 1NU1E 1H8AA 2W27A 4U3FJ 4HB1A 1PL5A 3U1CA 2RKLA 3RK3D 3JC22 2P2UA 2Y9YA 2CPBA 2N1TA 1YHQP 4I7ZB 2IYOA 3V6IA 2KUBA 3MTUE 2NPSA 2BASA 2ZYAA 3HE5B 4YXDC 1SS1A 3GF7A 2IFNA 2O01H 1JB0J 3R2PA 3PH0A 3GG2A 3H32B 5B66H 4IOIH 1KILB 5APXA 3CI9A 1AJYA 1H0TB 1IFPA 2QIWA 2FFDA 1Q90D 2P1JA 3ITKA 1RHZB 5CJ0A 3VP9A 5KLVE 1RH5B
chains in the Genus database with same CATH topology
3M06A 5AW4B 1LWUA 1FJPA 2KB7P 4N78D 3P32A 4HYTB 1IFNA 3VMXA 3WMM0 1HGVA 2M3BA 4GT1A 1SQPK 5BU5A 4IFDK 3MUDA 1M1JB 1N7SD 2Q3IA 1GK4A 1JY3P 3L4FA 4JYCA 3M9HA 5AVYB 3E1IA 1FDMA 4WY4A 1KILD 3KYQA 3IR9A 1GU4A 3A3YB 1M1JA 3IFMA 4B86A 1NHLA 3VTPC 1LT9A 3M91A 3L37A 1JMMA 1JY2O 1X8YA 3V2NA 1JNMA 2WWWA 5AVWB 2I1JA 1FAVA 3HD7B 1YTZI 1DEBA 1AFOA 1X79B 1HH0A 1CZQA 3G3ZA 1EQ7A 2A45G 5CCHC 2P7JA 1FZCC 2KSJA 1LTSC 3RK2C 3B5NC 3EFGA 5AW2B 5AW7B 5KJ7D 4I6MC 2H8PD 4C7RA 2OYIC 1T3UA 4I2LC 1JY2N 2HODB 1S9KD 1G1JA 1GTWA 3BRTB 1WRGA 1HJBA 1RE4C 5AVSB 3NXSA 5BU8B 4GKGA 4W80A 1LTGC 1LTIC 2N1TB 4IFFA 1GL2C 1KZUB 3HD7D 4W7YA 1JY3N 2NPSB 1NOHA 4IFMA 1J1DB 1HTLC 4N78E 3VP8A 2HPCB 1HBWA 3VMZA 2E43A 3B5NB 4Y99B 1N73C 2FYZA 3LIEA 1IO4A 1WT6A 2LKMA 3CLQA 5AW1B 1OWAA 5CCHA 3BVHA 1SQQK 2QM8A 4DZOA 2N1TD 3HTKA 1FZCA 2HPCA 2P67A 5AVVB 3B5NA 1AQ5A 2M8RA 5AW6B 3TSIA 3V4QA 2OYIA 5AVQB 1IFIA 2C9LY 1N7LA 2XDJA 1A02F 1SQBK 2NPSD 1J1EC 3II6A 1RE4A 1T2KC 2KOGA 1MV8A 4JYBA 3M0DA 1JY2P 2YKOA 1M7LA 2H7HA 1YTZT 1GL2A 4LC1A 1KFNA 4HH2A 3A7OA 2WSCH 4WY4B 2ZFCA 3PP5A 1CSBA 2H43A 2WITA 2WZ7A 5BVZA 1E5WA 1YYCA 4N6JA 3TYYA 3RL0B 1LT9B 3T97A 3P8CD 3RK3C 1G2CB 1NH4A 1A02J 5CCGC 1RF0C 1S9KE 1SVFA 3HUSC 5AVUB 3A2AA 2FKWB 3P8MC 1IFJA 1N73A 1XTCC 1SQVK 1SQXK 1L4AC 3M0AA 3N4XA 3OA7A 3KPEA 4M3LA 4AUWA 1G2CA 1FJKA 1IFMA 1MUUA 1Z56A 3NMDA 1FOSE 1LTJC 1FZEA 4WB4A 1NTMK 4WY4D 3V2PA 4GIFA 4JF7A 1MFZA 1QL2A 2R5BA 2R3CA 1RF1C 3RL0D 2C0XA 4C7NA 3A5TA 1URQC 3GHGC 1GZLA 1ZV8A 2KYVA 2J58A 1H89A 5CJ4A 1SFCC 5APSA 2GUSA 1IC2A 3VN0A 1ZR4A 3H6PA 3U59A 3V2RA 1L4AB 3TNUA 4EIJA 5CCGA 4LLHA 5AW9B 1RF0A 5AVZB 3HRNA 3HUSA 1N2DC 1NKNA 1GW4A 2W6AA 1N7SC 2IX7C 1L4AA 4KHXA 1T8ZA 2C0WA 1JUNA 1GU5A 1JOCA 3V2QA 2O1KA 2Q5UA 3HTKB 1FZCB 1KILC 5AVRB 3RK2B 1LTJA 2FYUK 1L0NK 1QL1A 1VDFA 2JEEA 2MJZA 2ZXEB 1IJDB 3EQ2A 4ZKUA 2OYIB 1CI6B 2WPRA 3M9QA 2HFED 3BRVB 4WBAA 3P8CE 1LTBC 2Q7CA 4LGDE 1DX7A 1L4AD 1RF1A 5AW3B 1HWTC 2QM7A 2WT7A 3L36A 1LTTC 1RE3C 1GL2B 1H88A 1URQA 3GHGA 1FOSF 1XTGB 3MIWA 1JO5A 1T3JA 1ZR2A 2YKPA 1MZ9A 2XKMA 1SFCA 1CI6A 1HUCA 1IFDA 1JTHA 4O9BA 5CCHD 5KJ7C 2YKQA 2KP8A 2Z5IA 2OARA 3RK2D 3B5ND 3OJAB 2XZRA 2R5DA 2PP6A 4C46A 1NTKK 4DOJA 3HE5A 1N73B 1GK6A 5AW8B 1N7SA 1NAFA 3VOPA 4AYCA 4AQRD 2O1JA 1FZGA 2XNXA 1FZAA 3H32A 2XV5A 2Z5HA 3M9BA 1CW5A 3HD7C 1KILA 1SLQA 1GL2D 1GD2E 2WPQA 4ZKPA 2J59M 2A45I 1ZLLA 3CL3D 5CMZA 2YMYA 3LW5H 3NFQA 1J1EB 5APTA 5AW0B 1N86A 2HG5D 5KLVK 2YO3A 3UIAA 2WSEH 5AVTB 4C7NB 3HE4B 1FZFA 1HGZA 1RE3A 1GDTA 2PAJA 2C9NY 4I1LA 2POHA 1NTZK 3N7NA 1VPCA 3C9IA 1NO4A 4OH8B 1J2JB 2N1TC 2GUVA 2KLVA 3KQGA 3OAKA 1X9VA 5AVXB 2R32A 3HE4A 3TNUB 2IFMA 5KJ7A 2IPPA 3RK3B 1GW3A 5KTBA 3SWFA 1SP4A 3HUSB 2NPSC 3VYIA 5AW5B 2OYHC 1NKZB 2WSFH 1J1DC 4N3YB 3BASA 2JJLA 1T2KD 5CHXA 2CPSA 3NTNA 3P7KA 2E42A 5APYA 1PFIA 3I5CA 1DH3A 2A45H 1JY3O 1FBMA 3HD7A 3L35A 4Y99C 1ZN5A 1JCDA 1LTJB 2FFDC 2Q9IA 1HVVA 1JCCA 3MGNA 1IK9A 5APVA 1NWQA 1FZBA 2I1KA 4XA4A 3M0DC 1LWUC 1H8AA 2W27A 2WTYA 1RF1B 3O8ZA 2WT7B 3U1CA 3RK3D 1LGHB 1KFMA 3BATA 1L0LK 1URQB 3GHGB 5CCGD 2YO2A 1W2EA 2HLOA 2HODA 1KQLA 2P2UA 1SFCB 3B8EB 2OYHB 2L5GB 4W7ZA 2YNYA 2WPSA 3SWYA 2CPBA 3V5BA 2N1TA 1NU1K 1G1IA 1JTHB 2GM4A 4XE5B 2Z4EA 5APUA 4WY4C 4RESB 3MTUE 2NPSA 5APWA 2BASA 1LTAC 2OYHA 3VMYA 2FFDB 1M1JC 1RY3A 3HE5B 2W6BA 3RL0C 1LT9C 1N7SB 4EOTA 2IFNA 2O01H 2HYNA 3LIDA 3R2PA 3H32B 1LWUB 3MD0A 1KILB 5APXA 3CI9A 1OXZA 2VRSA 1URQD 3TK1A 3V4WA 2FFDA 2FXMA 2P1JA 1SFCD 2XU6A 1FU1A 3U1AA 3KDPB 2N9BA 5APQA 5CJ0A 3VP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HTL C;  1XTC C;  1LTB C;  1LTT C;  1LTG C;  1LTI C;  1LTA C;  1LTS C; 
#chains in the Genus database with same CATH topology
 3M06 A;  3P32 A;  1IFN A;  3VMX A;  1HGV A;  4YTP C;  1SQQ D;  3L74 D;  2M3B A;  3AE2 C;  2B88 A;  4HKZ H;  3MUD A;  1SQB D;  2LXB A;  3M9H A;  1DD3 A;  1PPJ D;  4EDF A;  2KNC B;  1EZV I;  3L71 E;  2Q3E A;  3H1K E;  2QVA A;  1NHL A;  1LT9 A;  3L37 A;  1X8Y A;  3AE4 C;  2WWW A;  1X79 B;  2QG4 A;  1CZQ A;  3QH9 A;  4GOF A;  3EFG A;  1VQN P;  1U7M A;  2H8P D;  1R5S A;  1JY2 N;  1G1J A;  3L70 G;  3WU2 H;  4KJM A;  1NTM D;  2H89 C;  2QJP B;  4GKG A;  4D6T E;  2DW3 A;  2N1T B;  2AXC A;  2KZJ A;  1OIP A;  3CXH D;  2G3A A;  1QGK B;  1KZU B;  1OVV A;  2QRX A;  1YQ3 C;  2NPS B;  2WVR A;  1J1D B;  1PIX A;  3VP8 A;  4RO0 A;  5L8R J;  4BWN A;  2RH0 A;  4MN4 C;  1IO4 A;  5KLI B;  3BCC E;  3CLQ A;  1OFC X;  1DEE G;  5AW1 B;  5CCH A;  5KKZ B;  1SQQ K;  4DZO A;  2BCC J;  3B5N A;  3H1L G;  4TT3 H;  2FBW C;  1KYO I;  5AW6 B;  1K04 A;  1P84 D;  1IK7 A;  1N7L A;  3L73 E;  1SQP E;  2FYU D;  1SQB K;  1BCC J;  1RE4 A;  1BGY D;  3G6E P;  3PHL A;  4JYB A;  4DJG A;  4UB8 H;  1YTZ T;  4LC1 A;  3IN6 A;  4HH2 A;  2WSC H;  3FXD A;  1USD A;  3H1I E;  2Y0C A;  2WZ7 A;  2B9B A;  2AEJ A;  4N6J A;  4IL6 H;  1R8E A;  1VQM P;  3RL0 B;  1LT9 B;  3P8C D;  1G2C B;  1A02 J;  1PZQ A;  2W6J H;  5AVU B;  5KAI H;  3B4S A;  4ASW A;  3P8M C;  2E75 B;  2B87 A;  2E74 C;  3AEG C;  3KPE A;  1IFM A;  1LTJ C;  1S5L E;  4WB4 A;  4WY4 D;  1NTM K;  2ZAE B;  1QL2 A;  1ZRT E;  1RF1 C;  4OGQ C;  2C0X A;  4C7N A;  5K5G B;  1URQ C;  1Q82 Q;  3PTZ A;  5KLV D;  3E1R A;  1JEK A;  1PGQ A;  1SFC C;  1BDC A;  2GUS A;  3H6P A;  3V2R A;  1L4A B;  3CWB G;  2O01 N;  5AVZ B;  1N2D C;  2E76 B;  2V4H A;  1GW4 A;  2W6A A;  1N7S C;  2A06 E;  2IX7 C;  3L71 D;  3H1K D;  2C0W A;  1VQL P;  1JUN A;  3G71 P;  5AVR B;  3RK2 B;  2M5A B;  2FYU K;  3I56 P;  1QL1 A;  1VDF A;  2ZXE B;  1IJD B;  1CI6 B;  1EZV D;  2WPR A;  3BRV B;  1VF5 C;  5AW3 B;  3CME P;  2ZT9 B;  2QM7 A;  2WT7 A;  1VQ9 P;  1LTT C;  1XTG B;  3MIW A;  3GMA A;  2YKP A;  2XKM A;  1KMI Z;  4U3F G;  3RL0 g;  2KP8 A;  4H44 C;  2IBZ G;  3D71 A;  5CBO A;  1Q86 Q;  3CX5 E;  2B87 B;  1SQX E;  1NAF A;  4AYC A;  2QEX P;  2Z5H A;  3HD7 C;  4EI2 A;  1GD2 E;  2A45 I;  4RKU J;  3AED C;  5KLV K;  3BCC D;  3Q5S A;  3UIA A;  1Q7Y Q;  2WSE H;  4C7N B;  3HE4 B;  1FZF A;  5E79 E;  1BCC E;  3EWK A;  2K88 A;  5H2F E;  3N7N A;  1VPC A;  3L73 D;  1SQP D;  3KQG A;  3L75 G;  2IFM A;  2JDI H;  3CCJ P;  2IPP A;  3RK3 B;  3SWF A;  1YQ4 C;  2OYH C;  1KYO D;  1NKZ B;  2O01 J;  2WSF H;  3FWL A;  4N3Y B;  3BAS A;  2JJL A;  3H1I D;  3TGU E;  1T2K D;  3NTN A;  1EXI A;  1DH3 A;  2A45 H;  2HR3 A;  3L35 A;  1T6A A;  1L0N E;  1OMI A;  3JCU E;  3SSU A;  3MGN A;  1IK9 A;  5KAF E;  1LWU C;  2FYN C;  2WT7 B;  2QJY B;  1KFM A;  5CCG D;  2HOD A;  2E5T A;  3CCS P;  2JO1 A;  4W7Z A;  1FDI A;  2YNY A;  2WPS A;  1BE3 J;  2I8D A;  2OGU A;  1ZRT D;  2M0B A;  3H1H J;  5GTI E;  4BXL A;  2ZXX A;  5APW A;  3KHU A;  1FDO A;  2W8Z A;  1M1J C;  1RY3 A;  5B5E E;  1IZN B;  1EDL A;  4RJT A;  4NPE A;  3MD0 A;  1USE A;  1OXZ A;  2VRS A;  2FXM A;  3KDP B;  2N9B A;  1VQ5 P;  2A06 D;  5AW4 B;  1TU3 F;  2KB7 P;  1YIT P;  4HYT B;  4GT1 A;  2Q1K A;  1SQP K;  4IFD K;  3A0H E;  1N8R Q;  3Q5R A;  2Q3I A;  3CWB J;  1ZXG A;  1JY3 P;  3L4F A;  3E1I A;  2ZYG A;  4WY4 A;  1KN7 A;  1W2B O;  4A7P A;  1GU4 A;  3A3Y B;  4B86 A;  4L73 A;  1EDK A;  1YJ9 P;  3CCQ P;  2IYP A;  1JMM A;  2W90 A;  3C1L A;  5AVW B;  4PV1 C;  1DEB A;  2D2C C;  1YJN P;  3CXH H;  3KZI E;  4EYY Q;  1LJ2 A;  1EQ7 A;  2A45 G;  1SQX D;  2P7J A;  1FZC C;  3H1J E;  3CCM P;  1LTS C;  4DCK A;  1S3J A;  3L70 E;  3Q2Y A;  5AW7 B;  1T3U A;  4R4M A;  2HOD B;  1KV4 A;  3WUT A;  1WRG A;  3NXS A;  1NTK J;  4IFF A;  2CK3 H;  2WSC J;  1GL2 C;  2UWJ E;  4H0L C;  3GW6 A;  1Q81 Q;  1U57 A;  1LNQ A;  1JY3 N;  1BCC D;  2AXT H;  1NOH A;  2ZJS E;  1HTL C;  3AE5 C;  1KB9 E;  1P84 H;  4N78 E;  2KI7 B;  4H13 D;  2LR2 A;  1SQQ G;  3L74 G;  5B66 E;  2FYZ A;  3CCU P;  3H1L E;  3L72 G;  4Z1M H;  2QM8 A;  1S1C X;  4PD4 H;  1SQB G;  1W5C E;  5AVV B;  3TGU D;  2M8R A;  3TSI A;  3V4Q A;  1PPJ G;  2OYI A;  2C9L Y;  1PGO A;  4PV1 D;  2KZI A;  1L0N D;  1J1E C;  1KQS O;  2Y0E A;  3AE8 C;  2KOG A;  1JY2 P;  3L75 J;  2H7H A;  3CCV P;  2E5Y A;  1EDI A;  3PJS K;  4WY4 B;  2ZFC A;  1CSB A;  2H43 A;  1E5W A;  2AEF A;  3TYY A;  2K9Y A;  5M1B A;  4NPF X;  1S9K E;  1SVF A;  3R4Y A;  1N73 A;  1SQX K;  4M3L A;  4AUW A;  1G2C A;  1FJK A;  1Z56 A;  3A0B H;  1FZE A;  3WUV A;  2GA1 A;  4JF7 A;  1MFZ A;  3G9R A;  4DT0 A;  5TIS H;  1ZP0 C;  3A5T A;  3AEB C;  2KYV A;  3VMA A;  1H89 A;  5TJH A;  2RN0 A;  5APS A;  3CWB E;  1IC2 A;  1VQ8 P;  3VN0 A;  1NTZ D;  4I7Z C;  3TNU A;  5CCG A;  5AW9 B;  1RF0 A;  2K9J A;  1NGM B;  3HUS A;  1NKN A;  1PP9 J;  1L4A A;  4KHX A;  1BGY G;  3AEE C;  3V2Q A;  2O1K A;  2Q5U A;  1KIL C;  1L0N K;  1LP1 A;  2JEE A;  3Q5P A;  2OYI B;  3AEF C;  3M9Q A;  2HFE D;  3AE3 C;  1ZME C;  1LTB C;  2WSE J;  1VL2 A;  2M5A A;  1RE3 C;  1H88 A;  3GHG A;  4UB8 E;  2RMZ A;  3H1J D;  1MZ9 A;  4K35 A;  3L70 D;  1CI6 A;  1L0L D;  4U3F E;  2IBZ E;  4L76 A;  1M8O B;  3CD6 P;  4IL6 E;  5KJ7 C;  1KQG B;  1NJI Q;  1NU1 D;  4IL6 X;  2WSF J;  1S4X A;  2R5D A;  5KAI E;  1N73 B;  5AW8 B;  3RGU A;  1HJ0 A;  1BE3 G;  2O1J A;  1FZG A;  2XNX A;  1D7M A;  3H1H G;  2FXO A;  1SQV G;  2QSI A;  2XV5 A;  3M9B A;  1KB9 D;  4ZNC A;  1CW5 A;  1SLQ A;  2WPQ A;  2J59 M;  1ZLL A;  3CL3 D;  2Y0D A;  3NFQ A;  3B71 A;  1EC5 A;  1KYO H;  3H1L D;  5AVT B;  1JM0 A;  2C9N Y;  1VQ7 P;  1U7J A;  4I1L A;  3AE9 C;  1AQT A;  1NTZ K;  1BDD A;  1QVF O;  1GMJ A;  3CC2 P;  2QJP C;  2N1T C;  2GUV A;  3L71 G;  3OAK A;  3HE4 A;  3D6Y A;  3TNU B;  3MZW B;  1GW3 A;  5KTB A;  2SPZ A;  2K9J B;  4PJ0 E;  1SP4 A;  3HUS B;  1SQQ J;  2NPS C;  3L74 J;  5AW5 B;  1J1D C;  1EZV G;  3L72 J;  4UB6 H;  5APY A;  1S5L H;  1SQB J;  1DD4 A;  1LP1 B;  2FFD C;  1M56 D;  2YIU B;  2QA4 P;  5KKZ C;  2WTY A;  3TDK A;  3O8Z A;  3BAT A;  4ASV A;  1L0L K;  3GHG B;  2YO2 A;  1W2E A;  2HLO A;  1KQL A;  3MUD C;  1X0T A;  2OYH B;  2E74 D;  3SWY A;  1NU1 K;  2NRG A;  3QWO C;  2Z4E A;  2JWA A;  5APU A;  3KXD A;  4RES B;  1LTA C;  4WWI A;  3CX5 I;  2W6B A;  3RL0 C;  1LT9 C;  2JKV A;  1NTM J;  1NTK G;  3LID A;  2WQY C;  4D6T D;  3BCC G;  4OGQ D;  1LWU B;  5DJT B;  1S72 P;  2E75 C;  1DIP A;  1URQ D;  3TK1 A;  3V4W A;  1SFC D;  2XU6 A;  3PRJ A;  3U1A A;  2W83 C;  2BEQ D;  1FJP A;  1SQP G;  3SFD C;  3CCE P;  3WMM 0;  1S2E A;  2BCC E;  1M1J B;  1N7S D;  1GK4 A;  4Y28 J;  3CCL P;  4JYC A;  5AVY B;  3IF4 A;  3KYQ A;  1KQF B;  2QJK B;  4JBZ A;  3MHV A;  3IFM A;  2FYU J;  1QX8 A;  1VF5 D;  4U3F D;  1BGY J;  4JQ0 D;  2WSS H;  4L74 A;  3CC7 P;  1M57 D;  3Q3D A;  4R4L A;  2E76 C;  1OW6 A;  2I1J A;  1HH0 A;  2KS1 A;  1KTM A;  3G3Z A;  5CCH C;  3S1K A;  3USS A;  2KSJ A;  2FY8 A;  5H2F H;  4K3A A;  3RK2 C;  3B5N C;  4JPZ B;  1EXJ A;  4H13 B;  5AW2 B;  4H44 D;  1OW8 A;  4C7R A;  4I2L C;  4WVZ A;  5GTH E;  1GTW A;  1HJB A;  1RE4 C;  5BU8 B;  2ZT9 C;  4W80 A;  1LTG C;  2K1A A;  3HD7 D;  4W7Y A;  4PV1 B;  3W68 A;  1NAY A;  2AEM A;  1SQQ E;  1SQV J;  2A06 G;  3JCU H;  2HPC B;  3VMZ A;  2E43 A;  1HBW A;  3AE7 C;  3L72 E;  4Y99 B;  4QMA A;  5KLV J;  3ABV C;  3CPW O;  4GOE A;  4BRY A;  2IDB A;  1OWA A;  1PPJ E;  2P67 A;  1PP9 G;  2XDJ A;  1A02 F;  3II6 A;  2L91 A;  3K5B A;  1MV8 A;  3L71 J;  3M0D A;  3H1K J;  1AA0 A;  1KFN A;  1K8A Q;  3A7O A;  1NYH A;  3PP5 A;  2PGD A;  2WIT A;  5BVZ A;  1YYC A;  1AV1 A;  3T97 A;  1R5L A;  3RK3 C;  1SQX G;  5C39 A;  2Y9Z A;  3A2A A;  1KD1 Q;  1IFJ A;  4CPG A;  2KS1 B;  3C8V A;  3OA7 A;  3V2P A;  2K37 A;  1YBK A;  2R3C A;  3CX5 D;  1LT1 A;  2QJY C;  2QE7 H;  1M90 Q;  3U59 A;  2AXT E;  2BCC D;  1M1K Q;  1KB9 I;  3AE6 C;  2MKV A;  4EIJ A;  3BCC J;  1P84 E;  4LLH A;  3HRN A;  1RQV A;  1E79 H;  3KZI H;  1BGY E;  2M3E A;  1L0N G;  4BRY B;  2KSE A;  1SQP J;  5CBN A;  1LTJ A;  4PD4 E;  3EQ2 A;  4ZKU A;  2V7Q H;  4YPC A;  3P8C E;  2Q7C A;  1DX7 A;  1RF1 A;  3H1I J;  1KIL E;  1URQ A;  1ZOY C;  1T3J A;  1K9M Q;  3H25 A;  1SFC A;  1BSH A;  2D2C D;  2O3J A;  1KB9 H;  1JTH A;  3T97 B;  3WUU A;  2YKQ A;  3SWK A;  2Z5I A;  1BE3 E;  2PP6 A;  1VQ6 P;  4C46 A;  3H1H E;  1EDJ A;  1GK6 A;  1SQV E;  1N7S A;  3VOP A;  3MP7 B;  4AQR D;  1GL2 D;  4ZKP A;  1YI2 P;  4H0L D;  5CMZ A;  3A0B E;  1MKM A;  2YMY A;  3L72 D;  1Y8A A;  1NTM G;  2HG5 D;  1NTZ G;  5TIS E;  1HGZ A;  2PFX A;  1NO4 A;  2JP3 A;  4OH8 B;  2P58 A;  3WU2 E;  2N9Y B;  5AVX B;  2R32 A;  1ZW0 A;  1EZV E;  4GDO A;  3CC4 P;  3E7K A;  2KIK A;  2E74 B;  2CPS A;  1KOR A;  3P7K A;  2OTL P;  2E42 A;  3S9O A;  1PFI A;  1JY3 O;  3HD7 A;  1LTJ B;  3FX0 A;  3H1J G;  1HVV A;  1AVY A;  2FYU G;  1L0L G;  3D6Z A;  1NWQ A;  3TF5 A;  3M0D C;  1JMB A;  2OTK E;  1RF1 B;  1VQK P;  4OGQ B;  2KLU A;  1LGH B;  1L2P A;  4TLF A;  1URQ B;  1NU1 G;  1SFC B;  3B8E B;  2L5G B;  1YIJ P;  2IBZ I;  3V5B A;  4GOD A;  1G1I A;  1JTH B;  2JWD A;  1AVO A;  2GM4 A;  1SQX J;  4XE5 B;  4WY4 C;  3FXE A;  1NTK E;  2OYH A;  3VMY A;  2FFD B;  1N7S B;  4EOT A;  2K3R A;  2HYN A;  2KXP B;  3F89 A;  2PRR A;  1FU1 A;  5APQ A;  1K05 A;  1VF5 B;  1LWU A;  1OVR A;  4N78 D;  2BEZ F;  1KYO E;  1K73 Q;  5KLV G;  5BU5 A;  3CMA P;  1VQP P;  4PD4 D;  5DJU B;  4OVN F;  2IZ1 A;  2YXR B;  1VQ4 P;  2OYO A;  1FDM A;  4H44 B;  1KIL D;  3TGU J;  3IR9 A;  4NPD A;  3L75 E;  2XND H;  4KT0 J;  1M1J A;  2OQQ A;  2WMM A;  3VTP C;  1L0N J;  3M91 A;  3H1K G;  1JY2 O;  1FE6 A;  3OW2 O;  3FWN A;  3V2N A;  1JNM A;  1OVU A;  4UB6 E;  3D70 A;  1FAV A;  3HD7 B;  1YTZ I;  3G4S P;  3O6Q A;  1AFO A;  1S5L X;  1BE3 D;  3H1H D;  1OW7 A;  1SQV D;  3RBZ A;  2B89 A;  5KJ7 D;  2KK7 A;  4I6M C;  2OYI C;  5KLI C;  1FS0 E;  1S9K D;  3BRT B;  2ZVO B;  5AVS B;  3FGA D;  4OWF A;  3GLM A;  1LTI C;  4PJ0 H;  4D6T G;  4U7J A;  4IFM A;  3B5N B;  3LW5 J;  1N73 C;  3LIE A;  1WT6 A;  2LKM A;  3CWB D;  2J5U A;  2LXC B;  3BVH A;  2ZVN B;  1NTZ J;  2R44 A;  2HPC A;  2N1T D;  3HTK A;  1FZC A;  2ITA A;  1PP9 E;  1UII A;  2FYN B;  1AQ5 A;  3JSV C;  5AVQ B;  1IFI A;  2R3S A;  2NPS D;  1T2K C;  3L73 G;  2YKO A;  1M7L A;  1GL2 A;  2H88 C;  2Q6Q A;  4HJG H;  1OX3 A;  1RQU A;  3GF3 A;  3H1I G;  1NH4 A;  5CCG C;  1RF0 C;  3CX5 H;  4ZMD A;  3HUS C;  2FKW B;  3H1J J;  1Y47 A;  3O6Q B;  1XTC C;  3AEA C;  3L70 J;  1SQV K;  3RBX A;  1L4A C;  3M0A A;  3N4X A;  1BSN A;  1L0L J;  1NTK D;  1PGJ A;  2FXP A;  3RK3 E;  2IBZ D;  1FC2 C;  1MUU A;  3NMD A;  1PV3 A;  1FOS E;  4L75 A;  2V7Q J;  1NU1 J;  2YIU C;  3F5H A;  2WPV B;  4GIF A;  2R5B A;  3Q1M A;  2YXQ B;  3EFF K;  5E79 H;  3RL0 D;  1YJW P;  3GHG C;  1GZL A;  1ZV8 A;  2J58 A;  5CJ4 A;  1UIX A;  1Y9B A;  2E75 D;  1ZR4 A;  1HF9 A;  2P10 A;  2OTJ P;  3I55 P;  1X22 A;  3H1L J;  3W67 A;  2D2C B;  1NVO A;  1T8Z A;  3L75 D;  3L74 E;  1GU5 A;  1JOC A;  3HTK B;  1FZC B;  1WMK A;  5GTH H;  2MJZ A;  2IZ0 A;  1MFT A;  1QLE D;  5KAF H;  1KC8 Q;  1SQB E;  4WBA A;  2YMK A;  4LGD E;  1L4A D;  1HWT C;  3L36 A;  4YXW H;  1PGP A;  1GL2 B;  1FOS F;  1JO5 A;  1ZR2 A;  4H0L B;  2E76 D;  2G8Y A;  1HUC A;  1Q2N A;  1IFD A;  4O9B A;  5EFW B;  5CCH D;  5GTI H;  2OAR A;  3RK2 D;  3B5N D;  3OJA B;  2QJK C;  2XZR A;  5B5E H;  4DOJ A;  1NTK K;  3HE5 A;  1QVG O;  1QEX A;  1OZH A;  3CXH I;  3IAO A;  1FZA A;  2ZT9 D;  3AE1 C;  3H32 A;  3AEC C;  1KIL A;  1H0T A;  1NTM E;  1NTZ E;  3SFE C;  2NZ2 A;  3LW5 H;  1J1E B;  3CXH E;  5APT A;  5AW0 B;  1N86 A;  3S4R A;  3CCR P;  2YO3 A;  4H13 C;  2BCC G;  1RE3 A;  1GDT A;  2PAJ A;  4D6T J;  3A0H H;  1PP9 D;  2POH A;  3C9I A;  1BCC G;  1J2J B;  3PLN A;  4XFJ A;  2KLV A;  1X9V A;  5KJ7 A;  1VQO P;  1P84 I;  2KNC A;  2JR8 A;  3VYI A;  5CHX A;  3ZDM A;  3I5C A;  1FBM A;  4Y99 C;  1ZN5 A;  1JCD A;  2FYU E;  3TGU G;  1L0L E;  4PD4 I;  2Q9I A;  2ZYD A;  1JCC A;  5APV A;  1FZB A;  2I1K A;  4XA4 A;  3L73 J;  1NU1 E;  1H8A A;  2W27 A;  4U3F J;  4HB1 A;  1PL5 A;  3U1C A;  2RKL A;  3RK3 D;  3JC2 2;  2P2U A;  2Y9Y A;  2CPB A;  2N1T A;  1YHQ P;  4I7Z B;  2IYO A;  3V6I A;  2KUB A;  3MTU E;  2NPS A;  2BAS A;  2ZYA A;  3HE5 B;  4YXD C;  1SS1 A;  3GF7 A;  2IFN A;  2O01 H;  1JB0 J;  3R2P A;  3PH0 A;  3GG2 A;  3H32 B;  5B66 H;  4IOI H;  1KIL B;  5APX A;  3CI9 A;  1AJY A;  1H0T B;  1IFP A;  2QIW A;  2FFD A;  1Q90 D;  2P1J A;  3ITK A;  1RHZ B;  5CJ0 A;  3VP9 A;  5KLV E;  1RH5 B; 
#chains in the Genus database with same CATH homology
 3M06 A;  5AW4 B;  1LWU A;  1FJP A;  2KB7 P;  4N78 D;  3P32 A;  4HYT B;  1IFN A;  3VMX A;  3WMM 0;  1HGV A;  2M3B A;  4GT1 A;  1SQP K;  5BU5 A;  4IFD K;  3MUD A;  1M1J B;  1N7S D;  2Q3I A;  1GK4 A;  1JY3 P;  3L4F A;  4JYC A;  3M9H A;  5AVY B;  3E1I A;  1FDM A;  4WY4 A;  1KIL D;  3KYQ A;  3IR9 A;  1GU4 A;  3A3Y B;  1M1J A;  3IFM A;  4B86 A;  1NHL A;  3VTP C;  1LT9 A;  3M91 A;  3L37 A;  1JMM A;  1JY2 O;  1X8Y A;  3V2N A;  1JNM A;  2WWW A;  5AVW B;  2I1J A;  1FAV A;  3HD7 B;  1YTZ I;  1DEB A;  1AFO A;  1X79 B;  1HH0 A;  1CZQ A;  3G3Z A;  1EQ7 A;  2A45 G;  5CCH C;  2P7J A;  1FZC C;  2KSJ A;  1LTS C;  3RK2 C;  3B5N C;  3EFG A;  5AW2 B;  5AW7 B;  5KJ7 D;  4I6M C;  2H8P D;  4C7R A;  2OYI C;  1T3U A;  4I2L C;  1JY2 N;  2HOD B;  1S9K D;  1G1J A;  1GTW A;  3BRT B;  1WRG A;  1HJB A;  1RE4 C;  5AVS B;  3NXS A;  5BU8 B;  4GKG A;  4W80 A;  1LTG C;  1LTI C;  2N1T B;  4IFF A;  1GL2 C;  1KZU B;  3HD7 D;  4W7Y A;  1JY3 N;  2NPS B;  1NOH A;  4IFM A;  1J1D B;  1HTL C;  4N78 E;  3VP8 A;  2HPC B;  1HBW A;  3VMZ A;  2E43 A;  3B5N B;  4Y99 B;  1N73 C;  2FYZ A;  3LIE A;  1IO4 A;  1WT6 A;  2LKM A;  3CLQ A;  5AW1 B;  1OWA A;  5CCH A;  3BVH A;  1SQQ K;  2QM8 A;  4DZO A;  2N1T D;  3HTK A;  1FZC A;  2HPC A;  2P67 A;  5AVV B;  3B5N A;  1AQ5 A;  2M8R A;  5AW6 B;  3TSI A;  3V4Q A;  2OYI A;  5AVQ B;  1IFI A;  2C9L Y;  1N7L A;  2XDJ A;  1A02 F;  1SQB K;  2NPS D;  1J1E C;  3II6 A;  1RE4 A;  1T2K C;  2KOG A;  1MV8 A;  4JYB A;  3M0D A;  1JY2 P;  2YKO A;  1M7L A;  2H7H A;  1YTZ T;  1GL2 A;  4LC1 A;  1KFN A;  4HH2 A;  3A7O A;  2WSC H;  4WY4 B;  2ZFC A;  3PP5 A;  1CSB A;  2H43 A;  2WIT A;  2WZ7 A;  5BVZ A;  1E5W A;  1YYC A;  4N6J A;  3TYY A;  3RL0 B;  1LT9 B;  3T97 A;  3P8C D;  3RK3 C;  1G2C B;  1NH4 A;  1A02 J;  5CCG C;  1RF0 C;  1S9K E;  1SVF A;  3HUS C;  5AVU B;  3A2A A;  2FKW B;  3P8M C;  1IFJ A;  1N73 A;  1XTC C;  1SQV K;  1SQX K;  1L4A C;  3M0A A;  3N4X A;  3OA7 A;  3KPE A;  4M3L A;  4AUW A;  1G2C A;  1FJK A;  1IFM A;  1MUU A;  1Z56 A;  3NMD A;  1FOS E;  1LTJ C;  1FZE A;  4WB4 A;  1NTM K;  4WY4 D;  3V2P A;  4GIF A;  4JF7 A;  1MFZ A;  1QL2 A;  2R5B A;  2R3C A;  1RF1 C;  3RL0 D;  2C0X A;  4C7N A;  3A5T A;  1URQ C;  3GHG C;  1GZL A;  1ZV8 A;  2KYV A;  2J58 A;  1H89 A;  5CJ4 A;  1SFC C;  5APS A;  2GUS A;  1IC2 A;  3VN0 A;  1ZR4 A;  3H6P A;  3U59 A;  3V2R A;  1L4A B;  3TNU A;  4EIJ A;  5CCG A;  4LLH A;  5AW9 B;  1RF0 A;  5AVZ B;  3HRN A;  3HUS A;  1N2D C;  1NKN A;  1GW4 A;  2W6A A;  1N7S C;  2IX7 C;  1L4A A;  4KHX A;  1T8Z A;  2C0W A;  1JUN A;  1GU5 A;  1JOC A;  3V2Q A;  2O1K A;  2Q5U A;  3HTK B;  1FZC B;  1KIL C;  5AVR B;  3RK2 B;  1LTJ A;  2FYU K;  1L0N K;  1QL1 A;  1VDF A;  2JEE A;  2MJZ A;  2ZXE B;  1IJD B;  3EQ2 A;  4ZKU A;  2OYI B;  1CI6 B;  2WPR A;  3M9Q A;  2HFE D;  3BRV B;  4WBA A;  3P8C E;  1LTB C;  2Q7C A;  4LGD E;  1DX7 A;  1L4A D;  1RF1 A;  5AW3 B;  1HWT C;  2QM7 A;  2WT7 A;  3L36 A;  1LTT C;  1RE3 C;  1GL2 B;  1H88 A;  1URQ A;  3GHG A;  1FOS F;  1XTG B;  3MIW A;  1JO5 A;  1T3J A;  1ZR2 A;  2YKP A;  1MZ9 A;  2XKM A;  1SFC A;  1CI6 A;  1HUC A;  1IFD A;  1JTH A;  4O9B A;  5CCH D;  5KJ7 C;  2YKQ A;  2KP8 A;  2Z5I A;  2OAR A;  3RK2 D;  3B5N D;  3OJA B;  2XZR A;  2R5D A;  2PP6 A;  4C46 A;  1NTK K;  4DOJ A;  3HE5 A;  1N73 B;  1GK6 A;  5AW8 B;  1N7S A;  1NAF A;  3VOP A;  4AYC A;  4AQR D;  2O1J A;  1FZG A;  2XNX A;  1FZA A;  3H32 A;  2XV5 A;  2Z5H A;  3M9B A;  1CW5 A;  3HD7 C;  1KIL A;  1SLQ A;  1GL2 D;  1GD2 E;  2WPQ A;  4ZKP A;  2J59 M;  2A45 I;  1ZLL A;  3CL3 D;  5CMZ A;  2YMY A;  3LW5 H;  3NFQ A;  1J1E B;  5APT A;  5AW0 B;  1N86 A;  2HG5 D;  5KLV K;  2YO3 A;  3UIA A;  2WSE H;  5AVT B;  4C7N B;  3HE4 B;  1FZF A;  1HGZ A;  1RE3 A;  1GDT A;  2PAJ A;  2C9N Y;  4I1L A;  2POH A;  1NTZ K;  3N7N A;  1VPC A;  3C9I A;  1NO4 A;  4OH8 B;  1J2J B;  2N1T C;  2GUV A;  2KLV A;  3KQG A;  3OAK A;  1X9V A;  5AVX B;  2R32 A;  3HE4 A;  3TNU B;  2IFM A;  5KJ7 A;  2IPP A;  3RK3 B;  1GW3 A;  5KTB A;  3SWF A;  1SP4 A;  3HUS B;  2NPS C;  3VYI A;  5AW5 B;  2OYH C;  1NKZ B;  2WSF H;  1J1D C;  4N3Y B;  3BAS A;  2JJL A;  1T2K D;  5CHX A;  2CPS A;  3NTN A;  3P7K A;  2E42 A;  5APY A;  1PFI A;  3I5C A;  1DH3 A;  2A45 H;  1JY3 O;  1FBM A;  3HD7 A;  3L35 A;  4Y99 C;  1ZN5 A;  1JCD A;  1LTJ B;  2FFD C;  2Q9I A;  1HVV A;  1JCC A;  3MGN A;  1IK9 A;  5APV A;  1NWQ A;  1FZB A;  2I1K A;  4XA4 A;  3M0D C;  1LWU C;  1H8A A;  2W27 A;  2WTY A;  1RF1 B;  3O8Z A;  2WT7 B;  3U1C A;  3RK3 D;  1LGH B;  1KFM A;  3BAT A;  1L0L K;  1URQ B;  3GHG B;  5CCG D;  2YO2 A;  1W2E A;  2HLO A;  2HOD A;  1KQL A;  2P2U A;  1SFC B;  3B8E B;  2OYH B;  2L5G B;  4W7Z A;  2YNY A;  2WPS A;  3SWY A;  2CPB A;  3V5B A;  2N1T A;  1NU1 K;  1G1I A;  1JTH B;  2GM4 A;  4XE5 B;  2Z4E A;  5APU A;  4WY4 C;  4RES B;  3MTU E;  2NPS A;  5APW A;  2BAS A;  1LTA C;  2OYH A;  3VMY A;  2FFD B;  1M1J C;  1RY3 A;  3HE5 B;  2W6B A;  3RL0 C;  1LT9 C;  1N7S B;  4EOT A;  2IFN A;  2O01 H;  2HYN A;  3LID A;  3R2P A;  3H32 B;  1LWU B;  3MD0 A;  1KIL B;  5APX A;  3CI9 A;  1OXZ A;  2VRS A;  1URQ D;  3TK1 A;  3V4W A;  2FFD A;  2FXM A;  2P1J A;  1SFC D;  2XU6 A;  1FU1 A;  3U1A A;  3KDP B;  2N9B A;  5APQ A;  5CJ0 A;  3VP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...