1LTBC

2.6 angstroms crystal structure of partially-activated e. coli heat-labile enterotoxin (lt)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
41
structure length
41
Chain Sequence
GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Enterotoxin
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
publication title Structure of partially-activated E. coli heat-labile enterotoxin (LT) at 2.6 A resolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 16
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1993-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltbC00
1LTTC 1LTSC 1XTCC 1LTIC 1HTLC 1LTBC 1LTAC 1LTGC
chains in the Genus database with same CATH superfamily
2YMKA 3L70D 3H1IE 2A45G 3H1HE 1JCCA 1M1JA 2YKQA 1OZHA 1H8AA 3GW6A 1JTHA 1M1JB 3A0BE 2PGDA 1GW3A 2QEXP 1JNMA 1JTHB 2Y0CA 1L0LE 3GLMA 1N73C 4I6MC 5AW7B 3CX5E 2V7QJ 5E79H 3H1LE 3II6A 4L75A 3H1KJ 1VF5B 3W67A 1K05A 1KMIZ 2HYNA 2OYIC 1QEXA 3H1IJ 2PFXA 5B5EE 3H1HJ 2FYNC 3GG2A 4O9BA 2IBZG 4XFJA 2KSJA 1NGMB 3HRNA 1RE3A 1JY3O 3CXHI 1KQFB 1KYOI 3HE5A 3C8VA 2Y0DA 4JQ0D 1L0LJ 4K3AA 3HE5B 5BU8B 1YJ9P 4DJGA 1FZGA 3HD7D 1BE3D 1Q82Q 3H1LJ 2Q5UA 1YYCA 2QSIA 3Q1MA 1NKNA 1LWUA 1Y8AA 2FYUE 2KOGA 3AE9C 1LWUB 1N7LA 2ZYAA 1AV1A 3GMAA 3HTKA 4UB8H 1K8AQ 3CWBD 3B8EB 1RF0C 1USEA 3N7NA 3EWKA 1M1KQ 1JB0J 3HTKB 3GHGA 5CCGC 4L73A 2KSEA 3TK1A 3L72E 3Q3DA 5AW2B 3GHGB 1L0NE 3KHUA 4IFFA 2QJYB 2M0BA 4W7YA 1OIPA 1LTJC 2N1TD 3WU2E 1PPJE 2FYUJ 3L35A 3M9HA 3TGUG 1SS1A 1FS0E 3CCRP 2Q1KA 4N3YB 3C9IA 2PAJA 5AW5B 1OX3A 3HD7A 4UB6H 4DOJA 1DD3A 1M8OB 3L72J 3AEEC 3HD7B 1L0NJ 1SQBK 2ZJSE 3AECC 2KI7B 1YHQP 1J1DC 1SQBG 4GKGA 2GUSA 3BASA 1FOSF 3ZDMA 3MP7B 1MZ9A 3BCCE 5APQA 3CXHD 2P1JA 1HWTC 1R5SA 4WWIA 1BE3G 1LTSC 1USDA 1FZCA 1SQVD 1YQ3C 5CJ0A 2W8ZA 1FZCB 5H2FH 2O1JA 5AVSB 1PGPA 4IFDK 2YIUC 3BCCD 3LIEA 3CWBG 1NAFA 3L75E 2KNCA 3P8CE 4ASWA 2H88C 4H13C 4YXDC 2KNCB 1AVOA 2AEFA 4K35A 5EFWB 3CCQP 1OMIA 5AVWB 1JY3P 1BSHA 4OH8B 3VMYA 4C46A 1NO4A 1T3UA 2WMMA 1KB9I 2XNXA 1LGHB 2OYHA 4XA4A 3P8CD 1G1JA 2K88A 5KAIH 1NU1K 4GOFA 1NTZD 1MFZA 3L75J 1L4AC 2OYHB 1NU1G 3R2PA 3CL3D 3B71A 3WMM0 3B4SA 5L8RJ 3WUTA 3AEGC 5AW0B 1P84D 3W68A 3JCUH 4YTPC 1EDJA 1SLQA 4RO0A 2UWJE 5GTHH 1S5LE 3JSVC 1SQPE 1QLED 3NTNA 4B86A 2A45H 3D70A 1URQC 2N9BA 2KLVA 4QMAA 1N7SC 1ZRTE 1SQVG 1LT9C 3H1JD 2FYZA 4I7ZB 3M06A 1SP4A 3PTZA 2HODA 5AW1B 5KAIE 5GTIE 2HODB 4OGQC 1G2CA 5K5GB 1SQPJ 4GDOA 4PD4H 1N8RQ 1G2CB 4GIFA 4DT0A 2QIWA 1ZRTD 5CCGD 5APTA 4D6TE 2W6JH 1KORA 3RBXA 4WY4C 1ZMEC 1JUNA 2E74C 3G9RA 1IK7A 1NAYA 2O01N 3G4SP 3VP8A 1FZFA 4KJMA 4R4LA 2C0WA 3B5ND 1FZCC 1S9KD 4JYBA 2J5UA 2FYNB 2POHA 1U7JA 1S3JA 4I1LA 1AA0A 1NTZG 1ZR4A 3U1AA 3A2AA 1SQXD 1IZNB 4ZNCA 1GL2D 1QL1A 3I55P 1NTKK 1RE4A 4D6TJ 3SWYA 2HFED 1NTKG 2PP6A 3VMXA 2NPSA 5BVZA 3S9OA 1RHZB 1FBMA 3RBZA 4Y99C 2WSCH 1MUUA 2NPSB 3MUDA 3S1KA 1EC5A 1CW5A 2JJLA 5KTBA 3AE7C 1JEKA 5TISH 1LTBC 3VMZA 2M8RA 1H88A 2IYOA 1KN7A 1JY3N 1RF0A 2IPPA 3IFMA 3VN0A 3BRTB 1FZAA 1BCCE 5CCHC 1HJBA 2RMZA 3CX5I 1M90Q 4IL6X 3L73G 2OYHC 1TU3F 1SQQK 3AE8C 1M56D 1YITP 1LTJA 1OVVA 5APYA 3NXSA 1SQQG 1FOSE 2MKVA 2IZ0A 2R32A 4JPZB 3SWFA 1LTJB 2YNYA 1GW4A 2E5YA 5KJ7C 1BCCD 2OTKE 4EDFA 4L74A 3RK3C 1JY2P 2QJPC 1BCCJ 3CCMP 1CI6A 1IO4A 2LKMA 1CSBA 4OWFA 2E75C 1BGYE 2K9JA 1CI6B 1HGVA 2WVRA 5B66H 1NHLA 5CHXA 3QWOC 2CPBA 1PL5A 2W27A 2R44A 1SQXG 3KZIE 3AE5C 1J1DB 1PGQA 1FZEA 1BDDA 1KQGB 2WSCJ 5KLVE 3CMAP 1FE6A 3H1KD 1RQUA 4U3FE 1VQNP 3UIAA 1L2PA 2OTJP 1MKMA 1IFJA 1PP9G 3H1ID 2QG4A 2BCCG 3IR9A 1BGYJ 3H1HD 2FBWC 3L36A 1ZW0A 1WMKA 3FX0A 4KHXA 2Q3IA 1SQBE 1URQD 4HB1A 2YIUB 3D6ZA 2B87A 3CD6P 3AE3C 4H44C 5KLVD 2FY8A 2O1KA 4RKUJ 3V6IA 1NTME 2B87B 1L0LD 3U59A 5B66E 3CC2P 1EZVE 4H13B 3NMDA 5M1BA 3CX5D 5KLVJ 4DZOA 1OXZA 2E5TA 2W83C 2XV5A 3H1LD 2B88A 3MTUE 4U3FJ 5C39A 1FC2C 2ZT9B 1RE4C 4LLHA 2VRSA 4BRYA 2RKLA 3AE6C 2C9LY 2NPSC 4BRYB 3GF7A 1M57D 3H6PA 3MUDC 1SQBJ 1NTMD 1L4AA 1XTCC 4WY4D 3M0AA 5E79E 1VQ7P 2XNDH 2E74D 1EZVD 1VL2A 2WSFH 2E76C 1L4AB 3RL0C 1NTMJ 4WBAA 3MHVA 4N6JA 4U7JA 2QJKC 3CXHH 3L70G 1KYOH 2R3SA 4MN4C 2QM8A 1GK4A 5KKZC 1HBWA 2FYUD 3FXEA 2P58A 3A7OA 1URQA 1Y47A 2KZIA 1N7SA 1VQ4P 1URQB 1LT9A 2H43A 3T97A 1M7LA 3H1KG 1KILE 1NU1E 2K3RA 5APSA 1N7SB 2P67A 1LT9B 3T97B 1X8YA 2H89C 3CPWO 1DEEG 2L5GB 2YKOA 2QVAA 3H1HG 3L72D 2HG5D 3G6EP 1P84I 5AW3B 1L0ND 3L71E 1J1EC 5KAFH 4OGQB 1PPJD 4UB8E 3NFQA 3OA7A 3CC7P 2W90A 1L0LG 4WY4A 3RK3E 2OQQA 5AVZB 1CZQA 3H1LG 3M0DC 4WY4B 1NU1J 1PZQA 2E74B 3ITKA 1JO5A 2O3JA 3AEBC 4RESB 4PJ0H 3CCSP 4EI2A 5BU5A 1DH3A 3SWKA 3L71J 5APWA 3FXDA 2IFMA 3V5BA 1EXJA 4ZMDA 5AVYB 3RK3D 1OW8A 2K9YA 2KP8A 2YO3A 4UB6E 1DIPA 5KAFE 1LTTC 3VYIA 4KT0J 4BXLA 4NPFX 4Y99B 1ZXGA 1PGOA 2FYUG 2W6AA 1NKZB 2ZT9C 1BSNA 2R5BA 1K04A 2IDBA 1JM0A 3CMEP 1GDTA 1KILA 3L75D 5CCHA 1S5LX 5AVXB 1OVRA 2D2CC 3Q5RA 1PFIA 2A06E 4N78E 2NRGA 1YBKA 2KYVA 1KILB 3HUSA 3I56P 4YPCA 2FFDA 5H2FE 1N86A 2IZ1A 3FGAD 3CC4P 1KC8Q 2H7HA 1EQ7A 5AVRB 3CCLP 3SFEC 3L74E 1PGJA 1PPJG 1LTGC 4Y28J 2RH0A 3WUVA 4C7RA 1A02F 3MGNA 1JY2O 2IYPA 4H44D 5KJ7A 1VQ9P 4I2LC 4N78D 4IOIH 4NPDA 2K1AA 1YTZT 3RK3B 1KB9H 1SQVK 4HJGH 3L73E 2ZYGA 2PRRA 2QJPB 5CBOA 1NTKJ 2LXCB 2E75B 1GU5A 2NPSD 2ITAA 3L74J 2JEEA 3RGUA 1SQPD 4W80A 3CCEP 1VQ8P 2ZXEB 1HH0A 3F5HA 3AEFC 3BCCG 4C7NA 1G1IA 1AQ5A 3KQGA 1SFCA 1H0TA 2E76D 3RL0D 2B9BA 1LT1A 3MZWB 4C7NB 2KS1A 2C0XA 3BVHA 3JCUE 4AYCA 2WSEH 3AE1C 3BRVB 3L73J 1X0TA 5GTHE 3P32A 2KS1B 5DJTB 2XDJA 1Z56A 2I1JA 1OVUA 1Q86Q 1SQQJ 2M3BA 3ABVC 5KLIC 1AJYA 1NTZK 1S1CX 2B89A 1OW7A 2WWWA 5CBNA 4Z1MH 2NZ2A 3CCJP 1IC2A 1FJPA 4H44B 1W2BO 4D6TD 1FJKA 2AXTH 2M5AA 2CK3H 4R4MA 2W6BA 4WB4A 3TSIA 1PP9E 1D7MA 2BCCE 1FDOA 4PD4E 2HLOA 1NJIQ 4BWNA 3RK2B 5CJ4A 2N1TC 3USSA 2I1KA 3O6QA 2IBZE 1VQKP 3EFGA 2JP3A 2Q3EA 3O6QB 1K9MQ 3V2RA 4IL6H 1ZN5A 2E76B 3RL0B 1HTLC 3H1JG 3AE2C 1KILC 2QJKB 1PIXA 2G8YA 4JYCA 1Q2NA 1PP9J 1JMMA 1SQPG 3HUSC 2FFDC 2BCCJ 2HPCA 5KKZB 1W5CE 4HKZH 2IBZD 1QVFO 2HPCB 1RF1A 2WSEJ 3KPEA 2Q9IA 2FXPA 3A0BH 1WRGA 1QVGO 3V2PA 4TT3H 3E7KA 1EZVI 3KDPB 4H13D 1QX8A 2WZ7A 1AVYA 2ZYDA 3FWNA 1U57A 5TISE 2ZT9D 3EFFK 3VP9A 2GA1A 2OGUA 1Q7YQ 2YKPA 4PV1C 3CX5H 5AW9B 3GF3A 5TJHA 1J1EB 2Y9YA 3TYYA 1Q81Q 1RY3A 1SQXK 2M3EA 5APXA 3CI9A 1QL2A 5CMZA 2K9JB 2D2CD 3Q5SA 4D6TG 3CCUP 2JKVA 1YQ4C 1GD2E 2KK7A 3M0DA 4JF7A 1JMBA 1S2EA 1L4AD 1IFNA 3TGUE 1FU1A 2OTLP 4A7PA 1SFCC 1XTGB 1R5LA 1BGYD 3L70J 2AXCA 1YI2P 1LTIC 4AQRD 1KQSO 1EDLA 2Y9ZA 2ZAEB 3VOPA 3SSUA 3Q5PA 3V2QA 2KXPB 2JR8A 2XU6A 3TGUD 4H0LC 1NH4A 1FDIA 2R3CA 1N7SD 1W2EA 2Z4EA 3L4FA 3OJAB 4U3FD 3TGUJ 2OYOA 4NPEA 1BDCA 4L76A 1BE3E 2P10A 2QA4P 2V4HA 3JC22 2KUBA 3EQ2A 3V4WA 3C1LA 2H8PD 4OGQD 2J59M 2WTYA 3H32A 3RK2C 1SQBD 1IFIA 2LXBA 3H32B 3WU2H 1BCCG 1OFCX 3CWBE 3AEDC 3LIDA 4WVZA 2D2CB 3PP5A 3V4QA 1FZBA 2E43A 4W7ZA 1MV8A 2BEZF 3D71A 1LNQA 1A02J 1AQTA 2KLUA 3V2NA 1GU4A 1VQMP 1BE3J 1VDFA 3HE4A 1FAVA 2Q7CA 2ZVOB 1IFPA 2JWAA 3HE4B 3M9BA 2QRXA 2SPZA 2LR2A 2BASA 3IF4A 3E1IA 2MJZA 1E5WA 1WT6A 1IFMA 3CWBJ 1RF1C 2O01H 1BGYG 3MIWA 3AE4C 1KV4A 1J2JB 3H1IG 4ZKPA 1EXIA 1X79B 3B5NC 3SFDC 1X22A 1JY2N 4RJTA 3H25A 5KLVK 2KZJA 2WSSH 1KFNA 1L0LK 3F89A 3MD0A 1GL2C 5KLVG 4ZKUA 1YTZI 3CXHE 1KILD 1KYOE 4U3FG 4GOEA 1NU1D 5CCHD 1DX7A 4XE5B 3WUUA 1T3JA 1GMJA 5DJUB 5APUA 1SQVE 3CLQA 3A3YB 3L71D 2KIKA 4ASVA 1M1JC 1NTMK 2N9YB 3FWLA 1PV3A 1P84H 5KLIB 2YO2A 5KJ7D 1KYOD 1NTMG 2WSFJ 4TLFA 2QE7H 1EZVG 1GK6A 1T2KC 2G3AA 2BEQD 2YXRB 1VF5C 4PV1D 4LC1A 2E75D 3PH0A 1SQVJ 3A0HH 2FYUK 1S72P 4EIJA 1DD4A 2N1TA 1NYHA 1K73Q 4HH2A 2N1TB 3S4RA 2GM4A 1NOHA 2RN0A 2O01J 3TDKA 3TNUA 1S5LH 3VTPC 5AVQB 5AVUB 3BCCJ 1NTZE 2WPRA 1S4XA 3TNUB 1KFMA 1SFCD 1RE3C 4PJ0E 2Z5IA 3AEAC 2Y0EA 5AW6B 3U1CA 2FXOA 2FXMA 3D6YA 3LW5H 1HUCA 1L0NK 2GUVA 2JDIH 3M91A 1P84E 1VQLP 1NTKE 3L72G 3PHLA 1VQOP 1L0NG 2A45I 3HUSB 2Q6QA 2FFDB 1Q90D 1GZLA 1LWUC 2CPSA 3E1RA 1VQPP 4H0LD 5GTIH 5APVA 1YIJP 1LP1A 3A0HE 1JOCA 2DW3A 2I8DA 1NTZJ 2A06D 1LP1B 3H1JE 1NTKD 1RQVA 3G71P 1E79H 1OW6A 2WT7A 4AUWA 2J58A 3GHGC 3L71G 3PLNA 2Z5HA 4PD4I 1IJDB 2QJYC 3L74D 2WT7B 4PV1B 1UIIA 2KB7P 3RK2D 3G3ZA 5AVTB 2P7JA 3PJSK 1SQQE 2IBZI 1JCDA 4YXWH 1QGKB 1GTWA 2WPQA 1KTMA 5AVVB 2HR3A 1U7MA 3OAKA 3K5BA 3L73D 1EDIA 1HGZA 3PRJA 1SFCB 1UIXA 1NVOA 2WPVB 3H1JJ 2K37A 3IN6A 1H0TB 1T6AA 4CPGA 2WPSA 4DCKA 1OWAA 3HD7C 1EDKA 1SQQD 1VQ6P 4LGDE 5AW8B 4M3LA 1S9KE 1KZUB 2WQYC 1HF9A 3CCVP 1N73A 1KB9E 3OW2O 2AEJA 1SQXE 3LW5J 2C9NY 3L75G 2P2UA 1VPCA 4H0LB 1N73B 4IFMA 1SVFA 2OYIA 2AEMA 4GODA 2XKMA 2OYIB 1RH5B 1LTAC 3L37A 3VMAA 2M5AB 1FDMA 1HVVA 1X9VA 3KXDA 1KB9D 1KQLA 3N4XA 1ZP0C 3I5CA 1IFDA 3IAOA 2IX7C 1ZV8A 2A06G 3O8ZA 3P8MC 3R4YA 4HYTB 1SQXJ 1H89A 1YJNP 3TF5A 1PP9D 3L74G 1Y9BA 1MFTA 2YMYA 2BCCD 1SQPK 3KYQA 2FKWB 4PD4D 2V7QH 2L91A 2XZRA 2E42A 2ZVNB 4GT1A 5AW4B 1IK9A 2AXTE 2YXQB 1ZOYC 5CCGA 1T2KD 2ZXXA 1AFOA 3QH9A 1DEBA 1KD1Q 3KZIH 2OARA 1VF5D 1T8ZA 1NWQA 1N2DC 2R5DA 1YJWP 1RF1B 3P7KA 1ZLLA 3A5TA 3B5NA 3M9QA 2JWDA 3L70E 2WITA 1ZR2A 3B5NB 3Q2YA 2QM7A 3BATA 4EYYQ 1R8EA 4EOTA 1GL2A 4IL6E 2IFNA 1VQ5P 4JBZA 5B5EH 1GL2B 3RL0g 1LJ2A 4OVNF 2ZFCA 2JO1A 3H1KE 4I7ZC 1HJ0A
chains in the Genus database with same CATH topology
1GDTA 1E5WA 3B5ND 1FZCC 1WT6A 1S9KD 1IFMA 4JYBA 1RF1C 1KILA 2O01H 5CCHA 5AVXB 2POHA 2A45G 3MIWA 1JCCA 1M1JA 2YKQA 4I1LA 1ZR4A 1PFIA 3U1AA 4N78E 2KYVA 1J2JB 1KILB 3HUSA 3A2AA 1H8AA 1JTHA 4ZKPA 1GL2D 2FFDA 1M1JB 1N86A 1QL1A 1NTKK 1X79B 1GW3A 1JNMA 2H7HA 3B5NC 1EQ7A 1RE4A 1JTHB 1JY2N 5AVRB 3SWYA 2HFED 2PP6A 3VMXA 1LTGC 5KLVK 2NPSA 5BVZA 4C7RA 1FBMA 1A02F 1KFNA 4Y99C 3MGNA 1N73C 1L0LK 3MD0A 1GL2C 1JY2O 2WSCH 4I6MC 5AW7B 1MUUA 4ZKUA 5KJ7A 1YTZI 2NPSB 3MUDA 3II6A 1CW5A 1KILD 2JJLA 5KTBA 5CCHD 1DX7A 4I2LC 4XE5B 1LTBC 2HYNA 3VMZA 2M8RA 4N78D 1H88A 2OYIC 1T3JA 5APUA 1YTZT 3RK3B 3CLQA 1SQVK 4O9BA 1JY3N 1RF0A 2IPPA 3IFMA 3VN0A 3A3YB 3BRTB 2KSJA 1FZAA 5CCHC 1HJBA 3HRNA 1M1JC 1RE3A 1GU5A 2OYHC 2NPSD 1JY3O 1NTMK 3HE5A 1SQQK 2JEEA 2YO2A 4W80A 5KJ7D 2ZXEB 1HH0A 1LTJA 3HE5B 5BU8B 5APYA 3NXSA 1FOSE 1FZGA 3HD7D 1GK6A 4C7NA 1T2KC 1G1IA 2R32A 1AQ5A 3KQGA 3SWFA 2Q5UA 1SFCA 1YYCA 1LTJB 3RL0D 2YNYA 1GW4A 1NKNA 4C7NB 1LWUA 4LC1A 2KOGA 2C0XA 3BVHA 5KJ7C 2FYUK 4AYCA 4EIJA 2N1TA 2WSEH 3RK3C 1LWUB 3BRVB 1N7LA 3P32A 1JY2P 2XDJA 1Z56A 4HH2A 2N1TB 3HTKA 2GM4A 1CI6A 1IO4A 3B8EB 1NOHA 1RF0C 2LKMA 1CSBA 2I1JA 3N7NA 3TNUA 3VTPC 5AVQB 5AVUB 3HTKB 5CCGC 3GHGA 2WPRA 1CI6B 2M3BA 1NTZK 1HGVA 3TNUB 1KFMA 1SFCD 1RE3C 2WWWA 3TK1A 2Z5IA 1NHLA 5AW2B 3GHGB 5CHXA 1IC2A 5AW6B 3U1CA 1FJPA 2CPBA 2FXMA 2W27A 3LW5H 4IFFA 1HUCA 1L0NK 1FJKA 2GUVA 1J1DB 3M91A 4W7YA 1LTJC 2W6BA 2N1TD 4WB4A 3TSIA 3L35A 1FZEA 2A45I 3HUSB 2FFDB 3M9HA 1GZLA 1LWUC 2CPSA 2HLOA 3UIAA 1IFJA 3RK2B 5CJ4A 2N1TC 5APVA 4N3YB 3C9IA 2PAJA 3IR9A 2I1KA 5AW5B 1JOCA 3L36A 3HD7A 3EFGA 4DOJA 4KHXA 2Q3IA 1URQD 3V2RA 2WT7A 3HD7B 4AUWA 1SQBK 2J58A 3GHGC 1ZN5A 2Z5HA 3RL0B 1HTLC 1IJDB 2WT7B 1KILC 1J1DC 2KB7P 2O1KA 4GKGA 2GUSA 3RK2D 3G3ZA 5AVTB 3BASA 2P7JA 4JYCA 3U59A 1FOSF 1JMMA 3HUSC 3NMDA 1MZ9A 4DZOA 1OXZA 5APQA 1JCDA 2XV5A 2FFDC 2HPCA 2P1JA 3MTUE 1HWTC 1GTWA 2WPQA 1RE4C 4LLHA 2VRSA 5AVVB 1LTSC 1FZCA 2HPCB 1RF1A 3OAKA 2C9LY 2NPSC 3KPEA 2Q9IA 5CJ0A 1HGZA 1FZCB 1WRGA 1SFCB 2O1JA 3V2PA 5AVSB 3H6PA 1L4AA 3KDPB 1XTCC 2WZ7A 4WY4D 3M0AA 4IFDK 2WPSA 1OWAA 3HD7C 4LGDE 5AW8B 2WSFH 4M3LA 3LIEA 1L4AB 3RL0C 1S9KE 3VP9A 1NAFA 1KZUB 4WBAA 4N6JA 2YKPA 5AW9B 3P8CE 1N73A 1J1EB 3TYYA 2C9NY 2P2UA 1RY3A 2QM8A 1SQXK 1VPCA 1GK4A 1N73B 5APXA 3CI9A 1QL2A 1HBWA 5CMZA 4IFMA 1SVFA 2OYIA 1GD2E 3A7OA 5AVWB 3M0DA 4JF7A 2XKMA 1JY3P 1URQA 1L4AD 2OYIB 1IFNA 4OH8B 3VMYA 1LTAC 3L37A 4C46A 1NO4A 1FU1A 1N7SA 1T3UA 1URQB 1LT9A 1SFCC 1XTGB 2H43A 1FDMA 3T97A 1HVVA 1M7LA 2XNXA 1LGHB 1X9VA 2OYHA 4XA4A 3P8CD 1G1JA 5APSA 1N7SB 2P67A 1KQLA 1NU1K 1LT9B 3N4XA 1MFZA 1X8YA 1LTIC 4AQRD 3I5CA 1IFDA 2L5GB 2YKOA 1L4AC 2OYHB 2IX7C 1ZV8A 2HG5D 3R2PA 5AW3B 3O8ZA 3CL3D 3P8MC 3WMM0 3VOPA 4HYTB 1J1EC 3V2QA 1H89A 5AW0B 2XU6A 1NH4A 3NFQA 1SLQA 2R3CA 3OA7A 1N7SD 1W2EA 2Z4EA 2YMYA 3L4FA 1SQPK 3KYQA 2FKWB 4WY4A 3OJAB 3NTNA 4B86A 2XZRA 5AVZB 1CZQA 2A45H 2E42A 3M0DC 4WY4B 1URQC 4GT1A 5AW4B 1IK9A 2N9BA 2KLVA 3EQ2A 3V4WA 1JO5A 4RESB 2H8PD 5CCGA 1N7SC 2J59M 2WTYA 1LT9C 1T2KD 1AFOA 3H32A 5BU5A 3RK2C 1DEBA 1IFIA 2FYZA 1DH3A 2OARA 3M06A 1T8ZA 1NWQA 1SP4A 5APWA 2HODA 1N2DC 3H32B 5AW1B 2R5DA 1RF1B 2IFMA 3V5BA 3P7KA 3LIDA 5AVYB 3RK3D 2HODB 3PP5A 1ZLLA 3V4QA 1G2CA 1FZBA 3A5TA 3B5NA 3M9QA 2E43A 4W7ZA 1MV8A 2KP8A 2WITA 2YO3A 1G2CB 1ZR2A 3B5NB 4GIFA 1A02J 1LTTC 3V2NA 1GU4A 2QM7A 3BATA 5CCGD 5APTA 4EOTA 1GL2A 1VDFA 3VYIA 3HE4A 2IFNA 4WY4C 1JUNA 4Y99B 1FAVA 2Q7CA 2W6AA 1GL2B 1NKZB 3HE4B 3M9BA 3VP8A 2BASA 2ZFCA 3E1IA 2R5BA 2MJZA 1FZFA 2C0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTT C;  1LTS C;  1XTC C;  1LTI C;  1HTL C;  1LTB C;  1LTA C;  1LTG C; 
#chains in the Genus database with same CATH topology
 2YMK A;  3L70 D;  3H1I E;  2A45 G;  3H1H E;  1JCC A;  1M1J A;  2YKQ A;  1OZH A;  1H8A A;  3GW6 A;  1JTH A;  1M1J B;  3A0B E;  2PGD A;  1GW3 A;  2QEX P;  1JNM A;  1JTH B;  2Y0C A;  1L0L E;  3GLM A;  1N73 C;  4I6M C;  5AW7 B;  3CX5 E;  2V7Q J;  5E79 H;  3H1L E;  3II6 A;  4L75 A;  3H1K J;  1VF5 B;  3W67 A;  1K05 A;  1KMI Z;  2HYN A;  2OYI C;  1QEX A;  3H1I J;  2PFX A;  5B5E E;  3H1H J;  2FYN C;  3GG2 A;  4O9B A;  2IBZ G;  4XFJ A;  2KSJ A;  1NGM B;  3HRN A;  1RE3 A;  1JY3 O;  3CXH I;  1KQF B;  1KYO I;  3HE5 A;  3C8V A;  2Y0D A;  4JQ0 D;  1L0L J;  4K3A A;  3HE5 B;  5BU8 B;  1YJ9 P;  4DJG A;  1FZG A;  3HD7 D;  1BE3 D;  1Q82 Q;  3H1L J;  2Q5U A;  1YYC A;  2QSI A;  3Q1M A;  1NKN A;  1LWU A;  1Y8A A;  2FYU E;  2KOG A;  3AE9 C;  1LWU B;  1N7L A;  2ZYA A;  1AV1 A;  3GMA A;  3HTK A;  4UB8 H;  1K8A Q;  3CWB D;  3B8E B;  1RF0 C;  1USE A;  3N7N A;  3EWK A;  1M1K Q;  1JB0 J;  3HTK B;  3GHG A;  5CCG C;  4L73 A;  2KSE A;  3TK1 A;  3L72 E;  3Q3D A;  5AW2 B;  3GHG B;  1L0N E;  3KHU A;  4IFF A;  2QJY B;  2M0B A;  4W7Y A;  1OIP A;  1LTJ C;  2N1T D;  3WU2 E;  1PPJ E;  2FYU J;  3L35 A;  3M9H A;  3TGU G;  1SS1 A;  1FS0 E;  3CCR P;  2Q1K A;  4N3Y B;  3C9I A;  2PAJ A;  5AW5 B;  1OX3 A;  3HD7 A;  4UB6 H;  4DOJ A;  1DD3 A;  1M8O B;  3L72 J;  3AEE C;  3HD7 B;  1L0N J;  1SQB K;  2ZJS E;  3AEC C;  2KI7 B;  1YHQ P;  1J1D C;  1SQB G;  4GKG A;  2GUS A;  3BAS A;  1FOS F;  3ZDM A;  3MP7 B;  1MZ9 A;  3BCC E;  5APQ A;  3CXH D;  2P1J A;  1HWT C;  1R5S A;  4WWI A;  1BE3 G;  1LTS C;  1USD A;  1FZC A;  1SQV D;  1YQ3 C;  5CJ0 A;  2W8Z A;  1FZC B;  5H2F H;  2O1J A;  5AVS B;  1PGP A;  4IFD K;  2YIU C;  3BCC D;  3LIE A;  3CWB G;  1NAF A;  3L75 E;  2KNC A;  3P8C E;  4ASW A;  2H88 C;  4H13 C;  4YXD C;  2KNC B;  1AVO A;  2AEF A;  4K35 A;  5EFW B;  3CCQ P;  1OMI A;  5AVW B;  1JY3 P;  1BSH A;  4OH8 B;  3VMY A;  4C46 A;  1NO4 A;  1T3U A;  2WMM A;  1KB9 I;  2XNX A;  1LGH B;  2OYH A;  4XA4 A;  3P8C D;  1G1J A;  2K88 A;  5KAI H;  1NU1 K;  4GOF A;  1NTZ D;  1MFZ A;  3L75 J;  1L4A C;  2OYH B;  1NU1 G;  3R2P A;  3CL3 D;  3B71 A;  3WMM 0;  3B4S A;  5L8R J;  3WUT A;  3AEG C;  5AW0 B;  1P84 D;  3W68 A;  3JCU H;  4YTP C;  1EDJ A;  1SLQ A;  4RO0 A;  2UWJ E;  5GTH H;  1S5L E;  3JSV C;  1SQP E;  1QLE D;  3NTN A;  4B86 A;  2A45 H;  3D70 A;  1URQ C;  2N9B A;  2KLV A;  4QMA A;  1N7S C;  1ZRT E;  1SQV G;  1LT9 C;  3H1J D;  2FYZ A;  4I7Z B;  3M06 A;  1SP4 A;  3PTZ A;  2HOD A;  5AW1 B;  5KAI E;  5GTI E;  2HOD B;  4OGQ C;  1G2C A;  5K5G B;  1SQP J;  4GDO A;  4PD4 H;  1N8R Q;  1G2C B;  4GIF A;  4DT0 A;  2QIW A;  1ZRT D;  5CCG D;  5APT A;  4D6T E;  2W6J H;  1KOR A;  3RBX A;  4WY4 C;  1ZME C;  1JUN A;  2E74 C;  3G9R A;  1IK7 A;  1NAY A;  2O01 N;  3G4S P;  3VP8 A;  1FZF A;  4KJM A;  4R4L A;  2C0W A;  3B5N D;  1FZC C;  1S9K D;  4JYB A;  2J5U A;  2FYN B;  2POH A;  1U7J A;  1S3J A;  4I1L A;  1AA0 A;  1NTZ G;  1ZR4 A;  3U1A A;  3A2A A;  1SQX D;  1IZN B;  4ZNC A;  1GL2 D;  1QL1 A;  3I55 P;  1NTK K;  1RE4 A;  4D6T J;  3SWY A;  2HFE D;  1NTK G;  2PP6 A;  3VMX A;  2NPS A;  5BVZ A;  3S9O A;  1RHZ B;  1FBM A;  3RBZ A;  4Y99 C;  2WSC H;  1MUU A;  2NPS B;  3MUD A;  3S1K A;  1EC5 A;  1CW5 A;  2JJL A;  5KTB A;  3AE7 C;  1JEK A;  5TIS H;  1LTB C;  3VMZ A;  2M8R A;  1H88 A;  2IYO A;  1KN7 A;  1JY3 N;  1RF0 A;  2IPP A;  3IFM A;  3VN0 A;  3BRT B;  1FZA A;  1BCC E;  5CCH C;  1HJB A;  2RMZ A;  3CX5 I;  1M90 Q;  4IL6 X;  3L73 G;  2OYH C;  1TU3 F;  1SQQ K;  3AE8 C;  1M56 D;  1YIT P;  1LTJ A;  1OVV A;  5APY A;  3NXS A;  1SQQ G;  1FOS E;  2MKV A;  2IZ0 A;  2R32 A;  4JPZ B;  3SWF A;  1LTJ B;  2YNY A;  1GW4 A;  2E5Y A;  5KJ7 C;  1BCC D;  2OTK E;  4EDF A;  4L74 A;  3RK3 C;  1JY2 P;  2QJP C;  1BCC J;  3CCM P;  1CI6 A;  1IO4 A;  2LKM A;  1CSB A;  4OWF A;  2E75 C;  1BGY E;  2K9J A;  1CI6 B;  1HGV A;  2WVR A;  5B66 H;  1NHL A;  5CHX A;  3QWO C;  2CPB A;  1PL5 A;  2W27 A;  2R44 A;  1SQX G;  3KZI E;  3AE5 C;  1J1D B;  1PGQ A;  1FZE A;  1BDD A;  1KQG B;  2WSC J;  5KLV E;  3CMA P;  1FE6 A;  3H1K D;  1RQU A;  4U3F E;  1VQN P;  3UIA A;  1L2P A;  2OTJ P;  1MKM A;  1IFJ A;  1PP9 G;  3H1I D;  2QG4 A;  2BCC G;  3IR9 A;  1BGY J;  3H1H D;  2FBW C;  3L36 A;  1ZW0 A;  1WMK A;  3FX0 A;  4KHX A;  2Q3I A;  1SQB E;  1URQ D;  4HB1 A;  2YIU B;  3D6Z A;  2B87 A;  3CD6 P;  3AE3 C;  4H44 C;  5KLV D;  2FY8 A;  2O1K A;  4RKU J;  3V6I A;  1NTM E;  2B87 B;  1L0L D;  3U59 A;  5B66 E;  3CC2 P;  1EZV E;  4H13 B;  3NMD A;  5M1B A;  3CX5 D;  5KLV J;  4DZO A;  1OXZ A;  2E5T A;  2W83 C;  2XV5 A;  3H1L D;  2B88 A;  3MTU E;  4U3F J;  5C39 A;  1FC2 C;  2ZT9 B;  1RE4 C;  4LLH A;  2VRS A;  4BRY A;  2RKL A;  3AE6 C;  2C9L Y;  2NPS C;  4BRY B;  3GF7 A;  1M57 D;  3H6P A;  3MUD C;  1SQB J;  1NTM D;  1L4A A;  1XTC C;  4WY4 D;  3M0A A;  5E79 E;  1VQ7 P;  2XND H;  2E74 D;  1EZV D;  1VL2 A;  2WSF H;  2E76 C;  1L4A B;  3RL0 C;  1NTM J;  4WBA A;  3MHV A;  4N6J A;  4U7J A;  2QJK C;  3CXH H;  3L70 G;  1KYO H;  2R3S A;  4MN4 C;  2QM8 A;  1GK4 A;  5KKZ C;  1HBW A;  2FYU D;  3FXE A;  2P58 A;  3A7O A;  1URQ A;  1Y47 A;  2KZI A;  1N7S A;  1VQ4 P;  1URQ B;  1LT9 A;  2H43 A;  3T97 A;  1M7L A;  3H1K G;  1KIL E;  1NU1 E;  2K3R A;  5APS A;  1N7S B;  2P67 A;  1LT9 B;  3T97 B;  1X8Y A;  2H89 C;  3CPW O;  1DEE G;  2L5G B;  2YKO A;  2QVA A;  3H1H G;  3L72 D;  2HG5 D;  3G6E P;  1P84 I;  5AW3 B;  1L0N D;  3L71 E;  1J1E C;  5KAF H;  4OGQ B;  1PPJ D;  4UB8 E;  3NFQ A;  3OA7 A;  3CC7 P;  2W90 A;  1L0L G;  4WY4 A;  3RK3 E;  2OQQ A;  5AVZ B;  1CZQ A;  3H1L G;  3M0D C;  4WY4 B;  1NU1 J;  1PZQ A;  2E74 B;  3ITK A;  1JO5 A;  2O3J A;  3AEB C;  4RES B;  4PJ0 H;  3CCS P;  4EI2 A;  5BU5 A;  1DH3 A;  3SWK A;  3L71 J;  5APW A;  3FXD A;  2IFM A;  3V5B A;  1EXJ A;  4ZMD A;  5AVY B;  3RK3 D;  1OW8 A;  2K9Y A;  2KP8 A;  2YO3 A;  4UB6 E;  1DIP A;  5KAF E;  1LTT C;  3VYI A;  4KT0 J;  4BXL A;  4NPF X;  4Y99 B;  1ZXG A;  1PGO A;  2FYU G;  2W6A A;  1NKZ B;  2ZT9 C;  1BSN A;  2R5B A;  1K04 A;  2IDB A;  1JM0 A;  3CME P;  1GDT A;  1KIL A;  3L75 D;  5CCH A;  1S5L X;  5AVX B;  1OVR A;  2D2C C;  3Q5R A;  1PFI A;  2A06 E;  4N78 E;  2NRG A;  1YBK A;  2KYV A;  1KIL B;  3HUS A;  3I56 P;  4YPC A;  2FFD A;  5H2F E;  1N86 A;  2IZ1 A;  3FGA D;  3CC4 P;  1KC8 Q;  2H7H A;  1EQ7 A;  5AVR B;  3CCL P;  3SFE C;  3L74 E;  1PGJ A;  1PPJ G;  1LTG C;  4Y28 J;  2RH0 A;  3WUV A;  4C7R A;  1A02 F;  3MGN A;  1JY2 O;  2IYP A;  4H44 D;  5KJ7 A;  1VQ9 P;  4I2L C;  4N78 D;  4IOI H;  4NPD A;  2K1A A;  1YTZ T;  3RK3 B;  1KB9 H;  1SQV K;  4HJG H;  3L73 E;  2ZYG A;  2PRR A;  2QJP B;  5CBO A;  1NTK J;  2LXC B;  2E75 B;  1GU5 A;  2NPS D;  2ITA A;  3L74 J;  2JEE A;  3RGU A;  1SQP D;  4W80 A;  3CCE P;  1VQ8 P;  2ZXE B;  1HH0 A;  3F5H A;  3AEF C;  3BCC G;  4C7N A;  1G1I A;  1AQ5 A;  3KQG A;  1SFC A;  1H0T A;  2E76 D;  3RL0 D;  2B9B A;  1LT1 A;  3MZW B;  4C7N B;  2KS1 A;  2C0X A;  3BVH A;  3JCU E;  4AYC A;  2WSE H;  3AE1 C;  3BRV B;  3L73 J;  1X0T A;  5GTH E;  3P32 A;  2KS1 B;  5DJT B;  2XDJ A;  1Z56 A;  2I1J A;  1OVU A;  1Q86 Q;  1SQQ J;  2M3B A;  3ABV C;  5KLI C;  1AJY A;  1NTZ K;  1S1C X;  2B89 A;  1OW7 A;  2WWW A;  5CBN A;  4Z1M H;  2NZ2 A;  3CCJ P;  1IC2 A;  1FJP A;  4H44 B;  1W2B O;  4D6T D;  1FJK A;  2AXT H;  2M5A A;  2CK3 H;  4R4M A;  2W6B A;  4WB4 A;  3TSI A;  1PP9 E;  1D7M A;  2BCC E;  1FDO A;  4PD4 E;  2HLO A;  1NJI Q;  4BWN A;  3RK2 B;  5CJ4 A;  2N1T C;  3USS A;  2I1K A;  3O6Q A;  2IBZ E;  1VQK P;  3EFG A;  2JP3 A;  2Q3E A;  3O6Q B;  1K9M Q;  3V2R A;  4IL6 H;  1ZN5 A;  2E76 B;  3RL0 B;  1HTL C;  3H1J G;  3AE2 C;  1KIL C;  2QJK B;  1PIX A;  2G8Y A;  4JYC A;  1Q2N A;  1PP9 J;  1JMM A;  1SQP G;  3HUS C;  2FFD C;  2BCC J;  2HPC A;  5KKZ B;  1W5C E;  4HKZ H;  2IBZ D;  1QVF O;  2HPC B;  1RF1 A;  2WSE J;  3KPE A;  2Q9I A;  2FXP A;  3A0B H;  1WRG A;  1QVG O;  3V2P A;  4TT3 H;  3E7K A;  1EZV I;  3KDP B;  4H13 D;  1QX8 A;  2WZ7 A;  1AVY A;  2ZYD A;  3FWN A;  1U57 A;  5TIS E;  2ZT9 D;  3EFF K;  3VP9 A;  2GA1 A;  2OGU A;  1Q7Y Q;  2YKP A;  4PV1 C;  3CX5 H;  5AW9 B;  3GF3 A;  5TJH A;  1J1E B;  2Y9Y A;  3TYY A;  1Q81 Q;  1RY3 A;  1SQX K;  2M3E A;  5APX A;  3CI9 A;  1QL2 A;  5CMZ A;  2K9J B;  2D2C D;  3Q5S A;  4D6T G;  3CCU P;  2JKV A;  1YQ4 C;  1GD2 E;  2KK7 A;  3M0D A;  4JF7 A;  1JMB A;  1S2E A;  1L4A D;  1IFN A;  3TGU E;  1FU1 A;  2OTL P;  4A7P A;  1SFC C;  1XTG B;  1R5L A;  1BGY D;  3L70 J;  2AXC A;  1YI2 P;  1LTI C;  4AQR D;  1KQS O;  1EDL A;  2Y9Z A;  2ZAE B;  3VOP A;  3SSU A;  3Q5P A;  3V2Q A;  2KXP B;  2JR8 A;  2XU6 A;  3TGU D;  4H0L C;  1NH4 A;  1FDI A;  2R3C A;  1N7S D;  1W2E A;  2Z4E A;  3L4F A;  3OJA B;  4U3F D;  3TGU J;  2OYO A;  4NPE A;  1BDC A;  4L76 A;  1BE3 E;  2P10 A;  2QA4 P;  2V4H A;  3JC2 2;  2KUB A;  3EQ2 A;  3V4W A;  3C1L A;  2H8P D;  4OGQ D;  2J59 M;  2WTY A;  3H32 A;  3RK2 C;  1SQB D;  1IFI A;  2LXB A;  3H32 B;  3WU2 H;  1BCC G;  1OFC X;  3CWB E;  3AED C;  3LID A;  4WVZ A;  2D2C B;  3PP5 A;  3V4Q A;  1FZB A;  2E43 A;  4W7Z A;  1MV8 A;  2BEZ F;  3D71 A;  1LNQ A;  1A02 J;  1AQT A;  2KLU A;  3V2N A;  1GU4 A;  1VQM P;  1BE3 J;  1VDF A;  3HE4 A;  1FAV A;  2Q7C A;  2ZVO B;  1IFP A;  2JWA A;  3HE4 B;  3M9B A;  2QRX A;  2SPZ A;  2LR2 A;  2BAS A;  3IF4 A;  3E1I A;  2MJZ A;  1E5W A;  1WT6 A;  1IFM A;  3CWB J;  1RF1 C;  2O01 H;  1BGY G;  3MIW A;  3AE4 C;  1KV4 A;  1J2J B;  3H1I G;  4ZKP A;  1EXI A;  1X79 B;  3B5N C;  3SFD C;  1X22 A;  1JY2 N;  4RJT A;  3H25 A;  5KLV K;  2KZJ A;  2WSS H;  1KFN A;  1L0L K;  3F89 A;  3MD0 A;  1GL2 C;  5KLV G;  4ZKU A;  1YTZ I;  3CXH E;  1KIL D;  1KYO E;  4U3F G;  4GOE A;  1NU1 D;  5CCH D;  1DX7 A;  4XE5 B;  3WUU A;  1T3J A;  1GMJ A;  5DJU B;  5APU A;  1SQV E;  3CLQ A;  3A3Y B;  3L71 D;  2KIK A;  4ASV A;  1M1J C;  1NTM K;  2N9Y B;  3FWL A;  1PV3 A;  1P84 H;  5KLI B;  2YO2 A;  5KJ7 D;  1KYO D;  1NTM G;  2WSF J;  4TLF A;  2QE7 H;  1EZV G;  1GK6 A;  1T2K C;  2G3A A;  2BEQ D;  2YXR B;  1VF5 C;  4PV1 D;  4LC1 A;  2E75 D;  3PH0 A;  1SQV J;  3A0H H;  2FYU K;  1S72 P;  4EIJ A;  1DD4 A;  2N1T A;  1NYH A;  1K73 Q;  4HH2 A;  2N1T B;  3S4R A;  2GM4 A;  1NOH A;  2RN0 A;  2O01 J;  3TDK A;  3TNU A;  1S5L H;  3VTP C;  5AVQ B;  5AVU B;  3BCC J;  1NTZ E;  2WPR A;  1S4X A;  3TNU B;  1KFM A;  1SFC D;  1RE3 C;  4PJ0 E;  2Z5I A;  3AEA C;  2Y0E A;  5AW6 B;  3U1C A;  2FXO A;  2FXM A;  3D6Y A;  3LW5 H;  1HUC A;  1L0N K;  2GUV A;  2JDI H;  3M91 A;  1P84 E;  1VQL P;  1NTK E;  3L72 G;  3PHL A;  1VQO P;  1L0N G;  2A45 I;  3HUS B;  2Q6Q A;  2FFD B;  1Q90 D;  1GZL A;  1LWU C;  2CPS A;  3E1R A;  1VQP P;  4H0L D;  5GTI H;  5APV A;  1YIJ P;  1LP1 A;  3A0H E;  1JOC A;  2DW3 A;  2I8D A;  1NTZ J;  2A06 D;  1LP1 B;  3H1J E;  1NTK D;  1RQV A;  3G71 P;  1E79 H;  1OW6 A;  2WT7 A;  4AUW A;  2J58 A;  3GHG C;  3L71 G;  3PLN A;  2Z5H A;  4PD4 I;  1IJD B;  2QJY C;  3L74 D;  2WT7 B;  4PV1 B;  1UII A;  2KB7 P;  3RK2 D;  3G3Z A;  5AVT B;  2P7J A;  3PJS K;  1SQQ E;  2IBZ I;  1JCD A;  4YXW H;  1QGK B;  1GTW A;  2WPQ A;  1KTM A;  5AVV B;  2HR3 A;  1U7M A;  3OAK A;  3K5B A;  3L73 D;  1EDI A;  1HGZ A;  3PRJ A;  1SFC B;  1UIX A;  1NVO A;  2WPV B;  3H1J J;  2K37 A;  3IN6 A;  1H0T B;  1T6A A;  4CPG A;  2WPS A;  4DCK A;  1OWA A;  3HD7 C;  1EDK A;  1SQQ D;  1VQ6 P;  4LGD E;  5AW8 B;  4M3L A;  1S9K E;  1KZU B;  2WQY C;  1HF9 A;  3CCV P;  1N73 A;  1KB9 E;  3OW2 O;  2AEJ A;  1SQX E;  3LW5 J;  2C9N Y;  3L75 G;  2P2U A;  1VPC A;  4H0L B;  1N73 B;  4IFM A;  1SVF A;  2OYI A;  2AEM A;  4GOD A;  2XKM A;  2OYI B;  1RH5 B;  1LTA C;  3L37 A;  3VMA A;  2M5A B;  1FDM A;  1HVV A;  1X9V A;  3KXD A;  1KB9 D;  1KQL A;  3N4X A;  1ZP0 C;  3I5C A;  1IFD A;  3IAO A;  2IX7 C;  1ZV8 A;  2A06 G;  3O8Z A;  3P8M C;  3R4Y A;  4HYT B;  1SQX J;  1H89 A;  1YJN P;  3TF5 A;  1PP9 D;  3L74 G;  1Y9B A;  1MFT A;  2YMY A;  2BCC D;  1SQP K;  3KYQ A;  2FKW B;  4PD4 D;  2V7Q H;  2L91 A;  2XZR A;  2E42 A;  2ZVN B;  4GT1 A;  5AW4 B;  1IK9 A;  2AXT E;  2YXQ B;  1ZOY C;  5CCG A;  1T2K D;  2ZXX A;  1AFO A;  3QH9 A;  1DEB A;  1KD1 Q;  3KZI H;  2OAR A;  1VF5 D;  1T8Z A;  1NWQ A;  1N2D C;  2R5D A;  1YJW P;  1RF1 B;  3P7K A;  1ZLL A;  3A5T A;  3B5N A;  3M9Q A;  2JWD A;  3L70 E;  2WIT A;  1ZR2 A;  3B5N B;  3Q2Y A;  2QM7 A;  3BAT A;  4EYY Q;  1R8E A;  4EOT A;  1GL2 A;  4IL6 E;  2IFN A;  1VQ5 P;  4JBZ A;  5B5E H;  1GL2 B;  3RL0 g;  1LJ2 A;  4OVN F;  2ZFC A;  2JO1 A;  3H1K E;  4I7Z C;  1HJ0 A; 
#chains in the Genus database with same CATH homology
 1GDT A;  1E5W A;  3B5N D;  1FZC C;  1WT6 A;  1S9K D;  1IFM A;  4JYB A;  1RF1 C;  1KIL A;  2O01 H;  5CCH A;  5AVX B;  2POH A;  2A45 G;  3MIW A;  1JCC A;  1M1J A;  2YKQ A;  4I1L A;  1ZR4 A;  1PFI A;  3U1A A;  4N78 E;  2KYV A;  1J2J B;  1KIL B;  3HUS A;  3A2A A;  1H8A A;  1JTH A;  4ZKP A;  1GL2 D;  2FFD A;  1M1J B;  1N86 A;  1QL1 A;  1NTK K;  1X79 B;  1GW3 A;  1JNM A;  2H7H A;  3B5N C;  1EQ7 A;  1RE4 A;  1JTH B;  1JY2 N;  5AVR B;  3SWY A;  2HFE D;  2PP6 A;  3VMX A;  1LTG C;  5KLV K;  2NPS A;  5BVZ A;  4C7R A;  1FBM A;  1A02 F;  1KFN A;  4Y99 C;  3MGN A;  1N73 C;  1L0L K;  3MD0 A;  1GL2 C;  1JY2 O;  2WSC H;  4I6M C;  5AW7 B;  1MUU A;  4ZKU A;  5KJ7 A;  1YTZ I;  2NPS B;  3MUD A;  3II6 A;  1CW5 A;  1KIL D;  2JJL A;  5KTB A;  5CCH D;  1DX7 A;  4I2L C;  4XE5 B;  1LTB C;  2HYN A;  3VMZ A;  2M8R A;  4N78 D;  1H88 A;  2OYI C;  1T3J A;  5APU A;  1YTZ T;  3RK3 B;  3CLQ A;  1SQV K;  4O9B A;  1JY3 N;  1RF0 A;  2IPP A;  3IFM A;  3VN0 A;  3A3Y B;  3BRT B;  2KSJ A;  1FZA A;  5CCH C;  1HJB A;  3HRN A;  1M1J C;  1RE3 A;  1GU5 A;  2OYH C;  2NPS D;  1JY3 O;  1NTM K;  3HE5 A;  1SQQ K;  2JEE A;  2YO2 A;  4W80 A;  5KJ7 D;  2ZXE B;  1HH0 A;  1LTJ A;  3HE5 B;  5BU8 B;  5APY A;  3NXS A;  1FOS E;  1FZG A;  3HD7 D;  1GK6 A;  4C7N A;  1T2K C;  1G1I A;  2R32 A;  1AQ5 A;  3KQG A;  3SWF A;  2Q5U A;  1SFC A;  1YYC A;  1LTJ B;  3RL0 D;  2YNY A;  1GW4 A;  1NKN A;  4C7N B;  1LWU A;  4LC1 A;  2KOG A;  2C0X A;  3BVH A;  5KJ7 C;  2FYU K;  4AYC A;  4EIJ A;  2N1T A;  2WSE H;  3RK3 C;  1LWU B;  3BRV B;  1N7L A;  3P32 A;  1JY2 P;  2XDJ A;  1Z56 A;  4HH2 A;  2N1T B;  3HTK A;  2GM4 A;  1CI6 A;  1IO4 A;  3B8E B;  1NOH A;  1RF0 C;  2LKM A;  1CSB A;  2I1J A;  3N7N A;  3TNU A;  3VTP C;  5AVQ B;  5AVU B;  3HTK B;  5CCG C;  3GHG A;  2WPR A;  1CI6 B;  2M3B A;  1NTZ K;  1HGV A;  3TNU B;  1KFM A;  1SFC D;  1RE3 C;  2WWW A;  3TK1 A;  2Z5I A;  1NHL A;  5AW2 B;  3GHG B;  5CHX A;  1IC2 A;  5AW6 B;  3U1C A;  1FJP A;  2CPB A;  2FXM A;  2W27 A;  3LW5 H;  4IFF A;  1HUC A;  1L0N K;  1FJK A;  2GUV A;  1J1D B;  3M91 A;  4W7Y A;  1LTJ C;  2W6B A;  2N1T D;  4WB4 A;  3TSI A;  3L35 A;  1FZE A;  2A45 I;  3HUS B;  2FFD B;  3M9H A;  1GZL A;  1LWU C;  2CPS A;  2HLO A;  3UIA A;  1IFJ A;  3RK2 B;  5CJ4 A;  2N1T C;  5APV A;  4N3Y B;  3C9I A;  2PAJ A;  3IR9 A;  2I1K A;  5AW5 B;  1JOC A;  3L36 A;  3HD7 A;  3EFG A;  4DOJ A;  4KHX A;  2Q3I A;  1URQ D;  3V2R A;  2WT7 A;  3HD7 B;  4AUW A;  1SQB K;  2J58 A;  3GHG C;  1ZN5 A;  2Z5H A;  3RL0 B;  1HTL C;  1IJD B;  2WT7 B;  1KIL C;  1J1D C;  2KB7 P;  2O1K A;  4GKG A;  2GUS A;  3RK2 D;  3G3Z A;  5AVT B;  3BAS A;  2P7J A;  4JYC A;  3U59 A;  1FOS F;  1JMM A;  3HUS C;  3NMD A;  1MZ9 A;  4DZO A;  1OXZ A;  5APQ A;  1JCD A;  2XV5 A;  2FFD C;  2HPC A;  2P1J A;  3MTU E;  1HWT C;  1GTW A;  2WPQ A;  1RE4 C;  4LLH A;  2VRS A;  5AVV B;  1LTS C;  1FZC A;  2HPC B;  1RF1 A;  3OAK A;  2C9L Y;  2NPS C;  3KPE A;  2Q9I A;  5CJ0 A;  1HGZ A;  1FZC B;  1WRG A;  1SFC B;  2O1J A;  3V2P A;  5AVS B;  3H6P A;  1L4A A;  3KDP B;  1XTC C;  2WZ7 A;  4WY4 D;  3M0A A;  4IFD K;  2WPS A;  1OWA A;  3HD7 C;  4LGD E;  5AW8 B;  2WSF H;  4M3L A;  3LIE A;  1L4A B;  3RL0 C;  1S9K E;  3VP9 A;  1NAF A;  1KZU B;  4WBA A;  4N6J A;  2YKP A;  5AW9 B;  3P8C E;  1N73 A;  1J1E B;  3TYY A;  2C9N Y;  2P2U A;  1RY3 A;  2QM8 A;  1SQX K;  1VPC A;  1GK4 A;  1N73 B;  5APX A;  3CI9 A;  1QL2 A;  1HBW A;  5CMZ A;  4IFM A;  1SVF A;  2OYI A;  1GD2 E;  3A7O A;  5AVW B;  3M0D A;  4JF7 A;  2XKM A;  1JY3 P;  1URQ A;  1L4A D;  2OYI B;  1IFN A;  4OH8 B;  3VMY A;  1LTA C;  3L37 A;  4C46 A;  1NO4 A;  1FU1 A;  1N7S A;  1T3U A;  1URQ B;  1LT9 A;  1SFC C;  1XTG B;  2H43 A;  1FDM A;  3T97 A;  1HVV A;  1M7L A;  2XNX A;  1LGH B;  1X9V A;  2OYH A;  4XA4 A;  3P8C D;  1G1J A;  5APS A;  1N7S B;  2P67 A;  1KQL A;  1NU1 K;  1LT9 B;  3N4X A;  1MFZ A;  1X8Y A;  1LTI C;  4AQR D;  3I5C A;  1IFD A;  2L5G B;  2YKO A;  1L4A C;  2OYH B;  2IX7 C;  1ZV8 A;  2HG5 D;  3R2P A;  5AW3 B;  3O8Z A;  3CL3 D;  3P8M C;  3WMM 0;  3VOP A;  4HYT B;  1J1E C;  3V2Q A;  1H89 A;  5AW0 B;  2XU6 A;  1NH4 A;  3NFQ A;  1SLQ A;  2R3C A;  3OA7 A;  1N7S D;  1W2E A;  2Z4E A;  2YMY A;  3L4F A;  1SQP K;  3KYQ A;  2FKW B;  4WY4 A;  3OJA B;  3NTN A;  4B86 A;  2XZR A;  5AVZ B;  1CZQ A;  2A45 H;  2E42 A;  3M0D C;  4WY4 B;  1URQ C;  4GT1 A;  5AW4 B;  1IK9 A;  2N9B A;  2KLV A;  3EQ2 A;  3V4W A;  1JO5 A;  4RES B;  2H8P D;  5CCG A;  1N7S C;  2J59 M;  2WTY A;  1LT9 C;  1T2K D;  1AFO A;  3H32 A;  5BU5 A;  3RK2 C;  1DEB A;  1IFI A;  2FYZ A;  1DH3 A;  2OAR A;  3M06 A;  1T8Z A;  1NWQ A;  1SP4 A;  5APW A;  2HOD A;  1N2D C;  3H32 B;  5AW1 B;  2R5D A;  1RF1 B;  2IFM A;  3V5B A;  3P7K A;  3LID A;  5AVY B;  3RK3 D;  2HOD B;  3PP5 A;  1ZLL A;  3V4Q A;  1G2C A;  1FZB A;  3A5T A;  3B5N A;  3M9Q A;  2E43 A;  4W7Z A;  1MV8 A;  2KP8 A;  2WIT A;  2YO3 A;  1G2C B;  1ZR2 A;  3B5N B;  4GIF A;  1A02 J;  1LTT C;  3V2N A;  1GU4 A;  2QM7 A;  3BAT A;  5CCG D;  5APT A;  4EOT A;  1GL2 A;  1VDF A;  3VYI A;  3HE4 A;  2IFN A;  4WY4 C;  1JUN A;  4Y99 B;  1FAV A;  2Q7C A;  2W6A A;  1GL2 B;  1NKZ B;  3HE4 B;  3M9B A;  3VP8 A;  2BAS A;  2ZFC A;  3E1I A;  2R5B A;  2MJZ A;  1FZF A;  2C0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...