1LTBC

2.6 angstroms crystal structure of partially-activated e. coli heat-labile enterotoxin (lt)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
41
structure length
41
Chain Sequence
GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of partially-activated E. coli heat-labile enterotoxin (LT) at 2.6 A resolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Enterotoxin
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
total genus 16
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1993-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltbC00
1LTBC 1LTGC 1LTTC 1LTAC 1HTLC 1XTCC 1LTSC 1LTIC
chains in the Genus database with same CATH superfamily
1QL1A 2V7QH 2VRSA 3MUDC 3A0HE 3V2QA 2J58A 5B66E 2KB7P 1YYCA 3HD7B 2FXOA 1IK9A 1DEEG 1X0TA 3H1LG 1PP9J 2NRGA 1L0LJ 3A0BH 1YJ9P 3HTKB 2Q3IA 4HYTB 1VQ9P 3IN6A 4D6TE 1Q90D 5AVQB 1KMIZ 1K04A 1G1JA 1KB9E 3E1RA 1FOSE 4GKGA 2KNCB 2FXMA 1OW7A 2JO1A 1H88A 1KN7A 2NPSB 1X79B 4IFFA 1NWQA 1EDKA 3CX5E 4HH2A 4U3FE 5BU5A 1FU1A 1HGVA 1NKZB 3P8MC 4H0LD 3TNUB 1GU4A 2JKVA 2IX7C 2W8ZA 2ZVNB 1BCCG 1QX8A 3B5NC 2FFDC 5H2FH 1M1JC 3CX5D 4U3FD 4EOTA 1PPJD 1NTMG 2PFXA 3ABVC 3MD0A 1VQ8P 1BGYJ 1IC2A 1NKNA 2O3JA 1EDIA 1KYOH 5KJ7C 3CMEP 2OYIA 3V2RA 1NTZK 1ZRTE 4NPEA 3OA7A 1VDFA 4DT0A 1LWUA 2OGUA 1CW5A 2ZAEB 3VMYA 1KQGB 3T97A 3SWYA 2SPZA 3V2NA 1NTZG 2OYOA 1JNMA 1HWTC 1H0TA 1AA0A 1L4AC 1Y9BA 1KORA 2KZJA 2W83C 1N73A 1JY2O 1BGYE 2D2CD 1S2EA 1SQBD 2D2CC 2AEMA 1S1CX 5AVZB 1M1JB 3WUVA 3FXDA 1PP9G 1SQPG 2KK7A 1RF0A 2FY8A 1NHLA 3B5NB 3MZWB 4XE5B 2V7QJ 2WWWA 1L4AB 1PGJA 1RY3A 2FXPA 5APWA 2HODA 3M9BA 2G3AA 3H1HE 1EDLA 3P7KA 4N78E 1HJ0A 2B89A 4EDFA 5L8RJ 4UB6H 4KT0J 4EIJA 2PRRA 3I56P 1W5CE 5B5EH 1SQPJ 3CWBE 1M8OB 3L4FA 3H25A 3VMAA 4M3LA 1T2KD 3U1AA 1T2KC 2I1JA 2YO2A 1HTLC 4LLHA 1FZGA 2FYZA 3HD7C 3HRNA 3H1JD 1S5LH 4IFDK 3EFGA 2Y9YA 1WMKA 5TISH 5DJTB 3L73J 4AQRD 1KV4A 1NTZJ 3H1HJ 2E75C 4H44D 4H0LB 2K1AA 2BEQD 3AE3C 3KZIH 3L70E 5AW1B 4YPCA 2HFED 1PP9D 3H1JJ 3H32B 1UIXA 1U7JA 3HUSA 4YXDC 3KDPB 5AW8B 3I5CA 3CX5I 1A02F 1PFIA 3GHGA 3IAOA 5AVXB 5KLIB 2E42A 3NTNA 2K9JA 4RESB 3AECC 2ZT9B 3RL0B 2KLUA 1BGYG 4ZKPA 1YIJP 4W80A 4IOIH 4NPFX 2KSJA 1W2EA 1NTMJ 4WVZA 1OWAA 3V6IA 5CJ0A 3L73E 5KAIE 1BCCD 2L91A 2I8DA 3M0AA 3EQ2A 2IZ0A 2XZRA 1MFTA 1LWUC 1GW3A 1NTKE 1KYOI 1NTMD 1ZRTD 2M5AA 2XNDH 1S4XA 5CCHA 1PIXA 2CPSA 1JTHB 1SFCA 2CPBA 1X9VA 2E76D 2YMKA 3AE7C 3OAKA 3RK3D 1N7SC 1NGMB 3RGUA 2YIUC 4ZKUA 1NTKD 1NTME 3VTPC 3D6ZA 2J59M 2JR8A 1KB9I 2PP6A 3CXHE 3H1KE 3NMDA 3V5BA 1BCCE 2E74B 2LXCB 3AEGC 2A45H 3PJSK 4PV1B 1Q82Q 1J1EC 2MKVA 2W27A 1URQA 1KILC 1OFCX 1JB0J 5CBNA 1DH3A 2QSIA 5AW0B 1UIIA 3IF4A 3A0HH 3IR9A 3CCSP 1NAYA 1LJ2A 1SQQJ 2IFNA 1SQBK 3KZIE 5CBOA 3G6EP 3AEBC 3CXHD 4BXLA 1GD2E 4D6TG 3E7KA 3BATA 2FYNB 4C46A 4DZOA 2CK3H 1Q7YQ 4WY4C 4XFJA 3KQGA 2E5TA 3N7NA 4K3AA 5AW9B 2A45I 2KS1A 4C7NB 5KJ7D 3CCVP 4H44B 1LT9B 2KYVA 3B71A 2P1JA 1LTJA 1NU1G 1SLQA 3II6A 4CPGA 3D71A 4RKUJ 1ZR4A 5AW5B 1YQ4C 1KILE 1SQVG 1LTGC 1YTZI 3W68A 3CCRP 3PP5A 1JMMA 3AEAC 1GL2A 5AVUB 5CCGC 3W67A 1OVRA 1Q86Q 1FBMA 1XTCC 1HVVA 1VQKP 2Q9IA 3AEFC 1MKMA 2B9BA 5KLVD 3VP9A 2QJKB 3KHUA 3A5TA 5APXA 2OYHC 1L0LE 2IZ1A 3LW5H 5AW4B 1EZVG 1RF1C 5KKZB 4OH8B 1S72P 3B8EB 4H13B 4AUWA 3GG2A 1BSNA 1S9KD 1NVOA 2FYUE 2Q5UA 2YKQA 1S3JA 4LC1A 2E43A 1P84E 2WSCH 2IYPA 3L72G 1RE4C 1NU1E 3BCCJ 3CL3D 1HF9A 1KILD 1M56D 1U7MA 1RH5B 2ITAA 1D7MA 3H1IE 4BRYA 1J1DC 3L75E 1SQVD 2ZVOB 3OW2O 1N8RQ 1N2DC 1FE6A 3C9IA 5APYA 2E74D 2KIKA 3PHLA 3L71D 4PV1D 4ASWA 1EXIA 2FYUJ 2QE7H 4GDOA 3Q1MA 2QJPB 4PJ0E 4I2LC 1SFCD 2FKWB 2K3RA 2Y9ZA 1NU1J 2Z5HA 3TGUG 1RE3A 2BCCJ 4DJGA 1KTMA 1H0TB 2HLOA 2YMYA 3UIAA 1W2BO 2OYHB 2P2UA 1IFJA 1L0NG 1SS1A 2QJYC 2WITA 1G1IA 2YO3A 2AXCA 3T97B 2Z4EA 1FZFA 2BCCD 1SVFA 2ZJSE 5BVZA 5CCGD 1VQPP 1J1DB 2RKLA 3L71E 5AW3B 1FJPA 3AEEC 3H32A 4D6TJ 1SQVK 3TGUJ 1IFNA 3VN0A 4LGDE 2M0BA 4L74A 4Y99B 3JSVC 3K5BA 1VQ6P 5AVYB 1EQ7A 4C7RA 1FZEA 1KILA 2BCCE 1ZW0A 2WSEJ 3JCUE 4A7PA 1RF0C 1FDIA 3L71G 1LT9C 1RQVA 3M0DA 4NPDA 2E75D 4H44C 2GM4A 3TNUA 1AQ5A 1QGKB 2Y0DA 2GUSA 4WY4D 1E5WA 2YKPA 1GW4A 2H8PD 5KKZC 1IJDB 3R2PA 5E79H 5AVSB 3RK2B 1H89A 2IBZG 1Q2NA 3S4RA 2KNCA 2PGDA 4JYCA 1OMIA 2QJKC 4DCKA 3V4QA 1MZ9A 2XV5A 1EZVI 1FZCA 1M7LA 2KI7B 2L5GB 1T8ZA 2WMMA 3G3ZA 1KC8Q 1URQD 3CC4P 2O01H 4EI2A 4RJTA 1SQPD 1BDCA 4L75A 2R5DA 1PGQA 3H1KD 1KILB 4IFMA 4K35A 1IFDA 1LTBC 1J1EB 1FZBA 1XTGB 1NU1K 2YXQB 3L70G 3H1ID 3L74E 3L75D 1M1JA 3M9HA 3PLNA 3WU2E 5KAIH 1BSHA 1JMBA 2V4HA 3SWFA 2AEJA 3KYQA 1SQQD 2YIUB 2E76C 2Q1KA 4Z1MH 1DEBA 3GF3A 3AE6C 2WSFJ 1N7SD 2FYNC 1GDTA 1FDOA 1VF5B 1ZP0C 3H1JG 1LWUB 2KZIA 4U7JA 2J5UA 3L74D 2C9LY 4GODA 2QM8A 4TLFA 1T3UA 2ZXXA 1JM0A 2C0WA 1KFNA 4N78D 2WT7A 3BVHA 2OYIC 1WRGA 3H1HD 4UB8E 5KAFH 4UB8H 2Y0CA 5KAFE 2QRXA 3KXDA 5GTHE 1RHZB 4W7ZA 2QVAA 3TK1A 2Q3EA 3SFDC 1OIPA 4UB6E 4BRYB 2QG4A 1SQBE 2ZYDA 4L76A 5AVWB 3AE5C 3H1JE 3JCUH 1SQQG 4OGQB 3GHGC 1FZCB 2N1TA 1RQUA 2E75B 2QM7A 1GTWA 4EYYQ 4BWNA 3I55P 2LR2A 5AVVB 3HTKA 1URQC 2M3EA 2XU6A 4IL6H 3G9RA 5CCHD 4GOFA 3MIWA 1JO5A 1GMJA 3CXHH 1JY3P 3PRJA 1QLED 1VL2A 1LNQA 3AE9C 1LTAC 3BRVB 3H1LD 3HD7A 4GOEA 3G71P 3D6YA 2WPRA 5APSA 4W7YA 3L73D 3Q3DA 2I1KA 5KLIC 2HYNA 1HUCA 1SFCC 1ZV8A 4WY4A 5AVRB 1GL2B 2A06G 1LGHB 1EDJA 1DD4A 3GF7A 4PJ0H 3PTZA 4U3FG 3S9OA 2FBWC 2ZYAA 5AW7B 2JWDA 3EWKA 4H0LC 1LTSC 1NYHA 5CJ4A 3CCJP 2OYHA 1HH0A 2BASA 1L0LK 2PAJA 1LTJC 1J2JB 2JEEA 1IFPA 3FWLA 1Y47A 2HR3A 4Y28J 3CPWO 3CCQP 4OVNF 2HPCB 2NZ2A 4B86A 1OX3A 1CZQA 3L75G 1RE3C 3L36A 3H1IG 5CCGA 4ZMDA 1M1KQ 1LP1B 1VQ4P 1A02J 1BCCJ 3Q2YA 3C1LA 5CCHC 1JEKA 2BEZF 1P84H 2B88A 2K9YA 4JPZB 4N3YB 1OVVA 1NJIQ 2WPSA 1R5SA 1S5LX 3L73G 1KB9H 1NU1D 2POHA 2WQYC 1FOSF 5APVA 4I7ZC 4PD4E 4KHXA 4HJGH 2A06D 1S5LE 3TYYA 1EC5A 1VQLP 1L0NE 1SQPK 1BE3D 1L0LG 1K05A 1G2CB 2D2CB 2IPPA 3H1LJ 1YITP 3A7OA 2GUVA 4OGQD 3RBZA 4I7ZB 4ASVA 1P84I 1SQXE 1BE3E 3CC2P 1SFCB 1JTHA 1OZHA 2NPSC 2R3SA 4WB4A 2KP8A 1K73Q 3IFMA 1EXJA 1AFOA 1IFIA 3RBXA 3AE2C 3MP7B 4AYCA 4DOJA 3MTUE 2M5AB 3A2AA 3M06A 5GTHH 3VP8A 1QEXA 5BU8B 1KQLA 3FWNA 5EFWB 1NTMK 1S9KE 1FS0E 3L72E 2DW3A 1LTJB 2FYUD 4R4MA 1SQXD 2QEXP 1USDA 3LIDA 1OXZA 2FFDB 2H43A 1LT9A 3M0DC 1NO4A 3F89A 3GHGB 1RE4A 1ZOYC 1BE3G 1L0LD 5KLVJ 2KS1B 3QWOC 1GL2D 4C7NA 1IZNB 1GL2C 3BCCE 2WTYA 3SWKA 1VQMP 1OVUA 3VMXA 1VQOP 1H8AA 1VPCA 3TF5A 2K88A 3H1IJ 3VOPA 1FAVA 2LXBA 3L75J 4OWFA 1KZUB 2P67A 3NXSA 2ZT9D 3RL0D 1RF1A 3TDKA 1Z56A 1OW6A 2RH0A 1KFMA 2ZXEB 3VYIA 1HBWA 2JWAA 1URQB 1SP4A 3HE5A 4U3FJ 2A45G 4O9BA 1CI6A 1VF5C 3H6PA 1VQNP 3CX5H 2R5BA 3RK3B 3QH9A 3RK3E 1FZCC 2AXTH 1SQQK 4OGQC 1NTKG 2OTLP 3FX0A 1LTIC 2E76B 2XDJA 3E1IA 1JCCA 4RO0A 2XKMA 2WSFH 4JBZA 4TT3H 4WWIA 5E79E 3WUUA 4JQ0D 1MV8A 2W90A 3MUDA 3HE4A 1DX7A 3U59A 3HE4B 1IO4A 1PZQA 3L71J 1KQFB 2IBZD 1VF5D 3FGAD 5B66H 2KUBA 2KXPB 2WVRA 5KLVK 3TGUE 3P8CE 5APQA 3EFFK 1AVOA 5APUA 2LKMA 3WMM0 3GMAA 3ZDMA 1X8YA 5M1BA 1VQ5P 2K9JB 4ZNCA 5TISE 4PD4I 3H1KG 3RK2C 3BRTB 1CI6B 3USSA 3HUSB 4N6JA 1JY2P 3R4YA 1JY3N 1M57D 3HE5B 1T3JA 2IDBA 3D70A 2N1TC 2AXTE 1NTZD 4KJMA 4QMAA 3U1CA 1SQBJ 2M8RA 2NPSD 3CC7P 4Y99C 3L74J 2UWJE 1GZLA 4JF7A 2WSCJ 3CWBD 5KJ7A 5AVTB 3FXEA 2FYUG 1SQXG 2NPSA 1DD3A 1OW8A 2O1KA 2OTKE 2P10A 2RMZA 2ZYGA 1PGOA 1BDDA 1TU3F 2O01N 5CHXA 1L0NK 1EZVE 1SQPE 1YTZT 2QJYB 2XNXA 3A3YB 1JCDA 3CWBJ 2R3CA 3P32A 5GTIE 3CCUP 2HODB 3S1KA 2OARA 1K9MQ 4GIFA 1IFMA 3BCCG 1L4AA 2KSEA 3CXHI 1EZVD 3GLMA 2ZFCA 3L70J 1FC2C 4L73A 4XA4A 5C39A 4H13D 3CMAP 3B5NA 4I1LA 3CI9A 3ITKA 1QVGO 3VMZA 1SQVE 2IYOA 3M9QA 5DJUB 1E79H 1FZAA 2KOGA 2JJLA 1JUNA 2Q7CA 1N73B 1LTTC 2N1TD 3MGNA 3O6QB 4I6MC 2W6BA 3CCEP 1KYOE 5CMZA 1X22A 1YHQP 2M3BA 1AQTA 2N9BA 3CWBG 2W6AA 1FDMA 3F5HA 5B5EE 2N9YB 3B5ND 3KPEA 5H2FE 3AEDC 3L37A 1G2CA 2YKOA 1L4AD 1N7LA 1PPJE 1N86A 1Y8AA 2Y0EA 3Q5RA 4HKZH 1K8AQ 1SQVJ 2OYIB 2YXRB 1ZMEC 4YTPC 1YBKA 1BGYD 2RN0A 2WSEH 2A06E 3AE4C 2QJPC 1L0ND 1MFZA 1U57A 4PD4D 3TSIA 4YXWH 3G4SP 3CCMP 1RF1B 1ZN5A 1KD1Q 3TGUD 2E5YA 1NOHA 2B87A 1AJYA 2WPVB 5TJHA 1JY2N 3SFEC 2WZ7A 1N7SA 2QA4P 1L0NJ 1GU5A 2Q6QA 3H1KJ 1SQXK 4PD4H 5AW2B 2FYUK 1ZLLA 3B4SA 3H1LE 4IL6E 1NTZE 1ZR2A 1M90Q 2BCCG 3N4XA 3RL0g 1IK7A 1KQSO 1PV3A 1N73C 1QVFO 1QL2A 2HG5D 4IL6X 2FFDA 1DIPA 2H89C 2GA1A 2R32A 3JC22 3HD7D 5K5GB 4MN4C 3CLQA 4GT1A 4WBAA 1YI2P 1L2PA 4H13C 3RK2D 2WPQA 1P84D 2W6JH 4WY4B 1YQ3C 3V2PA 2O1JA 1MUUA 3O8ZA 1JOCA 3WUTA 2H7HA 3Q5SA 4R4LA 3L72J 1NTKJ 1T6AA 3M91A 4D6TD 3CCLP 3L35A 3Q5PA 1YJWP 1KB9D 1PPJG 4HB1A 2R44A 5KLVE 3NFQA 3GW6A 3C8VA 5APTA 2OTJP 3OJAB 1USEA 1HGZA 1NH4A 1KYOD 1WT6A 2E74C 3BCCD 4PV1C 1LT1A 2IBZI 1R8EA 2QIWA 3L70D 2N1TB 5GTIH 3LW5J 1PGPA 2WSSH 3A0BE 1VQ7P 5AW6B 1N7SB 3HUSC 3PH0A 2C9NY 3BASA 1SQXJ 2JDIH 2B87B 1GK4A 1R5LA 2JP3A 3WU2H 2K37A 3RK3C 2H88C 2P58A 2YNYA 2C0XA 3L74G 1SQQE 3MHVA 3V4WA 1SQBG 1BE3J 1HJBA 2Z5IA 1LP1A 2P7JA 4JYBA 5KLVG 2WT7B 3H1HG 1ZXGA 3CD6P 3AE1C 2O01J 1FJKA 2HPCA 3AE8C 1PL5A 2IFMA 3P8CD 1Q81Q 1CSBA 1GK6A 1AVYA 1JY3O 2ZT9C 1PP9E 3RL0C 2IBZE 1YJNP 2OQQA 3SSUA 5KTBA 2AEFA 2G8YA 1AV1A 2MJZA 3L72D 3O6QA 1NAFA 1NTKK 2KLVA 3LIEA
chains in the Genus database with same CATH topology
1QL1A 2VRSA 3V2QA 2J58A 2KB7P 1YYCA 3HD7B 1IK9A 3HTKB 2Q3IA 4HYTB 5AVQB 1G1JA 1FOSE 4GKGA 2FXMA 1H88A 2NPSB 1X79B 4IFFA 1NWQA 5BU5A 4HH2A 1FU1A 1HGVA 1NKZB 3P8MC 3TNUB 1GU4A 2IX7C 3B5NC 2FFDC 1M1JC 4EOTA 3MD0A 1IC2A 1NKNA 5KJ7C 2OYIA 3V2RA 1NTZK 3OA7A 1VDFA 1LWUA 1CW5A 3VMYA 3T97A 3SWYA 1JNMA 1HWTC 1L4AC 1N73A 1JY2O 5AVZB 1M1JB 4XE5B 1RF0A 3B5NB 1NHLA 2WWWA 1L4AB 1RY3A 5APWA 2HODA 3M9BA 3P7KA 4N78E 4EIJA 3L4FA 4M3LA 1T2KD 1T2KC 2I1JA 2YO2A 1HTLC 4LLHA 1FZGA 2FYZA 3HD7C 3HRNA 4IFDK 3EFGA 4AQRD 5AW1B 2HFED 3H32B 3HUSA 3KDPB 5AW8B 3I5CA 1A02F 1PFIA 3GHGA 5AVXB 2E42A 3NTNA 4RESB 3RL0B 4ZKPA 4W80A 2KSJA 1W2EA 1OWAA 5CJ0A 3M0AA 3EQ2A 2XZRA 1LWUC 1GW3A 5CCHA 2CPSA 1JTHB 1SFCA 2CPBA 1X9VA 3OAKA 3RK3D 1N7SC 3VTPC 2J59M 3NMDA 2PP6A 3V5BA 2A45H 1J1EC 2W27A 1URQA 1KILC 1DH3A 5AW0B 3IR9A 2IFNA 1SQBK 1GD2E 3BATA 4C46A 4DZOA 4WY4C 5AW9B 3KQGA 3N7NA 4C7NB 2A45I 5KJ7D 1LT9B 2KYVA 2P1JA 1LTJA 1SLQA 3II6A 1ZR4A 5AW5B 1YTZI 1LTGC 3PP5A 1JMMA 5AVUB 1GL2A 5CCGC 1FBMA 1XTCC 1HVVA 2Q9IA 3VP9A 3A5TA 5APXA 2OYHC 3LW5H 5AW4B 1RF1C 4OH8B 3B8EB 4AUWA 1S9KD 2Q5UA 2YKQA 4LC1A 2E43A 2WSCH 1RE4C 3CL3D 1KILD 1J1DC 1N2DC 3C9IA 5APYA 4I2LC 1SFCD 2FKWB 2Z5HA 1RE3A 2HLOA 2YMYA 3UIAA 2OYHB 2P2UA 1IFJA 2Z4EA 2WITA 1G1IA 2YO3A 1FZFA 1SVFA 5BVZA 5CCGD 1J1DB 5AW3B 1FJPA 3H32A 1SQVK 1IFNA 3VN0A 4LGDE 4Y99B 5AVYB 1EQ7A 4C7RA 1FZEA 1KILA 1RF0C 1LT9C 3M0DA 2GM4A 3TNUA 2GUSA 4WY4D 1E5WA 2YKPA 1GW4A 2H8PD 1IJDB 3R2PA 5AVSB 3RK2B 1H89A 4JYCA 1FZCA 3V4QA 1MZ9A 2XV5A 1M7LA 2L5GB 1T8ZA 3G3ZA 1URQD 2O01H 2R5DA 1KILB 4IFMA 1IFDA 1LTBC 1J1EB 1FZBA 1XTGB 1NU1K 3M9HA 1M1JA 3SWFA 3KYQA 1DEBA 1N7SD 1GDTA 1LWUB 2C9LY 2QM8A 1T3UA 2WT7A 2C0WA 1KFNA 4N78D 3BVHA 1WRGA 4W7ZA 3TK1A 5AVWB 3GHGC 1FZCB 2N1TA 2QM7A 1GTWA 5AVVB 3HTKA 1URQC 2XU6A 5CCHD 3MIWA 1JO5A 1JY3P 3HD7A 1LTAC 3BRVB 2WPRA 5APSA 4W7YA 2I1KA 2HYNA 1HUCA 1SFCC 1ZV8A 4WY4A 5AVRB 1GL2B 1LGHB 5CJ4A 1LTSC 2OYHA 1HH0A 2BASA 1L0LK 2PAJA 1LTJC 1J2JB 2JEEA 5AW7B 1AQ5A 2HPCB 4B86A 1CZQA 5CCGA 1RE3C 3L36A 1A02J 5CCHC 4N3YB 2WPSA 2POHA 1FOSF 5APVA 4KHXA 3TYYA 1SQPK 1G2CB 2IPPA 3A7OA 2GUVA 1SFCB 1JTHA 2NPSC 4WB4A 2KP8A 1AFOA 3IFMA 1IFIA 4AYCA 4DOJA 3MTUE 3A2AA 3M06A 3VP8A 5BU8B 1KQLA 1NTMK 1S9KE 1LTJB 2FFDB 3LIDA 1OXZA 2H43A 1LT9A 3M0DC 1NO4A 3GHGB 1RE4A 1GL2D 4C7NA 1GL2C 2WTYA 1H8AA 3VMXA 1VPCA 3VOPA 1FAVA 1KZUB 2P67A 3NXSA 3RL0D 1RF1A 1Z56A 3VYIA 1KFMA 2ZXEB 1HBWA 1URQB 1SP4A 3HE5A 2A45G 4O9BA 1CI6A 3H6PA 2R5BA 3RK3B 1FZCC 1SQQK 1LTIC 2XDJA 3E1IA 3U1AA 1JCCA 2XKMA 2WSFH 1MV8A 3MUDA 3HE4A 1DX7A 3U59A 3HE4B 1IO4A 5KLVK 3P8CE 5APQA 5APUA 2LKMA 3WMM0 1X8YA 3RK2C 3BRTB 1CI6B 3HUSB 4N6JA 1JY2P 1JY3N 3HE5B 1T3JA 2N1TC 3U1CA 2NPSD 2M8RA 4Y99C 4JF7A 1GZLA 5KJ7A 5AVTB 2NPSA 2O1KA 5CHXA 1L0NK 1YTZT 2XNXA 3A3YB 3P32A 1JCDA 2R3CA 2HODB 2OARA 4GIFA 1IFMA 1L4AA 3V2NA 4ZKUA 2ZFCA 4XA4A 3B5NA 4I1LA 3CI9A 3VMZA 3M9QA 1FZAA 2KOGA 2JJLA 1JUNA 2Q7CA 1N73B 1LTTC 2N1TD 3MGNA 4I6MC 2W6BA 5CMZA 2M3BA 2N9BA 1FDMA 2W6AA 3B5ND 3KPEA 3L37A 1G2CA 2YKOA 1L4AD 1N7LA 1N86A 2OYIB 2WSEH 1MFZA 3TSIA 2OYIC 1RF1B 1ZN5A 1NOHA 1JY2N 2WZ7A 1N7SA 1GU5A 1SQXK 5AW2B 2FYUK 1ZLLA 1ZR2A 3N4XA 1N73C 1QL2A 2HG5D 2FFDA 2R32A 3HD7D 3CLQA 4GT1A 4WBAA 3RK2D 2WPQA 4WY4B 3V2PA 2O1JA 1MUUA 3O8ZA 1JOCA 2H7HA 3M91A 3L35A 3NFQA 5APTA 3OJAB 1WT6A 1HGZA 1NH4A 2N1TB 5AW6B 1N7SB 3HUSC 2C9NY 3BASA 1GK4A 3RK3C 2YNYA 2C0XA 3V4WA 1HJBA 2Z5IA 4JYBA 2P7JA 2WT7B 1FJKA 2HPCA 2IFMA 3P8CD 1CSBA 1GK6A 1JY3O 3RL0C 5KTBA 2MJZA 1NAFA 1NTKK 2KLVA 3LIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTB C;  1LTG C;  1LTT C;  1LTA C;  1HTL C;  1XTC C;  1LTS C;  1LTI C; 
#chains in the Genus database with same CATH topology
 1QL1 A;  2V7Q H;  2VRS A;  3MUD C;  3A0H E;  3V2Q A;  2J58 A;  5B66 E;  2KB7 P;  1YYC A;  3HD7 B;  2FXO A;  1IK9 A;  1DEE G;  1X0T A;  3H1L G;  1PP9 J;  2NRG A;  1L0L J;  3A0B H;  1YJ9 P;  3HTK B;  2Q3I A;  4HYT B;  1VQ9 P;  3IN6 A;  4D6T E;  1Q90 D;  5AVQ B;  1KMI Z;  1K04 A;  1G1J A;  1KB9 E;  3E1R A;  1FOS E;  4GKG A;  2KNC B;  2FXM A;  1OW7 A;  2JO1 A;  1H88 A;  1KN7 A;  2NPS B;  1X79 B;  4IFF A;  1NWQ A;  1EDK A;  3CX5 E;  4HH2 A;  4U3F E;  5BU5 A;  1FU1 A;  1HGV A;  1NKZ B;  3P8M C;  4H0L D;  3TNU B;  1GU4 A;  2JKV A;  2IX7 C;  2W8Z A;  2ZVN B;  1BCC G;  1QX8 A;  3B5N C;  2FFD C;  5H2F H;  1M1J C;  3CX5 D;  4U3F D;  4EOT A;  1PPJ D;  1NTM G;  2PFX A;  3ABV C;  3MD0 A;  1VQ8 P;  1BGY J;  1IC2 A;  1NKN A;  2O3J A;  1EDI A;  1KYO H;  5KJ7 C;  3CME P;  2OYI A;  3V2R A;  1NTZ K;  1ZRT E;  4NPE A;  3OA7 A;  1VDF A;  4DT0 A;  1LWU A;  2OGU A;  1CW5 A;  2ZAE B;  3VMY A;  1KQG B;  3T97 A;  3SWY A;  2SPZ A;  3V2N A;  1NTZ G;  2OYO A;  1JNM A;  1HWT C;  1H0T A;  1AA0 A;  1L4A C;  1Y9B A;  1KOR A;  2KZJ A;  2W83 C;  1N73 A;  1JY2 O;  1BGY E;  2D2C D;  1S2E A;  1SQB D;  2D2C C;  2AEM A;  1S1C X;  5AVZ B;  1M1J B;  3WUV A;  3FXD A;  1PP9 G;  1SQP G;  2KK7 A;  1RF0 A;  2FY8 A;  1NHL A;  3B5N B;  3MZW B;  4XE5 B;  2V7Q J;  2WWW A;  1L4A B;  1PGJ A;  1RY3 A;  2FXP A;  5APW A;  2HOD A;  3M9B A;  2G3A A;  3H1H E;  1EDL A;  3P7K A;  4N78 E;  1HJ0 A;  2B89 A;  4EDF A;  5L8R J;  4UB6 H;  4KT0 J;  4EIJ A;  2PRR A;  3I56 P;  1W5C E;  5B5E H;  1SQP J;  3CWB E;  1M8O B;  3L4F A;  3H25 A;  3VMA A;  4M3L A;  1T2K D;  3U1A A;  1T2K C;  2I1J A;  2YO2 A;  1HTL C;  4LLH A;  1FZG A;  2FYZ A;  3HD7 C;  3HRN A;  3H1J D;  1S5L H;  4IFD K;  3EFG A;  2Y9Y A;  1WMK A;  5TIS H;  5DJT B;  3L73 J;  4AQR D;  1KV4 A;  1NTZ J;  3H1H J;  2E75 C;  4H44 D;  4H0L B;  2K1A A;  2BEQ D;  3AE3 C;  3KZI H;  3L70 E;  5AW1 B;  4YPC A;  2HFE D;  1PP9 D;  3H1J J;  3H32 B;  1UIX A;  1U7J A;  3HUS A;  4YXD C;  3KDP B;  5AW8 B;  3I5C A;  3CX5 I;  1A02 F;  1PFI A;  3GHG A;  3IAO A;  5AVX B;  5KLI B;  2E42 A;  3NTN A;  2K9J A;  4RES B;  3AEC C;  2ZT9 B;  3RL0 B;  2KLU A;  1BGY G;  4ZKP A;  1YIJ P;  4W80 A;  4IOI H;  4NPF X;  2KSJ A;  1W2E A;  1NTM J;  4WVZ A;  1OWA A;  3V6I A;  5CJ0 A;  3L73 E;  5KAI E;  1BCC D;  2L91 A;  2I8D A;  3M0A A;  3EQ2 A;  2IZ0 A;  2XZR A;  1MFT A;  1LWU C;  1GW3 A;  1NTK E;  1KYO I;  1NTM D;  1ZRT D;  2M5A A;  2XND H;  1S4X A;  5CCH A;  1PIX A;  2CPS A;  1JTH B;  1SFC A;  2CPB A;  1X9V A;  2E76 D;  2YMK A;  3AE7 C;  3OAK A;  3RK3 D;  1N7S C;  1NGM B;  3RGU A;  2YIU C;  4ZKU A;  1NTK D;  1NTM E;  3VTP C;  3D6Z A;  2J59 M;  2JR8 A;  1KB9 I;  2PP6 A;  3CXH E;  3H1K E;  3NMD A;  3V5B A;  1BCC E;  2E74 B;  2LXC B;  3AEG C;  2A45 H;  3PJS K;  4PV1 B;  1Q82 Q;  1J1E C;  2MKV A;  2W27 A;  1URQ A;  1KIL C;  1OFC X;  1JB0 J;  5CBN A;  1DH3 A;  2QSI A;  5AW0 B;  1UII A;  3IF4 A;  3A0H H;  3IR9 A;  3CCS P;  1NAY A;  1LJ2 A;  1SQQ J;  2IFN A;  1SQB K;  3KZI E;  5CBO A;  3G6E P;  3AEB C;  3CXH D;  4BXL A;  1GD2 E;  4D6T G;  3E7K A;  3BAT A;  2FYN B;  4C46 A;  4DZO A;  2CK3 H;  1Q7Y Q;  4WY4 C;  4XFJ A;  3KQG A;  2E5T A;  3N7N A;  4K3A A;  5AW9 B;  2A45 I;  2KS1 A;  4C7N B;  5KJ7 D;  3CCV P;  4H44 B;  1LT9 B;  2KYV A;  3B71 A;  2P1J A;  1LTJ A;  1NU1 G;  1SLQ A;  3II6 A;  4CPG A;  3D71 A;  4RKU J;  1ZR4 A;  5AW5 B;  1YQ4 C;  1KIL E;  1SQV G;  1LTG C;  1YTZ I;  3W68 A;  3CCR P;  3PP5 A;  1JMM A;  3AEA C;  1GL2 A;  5AVU B;  5CCG C;  3W67 A;  1OVR A;  1Q86 Q;  1FBM A;  1XTC C;  1HVV A;  1VQK P;  2Q9I A;  3AEF C;  1MKM A;  2B9B A;  5KLV D;  3VP9 A;  2QJK B;  3KHU A;  3A5T A;  5APX A;  2OYH C;  1L0L E;  2IZ1 A;  3LW5 H;  5AW4 B;  1EZV G;  1RF1 C;  5KKZ B;  4OH8 B;  1S72 P;  3B8E B;  4H13 B;  4AUW A;  3GG2 A;  1BSN A;  1S9K D;  1NVO A;  2FYU E;  2Q5U A;  2YKQ A;  1S3J A;  4LC1 A;  2E43 A;  1P84 E;  2WSC H;  2IYP A;  3L72 G;  1RE4 C;  1NU1 E;  3BCC J;  3CL3 D;  1HF9 A;  1KIL D;  1M56 D;  1U7M A;  1RH5 B;  2ITA A;  1D7M A;  3H1I E;  4BRY A;  1J1D C;  3L75 E;  1SQV D;  2ZVO B;  3OW2 O;  1N8R Q;  1N2D C;  1FE6 A;  3C9I A;  5APY A;  2E74 D;  2KIK A;  3PHL A;  3L71 D;  4PV1 D;  4ASW A;  1EXI A;  2FYU J;  2QE7 H;  4GDO A;  3Q1M A;  2QJP B;  4PJ0 E;  4I2L C;  1SFC D;  2FKW B;  2K3R A;  2Y9Z A;  1NU1 J;  2Z5H A;  3TGU G;  1RE3 A;  2BCC J;  4DJG A;  1KTM A;  1H0T B;  2HLO A;  2YMY A;  3UIA A;  1W2B O;  2OYH B;  2P2U A;  1IFJ A;  1L0N G;  1SS1 A;  2QJY C;  2WIT A;  1G1I A;  2YO3 A;  2AXC A;  3T97 B;  2Z4E A;  1FZF A;  2BCC D;  1SVF A;  2ZJS E;  5BVZ A;  5CCG D;  1VQP P;  1J1D B;  2RKL A;  3L71 E;  5AW3 B;  1FJP A;  3AEE C;  3H32 A;  4D6T J;  1SQV K;  3TGU J;  1IFN A;  3VN0 A;  4LGD E;  2M0B A;  4L74 A;  4Y99 B;  3JSV C;  3K5B A;  1VQ6 P;  5AVY B;  1EQ7 A;  4C7R A;  1FZE A;  1KIL A;  2BCC E;  1ZW0 A;  2WSE J;  3JCU E;  4A7P A;  1RF0 C;  1FDI A;  3L71 G;  1LT9 C;  1RQV A;  3M0D A;  4NPD A;  2E75 D;  4H44 C;  2GM4 A;  3TNU A;  1AQ5 A;  1QGK B;  2Y0D A;  2GUS A;  4WY4 D;  1E5W A;  2YKP A;  1GW4 A;  2H8P D;  5KKZ C;  1IJD B;  3R2P A;  5E79 H;  5AVS B;  3RK2 B;  1H89 A;  2IBZ G;  1Q2N A;  3S4R A;  2KNC A;  2PGD A;  4JYC A;  1OMI A;  2QJK C;  4DCK A;  3V4Q A;  1MZ9 A;  2XV5 A;  1EZV I;  1FZC A;  1M7L A;  2KI7 B;  2L5G B;  1T8Z A;  2WMM A;  3G3Z A;  1KC8 Q;  1URQ D;  3CC4 P;  2O01 H;  4EI2 A;  4RJT A;  1SQP D;  1BDC A;  4L75 A;  2R5D A;  1PGQ A;  3H1K D;  1KIL B;  4IFM A;  4K35 A;  1IFD A;  1LTB C;  1J1E B;  1FZB A;  1XTG B;  1NU1 K;  2YXQ B;  3L70 G;  3H1I D;  3L74 E;  3L75 D;  1M1J A;  3M9H A;  3PLN A;  3WU2 E;  5KAI H;  1BSH A;  1JMB A;  2V4H A;  3SWF A;  2AEJ A;  3KYQ A;  1SQQ D;  2YIU B;  2E76 C;  2Q1K A;  4Z1M H;  1DEB A;  3GF3 A;  3AE6 C;  2WSF J;  1N7S D;  2FYN C;  1GDT A;  1FDO A;  1VF5 B;  1ZP0 C;  3H1J G;  1LWU B;  2KZI A;  4U7J A;  2J5U A;  3L74 D;  2C9L Y;  4GOD A;  2QM8 A;  4TLF A;  1T3U A;  2ZXX A;  1JM0 A;  2C0W A;  1KFN A;  4N78 D;  2WT7 A;  3BVH A;  2OYI C;  1WRG A;  3H1H D;  4UB8 E;  5KAF H;  4UB8 H;  2Y0C A;  5KAF E;  2QRX A;  3KXD A;  5GTH E;  1RHZ B;  4W7Z A;  2QVA A;  3TK1 A;  2Q3E A;  3SFD C;  1OIP A;  4UB6 E;  4BRY B;  2QG4 A;  1SQB E;  2ZYD A;  4L76 A;  5AVW B;  3AE5 C;  3H1J E;  3JCU H;  1SQQ G;  4OGQ B;  3GHG C;  1FZC B;  2N1T A;  1RQU A;  2E75 B;  2QM7 A;  1GTW A;  4EYY Q;  4BWN A;  3I55 P;  2LR2 A;  5AVV B;  3HTK A;  1URQ C;  2M3E A;  2XU6 A;  4IL6 H;  3G9R A;  5CCH D;  4GOF A;  3MIW A;  1JO5 A;  1GMJ A;  3CXH H;  1JY3 P;  3PRJ A;  1QLE D;  1VL2 A;  1LNQ A;  3AE9 C;  1LTA C;  3BRV B;  3H1L D;  3HD7 A;  4GOE A;  3G71 P;  3D6Y A;  2WPR A;  5APS A;  4W7Y A;  3L73 D;  3Q3D A;  2I1K A;  5KLI C;  2HYN A;  1HUC A;  1SFC C;  1ZV8 A;  4WY4 A;  5AVR B;  1GL2 B;  2A06 G;  1LGH B;  1EDJ A;  1DD4 A;  3GF7 A;  4PJ0 H;  3PTZ A;  4U3F G;  3S9O A;  2FBW C;  2ZYA A;  5AW7 B;  2JWD A;  3EWK A;  4H0L C;  1LTS C;  1NYH A;  5CJ4 A;  3CCJ P;  2OYH A;  1HH0 A;  2BAS A;  1L0L K;  2PAJ A;  1LTJ C;  1J2J B;  2JEE A;  1IFP A;  3FWL A;  1Y47 A;  2HR3 A;  4Y28 J;  3CPW O;  3CCQ P;  4OVN F;  2HPC B;  2NZ2 A;  4B86 A;  1OX3 A;  1CZQ A;  3L75 G;  1RE3 C;  3L36 A;  3H1I G;  5CCG A;  4ZMD A;  1M1K Q;  1LP1 B;  1VQ4 P;  1A02 J;  1BCC J;  3Q2Y A;  3C1L A;  5CCH C;  1JEK A;  2BEZ F;  1P84 H;  2B88 A;  2K9Y A;  4JPZ B;  4N3Y B;  1OVV A;  1NJI Q;  2WPS A;  1R5S A;  1S5L X;  3L73 G;  1KB9 H;  1NU1 D;  2POH A;  2WQY C;  1FOS F;  5APV A;  4I7Z C;  4PD4 E;  4KHX A;  4HJG H;  2A06 D;  1S5L E;  3TYY A;  1EC5 A;  1VQL P;  1L0N E;  1SQP K;  1BE3 D;  1L0L G;  1K05 A;  1G2C B;  2D2C B;  2IPP A;  3H1L J;  1YIT P;  3A7O A;  2GUV A;  4OGQ D;  3RBZ A;  4I7Z B;  4ASV A;  1P84 I;  1SQX E;  1BE3 E;  3CC2 P;  1SFC B;  1JTH A;  1OZH A;  2NPS C;  2R3S A;  4WB4 A;  2KP8 A;  1K73 Q;  3IFM A;  1EXJ A;  1AFO A;  1IFI A;  3RBX A;  3AE2 C;  3MP7 B;  4AYC A;  4DOJ A;  3MTU E;  2M5A B;  3A2A A;  3M06 A;  5GTH H;  3VP8 A;  1QEX A;  5BU8 B;  1KQL A;  3FWN A;  5EFW B;  1NTM K;  1S9K E;  1FS0 E;  3L72 E;  2DW3 A;  1LTJ B;  2FYU D;  4R4M A;  1SQX D;  2QEX P;  1USD A;  3LID A;  1OXZ A;  2FFD B;  2H43 A;  1LT9 A;  3M0D C;  1NO4 A;  3F89 A;  3GHG B;  1RE4 A;  1ZOY C;  1BE3 G;  1L0L D;  5KLV J;  2KS1 B;  3QWO C;  1GL2 D;  4C7N A;  1IZN B;  1GL2 C;  3BCC E;  2WTY A;  3SWK A;  1VQM P;  1OVU A;  3VMX A;  1VQO P;  1H8A A;  1VPC A;  3TF5 A;  2K88 A;  3H1I J;  3VOP A;  1FAV A;  2LXB A;  3L75 J;  4OWF A;  1KZU B;  2P67 A;  3NXS A;  2ZT9 D;  3RL0 D;  1RF1 A;  3TDK A;  1Z56 A;  1OW6 A;  2RH0 A;  1KFM A;  2ZXE B;  3VYI A;  1HBW A;  2JWA A;  1URQ B;  1SP4 A;  3HE5 A;  4U3F J;  2A45 G;  4O9B A;  1CI6 A;  1VF5 C;  3H6P A;  1VQN P;  3CX5 H;  2R5B A;  3RK3 B;  3QH9 A;  3RK3 E;  1FZC C;  2AXT H;  1SQQ K;  4OGQ C;  1NTK G;  2OTL P;  3FX0 A;  1LTI C;  2E76 B;  2XDJ A;  3E1I A;  1JCC A;  4RO0 A;  2XKM A;  2WSF H;  4JBZ A;  4TT3 H;  4WWI A;  5E79 E;  3WUU A;  4JQ0 D;  1MV8 A;  2W90 A;  3MUD A;  3HE4 A;  1DX7 A;  3U59 A;  3HE4 B;  1IO4 A;  1PZQ A;  3L71 J;  1KQF B;  2IBZ D;  1VF5 D;  3FGA D;  5B66 H;  2KUB A;  2KXP B;  2WVR A;  5KLV K;  3TGU E;  3P8C E;  5APQ A;  3EFF K;  1AVO A;  5APU A;  2LKM A;  3WMM 0;  3GMA A;  3ZDM A;  1X8Y A;  5M1B A;  1VQ5 P;  2K9J B;  4ZNC A;  5TIS E;  4PD4 I;  3H1K G;  3RK2 C;  3BRT B;  1CI6 B;  3USS A;  3HUS B;  4N6J A;  1JY2 P;  3R4Y A;  1JY3 N;  1M57 D;  3HE5 B;  1T3J A;  2IDB A;  3D70 A;  2N1T C;  2AXT E;  1NTZ D;  4KJM A;  4QMA A;  3U1C A;  1SQB J;  2M8R A;  2NPS D;  3CC7 P;  4Y99 C;  3L74 J;  2UWJ E;  1GZL A;  4JF7 A;  2WSC J;  3CWB D;  5KJ7 A;  5AVT B;  3FXE A;  2FYU G;  1SQX G;  2NPS A;  1DD3 A;  1OW8 A;  2O1K A;  2OTK E;  2P10 A;  2RMZ A;  2ZYG A;  1PGO A;  1BDD A;  1TU3 F;  2O01 N;  5CHX A;  1L0N K;  1EZV E;  1SQP E;  1YTZ T;  2QJY B;  2XNX A;  3A3Y B;  1JCD A;  3CWB J;  2R3C A;  3P32 A;  5GTI E;  3CCU P;  2HOD B;  3S1K A;  2OAR A;  1K9M Q;  4GIF A;  1IFM A;  3BCC G;  1L4A A;  2KSE A;  3CXH I;  1EZV D;  3GLM A;  2ZFC A;  3L70 J;  1FC2 C;  4L73 A;  4XA4 A;  5C39 A;  4H13 D;  3CMA P;  3B5N A;  4I1L A;  3CI9 A;  3ITK A;  1QVG O;  3VMZ A;  1SQV E;  2IYO A;  3M9Q A;  5DJU B;  1E79 H;  1FZA A;  2KOG A;  2JJL A;  1JUN A;  2Q7C A;  1N73 B;  1LTT C;  2N1T D;  3MGN A;  3O6Q B;  4I6M C;  2W6B A;  3CCE P;  1KYO E;  5CMZ A;  1X22 A;  1YHQ P;  2M3B A;  1AQT A;  2N9B A;  3CWB G;  2W6A A;  1FDM A;  3F5H A;  5B5E E;  2N9Y B;  3B5N D;  3KPE A;  5H2F E;  3AED C;  3L37 A;  1G2C A;  2YKO A;  1L4A D;  1N7L A;  1PPJ E;  1N86 A;  1Y8A A;  2Y0E A;  3Q5R A;  4HKZ H;  1K8A Q;  1SQV J;  2OYI B;  2YXR B;  1ZME C;  4YTP C;  1YBK A;  1BGY D;  2RN0 A;  2WSE H;  2A06 E;  3AE4 C;  2QJP C;  1L0N D;  1MFZ A;  1U57 A;  4PD4 D;  3TSI A;  4YXW H;  3G4S P;  3CCM P;  1RF1 B;  1ZN5 A;  1KD1 Q;  3TGU D;  2E5Y A;  1NOH A;  2B87 A;  1AJY A;  2WPV B;  5TJH A;  1JY2 N;  3SFE C;  2WZ7 A;  1N7S A;  2QA4 P;  1L0N J;  1GU5 A;  2Q6Q A;  3H1K J;  1SQX K;  4PD4 H;  5AW2 B;  2FYU K;  1ZLL A;  3B4S A;  3H1L E;  4IL6 E;  1NTZ E;  1ZR2 A;  1M90 Q;  2BCC G;  3N4X A;  3RL0 g;  1IK7 A;  1KQS O;  1PV3 A;  1N73 C;  1QVF O;  1QL2 A;  2HG5 D;  4IL6 X;  2FFD A;  1DIP A;  2H89 C;  2GA1 A;  2R32 A;  3JC2 2;  3HD7 D;  5K5G B;  4MN4 C;  3CLQ A;  4GT1 A;  4WBA A;  1YI2 P;  1L2P A;  4H13 C;  3RK2 D;  2WPQ A;  1P84 D;  2W6J H;  4WY4 B;  1YQ3 C;  3V2P A;  2O1J A;  1MUU A;  3O8Z A;  1JOC A;  3WUT A;  2H7H A;  3Q5S A;  4R4L A;  3L72 J;  1NTK J;  1T6A A;  3M91 A;  4D6T D;  3CCL P;  3L35 A;  3Q5P A;  1YJW P;  1KB9 D;  1PPJ G;  4HB1 A;  2R44 A;  5KLV E;  3NFQ A;  3GW6 A;  3C8V A;  5APT A;  2OTJ P;  3OJA B;  1USE A;  1HGZ A;  1NH4 A;  1KYO D;  1WT6 A;  2E74 C;  3BCC D;  4PV1 C;  1LT1 A;  2IBZ I;  1R8E A;  2QIW A;  3L70 D;  2N1T B;  5GTI H;  3LW5 J;  1PGP A;  2WSS H;  3A0B E;  1VQ7 P;  5AW6 B;  1N7S B;  3HUS C;  3PH0 A;  2C9N Y;  3BAS A;  1SQX J;  2JDI H;  2B87 B;  1GK4 A;  1R5L A;  2JP3 A;  3WU2 H;  2K37 A;  3RK3 C;  2H88 C;  2P58 A;  2YNY A;  2C0X A;  3L74 G;  1SQQ E;  3MHV A;  3V4W A;  1SQB G;  1BE3 J;  1HJB A;  2Z5I A;  1LP1 A;  2P7J A;  4JYB A;  5KLV G;  2WT7 B;  3H1H G;  1ZXG A;  3CD6 P;  3AE1 C;  2O01 J;  1FJK A;  2HPC A;  3AE8 C;  1PL5 A;  2IFM A;  3P8C D;  1Q81 Q;  1CSB A;  1GK6 A;  1AVY A;  1JY3 O;  2ZT9 C;  1PP9 E;  3RL0 C;  2IBZ E;  1YJN P;  2OQQ A;  3SSU A;  5KTB A;  2AEF A;  2G8Y A;  1AV1 A;  2MJZ A;  3L72 D;  3O6Q A;  1NAF A;  1NTK K;  2KLV A;  3LIE A; 
#chains in the Genus database with same CATH homology
 1QL1 A;  2VRS A;  3V2Q A;  2J58 A;  2KB7 P;  1YYC A;  3HD7 B;  1IK9 A;  3HTK B;  2Q3I A;  4HYT B;  5AVQ B;  1G1J A;  1FOS E;  4GKG A;  2FXM A;  1H88 A;  2NPS B;  1X79 B;  4IFF A;  1NWQ A;  5BU5 A;  4HH2 A;  1FU1 A;  1HGV A;  1NKZ B;  3P8M C;  3TNU B;  1GU4 A;  2IX7 C;  3B5N C;  2FFD C;  1M1J C;  4EOT A;  3MD0 A;  1IC2 A;  1NKN A;  5KJ7 C;  2OYI A;  3V2R A;  1NTZ K;  3OA7 A;  1VDF A;  1LWU A;  1CW5 A;  3VMY A;  3T97 A;  3SWY A;  1JNM A;  1HWT C;  1L4A C;  1N73 A;  1JY2 O;  5AVZ B;  1M1J B;  4XE5 B;  1RF0 A;  3B5N B;  1NHL A;  2WWW A;  1L4A B;  1RY3 A;  5APW A;  2HOD A;  3M9B A;  3P7K A;  4N78 E;  4EIJ A;  3L4F A;  4M3L A;  1T2K D;  1T2K C;  2I1J A;  2YO2 A;  1HTL C;  4LLH A;  1FZG A;  2FYZ A;  3HD7 C;  3HRN A;  4IFD K;  3EFG A;  4AQR D;  5AW1 B;  2HFE D;  3H32 B;  3HUS A;  3KDP B;  5AW8 B;  3I5C A;  1A02 F;  1PFI A;  3GHG A;  5AVX B;  2E42 A;  3NTN A;  4RES B;  3RL0 B;  4ZKP A;  4W80 A;  2KSJ A;  1W2E A;  1OWA A;  5CJ0 A;  3M0A A;  3EQ2 A;  2XZR A;  1LWU C;  1GW3 A;  5CCH A;  2CPS A;  1JTH B;  1SFC A;  2CPB A;  1X9V A;  3OAK A;  3RK3 D;  1N7S C;  3VTP C;  2J59 M;  3NMD A;  2PP6 A;  3V5B A;  2A45 H;  1J1E C;  2W27 A;  1URQ A;  1KIL C;  1DH3 A;  5AW0 B;  3IR9 A;  2IFN A;  1SQB K;  1GD2 E;  3BAT A;  4C46 A;  4DZO A;  4WY4 C;  5AW9 B;  3KQG A;  3N7N A;  4C7N B;  2A45 I;  5KJ7 D;  1LT9 B;  2KYV A;  2P1J A;  1LTJ A;  1SLQ A;  3II6 A;  1ZR4 A;  5AW5 B;  1YTZ I;  1LTG C;  3PP5 A;  1JMM A;  5AVU B;  1GL2 A;  5CCG C;  1FBM A;  1XTC C;  1HVV A;  2Q9I A;  3VP9 A;  3A5T A;  5APX A;  2OYH C;  3LW5 H;  5AW4 B;  1RF1 C;  4OH8 B;  3B8E B;  4AUW A;  1S9K D;  2Q5U A;  2YKQ A;  4LC1 A;  2E43 A;  2WSC H;  1RE4 C;  3CL3 D;  1KIL D;  1J1D C;  1N2D C;  3C9I A;  5APY A;  4I2L C;  1SFC D;  2FKW B;  2Z5H A;  1RE3 A;  2HLO A;  2YMY A;  3UIA A;  2OYH B;  2P2U A;  1IFJ A;  2Z4E A;  2WIT A;  1G1I A;  2YO3 A;  1FZF A;  1SVF A;  5BVZ A;  5CCG D;  1J1D B;  5AW3 B;  1FJP A;  3H32 A;  1SQV K;  1IFN A;  3VN0 A;  4LGD E;  4Y99 B;  5AVY B;  1EQ7 A;  4C7R A;  1FZE A;  1KIL A;  1RF0 C;  1LT9 C;  3M0D A;  2GM4 A;  3TNU A;  2GUS A;  4WY4 D;  1E5W A;  2YKP A;  1GW4 A;  2H8P D;  1IJD B;  3R2P A;  5AVS B;  3RK2 B;  1H89 A;  4JYC A;  1FZC A;  3V4Q A;  1MZ9 A;  2XV5 A;  1M7L A;  2L5G B;  1T8Z A;  3G3Z A;  1URQ D;  2O01 H;  2R5D A;  1KIL B;  4IFM A;  1IFD A;  1LTB C;  1J1E B;  1FZB A;  1XTG B;  1NU1 K;  3M9H A;  1M1J A;  3SWF A;  3KYQ A;  1DEB A;  1N7S D;  1GDT A;  1LWU B;  2C9L Y;  2QM8 A;  1T3U A;  2WT7 A;  2C0W A;  1KFN A;  4N78 D;  3BVH A;  1WRG A;  4W7Z A;  3TK1 A;  5AVW B;  3GHG C;  1FZC B;  2N1T A;  2QM7 A;  1GTW A;  5AVV B;  3HTK A;  1URQ C;  2XU6 A;  5CCH D;  3MIW A;  1JO5 A;  1JY3 P;  3HD7 A;  1LTA C;  3BRV B;  2WPR A;  5APS A;  4W7Y A;  2I1K A;  2HYN A;  1HUC A;  1SFC C;  1ZV8 A;  4WY4 A;  5AVR B;  1GL2 B;  1LGH B;  5CJ4 A;  1LTS C;  2OYH A;  1HH0 A;  2BAS A;  1L0L K;  2PAJ A;  1LTJ C;  1J2J B;  2JEE A;  5AW7 B;  1AQ5 A;  2HPC B;  4B86 A;  1CZQ A;  5CCG A;  1RE3 C;  3L36 A;  1A02 J;  5CCH C;  4N3Y B;  2WPS A;  2POH A;  1FOS F;  5APV A;  4KHX A;  3TYY A;  1SQP K;  1G2C B;  2IPP A;  3A7O A;  2GUV A;  1SFC B;  1JTH A;  2NPS C;  4WB4 A;  2KP8 A;  1AFO A;  3IFM A;  1IFI A;  4AYC A;  4DOJ A;  3MTU E;  3A2A A;  3M06 A;  3VP8 A;  5BU8 B;  1KQL A;  1NTM K;  1S9K E;  1LTJ B;  2FFD B;  3LID A;  1OXZ A;  2H43 A;  1LT9 A;  3M0D C;  1NO4 A;  3GHG B;  1RE4 A;  1GL2 D;  4C7N A;  1GL2 C;  2WTY A;  1H8A A;  3VMX A;  1VPC A;  3VOP A;  1FAV A;  1KZU B;  2P67 A;  3NXS A;  3RL0 D;  1RF1 A;  1Z56 A;  3VYI A;  1KFM A;  2ZXE B;  1HBW A;  1URQ B;  1SP4 A;  3HE5 A;  2A45 G;  4O9B A;  1CI6 A;  3H6P A;  2R5B A;  3RK3 B;  1FZC C;  1SQQ K;  1LTI C;  2XDJ A;  3E1I A;  3U1A A;  1JCC A;  2XKM A;  2WSF H;  1MV8 A;  3MUD A;  3HE4 A;  1DX7 A;  3U59 A;  3HE4 B;  1IO4 A;  5KLV K;  3P8C E;  5APQ A;  5APU A;  2LKM A;  3WMM 0;  1X8Y A;  3RK2 C;  3BRT B;  1CI6 B;  3HUS B;  4N6J A;  1JY2 P;  1JY3 N;  3HE5 B;  1T3J A;  2N1T C;  3U1C A;  2NPS D;  2M8R A;  4Y99 C;  4JF7 A;  1GZL A;  5KJ7 A;  5AVT B;  2NPS A;  2O1K A;  5CHX A;  1L0N K;  1YTZ T;  2XNX A;  3A3Y B;  3P32 A;  1JCD A;  2R3C A;  2HOD B;  2OAR A;  4GIF A;  1IFM A;  1L4A A;  3V2N A;  4ZKU A;  2ZFC A;  4XA4 A;  3B5N A;  4I1L A;  3CI9 A;  3VMZ A;  3M9Q A;  1FZA A;  2KOG A;  2JJL A;  1JUN A;  2Q7C A;  1N73 B;  1LTT C;  2N1T D;  3MGN A;  4I6M C;  2W6B A;  5CMZ A;  2M3B A;  2N9B A;  1FDM A;  2W6A A;  3B5N D;  3KPE A;  3L37 A;  1G2C A;  2YKO A;  1L4A D;  1N7L A;  1N86 A;  2OYI B;  2WSE H;  1MFZ A;  3TSI A;  2OYI C;  1RF1 B;  1ZN5 A;  1NOH A;  1JY2 N;  2WZ7 A;  1N7S A;  1GU5 A;  1SQX K;  5AW2 B;  2FYU K;  1ZLL A;  1ZR2 A;  3N4X A;  1N73 C;  1QL2 A;  2HG5 D;  2FFD A;  2R32 A;  3HD7 D;  3CLQ A;  4GT1 A;  4WBA A;  3RK2 D;  2WPQ A;  4WY4 B;  3V2P A;  2O1J A;  1MUU A;  3O8Z A;  1JOC A;  2H7H A;  3M91 A;  3L35 A;  3NFQ A;  5APT A;  3OJA B;  1WT6 A;  1HGZ A;  1NH4 A;  2N1T B;  5AW6 B;  1N7S B;  3HUS C;  2C9N Y;  3BAS A;  1GK4 A;  3RK3 C;  2YNY A;  2C0X A;  3V4W A;  1HJB A;  2Z5I A;  4JYB A;  2P7J A;  2WT7 B;  1FJK A;  2HPC A;  2IFM A;  3P8C D;  1CSB A;  1GK6 A;  1JY3 O;  3RL0 C;  5KTB A;  2MJZ A;  1NAF A;  1NTK K;  2KLV A;  3LIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...