3WU2H

Crystal structure analysis of photosystem ii complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
b'ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9 A
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
total genus 14
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 3wu2H01
5TISH 1S5LH 4PJ0H 4IL6H 4UB6H 2AXTH 4UB8H 3WU2H 5KAFH 3A0BH 5GTHH 3A0HH 5KAIH 3KZIH 5B5EH 5GTIH 5B66H 3JCUH 5H2FH 5E79H
chains in the Genus database with same CATH superfamily
1S2EA 1DEBA 1KFNA 2A06E 4OGQD 4XE5B 1T3JA 1OVRA 5AW5B 3AE8C 1M56D 4PV1C 4N78D 3H1JJ 5AW8B 2LXCB 1J1EB 1Q7YQ 1URQC 3CWBE 2OYIA 1VF5D 1EDJA 1LTIC 5H2FE 1X79B 1SQXD 1NVOA 4DCKA 3OW2O 4JBZA 3BCCG 5AVRB 3I5CA 5GTHE 1Q82Q 1UIIA 2IBZE 2YKQA 1S5LH 1BCCD 4D6TE 1KQGB 2HPCB 3LW5J 3MHVA 3HD7D 1KYOI 1JNMA 2CPBA 4I1LA 3IFMA 1S9KD 4Y99B 1YTZT 3AEBC 3L72D 3FWLA 2V4HA 5K5GB 2JEEA 3L4FA 1L0LJ 2KSEA 3A0BH 2AEMA 1LNQA 1OWAA 2OYOA 3TNUA 1N73B 2M5AB 5B5EH 3MUDA 1OXZA 5KLVD 3VP9A 2RH0A 1SQBE 1S5LX 4TT3H 2WSEJ 1AVYA 5AW3B 2QJKC 2BCCD 3WU2H 2K88A 2KS1A 1JY3N 1ZP0C 2YIUB 1KYOE 2P7JA 3G4SP 2E76B 2BEZF 5KKZC 2M3BA 3B5ND 2FYNB 1GL2B 2AEJA 1BCCJ 3H1HJ 3TYYA 2N9BA 4H44C 2FYUJ 3L75D 3L35A 4PD4D 5BU5A 2A45H 2O01N 2QJPB 1SQBK 2H43A 1FU1A 5KJ7A 4I6MC 1LTBC 3AEEC 1FJPA 3H1LD 4ZKUA 4CPGA 4L73A 3M91A 4H44B 5KLVJ 1G2CA 1PZQA 3L71E 2W27A 3V4WA 2WSEH 1KN7A 3HTKB 3NTNA 2C0XA 1NU1E 5TISH 1DIPA 2O01J 1FAVA 3A0HE 1U57A 1SQVG 3L70D 3L74E 4PJ0E 3V2PA 1KZUB 4K3AA 1CI6B 5CCGA 3CMEP 2ITAA 1SFCA 3GHGB 1VQ9P 2W6BA 1KTMA 3PH0A 4JPZB 5CCHA 1PP9G 5E79E 1OIPA 1AQTA 2OTKE 2FFDB 3SFDC 3F5HA 3H1JG 1JMMA 1VQ8P 1X8YA 2M3EA 2Y0EA 1VQ4P 3U59A 3BCCD 1URQD 1MUUA 1KQLA 1AA0A 1FOSF 4M3LA 4UB6E 1L4AC 1VQ5P 4WY4B 1EZVI 1JTHA 1ZOYC 3H1LJ 1BDDA 3GG2A 3KZIE 4IL6H 2Q3IA 1NAFA 1JMBA 3TGUD 3MGNA 1KB9E 5AVUB 5AW7B 1GZLA 2E42A 2WWWA 1EXIA 4DT0A 1PGPA 2NRGA 1M1JA 3V4QA 5B66H 1IK9A 1CZQA 1L4AB 1L0LG 1NGMB 1SQQE 1OW7A 2D2CC 1NOHA 3NFQA 2AXCA 1NTZK 3FXDA 2WTYA 3BRVB 3CC2P 1RE4C 1OW6A 4HB1A 1BE3J 2O1JA 4GIFA 2E76D 2ZXEB 4N6JA 3F89A 4MN4C 1GL2D 4HJGH 1FZCA 4UB8E 3AE6C 1LT9B 2D2CB 4PD4H 3CXHI 2MKVA 1LWUA 1EXJA 3II6A 1P84E 3CPWO 1BCCG 1G1IA 3H1HG 1SQQK 3RGUA 1QVFO 1PPJD 2ZT9B 1CI6A 3CX5E 2FYUG 3CI9A 3TGUJ 1JCCA 1X22A 1OFCX 2Z5IA 3FX0A 4LLHA 2M0BA 1OZHA 4H44D 2WPQA 4I7ZC 2KYVA 4KT0J 3G9RA 5KAIH 3K5BA 1L0ND 2N1TA 1RE3A 2R3SA 3MD0A 1LTJB 1SQPE 2O1KA 1T8ZA 2OYIB 1YTZI 1YITP 3I55P 1IFNA 5KLVG 5AVZB 2Y0DA 1IFMA 3ABVC 3AE2C 4HH2A 1UIXA 2YKOA 1BGYD 1SVFA 3WMM0 3Q5RA 1SQVD 4KHXA 3KYQA 1VQKP 4O9BA 3MUDC 2W6JH 3AE7C 1NU1G 1PP9D 1N7SA 1RF1B 3AE3C 2WZ7A 3V6IA 3PRJA 1FDOA 2E43A 3H1JD 1M57D 3O6QA 1SQPK 2VRSA 1GW4A 4WY4D 4YXWH 2XDJA 2JDIH 1KILA 3G6EP 5CJ0A 4ASVA 3IR9A 2QSIA 1N2DC 1HJ0A 2QM8A 1S3JA 3CWBD 1S5LE 3MP7B 1L0NJ 3OJAB 1YJWP 1NHLA 3H25A 1PGJA 2V7QJ 1K04A 2IFNA 3H1LG 1L4AD 2WPSA 3NXSA 1JY2O 1LT9A 2HG5D 5TJHA 1Q90D 5KJ7C 3CXHH 2IBZD 2YNYA 4D6TD 3VYIA 2KNCA 1BGYJ 1E79H 1J1EC 4NPEA 2NPSA 3A0BE 3Q1MA 2WSCJ 2GUVA 5B5EE 3D6ZA 1FDMA 2E74B 4GDOA 4RKUJ 2A45I 1RF0A 1PP9J 2G3AA 2WPRA 1BE3G 3CCSP 3AEAC 2D2CD 2KSJA 1XTCC 4EDFA 1FC2C 3H1KJ 3NMDA 1LTAC 4GOEA 3UIAA 4U3FE 1IJDB 3G3ZA 3E1RA 4BXLA 1LTJA 4JYCA 5CCGC 2HYNA 5APSA 4Y99C 2OTLP 1SFCC 4L76A 5AW6B 5CCHC 1NWQA 5AW1B 2YXQB 1G2CB 3HUSA 2P1JA 3RK2B 2IZ0A 2PFXA 3W68A 1H0TA 1NAYA 3VP8A 3CWBJ 1GD2E 3JCUH 1KILE 1NTKE 2SPZA 3H1HD 1N73C 3R4YA 2V7QH 2I1KA 2WITA 1MZ9A 1VL2A 1WMKA 2FYUD 3FGAD 3WUVA 1SFCB 3TGUG 2YO3A 1RF1A 4D6TJ 2ZVNB 3V5BA 4YTPC 2OARA 2YIUC 1Q2NA 1PL5A 2FXMA 1FZBA 1VQNP 2E76C 1Y47A 1HVVA 2FYNC 1FZFA 1IZNB 3U1CA 4WVZA 1GL2C 2PRRA 2AEFA 3P8CE 5TISE 2P2UA 4LGDE 1QEXA 1NTKK 4N78E 3B5NA 1QLED 3S4RA 1JTHB 1QX8A 5KLIB 1SQBJ 3P8MC 2IZ1A 1TU3F 2QJPC 2E75C 1OX3A 1SQXE 2KI7B 1NU1D 2LKMA 1S4XA 3L73E 2FBWC 3KXDA 5AW0B 1USEA 1S72P 2IYOA 3L74D 2JWAA 1NTME 2XV5A 1M1JB 1L0LK 3D71A 2IFMA 4IFFA 5H2FH 3D70A 3LW5H 2QM7A 1PPJG 3Q5SA 1S9KE 3S1KA 2KIKA 1LWUC 2E75B 3L72E 1H8AA 4KJMA 1EDKA 3EWKA 1KD1Q 1JUNA 1L0NG 4H0LC 5L8RJ 2JR8A 2E5YA 1W2BO 1FZCB 4IL6E 1AVOA 3GHGC 3GLMA 1SQXK 3SWKA 4PD4I 2OYHA 5DJUB 2E74D 2FFDC 1LWUB 1NTMK 1BGYG 4JYBA 5B66E 4EIJA 2KLUA 2YKPA 5KJ7D 2WT7A 3SWYA 1ZN5A 2QRXA 4L74A 3D6YA 4H0LB 3L71J 4OH8B 5AW9B 3H6PA 1JY3O 3EFGA 1NU1J 3USSA 3FWNA 1BE3D 3H32A 4W7YA 2W6AA 4WY4C 3L74J 1SQQD 3M9QA 4U7JA 3H1KG 1H89A 1VQPP 2IYPA 2N1TB 2B89A 1URQA 2FXOA 2A06G 1NTZE 2C9LY 2UWJE 3L75E 3AEDC 4PD4E 3MZWB 5CCGD 5M1BA 1DEEG 4RJTA 5BU8B 1SFCD 3M0DA 2XU6A 5CCHD 1ZW0A 3CWBG 4EOTA 4H13B 2B88A 1KV4A 1QGKB 1ZV8A 2OQQA 2GM4A 3H1IE 4Z1MH 3CLQA 4C7NA 2JKVA 1N7SB 1P84D 2C0WA 2IBZG 3HE4A 4ZKPA 4D6TG 1QL2A 5KAIE 1Q81Q 1EDLA 2J59M 2O01H 3CX5D 1PFIA 3L70E 2Y0CA 3O6QB 3GMAA 2BASA 2WMMA 3HE5A 1LT9C 2B87A 1KILB 1RY3A 3AE4C 1PGOA 2KZJA 5APQA 2M8RA 2KK7A 1QL1A 3R2PA 1SQQJ 1GMJA 3MIWA 5BVZA 1SQPD 1EZVE 3M9HA 3N7NA 4PJ0H 1IFDA 2PP6A 4GODA 1RHZB 2ZT9C 2GUSA 1RQVA 4L75A 1AQ5A 1FZAA 3RK3E 1SQBG 1YHQP 3QWOC 2ZJSE 1KFMA 3KPEA 1EC5A 4RESB 1R5SA 3BCCE 2K9YA 3M0AA 1BDCA 3VOPA 2KNCB 5APUA 2FYZA 2E75D 1LTJC 4QMAA 3M9BA 1HBWA 2OYIC 2NPSB 1QVGO 1IO4A 2QE7H 1D7MA 4IFMA 2PGDA 3Q2YA 2QA4P 3HUSC 4Y28J 5APWA 2IX7C 1KORA 1NH4A 1ZRTE 3U1AA 2R32A 1PIXA 2L5GB 3A7OA 1YYCA 1AJYA 4XA4A 1AFOA 3KZIH 3AEFC 3PHLA 2RMZA 4HKZH 1K9MQ 5APVA 1RF1C 3PJSK 4H0LD 3CXHE 4RO0A 3HUSB 1W2EA 3HD7B 2YO2A 3BASA 1JY2N 2AXTE 4GKGA 4GT1A 1N7LA 1H0TB 1SQPJ 5EFWB 1FS0E 3BRTB 1USDA 1FBMA 3TSIA 3E7KA 3L71G 3WUTA 1IFJA 4TLFA 1HWTC 2QVAA 1HTLC 3GF7A 1MKMA 3HRNA 3PP5A 3KDPB 3L74G 5CJ4A 3H1KD 4DZOA 2RKLA 2W83C 2ZXXA 4UB8H 2R5DA 4H13D 2A06D 4N3YB 1T3UA 1HGZA 4NPDA 1P84H 5AW2B 3JCUE 1N7SD 3EFFK 1WT6A 3B5NB 2Z5HA 3OAKA 2YMYA 2K37A 2E74C 1SS1A 3ZDMA 3GF3A 3P7KA 1KILD 2PAJA 1E5WA 2IPPA 3OA7A 3H1IG 1HH0A 1SQVE 3VTPC 2I1JA 4HYTB 3M06A 1GTWA 3FXEA 1IFPA 1HF9A 4ASWA 2NZ2A 2FY8A 4C7RA 3RK2C 1JM0A 1RH5B 1X9VA 5KAFH 2KZIA 2P58A 2IBZI 1M90Q 3WU2E 1SQQG 1XTGB 2K1AA 3LIEA 1IC2A 1L0NK 1VDFA 3H1JE 1SP4A 3VMXA 4JQ0D 2NPSD 1SQBD 3LIDA 1L2PA 2C9NY 1H88A 3P8CD 3A5TA 1J1DC 2ZT9D 3RK3C 2WPVB 2OYHB 1EZVG 1YI2P 3HD7A 1RQUA 4U3FJ 2K9JB 1DX7A 1DH3A 3B4SA 2ZAEB 5GTIH 1Y9BA 1KYOD 1LP1A 1Q86Q 4WBAA 4R4LA 1FDIA 1ZR4A 3RL0B 1BSNA 1SQVK 2WT7B 1SLQA 3IAOA 3V2NA 2ZYAA 1G1JA 3L73D 1EDIA 2QEXP 1LJ2A 2R5BA 1N86A 3CCJP 2Z4EA 4EI2A 3CMAP 1NTMD 3M0DC 1NTKJ 2KB7P 1J1DB 5CHXA 3H32B 2OTJP 3RK3B 2YXRB 2H7HA 4PV1B 3EQ2A 3WUUA 1L0LE 4WB4A 5KLIC 1URQB 1JB0J 2Q6QA 3IF4A 5APYA 2WSCH 1FZGA 1M1JC 3V2RA 3Q5PA 1OVVA 2WQYC 1LT1A 1SQPG 2CK3H 3GW6A 4OWFA 2KUBA 3CC4P 3MTUE 1GU5A 3L71D 4DOJA 4YXDC 1FE6A 4C7NB 1FZEA 3HE4B 2CPSA 1X0TA 1BSHA 1K73Q 3QH9A 1M1KQ 1R5LA 5AW4B 1BCCE 1FZCC 2QIWA 1Y8AA 3H1HE 4NPFX 1PGQA 1SQXJ 2QJYC 3HE5B 5AVVB 3L73J 5CMZA 2WSFJ 1W5CE 5AVYB 1GDTA 2B87B 2FYUE 1MV8A 3V2QA 5GTHH 1NTMJ 1YJNP 1LTTC 2XZRA 2XNDH 3RBXA 2QJKB 2YMKA 2QG4A 4I2LC 2Q5UA 1DD4A 1IK7A 1NTZD 3CCLP 2ZVOB 4BRYB 5KTBA 3SWFA 3L72J 2J58A 2H88C 2QJYB 5KKZB 1FJKA 5KLVE 2ZFCA 4AYCA 2K9JA 2P67A 4B86A 2N1TC 1RE3C 2BCCE 4W7ZA 1FOSE 3H1ID 4C46A 3AEGC 1JY2P 2GA1A 3C8VA 3A3YB 1KB9D 4AUWA 3CCVP 4R4MA 2FYUK 2LR2A 2BCCJ 1U7JA 1NKNA 3ITKA 2R44A 1OW8A 2HPCA 4H13C 1VQ7P 3CCEP 4OVNF 3RBZA 3RK2D 1KYOH 3CC7P 4YPCA 2Q1KA 1OVUA 5AVWB 3RL0D 3CCMP 1KQSO 1NJIQ 1KB9I 1N7SC 3B8EB 1ZXGA 2WSFH 4GOFA 3BVHA 3P32A 3RL0g 5KLVK 3VMAA 1EZVD 4U3FG 3CL3D 3C9IA 1IFIA 2E5TA 1NKZB 3VN0A 1NTZJ 3RK3D 4K35A 1N73A 2H8PD 3L75J 4PV1D 2I8DA 2M5AA 2L91A 1KILC 5APXA 3H1LE 2OGUA 1GW3A 1VPCA 3TK1A 1NU1K 1NTKG 1JCDA 5AVTB 3E1IA 3G71P 3SSUA 3H1IJ 3AECC 1ZLLA 2P10A 1YBKA 1S1CX 2A45G 1ZRTD 1N8RQ 3B71A 2KLVA 1YJ9P 4AQRD 3JC22 3T97B 1GL2A 3JSVC 5CBOA 2WSSH 1T2KC 2BEQD 2POHA 1BE3E 5AVQB 1P84I 3A0HH 3L70J 4OGQC 2Q7CA 3W67A 2NPSC 4W80A 4JF7A 1GU4A 1U7MA 1T6AA 4BRYA 2Q9IA 3CX5I 2KXPB 3CXHD 2WVRA 3TF5A 1RF0C 5DJTB 4A7PA 2HR3A 1HJBA 1VF5C 2J5UA 5E79H 3VMYA 2W90A 4IL6X 4WWIA 3O8ZA 1YQ3C 3VMZA 2H89C 4OGQB 4XFJA 1ZMEC 3SFEC 5AVSB 2N9YB 3AE5C 1SQXG 2HODB 2W8ZA 3BCCJ 3L73G 2R3CA 1LTGC 2LXBA 3HD7C 3C1LA 2IDBA 3TGUE 3HTKA 1CW5A 1NTMG 4UB6H 3CCRP 5APTA 1VF5B 3IN6A 1YQ4C 4ZNCA 2Y9ZA 3GHGA 3AE9C 3PTZA 1KB9H 3L72G 3L36A 1WRGA 2XKMA 2XNXA 1NO4A 1LGHB 2FFDA 2ZYGA 2Y9YA 3I56P 1KMIZ 1LP1B 1OMIA 1GK6A 1J2JB 1VQ6P 1ZR2A 1EQ7A 1A02J 2ZYDA 2HLOA 2FXPA 1HUCA 1GK4A 2MJZA 3AE1C 1M8OB 2N1TD 2G8YA 4BWNA 3N4XA 1KC8Q 5KAFE 2BCCG 1VQMP 1VQOP 4WY4A 2JJLA 2DW3A 1PV3A 3TDKA 4I7ZB 4IFDK 2HFED 3B5NC 2KP8A 4IOIH 3CCUP 1KQFB 2JWDA 1Z56A 3KHUA 1YIJP 1JY3P 3CD6P 1PPJE 4EYYQ 3PLNA 2JO1A 3T97A 2B9BA 4U3FD 2K3RA 5GTIE 1L4AA 2FKWB 1LTSC 3TNUB 1A02F 1L0NE 1NTZG 1M7LA 3CCQP 3L75G 1CSBA 3CX5H 4DJGA 1DD3A 1K05A 1JEKA 1K8AQ 1VQLP 1NTKD 2KS1B 1BGYE 1MFTA 2RN0A 1MFZA 2O3JA 1HGVA 2HODA 1JO5A 1NYHA 2Q3EA 3BATA 5CBNA 3Q3DA 3KQGA 1AV1A 2OYHC 1R8EA 2AXTH 3L37A 1RE4A 5C39A 2JP3A 4LC1A 1PP9E 1SQVJ 1L0LD 3RL0C 3S9OA 1JOCA 3L70G 3A2AA 2KOGA 3H1KE 4ZMDA 5AVXB 1T2KD
chains in the Genus database with same CATH topology
5TISH 1S5LH 4PJ0H 4IL6H 4UB6H 2AXTH 4UB8H 3WU2H 5KAFH 3A0BH 5GTHH 3A0HH 5KAIH 3KZIH 5B5EH 5GTIH 5B66H 3JCUH 5H2FH 5E79H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TIS H;  1S5L H;  4PJ0 H;  4IL6 H;  4UB6 H;  2AXT H;  4UB8 H;  3WU2 H;  5KAF H;  3A0B H;  5GTH H;  3A0H H;  5KAI H;  3KZI H;  5B5E H;  5GTI H;  5B66 H;  3JCU H;  5H2F H;  5E79 H; 
#chains in the Genus database with same CATH topology
 1S2E A;  1DEB A;  1KFN A;  2A06 E;  4OGQ D;  4XE5 B;  1T3J A;  1OVR A;  5AW5 B;  3AE8 C;  1M56 D;  4PV1 C;  4N78 D;  3H1J J;  5AW8 B;  2LXC B;  1J1E B;  1Q7Y Q;  1URQ C;  3CWB E;  2OYI A;  1VF5 D;  1EDJ A;  1LTI C;  5H2F E;  1X79 B;  1SQX D;  1NVO A;  4DCK A;  3OW2 O;  4JBZ A;  3BCC G;  5AVR B;  3I5C A;  5GTH E;  1Q82 Q;  1UII A;  2IBZ E;  2YKQ A;  1S5L H;  1BCC D;  4D6T E;  1KQG B;  2HPC B;  3LW5 J;  3MHV A;  3HD7 D;  1KYO I;  1JNM A;  2CPB A;  4I1L A;  3IFM A;  1S9K D;  4Y99 B;  1YTZ T;  3AEB C;  3L72 D;  3FWL A;  2V4H A;  5K5G B;  2JEE A;  3L4F A;  1L0L J;  2KSE A;  3A0B H;  2AEM A;  1LNQ A;  1OWA A;  2OYO A;  3TNU A;  1N73 B;  2M5A B;  5B5E H;  3MUD A;  1OXZ A;  5KLV D;  3VP9 A;  2RH0 A;  1SQB E;  1S5L X;  4TT3 H;  2WSE J;  1AVY A;  5AW3 B;  2QJK C;  2BCC D;  3WU2 H;  2K88 A;  2KS1 A;  1JY3 N;  1ZP0 C;  2YIU B;  1KYO E;  2P7J A;  3G4S P;  2E76 B;  2BEZ F;  5KKZ C;  2M3B A;  3B5N D;  2FYN B;  1GL2 B;  2AEJ A;  1BCC J;  3H1H J;  3TYY A;  2N9B A;  4H44 C;  2FYU J;  3L75 D;  3L35 A;  4PD4 D;  5BU5 A;  2A45 H;  2O01 N;  2QJP B;  1SQB K;  2H43 A;  1FU1 A;  5KJ7 A;  4I6M C;  1LTB C;  3AEE C;  1FJP A;  3H1L D;  4ZKU A;  4CPG A;  4L73 A;  3M91 A;  4H44 B;  5KLV J;  1G2C A;  1PZQ A;  3L71 E;  2W27 A;  3V4W A;  2WSE H;  1KN7 A;  3HTK B;  3NTN A;  2C0X A;  1NU1 E;  5TIS H;  1DIP A;  2O01 J;  1FAV A;  3A0H E;  1U57 A;  1SQV G;  3L70 D;  3L74 E;  4PJ0 E;  3V2P A;  1KZU B;  4K3A A;  1CI6 B;  5CCG A;  3CME P;  2ITA A;  1SFC A;  3GHG B;  1VQ9 P;  2W6B A;  1KTM A;  3PH0 A;  4JPZ B;  5CCH A;  1PP9 G;  5E79 E;  1OIP A;  1AQT A;  2OTK E;  2FFD B;  3SFD C;  3F5H A;  3H1J G;  1JMM A;  1VQ8 P;  1X8Y A;  2M3E A;  2Y0E A;  1VQ4 P;  3U59 A;  3BCC D;  1URQ D;  1MUU A;  1KQL A;  1AA0 A;  1FOS F;  4M3L A;  4UB6 E;  1L4A C;  1VQ5 P;  4WY4 B;  1EZV I;  1JTH A;  1ZOY C;  3H1L J;  1BDD A;  3GG2 A;  3KZI E;  4IL6 H;  2Q3I A;  1NAF A;  1JMB A;  3TGU D;  3MGN A;  1KB9 E;  5AVU B;  5AW7 B;  1GZL A;  2E42 A;  2WWW A;  1EXI A;  4DT0 A;  1PGP A;  2NRG A;  1M1J A;  3V4Q A;  5B66 H;  1IK9 A;  1CZQ A;  1L4A B;  1L0L G;  1NGM B;  1SQQ E;  1OW7 A;  2D2C C;  1NOH A;  3NFQ A;  2AXC A;  1NTZ K;  3FXD A;  2WTY A;  3BRV B;  3CC2 P;  1RE4 C;  1OW6 A;  4HB1 A;  1BE3 J;  2O1J A;  4GIF A;  2E76 D;  2ZXE B;  4N6J A;  3F89 A;  4MN4 C;  1GL2 D;  4HJG H;  1FZC A;  4UB8 E;  3AE6 C;  1LT9 B;  2D2C B;  4PD4 H;  3CXH I;  2MKV A;  1LWU A;  1EXJ A;  3II6 A;  1P84 E;  3CPW O;  1BCC G;  1G1I A;  3H1H G;  1SQQ K;  3RGU A;  1QVF O;  1PPJ D;  2ZT9 B;  1CI6 A;  3CX5 E;  2FYU G;  3CI9 A;  3TGU J;  1JCC A;  1X22 A;  1OFC X;  2Z5I A;  3FX0 A;  4LLH A;  2M0B A;  1OZH A;  4H44 D;  2WPQ A;  4I7Z C;  2KYV A;  4KT0 J;  3G9R A;  5KAI H;  3K5B A;  1L0N D;  2N1T A;  1RE3 A;  2R3S A;  3MD0 A;  1LTJ B;  1SQP E;  2O1K A;  1T8Z A;  2OYI B;  1YTZ I;  1YIT P;  3I55 P;  1IFN A;  5KLV G;  5AVZ B;  2Y0D A;  1IFM A;  3ABV C;  3AE2 C;  4HH2 A;  1UIX A;  2YKO A;  1BGY D;  1SVF A;  3WMM 0;  3Q5R A;  1SQV D;  4KHX A;  3KYQ A;  1VQK P;  4O9B A;  3MUD C;  2W6J H;  3AE7 C;  1NU1 G;  1PP9 D;  1N7S A;  1RF1 B;  3AE3 C;  2WZ7 A;  3V6I A;  3PRJ A;  1FDO A;  2E43 A;  3H1J D;  1M57 D;  3O6Q A;  1SQP K;  2VRS A;  1GW4 A;  4WY4 D;  4YXW H;  2XDJ A;  2JDI H;  1KIL A;  3G6E P;  5CJ0 A;  4ASV A;  3IR9 A;  2QSI A;  1N2D C;  1HJ0 A;  2QM8 A;  1S3J A;  3CWB D;  1S5L E;  3MP7 B;  1L0N J;  3OJA B;  1YJW P;  1NHL A;  3H25 A;  1PGJ A;  2V7Q J;  1K04 A;  2IFN A;  3H1L G;  1L4A D;  2WPS A;  3NXS A;  1JY2 O;  1LT9 A;  2HG5 D;  5TJH A;  1Q90 D;  5KJ7 C;  3CXH H;  2IBZ D;  2YNY A;  4D6T D;  3VYI A;  2KNC A;  1BGY J;  1E79 H;  1J1E C;  4NPE A;  2NPS A;  3A0B E;  3Q1M A;  2WSC J;  2GUV A;  5B5E E;  3D6Z A;  1FDM A;  2E74 B;  4GDO A;  4RKU J;  2A45 I;  1RF0 A;  1PP9 J;  2G3A A;  2WPR A;  1BE3 G;  3CCS P;  3AEA C;  2D2C D;  2KSJ A;  1XTC C;  4EDF A;  1FC2 C;  3H1K J;  3NMD A;  1LTA C;  4GOE A;  3UIA A;  4U3F E;  1IJD B;  3G3Z A;  3E1R A;  4BXL A;  1LTJ A;  4JYC A;  5CCG C;  2HYN A;  5APS A;  4Y99 C;  2OTL P;  1SFC C;  4L76 A;  5AW6 B;  5CCH C;  1NWQ A;  5AW1 B;  2YXQ B;  1G2C B;  3HUS A;  2P1J A;  3RK2 B;  2IZ0 A;  2PFX A;  3W68 A;  1H0T A;  1NAY A;  3VP8 A;  3CWB J;  1GD2 E;  3JCU H;  1KIL E;  1NTK E;  2SPZ A;  3H1H D;  1N73 C;  3R4Y A;  2V7Q H;  2I1K A;  2WIT A;  1MZ9 A;  1VL2 A;  1WMK A;  2FYU D;  3FGA D;  3WUV A;  1SFC B;  3TGU G;  2YO3 A;  1RF1 A;  4D6T J;  2ZVN B;  3V5B A;  4YTP C;  2OAR A;  2YIU C;  1Q2N A;  1PL5 A;  2FXM A;  1FZB A;  1VQN P;  2E76 C;  1Y47 A;  1HVV A;  2FYN C;  1FZF A;  1IZN B;  3U1C A;  4WVZ A;  1GL2 C;  2PRR A;  2AEF A;  3P8C E;  5TIS E;  2P2U A;  4LGD E;  1QEX A;  1NTK K;  4N78 E;  3B5N A;  1QLE D;  3S4R A;  1JTH B;  1QX8 A;  5KLI B;  1SQB J;  3P8M C;  2IZ1 A;  1TU3 F;  2QJP C;  2E75 C;  1OX3 A;  1SQX E;  2KI7 B;  1NU1 D;  2LKM A;  1S4X A;  3L73 E;  2FBW C;  3KXD A;  5AW0 B;  1USE A;  1S72 P;  2IYO A;  3L74 D;  2JWA A;  1NTM E;  2XV5 A;  1M1J B;  1L0L K;  3D71 A;  2IFM A;  4IFF A;  5H2F H;  3D70 A;  3LW5 H;  2QM7 A;  1PPJ G;  3Q5S A;  1S9K E;  3S1K A;  2KIK A;  1LWU C;  2E75 B;  3L72 E;  1H8A A;  4KJM A;  1EDK A;  3EWK A;  1KD1 Q;  1JUN A;  1L0N G;  4H0L C;  5L8R J;  2JR8 A;  2E5Y A;  1W2B O;  1FZC B;  4IL6 E;  1AVO A;  3GHG C;  3GLM A;  1SQX K;  3SWK A;  4PD4 I;  2OYH A;  5DJU B;  2E74 D;  2FFD C;  1LWU B;  1NTM K;  1BGY G;  4JYB A;  5B66 E;  4EIJ A;  2KLU A;  2YKP A;  5KJ7 D;  2WT7 A;  3SWY A;  1ZN5 A;  2QRX A;  4L74 A;  3D6Y A;  4H0L B;  3L71 J;  4OH8 B;  5AW9 B;  3H6P A;  1JY3 O;  3EFG A;  1NU1 J;  3USS A;  3FWN A;  1BE3 D;  3H32 A;  4W7Y A;  2W6A A;  4WY4 C;  3L74 J;  1SQQ D;  3M9Q A;  4U7J A;  3H1K G;  1H89 A;  1VQP P;  2IYP A;  2N1T B;  2B89 A;  1URQ A;  2FXO A;  2A06 G;  1NTZ E;  2C9L Y;  2UWJ E;  3L75 E;  3AED C;  4PD4 E;  3MZW B;  5CCG D;  5M1B A;  1DEE G;  4RJT A;  5BU8 B;  1SFC D;  3M0D A;  2XU6 A;  5CCH D;  1ZW0 A;  3CWB G;  4EOT A;  4H13 B;  2B88 A;  1KV4 A;  1QGK B;  1ZV8 A;  2OQQ A;  2GM4 A;  3H1I E;  4Z1M H;  3CLQ A;  4C7N A;  2JKV A;  1N7S B;  1P84 D;  2C0W A;  2IBZ G;  3HE4 A;  4ZKP A;  4D6T G;  1QL2 A;  5KAI E;  1Q81 Q;  1EDL A;  2J59 M;  2O01 H;  3CX5 D;  1PFI A;  3L70 E;  2Y0C A;  3O6Q B;  3GMA A;  2BAS A;  2WMM A;  3HE5 A;  1LT9 C;  2B87 A;  1KIL B;  1RY3 A;  3AE4 C;  1PGO A;  2KZJ A;  5APQ A;  2M8R A;  2KK7 A;  1QL1 A;  3R2P A;  1SQQ J;  1GMJ A;  3MIW A;  5BVZ A;  1SQP D;  1EZV E;  3M9H A;  3N7N A;  4PJ0 H;  1IFD A;  2PP6 A;  4GOD A;  1RHZ B;  2ZT9 C;  2GUS A;  1RQV A;  4L75 A;  1AQ5 A;  1FZA A;  3RK3 E;  1SQB G;  1YHQ P;  3QWO C;  2ZJS E;  1KFM A;  3KPE A;  1EC5 A;  4RES B;  1R5S A;  3BCC E;  2K9Y A;  3M0A A;  1BDC A;  3VOP A;  2KNC B;  5APU A;  2FYZ A;  2E75 D;  1LTJ C;  4QMA A;  3M9B A;  1HBW A;  2OYI C;  2NPS B;  1QVG O;  1IO4 A;  2QE7 H;  1D7M A;  4IFM A;  2PGD A;  3Q2Y A;  2QA4 P;  3HUS C;  4Y28 J;  5APW A;  2IX7 C;  1KOR A;  1NH4 A;  1ZRT E;  3U1A A;  2R32 A;  1PIX A;  2L5G B;  3A7O A;  1YYC A;  1AJY A;  4XA4 A;  1AFO A;  3KZI H;  3AEF C;  3PHL A;  2RMZ A;  4HKZ H;  1K9M Q;  5APV A;  1RF1 C;  3PJS K;  4H0L D;  3CXH E;  4RO0 A;  3HUS B;  1W2E A;  3HD7 B;  2YO2 A;  3BAS A;  1JY2 N;  2AXT E;  4GKG A;  4GT1 A;  1N7L A;  1H0T B;  1SQP J;  5EFW B;  1FS0 E;  3BRT B;  1USD A;  1FBM A;  3TSI A;  3E7K A;  3L71 G;  3WUT A;  1IFJ A;  4TLF A;  1HWT C;  2QVA A;  1HTL C;  3GF7 A;  1MKM A;  3HRN A;  3PP5 A;  3KDP B;  3L74 G;  5CJ4 A;  3H1K D;  4DZO A;  2RKL A;  2W83 C;  2ZXX A;  4UB8 H;  2R5D A;  4H13 D;  2A06 D;  4N3Y B;  1T3U A;  1HGZ A;  4NPD A;  1P84 H;  5AW2 B;  3JCU E;  1N7S D;  3EFF K;  1WT6 A;  3B5N B;  2Z5H A;  3OAK A;  2YMY A;  2K37 A;  2E74 C;  1SS1 A;  3ZDM A;  3GF3 A;  3P7K A;  1KIL D;  2PAJ A;  1E5W A;  2IPP A;  3OA7 A;  3H1I G;  1HH0 A;  1SQV E;  3VTP C;  2I1J A;  4HYT B;  3M06 A;  1GTW A;  3FXE A;  1IFP A;  1HF9 A;  4ASW A;  2NZ2 A;  2FY8 A;  4C7R A;  3RK2 C;  1JM0 A;  1RH5 B;  1X9V A;  5KAF H;  2KZI A;  2P58 A;  2IBZ I;  1M90 Q;  3WU2 E;  1SQQ G;  1XTG B;  2K1A A;  3LIE A;  1IC2 A;  1L0N K;  1VDF A;  3H1J E;  1SP4 A;  3VMX A;  4JQ0 D;  2NPS D;  1SQB D;  3LID A;  1L2P A;  2C9N Y;  1H88 A;  3P8C D;  3A5T A;  1J1D C;  2ZT9 D;  3RK3 C;  2WPV B;  2OYH B;  1EZV G;  1YI2 P;  3HD7 A;  1RQU A;  4U3F J;  2K9J B;  1DX7 A;  1DH3 A;  3B4S A;  2ZAE B;  5GTI H;  1Y9B A;  1KYO D;  1LP1 A;  1Q86 Q;  4WBA A;  4R4L A;  1FDI A;  1ZR4 A;  3RL0 B;  1BSN A;  1SQV K;  2WT7 B;  1SLQ A;  3IAO A;  3V2N A;  2ZYA A;  1G1J A;  3L73 D;  1EDI A;  2QEX P;  1LJ2 A;  2R5B A;  1N86 A;  3CCJ P;  2Z4E A;  4EI2 A;  3CMA P;  1NTM D;  3M0D C;  1NTK J;  2KB7 P;  1J1D B;  5CHX A;  3H32 B;  2OTJ P;  3RK3 B;  2YXR B;  2H7H A;  4PV1 B;  3EQ2 A;  3WUU A;  1L0L E;  4WB4 A;  5KLI C;  1URQ B;  1JB0 J;  2Q6Q A;  3IF4 A;  5APY A;  2WSC H;  1FZG A;  1M1J C;  3V2R A;  3Q5P A;  1OVV A;  2WQY C;  1LT1 A;  1SQP G;  2CK3 H;  3GW6 A;  4OWF A;  2KUB A;  3CC4 P;  3MTU E;  1GU5 A;  3L71 D;  4DOJ A;  4YXD C;  1FE6 A;  4C7N B;  1FZE A;  3HE4 B;  2CPS A;  1X0T A;  1BSH A;  1K73 Q;  3QH9 A;  1M1K Q;  1R5L A;  5AW4 B;  1BCC E;  1FZC C;  2QIW A;  1Y8A A;  3H1H E;  4NPF X;  1PGQ A;  1SQX J;  2QJY C;  3HE5 B;  5AVV B;  3L73 J;  5CMZ A;  2WSF J;  1W5C E;  5AVY B;  1GDT A;  2B87 B;  2FYU E;  1MV8 A;  3V2Q A;  5GTH H;  1NTM J;  1YJN P;  1LTT C;  2XZR A;  2XND H;  3RBX A;  2QJK B;  2YMK A;  2QG4 A;  4I2L C;  2Q5U A;  1DD4 A;  1IK7 A;  1NTZ D;  3CCL P;  2ZVO B;  4BRY B;  5KTB A;  3SWF A;  3L72 J;  2J58 A;  2H88 C;  2QJY B;  5KKZ B;  1FJK A;  5KLV E;  2ZFC A;  4AYC A;  2K9J A;  2P67 A;  4B86 A;  2N1T C;  1RE3 C;  2BCC E;  4W7Z A;  1FOS E;  3H1I D;  4C46 A;  3AEG C;  1JY2 P;  2GA1 A;  3C8V A;  3A3Y B;  1KB9 D;  4AUW A;  3CCV P;  4R4M A;  2FYU K;  2LR2 A;  2BCC J;  1U7J A;  1NKN A;  3ITK A;  2R44 A;  1OW8 A;  2HPC A;  4H13 C;  1VQ7 P;  3CCE P;  4OVN F;  3RBZ A;  3RK2 D;  1KYO H;  3CC7 P;  4YPC A;  2Q1K A;  1OVU A;  5AVW B;  3RL0 D;  3CCM P;  1KQS O;  1NJI Q;  1KB9 I;  1N7S C;  3B8E B;  1ZXG A;  2WSF H;  4GOF A;  3BVH A;  3P32 A;  3RL0 g;  5KLV K;  3VMA A;  1EZV D;  4U3F G;  3CL3 D;  3C9I A;  1IFI A;  2E5T A;  1NKZ B;  3VN0 A;  1NTZ J;  3RK3 D;  4K35 A;  1N73 A;  2H8P D;  3L75 J;  4PV1 D;  2I8D A;  2M5A A;  2L91 A;  1KIL C;  5APX A;  3H1L E;  2OGU A;  1GW3 A;  1VPC A;  3TK1 A;  1NU1 K;  1NTK G;  1JCD A;  5AVT B;  3E1I A;  3G71 P;  3SSU A;  3H1I J;  3AEC C;  1ZLL A;  2P10 A;  1YBK A;  1S1C X;  2A45 G;  1ZRT D;  1N8R Q;  3B71 A;  2KLV A;  1YJ9 P;  4AQR D;  3JC2 2;  3T97 B;  1GL2 A;  3JSV C;  5CBO A;  2WSS H;  1T2K C;  2BEQ D;  2POH A;  1BE3 E;  5AVQ B;  1P84 I;  3A0H H;  3L70 J;  4OGQ C;  2Q7C A;  3W67 A;  2NPS C;  4W80 A;  4JF7 A;  1GU4 A;  1U7M A;  1T6A A;  4BRY A;  2Q9I A;  3CX5 I;  2KXP B;  3CXH D;  2WVR A;  3TF5 A;  1RF0 C;  5DJT B;  4A7P A;  2HR3 A;  1HJB A;  1VF5 C;  2J5U A;  5E79 H;  3VMY A;  2W90 A;  4IL6 X;  4WWI A;  3O8Z A;  1YQ3 C;  3VMZ A;  2H89 C;  4OGQ B;  4XFJ A;  1ZME C;  3SFE C;  5AVS B;  2N9Y B;  3AE5 C;  1SQX G;  2HOD B;  2W8Z A;  3BCC J;  3L73 G;  2R3C A;  1LTG C;  2LXB A;  3HD7 C;  3C1L A;  2IDB A;  3TGU E;  3HTK A;  1CW5 A;  1NTM G;  4UB6 H;  3CCR P;  5APT A;  1VF5 B;  3IN6 A;  1YQ4 C;  4ZNC A;  2Y9Z A;  3GHG A;  3AE9 C;  3PTZ A;  1KB9 H;  3L72 G;  3L36 A;  1WRG A;  2XKM A;  2XNX A;  1NO4 A;  1LGH B;  2FFD A;  2ZYG A;  2Y9Y A;  3I56 P;  1KMI Z;  1LP1 B;  1OMI A;  1GK6 A;  1J2J B;  1VQ6 P;  1ZR2 A;  1EQ7 A;  1A02 J;  2ZYD A;  2HLO A;  2FXP A;  1HUC A;  1GK4 A;  2MJZ A;  3AE1 C;  1M8O B;  2N1T D;  2G8Y A;  4BWN A;  3N4X A;  1KC8 Q;  5KAF E;  2BCC G;  1VQM P;  1VQO P;  4WY4 A;  2JJL A;  2DW3 A;  1PV3 A;  3TDK A;  4I7Z B;  4IFD K;  2HFE D;  3B5N C;  2KP8 A;  4IOI H;  3CCU P;  1KQF B;  2JWD A;  1Z56 A;  3KHU A;  1YIJ P;  1JY3 P;  3CD6 P;  1PPJ E;  4EYY Q;  3PLN A;  2JO1 A;  3T97 A;  2B9B A;  4U3F D;  2K3R A;  5GTI E;  1L4A A;  2FKW B;  1LTS C;  3TNU B;  1A02 F;  1L0N E;  1NTZ G;  1M7L A;  3CCQ P;  3L75 G;  1CSB A;  3CX5 H;  4DJG A;  1DD3 A;  1K05 A;  1JEK A;  1K8A Q;  1VQL P;  1NTK D;  2KS1 B;  1BGY E;  1MFT A;  2RN0 A;  1MFZ A;  2O3J A;  1HGV A;  2HOD A;  1JO5 A;  1NYH A;  2Q3E A;  3BAT A;  5CBN A;  3Q3D A;  3KQG A;  1AV1 A;  2OYH C;  1R8E A;  2AXT H;  3L37 A;  1RE4 A;  5C39 A;  2JP3 A;  4LC1 A;  1PP9 E;  1SQV J;  1L0L D;  3RL0 C;  3S9O A;  1JOC A;  3L70 G;  3A2A A;  2KOG A;  3H1K E;  4ZMD A;  5AVX B;  1T2K D; 
#chains in the Genus database with same CATH homology
 5TIS H;  1S5L H;  4PJ0 H;  4IL6 H;  4UB6 H;  2AXT H;  4UB8 H;  3WU2 H;  5KAF H;  3A0B H;  5GTH H;  3A0H H;  5KAI H;  3KZI H;  5B5E H;  5GTI H;  5B66 H;  3JCU H;  5H2F H;  5E79 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...