3WU2H

Crystal structure analysis of photosystem ii complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
publication title Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9 A
pubmed doi rcsb
total genus 14
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 3wu2H01
2AXTH 5GTIH 3KZIH 4IL6H 3JCUH 3A0BH 3WU2H 5B5EH 5KAFH 5E79H 3A0HH 5H2FH 5TISH 1S5LH 4UB6H 5B66H 5GTHH 4PJ0H 5KAIH 4UB8H
chains in the Genus database with same CATH superfamily
3NTNA 2HODA 2O01J 3M91A 1N7LA 5KLVJ 4IFMA 1USEA 3FGAD 3LW5H 3PLNA 3B5NC 2O1JA 1VQ9P 3AE9C 2Q3IA 2B9BA 3L74E 2HLOA 2BCCG 2E76B 4GDOA 5KJ7C 3HD7C 2QJYC 3CPWO 2B89A 2WWWA 4U3FJ 4PD4E 3BCCG 4ZNCA 1KFMA 1JMMA 1EC5A 4KT0J 2XU6A 1VDFA 4H0LD 2H43A 3ZDMA 3GHGB 1HUCA 2WSSH 2AXTE 2AEJA 3E1RA 1S3JA 1JTHB 2E76C 1X8YA 2E5TA 3H1KG 4IFDK 2WSCJ 1NTZE 3PTZA 1UIIA 1QEXA 1M1JB 2OYIA 1M90Q 3IFMA 1LTTC 2OYOA 3BRVB 3CXHH 1NTMK 3WUTA 4K3AA 1PP9J 1LTSC 1WT6A 1NJIQ 3SWFA 4D6TG 2P58A 1VQ5P 1USDA 1NTZK 1W2EA 4Z1MH 1NU1E 3MUDA 1GK6A 3PJSK 3AECC 1OX3A 2NRGA 1LT9B 3L72D 2FKWB 1H88A 2XZRA 1OW6A 2BCCD 1Y9BA 2B87A 3G71P 3K5BA 2W6BA 3BCCD 1CW5A 3OAKA 1CSBA 1KYOE 3IF4A 1SQVE 2A45I 3L75G 1SQXJ 4RESB 1L4AD 2P67A 2LXCB 5E79H 5B66E 1BE3G 1SVFA 1VF5D 1QLED 2QM7A 3H1KD 2PAJA 4WBAA 4ASWA 3FWNA 4D6TD 1BCCE 1RF1B 2WSCH 2RMZA 3KHUA 3KYQA 4UB6H 1VQOP 2WSFH 3RGUA 3HE4A 2WMMA 2Y0EA 2E5YA 4KHXA 1BSNA 5AW5B 1FAVA 1AVOA 2IPPA 3CXHI 1OZHA 1KILE 2KOGA 1DH3A 4I2LC 1RH5B 1URQB 1SQQK 2AEFA 1NH4A 1PIXA 5CMZA 5AW0B 2WPRA 1Y47A 3A7OA 2ZFCA 1QL1A 4JYCA 1KILC 1J1DC 1IJDB 3TNUA 4XA4A 1EZVE 3JCUH 1K9MQ 1P84H 1EDIA 3CCEP 2KB7P 1TU3F 1H0TA 1YJ9P 1LTBC 1SQBK 1L0NE 2ZYGA 4JBZA 2HODB 1URQC 4ZKPA 4EYYQ 1SQPG 3L75D 4TT3H 2M5AA 4H44C 1ZMEC 4BRYA 1DIPA 5APYA 2CPBA 1NO4A 1BDDA 1GL2D 1ZR2A 4BWNA 5TISE 3GG2A 4PJ0E 5KTBA 5AVRB 5TJHA 1LP1A 2Q7CA 1ZW0A 1XTGB 1Q90D 3P32A 3H1HJ 2O3JA 5AVVB 4ZKUA 2K3RA 2W90A 1SFCD 1YITP 2KLUA 2KNCA 2LKMA 3L70E 3H1LG 3KDPB 3MHVA 1JY3P 1D7MA 1J1EB 4RKUJ 5AW4B 2G8YA 4GIFA 1JY3O 1FZEA 1ZRTD 1L4AA 1GK4A 3RK2B 2Y9ZA 2IBZE 2OYIB 1AJYA 3H1KJ 1DX7A 1YTZT 1KB9H 1NVOA 5KAIE 4OGQB 1T6AA 2QE7H 4GT1A 1BDCA 3FX0A 4OVNF 2O01N 4IOIH 3Q2YA 1S9KD 4DOJA 5GTIE 1BSHA 2QJKB 2YO3A 1CZQA 4D6TJ 1HWTC 2FYUE 5L8RJ 1FBMA 3Q5SA 5K5GB 5KLVG 2OYIC 2K1AA 1P84I 2H88C 2M3BA 4PV1B 2SPZA 1YTZI 1YQ4C 2B87B 2L91A 4XFJA 2Q5UA 1LTJA 4U3FG 3MUDC 4EIJA 3SWKA 3WMM0 1PGJA 3CCQP 2YXQB 2OTLP 3H1LD 4I1LA 2BASA 5APXA 3L73E 3BVHA 3CXHD 1LNQA 2J5UA 1OVRA 1BE3J 1R5SA 3MGNA 3H1IE 1SP4A 3M0AA 1GL2A 3HUSB 1S72P 3I56P 1K04A 3P7KA 1SQXK 3IN6A 3HE4B 3A0HH 4OWFA 1RF0C 2Y0CA 2ZT9B 3BATA 3H1JG 1KB9I 2ZXXA 1NAYA 5KLVD 4HYTB 2FYUG 1SFCA 4H13D 3KZIH 1NTKG 2P10A 3CC4P 2XDJA 3FWLA 1NU1J 1OXZA 5H2FH 2QVAA 5GTHH 3TNUB 2OQQA 1H89A 3M9QA 4U3FD 1T2KD 3H32A 4WY4D 1YYCA 2WPQA 4H0LC 4YPCA 3NMDA 1VQNP 3CX5H 1VQ8P 2M5AB 1KQSO 1IFJA 3L36A 4BRYB 3E1IA 4O9BA 1S1CX 1PGPA 4Y99C 1FZFA 1SQPJ 1AVYA 4K35A 1MV8A 1JY3N 1KQGB 1SQVJ 1KN7A 2IDBA 2YKOA 1LP1B 2NPSD 5KAFE 4PD4H 3CC7P 3PH0A 1JCDA 1MFTA 1PP9D 3L72E 2M3EA 1VL2A 4HH2A 5BVZA 3RL0D 3D70A 2E75D 2WPVB 2KNCB 1PPJG 4AUWA 2PP6A 3H1JD 3M0DC 3SFEC 3TF5A 3AE3C 4LLHA 4KJMA 1P84D 1N7SD 1BGYG 3O6QB 3H1LJ 2R3SA 1NTKD 2A06G 5CCHD 3A3YB 3UIAA 3S1KA 2JR8A 3MP7B 1KTMA 2KUBA 5AVQB 2ZAEB 2JO1A 3KQGA 3VP8A 1L4AC 3OJAB 2C0WA 3PRJA 1SQXD 1HJ0A 2QJYB 2E74D 1VF5C 3VMZA 2K88A 1IFMA 3CX5I 1QL2A 3H25A 3BRTB 5APQA 2GA1A 3A5TA 1N86A 2ZXEB 3H1HG 4L73A 3P8CD 1KYOH 3D6YA 1E5WA 1LTAC 1YI2P 1OW8A 1K73Q 1L0LG 1GD2E 1PPJD 5B66H 3B71A 4DJGA 1KMIZ 2W6AA 1KB9D 1LTJC 2ZVNB 2POHA 2K9JB 2I1JA 1NTME 3ITKA 1JY2O 2Y0DA 1W2BO 3L70J 5AVZB 1G1IA 2A06D 2V7QJ 1T3JA 1Q82Q 3CCVP 2C9NY 1Q86Q 1WRGA 2WSFJ 1QX8A 2M0BA 1Q2NA 3C1LA 3T97A 2KSEA 5CCGD 5AW6B 2JWAA 3W68A 2NPSA 3VN0A 2IZ0A 3HRNA 3N4XA 1S5LE 2KIKA 1GL2C 1EDLA 1S2EA 2GUSA 1MFZA 1RE3A 3H1JJ 5DJTB 1VQ6P 3Q5RA 2YNYA 5AW8B 2FYUJ 3JC22 2FYZA 5AVUB 1RQUA 2WTYA 3E7KA 3CCUP 1NTKJ 5B5EE 3L71E 1CI6A 3H32B 1JNMA 3H1HD 1OVVA 3L74G 1SFCC 5CCHA 3VTPC 3LIDA 4AQRD 3TK1A 1YBKA 1U7JA 1KYOI 2IYPA 2OGUA 2JKVA 5CBOA 3QH9A 3WUVA 5TISH 4PJ0H 3CWBE 4GKGA 4C7NA 2PGDA 2N1TD 4I7ZC 3B4SA 1DEBA 1K05A 1RF0A 3HE5A 4BXLA 2WITA 1OIPA 4NPFX 1E79H 1NTZG 4ZMDA 3V2RA 1X0TA 4N78D 2AEMA 1SQQE 1XTCC 1IZNB 2V7QH 3H1IJ 3D6ZA 2H7HA 1IFIA 5AW2B 3MIWA 2G3AA 2YMYA 4WB4A 1PFIA 1HH0A 1KILB 1J1DB 2KLVA 1PGQA 4R4LA 3B5ND 1EXJA 1SQBE 3CX5D 1NU1G 5KJ7D 3HD7D 1BGYJ 3CL3D 3WUUA 4H44B 3P8MC 3CXHE 3RK3B 1JO5A 1VPCA 3R4YA 3TGUE 3II6A 5GTIH 1L2PA 1JOCA 3RK3E 2KK7A 1EZVI 2LXBA 4QMAA 1RE4A 4PD4D 2E76D 1PGOA 4HJGH 4EDFA 1ZP0C 1SQVG 3RK3C 1BE3D 1JY2N 1N73A 3RBZA 5AW7B 2WZ7A 3A0BE 2DW3A 1SLQA 2LR2A 2FFDC 2K9YA 2YMKA 2QG4A 3M0DA 1RQVA 3CCLP 4IL6X 2BEQD 2I1KA 4IL6H 2WQYC 1PV3A 1L0LJ 1BCCG 5KLVK 2Z5HA 3MTUE 3M9BA 1FC2C 3G9RA 2KYVA 1NWQA 1NU1D 1GU4A 1ZLLA 1T2KC 1X22A 3T97B 3SSUA 2IYOA 3KPEA 1IC2A 4UB6E 2MKVA 1EZVG 2D2CB 1SQPD 1PP9E 1L0NG 2WVRA 3VOPA 3U1AA 1KYOD 1J2JB 4JPZB 1SQVD 1KORA 2KSJA 2GUVA 2NPSC 4AYCA 4L75A 4W7ZA 2WT7A 3VMAA 1FJPA 2QJPB 4DCKA 3JCUE 4LGDE 2OTJP 2D2CC 2W83C 5KKZB 2FXPA 3RL0C 2ZYDA 1RE3C 1EDKA 1GW4A 3L74J 1N7SC 3S4RA 1KD1Q 1JCCA 1U7MA 2JP3A 2QJPC 1EDJA 1LTIC 3O8ZA 1SQXE 1S4XA 3L70G 5CCHC 1HGZA 1NTKK 5KAFH 5KKZC 3HE5B 2W6JH 1OWAA 1GU5A 4W80A 2IBZG 1URQD 3AE5C 3GHGA 2CK3H 1NTZJ 2E74C 1Q81Q 1EZVD 1JTHA 3JSVC 3CMAP 5CHXA 3I5CA 3CI9A 1MZ9A 1L0ND 3V6IA 4H0LB 1FS0E 4YXDC 4JQ0D 1KQLA 1IFNA 3AE4C 2KS1A 1W5CE 3Q5PA 4Y99B 4RO0A 1YQ3C 2HYNA 1H0TB 2R5DA 2RN0A 5APUA 5KLIC 3L71J 4EI2A 2O1KA 4GOEA 1DD4A 1N73B 5M1BA 3L70D 1EQ7A 3F5HA 1AA0A 1R8EA 2HFED 3AEFC 3L73G 1RE4C 2J59M 3CWBJ 3EQ2A 3Q1MA 1M8OB 2JEEA 1KFNA 4LC1A 2UWJE 2ITAA 3H1IG 5BU5A 1GW3A 1N73C 4XE5B 3RK2D 2AXTH 1ZOYC 2BCCE 1VQLP 1NYHA 4OGQD 3FXDA 1BCCJ 3BCCE 2FYUD 1L4AB 1VQMP 2FYNB 1NHLA 3QWOC 1VF5B 3AE2C 1RF1A 2KXPB 2L5GB 3VYIA 2PFXA 3GMAA 1N8RQ 1S5LX 3A0HE 3L35A 4PV1D 3H1KE 1S5LH 3IAOA 2FFDA 2FYNC 3TGUJ 5CBNA 5AVXB 4D6TE 1L0NJ 1LTGC 2WT7B 5H2FE 5B5EH 2RH0A 3L73D 4NPEA 1WMKA 3GLMA 2YIUC 3CCMP 1M1KQ 1KZUB 5APSA 3EFGA 4ASVA 1FZCC 5AVWB 1LTJB 2IX7C 2KZIA 4B86A 2HPCA 1MKMA 3VP9A 1A02F 3CX5E 3H1ID 3L72G 2YKPA 4PD4I 4WY4A 4YTPC 2A45H 1JY2P 3V2NA 1G2CA 1BGYD 1ZV8A 2AXCA 1JUNA 3GF3A 3L75E 2ZT9D 3L37A 3SWYA 1GL2B 1FDMA 1FJKA 1FOSE 5AVSB 1BE3E 4JYBA 4UB8E 1NAFA 2H8PD 2Q9IA 2C9LY 1Q7YQ 3AEGC 3SFDC 1YJNP 4M3LA 2JDIH 4IFFA 1NKZB 1SFCB 1KC8Q 2KS1B 3GHGC 2H89C 1NGMB 3F89A 2P7JA 1AFOA 3AEDC 1N2DC 2OTKE 3WU2E 1N7SA 3G6EP 1ZRTE 2ZVOB 4I6MC 4C46A 1M1JC 4I7ZB 1L0LD 2R44A 5APWA 5AW1B 2FXOA 1U57A 2O01H 1FU1A 3A0BH 2W27A 1LWUA 3CCJP 2E43A 1FDIA 1S9KE 1NU1K 1SQPE 1NTMG 3USSA 2NZ2A 3L73J 1AV1A 4Y28J 1LT9C 3C8VA 1IK7A 2MJZA 1AQTA 2IZ1A 3VMYA 4C7RA 2XKMA 2K37A 1GZLA 3KXDA 3NFQA 1SQPK 3V5BA 4GOFA 3HTKA 3C9IA 2YO2A 1SQVK 2Q3EA 1M57D 1T8ZA 4JF7A 1M7LA 1RY3A 1GMJA 3V2QA 2P1JA 2R32A 3CMEP 3HUSA 3TYYA 3BASA 4DT0A 4OH8B 3H1LE 4WVZA 5KAIH 5APTA 1GTWA 1FE6A 2XNDH 1VQKP 1PZQA 3L71G 3L74D 2FFDB 1KV4A 3V4WA 2Z5IA 2WPSA 5CJ4A 5CCGA 1GDTA 1RF1C 3CC2P 4N3YB 3D71A 2CPSA 3G4SP 1NOHA 1M56D 4NPDA 4H13B 3TSIA 2HPCB 1NTMD 3CWBG 3LIEA 5KLVE 4YXWH 2KZJA 2A45G 3MZWB 3OA7A 2HG5D 1MUUA 3ABVC 3GF7A 2OYHA 1NTZD 2N9BA 3CCSP 3AEBC 1OFCX 1KQFB 1QVFO 4TLFA 4WY4B 1OMIA 1SQQG 5E79E 1YJWP 1L0NK 3G3ZA 1G2CB 1T3UA 3L72J 4H13C 4U3FE 2N9YB 2QA4P 4EOTA 3AE1C 4RJTA 2BCCJ 1HTLC 2RKLA 2R3CA 4WWIA 3AEEC 1SQBG 1NKNA 1HJBA 3BCCJ 2Y9YA 4R4MA 4WY4C 3M9HA 1QGKB 2IBZI 2NPSB 1R5LA 3L71D 2N1TA 4W7YA 3R2PA 4HKZH 1X9VA 3TGUG 1HGVA 2WSEJ 3O6QA 2IFMA 1FZCA 3AEAC 3AE7C 3RL0B 2FY8A 2E75B 5DJUB 2QSIA 1EXIA 1YIJP 2BEZF 2P2UA 1J1EC 1N7SB 3RBXA 3B5NA 3H1JE 1CI6B 3CWBD 5AW9B 2XNXA 2QRXA 1P84E 2ZJSE 2W8ZA 3RK2C 3U1CA 5KJ7A 3HD7A 2E75C 1H8AA 1LGHB 1NTKE 1OVUA 1JEKA 1IFPA 2C0XA 2E42A 1FDOA 1ZR4A 4OGQC 1IO4A 1SQQD 1LWUB 1HVVA 1BCCD 4DZOA 2M8RA 3GW6A 2QJKC 2FYUK 2E74B 4C7NB 1VQ7P 1OW7A 3V2PA 1Z56A 1KILD 2B88A 3NXSA 1SQBD 4PV1C 4L74A 1NTMJ 2YXRB 2YKQA 4IL6E 1LWUC 3L75J 2KP8A 3TGUD 2Q1KA 3RL0g 3HTKB 2K9JA 2XV5A 2FBWC 3S9OA 4H44D 3VMXA 3AE8C 5BU8B 1X79B 3RK3D 3P8CE 5AW3B 5KLIB 1PP9G 1ZXGA 2Q6QA 2WSEH 1PPJE 1M1JA 1RHZB 3N7NA 1YHQP 2GM4A 1KB9E 5CJ0A 1A02J 1BGYE 1PL5A 2OARA 3U59A 2VRSA 3PHLA 2A06E 5AVTB 3TDKA 3B8EB 3HUSC 4A7PA 1IFDA 1JM0A 4N6JA 5C39A 1IK9A 4MN4C 1FZBA 1DEEG 1LT9A 2V4HA 4U7JA 2ZT9C 3I55P 1JMBA 3AE6C 3A2AA 3L4FA 1SQXG 2FXMA 3Q3DA 3LW5J 5CCGC 2OYHB 2JWDA 5APVA 3PP5A 1QVGO 2IBZD 1VQ4P 3H6PA 2ZYAA 4CPGA 3CD6P 1HBWA 1FZAA 2J58A 3OW2O 4HB1A 3H1HE 3CCRP 1G1JA 1SS1A 3V4QA 3EFFK 5AVYB 4L76A 1LJ2A 1SQQJ 2OYHC 1L0LE 4GODA 2D2CD 3W67A 4UB8H 3FXEA 2QIWA 1K8AQ 1LT1A 1VQPP 2N1TB 1FZGA 1DD3A 1SQBJ 1ZN5A 3M06A 1KILA 2YIUB 1L0LK 1FZCB 1JB0J 2I8DA 1FOSF 3MD0A 1URQA 2HR3A 2PRRA 2KI7B 3KZIE 2JJLA 4N78E 1UIXA 1AQ5A 3IR9A 3WU2H 2N1TC 2IFNA 3B5NB 1Y8AA 1HF9A 2R5BA 5GTHE 2Z4EA 5EFWB 3CLQA 2QEXP 2QM8A 3HD7B 3EWKA
chains in the Genus database with same CATH topology
2AXTH 5GTIH 3KZIH 4IL6H 3JCUH 3A0BH 3WU2H 5B5EH 5KAFH 5E79H 3A0HH 5H2FH 5TISH 1S5LH 4UB6H 5B66H 5GTHH 4PJ0H 5KAIH 4UB8H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXT H;  5GTI H;  3KZI H;  4IL6 H;  3JCU H;  3A0B H;  3WU2 H;  5B5E H;  5KAF H;  5E79 H;  3A0H H;  5H2F H;  5TIS H;  1S5L H;  4UB6 H;  5B66 H;  5GTH H;  4PJ0 H;  5KAI H;  4UB8 H; 
#chains in the Genus database with same CATH topology
 3NTN A;  2HOD A;  2O01 J;  3M91 A;  1N7L A;  5KLV J;  4IFM A;  1USE A;  3FGA D;  3LW5 H;  3PLN A;  3B5N C;  2O1J A;  1VQ9 P;  3AE9 C;  2Q3I A;  2B9B A;  3L74 E;  2HLO A;  2BCC G;  2E76 B;  4GDO A;  5KJ7 C;  3HD7 C;  2QJY C;  3CPW O;  2B89 A;  2WWW A;  4U3F J;  4PD4 E;  3BCC G;  4ZNC A;  1KFM A;  1JMM A;  1EC5 A;  4KT0 J;  2XU6 A;  1VDF A;  4H0L D;  2H43 A;  3ZDM A;  3GHG B;  1HUC A;  2WSS H;  2AXT E;  2AEJ A;  3E1R A;  1S3J A;  1JTH B;  2E76 C;  1X8Y A;  2E5T A;  3H1K G;  4IFD K;  2WSC J;  1NTZ E;  3PTZ A;  1UII A;  1QEX A;  1M1J B;  2OYI A;  1M90 Q;  3IFM A;  1LTT C;  2OYO A;  3BRV B;  3CXH H;  1NTM K;  3WUT A;  4K3A A;  1PP9 J;  1LTS C;  1WT6 A;  1NJI Q;  3SWF A;  4D6T G;  2P58 A;  1VQ5 P;  1USD A;  1NTZ K;  1W2E A;  4Z1M H;  1NU1 E;  3MUD A;  1GK6 A;  3PJS K;  3AEC C;  1OX3 A;  2NRG A;  1LT9 B;  3L72 D;  2FKW B;  1H88 A;  2XZR A;  1OW6 A;  2BCC D;  1Y9B A;  2B87 A;  3G71 P;  3K5B A;  2W6B A;  3BCC D;  1CW5 A;  3OAK A;  1CSB A;  1KYO E;  3IF4 A;  1SQV E;  2A45 I;  3L75 G;  1SQX J;  4RES B;  1L4A D;  2P67 A;  2LXC B;  5E79 H;  5B66 E;  1BE3 G;  1SVF A;  1VF5 D;  1QLE D;  2QM7 A;  3H1K D;  2PAJ A;  4WBA A;  4ASW A;  3FWN A;  4D6T D;  1BCC E;  1RF1 B;  2WSC H;  2RMZ A;  3KHU A;  3KYQ A;  4UB6 H;  1VQO P;  2WSF H;  3RGU A;  3HE4 A;  2WMM A;  2Y0E A;  2E5Y A;  4KHX A;  1BSN A;  5AW5 B;  1FAV A;  1AVO A;  2IPP A;  3CXH I;  1OZH A;  1KIL E;  2KOG A;  1DH3 A;  4I2L C;  1RH5 B;  1URQ B;  1SQQ K;  2AEF A;  1NH4 A;  1PIX A;  5CMZ A;  5AW0 B;  2WPR A;  1Y47 A;  3A7O A;  2ZFC A;  1QL1 A;  4JYC A;  1KIL C;  1J1D C;  1IJD B;  3TNU A;  4XA4 A;  1EZV E;  3JCU H;  1K9M Q;  1P84 H;  1EDI A;  3CCE P;  2KB7 P;  1TU3 F;  1H0T A;  1YJ9 P;  1LTB C;  1SQB K;  1L0N E;  2ZYG A;  4JBZ A;  2HOD B;  1URQ C;  4ZKP A;  4EYY Q;  1SQP G;  3L75 D;  4TT3 H;  2M5A A;  4H44 C;  1ZME C;  4BRY A;  1DIP A;  5APY A;  2CPB A;  1NO4 A;  1BDD A;  1GL2 D;  1ZR2 A;  4BWN A;  5TIS E;  3GG2 A;  4PJ0 E;  5KTB A;  5AVR B;  5TJH A;  1LP1 A;  2Q7C A;  1ZW0 A;  1XTG B;  1Q90 D;  3P32 A;  3H1H J;  2O3J A;  5AVV B;  4ZKU A;  2K3R A;  2W90 A;  1SFC D;  1YIT P;  2KLU A;  2KNC A;  2LKM A;  3L70 E;  3H1L G;  3KDP B;  3MHV A;  1JY3 P;  1D7M A;  1J1E B;  4RKU J;  5AW4 B;  2G8Y A;  4GIF A;  1JY3 O;  1FZE A;  1ZRT D;  1L4A A;  1GK4 A;  3RK2 B;  2Y9Z A;  2IBZ E;  2OYI B;  1AJY A;  3H1K J;  1DX7 A;  1YTZ T;  1KB9 H;  1NVO A;  5KAI E;  4OGQ B;  1T6A A;  2QE7 H;  4GT1 A;  1BDC A;  3FX0 A;  4OVN F;  2O01 N;  4IOI H;  3Q2Y A;  1S9K D;  4DOJ A;  5GTI E;  1BSH A;  2QJK B;  2YO3 A;  1CZQ A;  4D6T J;  1HWT C;  2FYU E;  5L8R J;  1FBM A;  3Q5S A;  5K5G B;  5KLV G;  2OYI C;  2K1A A;  1P84 I;  2H88 C;  2M3B A;  4PV1 B;  2SPZ A;  1YTZ I;  1YQ4 C;  2B87 B;  2L91 A;  4XFJ A;  2Q5U A;  1LTJ A;  4U3F G;  3MUD C;  4EIJ A;  3SWK A;  3WMM 0;  1PGJ A;  3CCQ P;  2YXQ B;  2OTL P;  3H1L D;  4I1L A;  2BAS A;  5APX A;  3L73 E;  3BVH A;  3CXH D;  1LNQ A;  2J5U A;  1OVR A;  1BE3 J;  1R5S A;  3MGN A;  3H1I E;  1SP4 A;  3M0A A;  1GL2 A;  3HUS B;  1S72 P;  3I56 P;  1K04 A;  3P7K A;  1SQX K;  3IN6 A;  3HE4 B;  3A0H H;  4OWF A;  1RF0 C;  2Y0C A;  2ZT9 B;  3BAT A;  3H1J G;  1KB9 I;  2ZXX A;  1NAY A;  5KLV D;  4HYT B;  2FYU G;  1SFC A;  4H13 D;  3KZI H;  1NTK G;  2P10 A;  3CC4 P;  2XDJ A;  3FWL A;  1NU1 J;  1OXZ A;  5H2F H;  2QVA A;  5GTH H;  3TNU B;  2OQQ A;  1H89 A;  3M9Q A;  4U3F D;  1T2K D;  3H32 A;  4WY4 D;  1YYC A;  2WPQ A;  4H0L C;  4YPC A;  3NMD A;  1VQN P;  3CX5 H;  1VQ8 P;  2M5A B;  1KQS O;  1IFJ A;  3L36 A;  4BRY B;  3E1I A;  4O9B A;  1S1C X;  1PGP A;  4Y99 C;  1FZF A;  1SQP J;  1AVY A;  4K35 A;  1MV8 A;  1JY3 N;  1KQG B;  1SQV J;  1KN7 A;  2IDB A;  2YKO A;  1LP1 B;  2NPS D;  5KAF E;  4PD4 H;  3CC7 P;  3PH0 A;  1JCD A;  1MFT A;  1PP9 D;  3L72 E;  2M3E A;  1VL2 A;  4HH2 A;  5BVZ A;  3RL0 D;  3D70 A;  2E75 D;  2WPV B;  2KNC B;  1PPJ G;  4AUW A;  2PP6 A;  3H1J D;  3M0D C;  3SFE C;  3TF5 A;  3AE3 C;  4LLH A;  4KJM A;  1P84 D;  1N7S D;  1BGY G;  3O6Q B;  3H1L J;  2R3S A;  1NTK D;  2A06 G;  5CCH D;  3A3Y B;  3UIA A;  3S1K A;  2JR8 A;  3MP7 B;  1KTM A;  2KUB A;  5AVQ B;  2ZAE B;  2JO1 A;  3KQG A;  3VP8 A;  1L4A C;  3OJA B;  2C0W A;  3PRJ A;  1SQX D;  1HJ0 A;  2QJY B;  2E74 D;  1VF5 C;  3VMZ A;  2K88 A;  1IFM A;  3CX5 I;  1QL2 A;  3H25 A;  3BRT B;  5APQ A;  2GA1 A;  3A5T A;  1N86 A;  2ZXE B;  3H1H G;  4L73 A;  3P8C D;  1KYO H;  3D6Y A;  1E5W A;  1LTA C;  1YI2 P;  1OW8 A;  1K73 Q;  1L0L G;  1GD2 E;  1PPJ D;  5B66 H;  3B71 A;  4DJG A;  1KMI Z;  2W6A A;  1KB9 D;  1LTJ C;  2ZVN B;  2POH A;  2K9J B;  2I1J A;  1NTM E;  3ITK A;  1JY2 O;  2Y0D A;  1W2B O;  3L70 J;  5AVZ B;  1G1I A;  2A06 D;  2V7Q J;  1T3J A;  1Q82 Q;  3CCV P;  2C9N Y;  1Q86 Q;  1WRG A;  2WSF J;  1QX8 A;  2M0B A;  1Q2N A;  3C1L A;  3T97 A;  2KSE A;  5CCG D;  5AW6 B;  2JWA A;  3W68 A;  2NPS A;  3VN0 A;  2IZ0 A;  3HRN A;  3N4X A;  1S5L E;  2KIK A;  1GL2 C;  1EDL A;  1S2E A;  2GUS A;  1MFZ A;  1RE3 A;  3H1J J;  5DJT B;  1VQ6 P;  3Q5R A;  2YNY A;  5AW8 B;  2FYU J;  3JC2 2;  2FYZ A;  5AVU B;  1RQU A;  2WTY A;  3E7K A;  3CCU P;  1NTK J;  5B5E E;  3L71 E;  1CI6 A;  3H32 B;  1JNM A;  3H1H D;  1OVV A;  3L74 G;  1SFC C;  5CCH A;  3VTP C;  3LID A;  4AQR D;  3TK1 A;  1YBK A;  1U7J A;  1KYO I;  2IYP A;  2OGU A;  2JKV A;  5CBO A;  3QH9 A;  3WUV A;  5TIS H;  4PJ0 H;  3CWB E;  4GKG A;  4C7N A;  2PGD A;  2N1T D;  4I7Z C;  3B4S A;  1DEB A;  1K05 A;  1RF0 A;  3HE5 A;  4BXL A;  2WIT A;  1OIP A;  4NPF X;  1E79 H;  1NTZ G;  4ZMD A;  3V2R A;  1X0T A;  4N78 D;  2AEM A;  1SQQ E;  1XTC C;  1IZN B;  2V7Q H;  3H1I J;  3D6Z A;  2H7H A;  1IFI A;  5AW2 B;  3MIW A;  2G3A A;  2YMY A;  4WB4 A;  1PFI A;  1HH0 A;  1KIL B;  1J1D B;  2KLV A;  1PGQ A;  4R4L A;  3B5N D;  1EXJ A;  1SQB E;  3CX5 D;  1NU1 G;  5KJ7 D;  3HD7 D;  1BGY J;  3CL3 D;  3WUU A;  4H44 B;  3P8M C;  3CXH E;  3RK3 B;  1JO5 A;  1VPC A;  3R4Y A;  3TGU E;  3II6 A;  5GTI H;  1L2P A;  1JOC A;  3RK3 E;  2KK7 A;  1EZV I;  2LXB A;  4QMA A;  1RE4 A;  4PD4 D;  2E76 D;  1PGO A;  4HJG H;  4EDF A;  1ZP0 C;  1SQV G;  3RK3 C;  1BE3 D;  1JY2 N;  1N73 A;  3RBZ A;  5AW7 B;  2WZ7 A;  3A0B E;  2DW3 A;  1SLQ A;  2LR2 A;  2FFD C;  2K9Y A;  2YMK A;  2QG4 A;  3M0D A;  1RQV A;  3CCL P;  4IL6 X;  2BEQ D;  2I1K A;  4IL6 H;  2WQY C;  1PV3 A;  1L0L J;  1BCC G;  5KLV K;  2Z5H A;  3MTU E;  3M9B A;  1FC2 C;  3G9R A;  2KYV A;  1NWQ A;  1NU1 D;  1GU4 A;  1ZLL A;  1T2K C;  1X22 A;  3T97 B;  3SSU A;  2IYO A;  3KPE A;  1IC2 A;  4UB6 E;  2MKV A;  1EZV G;  2D2C B;  1SQP D;  1PP9 E;  1L0N G;  2WVR A;  3VOP A;  3U1A A;  1KYO D;  1J2J B;  4JPZ B;  1SQV D;  1KOR A;  2KSJ A;  2GUV A;  2NPS C;  4AYC A;  4L75 A;  4W7Z A;  2WT7 A;  3VMA A;  1FJP A;  2QJP B;  4DCK A;  3JCU E;  4LGD E;  2OTJ P;  2D2C C;  2W83 C;  5KKZ B;  2FXP A;  3RL0 C;  2ZYD A;  1RE3 C;  1EDK A;  1GW4 A;  3L74 J;  1N7S C;  3S4R A;  1KD1 Q;  1JCC A;  1U7M A;  2JP3 A;  2QJP C;  1EDJ A;  1LTI C;  3O8Z A;  1SQX E;  1S4X A;  3L70 G;  5CCH C;  1HGZ A;  1NTK K;  5KAF H;  5KKZ C;  3HE5 B;  2W6J H;  1OWA A;  1GU5 A;  4W80 A;  2IBZ G;  1URQ D;  3AE5 C;  3GHG A;  2CK3 H;  1NTZ J;  2E74 C;  1Q81 Q;  1EZV D;  1JTH A;  3JSV C;  3CMA P;  5CHX A;  3I5C A;  3CI9 A;  1MZ9 A;  1L0N D;  3V6I A;  4H0L B;  1FS0 E;  4YXD C;  4JQ0 D;  1KQL A;  1IFN A;  3AE4 C;  2KS1 A;  1W5C E;  3Q5P A;  4Y99 B;  4RO0 A;  1YQ3 C;  2HYN A;  1H0T B;  2R5D A;  2RN0 A;  5APU A;  5KLI C;  3L71 J;  4EI2 A;  2O1K A;  4GOE A;  1DD4 A;  1N73 B;  5M1B A;  3L70 D;  1EQ7 A;  3F5H A;  1AA0 A;  1R8E A;  2HFE D;  3AEF C;  3L73 G;  1RE4 C;  2J59 M;  3CWB J;  3EQ2 A;  3Q1M A;  1M8O B;  2JEE A;  1KFN A;  4LC1 A;  2UWJ E;  2ITA A;  3H1I G;  5BU5 A;  1GW3 A;  1N73 C;  4XE5 B;  3RK2 D;  2AXT H;  1ZOY C;  2BCC E;  1VQL P;  1NYH A;  4OGQ D;  3FXD A;  1BCC J;  3BCC E;  2FYU D;  1L4A B;  1VQM P;  2FYN B;  1NHL A;  3QWO C;  1VF5 B;  3AE2 C;  1RF1 A;  2KXP B;  2L5G B;  3VYI A;  2PFX A;  3GMA A;  1N8R Q;  1S5L X;  3A0H E;  3L35 A;  4PV1 D;  3H1K E;  1S5L H;  3IAO A;  2FFD A;  2FYN C;  3TGU J;  5CBN A;  5AVX B;  4D6T E;  1L0N J;  1LTG C;  2WT7 B;  5H2F E;  5B5E H;  2RH0 A;  3L73 D;  4NPE A;  1WMK A;  3GLM A;  2YIU C;  3CCM P;  1M1K Q;  1KZU B;  5APS A;  3EFG A;  4ASV A;  1FZC C;  5AVW B;  1LTJ B;  2IX7 C;  2KZI A;  4B86 A;  2HPC A;  1MKM A;  3VP9 A;  1A02 F;  3CX5 E;  3H1I D;  3L72 G;  2YKP A;  4PD4 I;  4WY4 A;  4YTP C;  2A45 H;  1JY2 P;  3V2N A;  1G2C A;  1BGY D;  1ZV8 A;  2AXC A;  1JUN A;  3GF3 A;  3L75 E;  2ZT9 D;  3L37 A;  3SWY A;  1GL2 B;  1FDM A;  1FJK A;  1FOS E;  5AVS B;  1BE3 E;  4JYB A;  4UB8 E;  1NAF A;  2H8P D;  2Q9I A;  2C9L Y;  1Q7Y Q;  3AEG C;  3SFD C;  1YJN P;  4M3L A;  2JDI H;  4IFF A;  1NKZ B;  1SFC B;  1KC8 Q;  2KS1 B;  3GHG C;  2H89 C;  1NGM B;  3F89 A;  2P7J A;  1AFO A;  3AED C;  1N2D C;  2OTK E;  3WU2 E;  1N7S A;  3G6E P;  1ZRT E;  2ZVO B;  4I6M C;  4C46 A;  1M1J C;  4I7Z B;  1L0L D;  2R44 A;  5APW A;  5AW1 B;  2FXO A;  1U57 A;  2O01 H;  1FU1 A;  3A0B H;  2W27 A;  1LWU A;  3CCJ P;  2E43 A;  1FDI A;  1S9K E;  1NU1 K;  1SQP E;  1NTM G;  3USS A;  2NZ2 A;  3L73 J;  1AV1 A;  4Y28 J;  1LT9 C;  3C8V A;  1IK7 A;  2MJZ A;  1AQT A;  2IZ1 A;  3VMY A;  4C7R A;  2XKM A;  2K37 A;  1GZL A;  3KXD A;  3NFQ A;  1SQP K;  3V5B A;  4GOF A;  3HTK A;  3C9I A;  2YO2 A;  1SQV K;  2Q3E A;  1M57 D;  1T8Z A;  4JF7 A;  1M7L A;  1RY3 A;  1GMJ A;  3V2Q A;  2P1J A;  2R32 A;  3CME P;  3HUS A;  3TYY A;  3BAS A;  4DT0 A;  4OH8 B;  3H1L E;  4WVZ A;  5KAI H;  5APT A;  1GTW A;  1FE6 A;  2XND H;  1VQK P;  1PZQ A;  3L71 G;  3L74 D;  2FFD B;  1KV4 A;  3V4W A;  2Z5I A;  2WPS A;  5CJ4 A;  5CCG A;  1GDT A;  1RF1 C;  3CC2 P;  4N3Y B;  3D71 A;  2CPS A;  3G4S P;  1NOH A;  1M56 D;  4NPD A;  4H13 B;  3TSI A;  2HPC B;  1NTM D;  3CWB G;  3LIE A;  5KLV E;  4YXW H;  2KZJ A;  2A45 G;  3MZW B;  3OA7 A;  2HG5 D;  1MUU A;  3ABV C;  3GF7 A;  2OYH A;  1NTZ D;  2N9B A;  3CCS P;  3AEB C;  1OFC X;  1KQF B;  1QVF O;  4TLF A;  4WY4 B;  1OMI A;  1SQQ G;  5E79 E;  1YJW P;  1L0N K;  3G3Z A;  1G2C B;  1T3U A;  3L72 J;  4H13 C;  4U3F E;  2N9Y B;  2QA4 P;  4EOT A;  3AE1 C;  4RJT A;  2BCC J;  1HTL C;  2RKL A;  2R3C A;  4WWI A;  3AEE C;  1SQB G;  1NKN A;  1HJB A;  3BCC J;  2Y9Y A;  4R4M A;  4WY4 C;  3M9H A;  1QGK B;  2IBZ I;  2NPS B;  1R5L A;  3L71 D;  2N1T A;  4W7Y A;  3R2P A;  4HKZ H;  1X9V A;  3TGU G;  1HGV A;  2WSE J;  3O6Q A;  2IFM A;  1FZC A;  3AEA C;  3AE7 C;  3RL0 B;  2FY8 A;  2E75 B;  5DJU B;  2QSI A;  1EXI A;  1YIJ P;  2BEZ F;  2P2U A;  1J1E C;  1N7S B;  3RBX A;  3B5N A;  3H1J E;  1CI6 B;  3CWB D;  5AW9 B;  2XNX A;  2QRX A;  1P84 E;  2ZJS E;  2W8Z A;  3RK2 C;  3U1C A;  5KJ7 A;  3HD7 A;  2E75 C;  1H8A A;  1LGH B;  1NTK E;  1OVU A;  1JEK A;  1IFP A;  2C0X A;  2E42 A;  1FDO A;  1ZR4 A;  4OGQ C;  1IO4 A;  1SQQ D;  1LWU B;  1HVV A;  1BCC D;  4DZO A;  2M8R A;  3GW6 A;  2QJK C;  2FYU K;  2E74 B;  4C7N B;  1VQ7 P;  1OW7 A;  3V2P A;  1Z56 A;  1KIL D;  2B88 A;  3NXS A;  1SQB D;  4PV1 C;  4L74 A;  1NTM J;  2YXR B;  2YKQ A;  4IL6 E;  1LWU C;  3L75 J;  2KP8 A;  3TGU D;  2Q1K A;  3RL0 g;  3HTK B;  2K9J A;  2XV5 A;  2FBW C;  3S9O A;  4H44 D;  3VMX A;  3AE8 C;  5BU8 B;  1X79 B;  3RK3 D;  3P8C E;  5AW3 B;  5KLI B;  1PP9 G;  1ZXG A;  2Q6Q A;  2WSE H;  1PPJ E;  1M1J A;  1RHZ B;  3N7N A;  1YHQ P;  2GM4 A;  1KB9 E;  5CJ0 A;  1A02 J;  1BGY E;  1PL5 A;  2OAR A;  3U59 A;  2VRS A;  3PHL A;  2A06 E;  5AVT B;  3TDK A;  3B8E B;  3HUS C;  4A7P A;  1IFD A;  1JM0 A;  4N6J A;  5C39 A;  1IK9 A;  4MN4 C;  1FZB A;  1DEE G;  1LT9 A;  2V4H A;  4U7J A;  2ZT9 C;  3I55 P;  1JMB A;  3AE6 C;  3A2A A;  3L4F A;  1SQX G;  2FXM A;  3Q3D A;  3LW5 J;  5CCG C;  2OYH B;  2JWD A;  5APV A;  3PP5 A;  1QVG O;  2IBZ D;  1VQ4 P;  3H6P A;  2ZYA A;  4CPG A;  3CD6 P;  1HBW A;  1FZA A;  2J58 A;  3OW2 O;  4HB1 A;  3H1H E;  3CCR P;  1G1J A;  1SS1 A;  3V4Q A;  3EFF K;  5AVY B;  4L76 A;  1LJ2 A;  1SQQ J;  2OYH C;  1L0L E;  4GOD A;  2D2C D;  3W67 A;  4UB8 H;  3FXE A;  2QIW A;  1K8A Q;  1LT1 A;  1VQP P;  2N1T B;  1FZG A;  1DD3 A;  1SQB J;  1ZN5 A;  3M06 A;  1KIL A;  2YIU B;  1L0L K;  1FZC B;  1JB0 J;  2I8D A;  1FOS F;  3MD0 A;  1URQ A;  2HR3 A;  2PRR A;  2KI7 B;  3KZI E;  2JJL A;  4N78 E;  1UIX A;  1AQ5 A;  3IR9 A;  3WU2 H;  2N1T C;  2IFN A;  3B5N B;  1Y8A A;  1HF9 A;  2R5B A;  5GTH E;  2Z4E A;  5EFW B;  3CLQ A;  2QEX P;  2QM8 A;  3HD7 B;  3EWK A; 
#chains in the Genus database with same CATH homology
 2AXT H;  5GTI H;  3KZI H;  4IL6 H;  3JCU H;  3A0B H;  3WU2 H;  5B5E H;  5KAF H;  5E79 H;  3A0H H;  5H2F H;  5TIS H;  1S5L H;  4UB6 H;  5B66 H;  5GTH H;  4PJ0 H;  5KAI H;  4UB8 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...