3WU2H

Crystal structure analysis of photosystem ii complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
63
structure length
63
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of oxygen-evolving photosystem II at a resolution of 1.9 A
pubmed doi rcsb
molecule tags Electron transport, photosynthesis
molecule keywords Photosystem Q(B) protein
total genus 14
structure length 63
sequence length 63
chains with identical sequence h
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 3wu2H01
4UB8H 5KAIH 5B66H 3KZIH 5KAFH 5GTHH 2AXTH 4UB6H 4PJ0H 3WU2H 5GTIH 5TISH 3JCUH 5E79H 1S5LH 5H2FH 4IL6H 5B5EH 3A0BH 3A0HH
chains in the Genus database with same CATH superfamily
3EWKA 1GL2B 3V5BA 3H1JJ 1VQOP 2W6AA 3TYYA 3V4QA 1QVGO 2M8RA 4PJ0H 2FBWC 4ASWA 1W5CE 3H1LG 1IZNB 3SFEC 1HWTC 5L8RJ 2GUSA 2IZ0A 1PL5A 1L0LK 1URQA 2Q3EA 1NVOA 2P1JA 1T8ZA 2NPSB 1SFCD 2GUVA 1LT9A 5APVA 3A5TA 1HJBA 2IYOA 2RH0A 3PTZA 2YMYA 3V2RA 4C7NA 1CI6A 1S9KD 1PPJE 4GODA 3H1LE 1YHQP 4HB1A 3RL0B 3AE8C 1S4XA 3GF7A 4EYYQ 1LTJB 1N2DC 3L75J 1KILB 2Z5IA 2A45G 1LT9B 1FZGA 2QJKB 3GLMA 3A3YB 3HUSC 3PH0A 5CCHA 2R5BA 3K5BA 2KIKA 4LLHA 3AE4C 1QGKB 4DJGA 3D71A 3PJSK 3KYQA 1R5LA 3CXHD 2KNCB 1KYOE 1NH4A 3CI9A 1OIPA 1Z56A 2JKVA 3KPEA 1PP9G 1EZVE 1NWQA 4PV1C 1JY2O 2HPCA 2XNXA 2M3BA 4GIFA 3L72G 3P8CE 1L0LJ 2E75D 1HH0A 1KILE 1SS1A 2A06D 3NMDA 4H0LB 4TLFA 4W7ZA 1M1JC 4PD4E 3C9IA 2G8YA 3TGUG 1VQ4P 2B9BA 2I1JA 3CWBJ 3CMAP 2XDJA 3CL3D 5KLVJ 3CMEP 2WQYC 1KB9I 2E75C 2ZYGA 2R3CA 4L74A 2ZYDA 3M91A 1LTTC 4OVNF 1RF0C 2B87A 2HR3A 4GOEA 5B66E 1NJIQ 2J5UA 2KUBA 1T2KD 1USDA 2KSJA 2GM4A 1FZAA 1LP1B 3L70J 3IAOA 3RBXA 2JO1A 3SWFA 1JNMA 1GZLA 2WVRA 3JCUH 4EDFA 1SQVD 2IYPA 2ZT9C 3CCQP 4LGDE 3CC4P 3Q5SA 1AQ5A 1IFJA 1M90Q 3G4SP 1H89A 2IX7C 1HVVA 1SFCC 4IL6H 1FJKA 3OJAB 3O8ZA 4WVZA 3CWBE 4Z1MH 5KKZC 1H8AA 1J2JB 2KS1B 2QJPC 3AE3C 2OYHC 1SVFA 2YO2A 3MGNA 1SQPD 3TDKA 2FYUE 1H0TA 3FX0A 3SWKA 2M0BA 2WSEH 3HD7C 3AE9C 4PD4D 1N8RQ 5KLIB 1BDCA 1FDIA 2B87B 2VRSA 1KYOH 3ABVC 4H13B 1JCCA 4OH8B 3VMYA 3NFQA 3L71J 3MD0A 2YKQA 2IDBA 1GW3A 1KYOD 4H44C 4OGQB 1EC5A 1BCCG 3AEFC 3L75D 2B88A 5TJHA 3CC2P 1J1DB 3GW6A 1EDKA 4PV1D 1MZ9A 2ZT9D 2FYNC 1URQC 2KK7A 4OWFA 2V7QJ 1NTME 2E74C 2E5YA 2PP6A 1FZFA 4K3AA 2MKVA 5AW1B 2C9NY 1JY3O 2O01H 3CC7P 1DD3A 2W8ZA 3RK3E 2YIUB 2KNCA 2E42A 2OARA 3RK2C 5DJTB 1ZRTD 3H1ID 4N6JA 4U3FG 2FFDC 1BE3G 3CWBD 2BEZF 5KAIE 4D6TJ 1S9KE 1VQ7P 2FXPA 1WT6A 3B71A 1BE3D 1FOSE 2HFED 4U3FD 1LWUC 3L70G 1FBMA 1NU1K 1S2EA 1W2BO 1P84I 3GHGB 4PJ0E 3JSVC 1IFPA 2N9BA 1FE6A 1LTJA 1JY2P 3V2NA 5CMZA 3ZDMA 1Q82Q 4GDOA 4U3FE 1Q2NA 4BXLA 2UWJE 4C7RA 5TISH 2KI7B 4JF7A 2L91A 1SQPK 2OYIB 3TK1A 2KP8A 3RK2B 1RF1C 3RGUA 1ZR2A 2A45I 3CX5I 1RY3A 1RE3A 2KZJA 4CPGA 3D70A 1L0NJ 3L73D 1KC8Q 1EZVG 2ZXXA 1N73A 1URQB 1X79B 1SQQD 1E79H 3L72J 1AQTA 2HODA 2W6BA 3TNUA 3S4RA 1MFZA 1ZLLA 2HG5D 1SLQA 4H44B 4RO0A 1PZQA 3L36A 1IK7A 1G1IA 2Z4EA 4H13C 3RL0g 1FJPA 4IL6E 2JDIH 1L4AD 5KLIC 3RBZA 2Q7CA 1HTLC 5BU8B 1EXJA 1VQKP 3O6QA 1AVYA 3RK3D 1VQ6P 1RQUA 3H1HE 2OYOA 1NTKJ 2WITA 1EXIA 2D2CB 1L4AC 1MUUA 1EDLA 1NYHA 2CK3H 2BEQD 2K9YA 2Q6QA 1SQBG 3VYIA 2RKLA 3AE1C 3HE5A 1KTMA 1KB9D 3PP5A 3Q5RA 3L4FA 3IN6A 1U7MA 2LXCB 4KJMA 1LNQA 3JC22 1AA0A 3TNUB 5KLVG 1T2KC 4PD4I 3CCLP 1N73B 3B5ND 1IFMA 5H2FH 1J1EB 3CXHH 3EQ2A 3MUDA 2K88A 3N7NA 1VQMP 1FDMA 4PD4H 1NTZG 1HBWA 5AW8B 1GD2E 1L0NG 2W83C 1PV3A 3T97A 2A06G 5CCGA 2WSCJ 3S9OA 5GTIH 5K5GB 2OYIA 1BGYG 1VDFA 1VPCA 2WSCH 2XKMA 3Q5PA 2M3EA 1N7LA 2AEJA 4AQRD 2M5AA 1PP9D 3WUUA 3L72E 2H8PD 3GHGA 2QEXP 2I8DA 1T3JA 3HTKB 1RF1B 1X9VA 1U7JA 2PGDA 1S3JA 2N1TA 1IFIA 3LW5H 1L0NE 5DJUB 1AVOA 5APXA 1KILD 3AE6C 1KQGB 4W7YA 3WU2E 1BGYE 1IFNA 3WMM0 1GK4A 1L0LD 1NAYA 3I5CA 4PV1B 3F5HA 1HF9A 5E79E 1QEXA 2QM8A 3A0BH 4GT1A 3HUSA 3P7KA 2QRXA 5CCHC 1NKZB 2ITAA 3AE2C 2XV5A 1RE4A 4L76A 1FZCB 5AVXB 3HUSB 2FFDB 1LWUA 1NOHA 2QJKC 1YITP 1IO4A 3VMXA 1FAVA 5GTHH 4BRYA 3Q2YA 1K9MQ 1GMJA 1KB9H 3AEEC 3E1IA 2E74B 1DX7A 2JJLA 5KLVE 2R32A 1JM0A 5KJ7C 2FYUK 3H1LD 1EQ7A 1J1DC 2G3AA 1JB0J 3AECC 5APUA 5CCGD 1SQXG 1Y9BA 2YXQB 3M0AA 1BDDA 1P84H 5B5EH 2BCCJ 1RF0A 3F89A 1URQD 3IR9A 4K35A 1OW8A 1YYCA 3L74G 1GL2C 3VP8A 1H88A 1LTBC 5KTBA 4WB4A 3KZIH 3CD6P 3V4WA 1DEEG 1PGPA 1VL2A 2IBZD 2WZ7A 2Y9YA 3M0DA 4HJGH 2D2CC 3CCUP 2Y0DA 2QA4P 4R4LA 2OYHB 5AVUB 2Q3IA 3BATA 1HUCA 2K9JA 3A0HH 3CLQA 5CCHD 3HE5B 1SFCB 2WPRA 4NPFX 5KAFH 5KLVK 2FYUJ 3FXEA 2FXOA 3H1KD 4KT0J 3H1KG 3LIDA 5AW3B 1YI2P 1Q86Q 1RHZB 1PP9J 2WSEJ 2HLOA 1OFCX 1X8YA 3RL0D 2OQQA 3W68A 4JBZA 5AVWB 1N86A 2O3JA 1L4AA 1PGQA 3CX5E 3KDPB 3O6QB 2IBZG 4NPEA 2N1TD 1VQNP 3MTUE 1ZN5A 4HKZH 3G6EP 3L74D 1OVUA 1S1CX 2IBZI 2E5TA 1SQPJ 3H1KE 3NXSA 1OXZA 4I2LC 1KYOI 1NKNA 1T3UA 1ZOYC 2YO3A 4UB6H 3L70E 2Y9ZA 1M57D 2Y0CA 4D6TD 1M56D 2IPPA 1NAFA 1OVRA 2KOGA 1YJNP 2YXRB 4U3FJ 5C39A 3CCEP 1CW5A 3PRJA 3S1KA 3G71P 1NTZE 1WMKA 3BCCJ 3BASA 1JMBA 5BU5A 1PIXA 1FZCC 1IK9A 4H0LD 4IFFA 1Y47A 3FWNA 4WY4C 1JOCA 3FGAD 2LKMA 2AXTE 2YKOA 5AW0B 1DEBA 5AW2B 4YXDC 3M9QA 1YTZT 1S5LH 1L0LE 1OX3A 1KILA 1TU3F 1PGOA 4I7ZC 3Q3DA 1UIXA 2E76C 1HJ0A 2LR2A 2WWWA 3AE5C 4B86A 3CCSP 3EFFK 1IFDA 1NTMJ 4C7NB 3GG2A 4XE5B 4UB8H 4W80A 4ZMDA 1FU1A 3LW5J 1NTKK 5AW9B 1LTJC 2NPSA 1L0LG 1JTHA 4L75A 1K73Q 2WSSH 1KFNA 1JY3N 4YXWH 1GTWA 1N7SA 5KJ7D 1NHLA 1PGJA 3L75E 3SWYA 1S72P 2BASA 1QL1A 1D7MA 4OGQC 3G3ZA 1J1EC 5APYA 2FY8A 3BRTB 3RK3C 1N73C 1BGYD 5CHXA 5KJ7A 4ZNCA 3U1CA 1BSNA 1L0ND 2E74D 3L73J 4A7PA 1NU1G 5GTIE 3PHLA 1NTZD 2KLVA 3HD7B 2N9YB 4RJTA 1OWAA 1USEA 5H2FE 1U57A 1L4AB 2C0XA 3VMAA 1X22A 3WUTA 1PFIA 3HE4B 3E7KA 1VQ8P 5KLVD 4DT0A 1BCCJ 1ZP0C 2JEEA 3GF3A 3M9BA 5EFWB 1L2PA 1SQBD 2YMKA 2ZYAA 3H1IJ 1W2EA 3L74E 3L74J 3V2QA 2ZT9B 1MKMA 3Q1MA 4UB6E 2K9JB 1Q81Q 1KD1Q 3BVHA 2H7HA 2Y0EA 2KS1A 4WBAA 2PAJA 3MP7B 1ZR4A 2Q1KA 1OZHA 3OAKA 4EIJA 3CPWO 3EFGA 1NTKD 3B8EB 4LC1A 1VQ9P 1N7SD 2KZIA 1QLED 1LJ2A 1SQQE 2P7JA 1PP9E 2P58A 1E5WA 1G1JA 4YTPC 2E43A 2K3RA 3C8VA 2Q5UA 2E75B 2O1JA 3L73E 2P2UA 3C1LA 3ITKA 4N3YB 2BCCG 4YPCA 1KQFB 3MUDC 2XU6A 4BWNA 1K8AQ 1QX8A 1NTMD 1VF5B 1M1JB 1Y8AA 1PPJD 3L71D 4I1LA 4NPDA 2FFDA 2QM7A 3HE4A 5CCGC 1QL2A 1R8EA 1SQQG 3USSA 2OYIC 1EZVD 3BRVB 3V6IA 3L73G 1ZV8A 1NTZK 2BCCE 2AEFA 1AFOA 1T6AA 3GHGC 1K04A 1SP4A 2DW3A 1LWUB 1GL2D 2IZ1A 2N1TC 1CZQA 2GA1A 1ZW0A 2WMMA 1G2CA 1SQBK 4UB8E 5B5EE 1FZCA 1OVVA 1VQLP 2WSFJ 2K37A 2V7QH 2O01J 3L37A 4Y28J 2WSFH 2WPQA 1YQ4C 3AEDC 3H1HD 1FDOA 2IFNA 3H1LJ 3HRNA 1LT9C 4M3LA 3TGUJ 2Q9IA 1LTGC 2YIUC 3B5NC 1KILC 1KQSO 3L70D 3H1JG 3A2AA 1N7SB 1S5LX 2MJZA 1YIJP 1KN7A 1RE4C 2B89A 2FYNB 1JTHB 3CWBG 1AJYA 3M06A 5KAIH 5GTHE 3H1JD 3H1IG 2QE7H 4IOIH 5APTA 3HTKA 1Q7YQ 3BCCE 3G9RA 1NTZJ 3H1HG 3CCVP 3LIEA 2ZAEB 3MIWA 1DH3A 1VF5D 3H6PA 4XA4A 3H1JE 3SFDC 3VMZA 1FZEA 2D2CD 2YKPA 1CI6B 2AEMA 1SQBE 3QWOC 1OW7A 1SQXK 3AEGC 3A0BE 1SQXJ 4HH2A 5CJ0A 5APSA 3T97B 3TF5A 1YJWP 5AVVB 3L75G 1BCCD 4ZKUA 1EDIA 1SQPE 2P67A 3H1KJ 2OTJP 2FXMA 2IBZE 2O1KA 2RN0A 3UIAA 1VQ5P 1Q90D 2A45H 2QJPB 2ZFCA 3CX5H 4TT3H 2ZVNB 5AVQB 2QSIA 5CBNA 1PPJG 4ASVA 2C9LY 3L71G 5KKZB 1NTMG 2OTLP 1YJ9P 1GL2A 3CCJP 1NU1E 2QG4A 3H32A 2BCCD 3WUVA 3E1RA 3M0DC 2Z5HA 1SQPG 3D6ZA 1NGMB 3NTNA 2QVAA 1IC2A 2ZVOB 1RQVA 2JP3A 4U7JA 3OW2O 1KV4A 2WPVB 2YNYA 2I1KA 1YBKA 3CXHE 1NTKG 1A02J 1SQVJ 2RMZA 1LTIC 2KLUA 3U1AA 5AVZB 1SQVG 2PRRA 2H88C 1X0TA 2W27A 3D6YA 1BE3J 1P84E 3AE7C 3II6A 4IL6X 4EI2A 2SPZA 2WTYA 1EZVI 3RK2D 3W67A 1NTKE 2JWAA 1OW6A 1SFCA 2L5GB 1GW4A 3H1HJ 4XFJA 1LTSC 4HYTB 5AVSB 2NZ2A 2HODB 4H0LC 5B66H 2K1AA 5CBOA 3V2PA 1SQVE 4RKUJ 1FS0E 5CJ4A 1M1KQ 2OYHA 3VTPC 2KB7P 3A7OA 1KMIZ 2W6JH 5APWA 2C0WA 3R2PA 3TGUD 1KB9E 1NU1D 4H44D 1DD4A 2QJYB 2ZJSE 2E76D 4ZKPA 2J59M 2FYZA 1JEKA 3I56P 1JCDA 3AEAC 1MFTA 3GMAA 3KHUA 1NO4A 3L72D 2FKWB 4H13D 4WY4A 1LT1A 4WWIA 2KSEA 5M1BA 4DCKA 3H25A 1JO5A 5AVTB 1NTMK 4OGQD 1ZXGA 2R44A 5E79H 2WT7B 3I55P 1R5SA 1GU4A 2W90A 3RK3B 2NRGA 3OA7A 3CXHI 1KQLA 1XTCC 3KQGA 4JPZB 3RL0C 1BGYJ 3WU2H 4GKGA 1GDTA 3FWLA 1RH5B 2KXPB 4Y99B 5AVYB 1IJDB 3M9HA 3VOPA 1SQBJ 1HGVA 3CX5D 4BRYB 3B5NA 2R5DA 2IFMA 2OGUA 3FXDA 3IF4A 2NPSC 1JMMA 4JQ0D 2XZRA 1KORA 5AW6B 5TISE 3QH9A 1A02F 1K05A 1N7SC 1G2CB 3PLNA 4R4MA 5AVRB 2HYNA 2H43A 1JUNA 4IFDK 2JR8A 1S5LE 4AUWA 3B5NB 5AW4B 1DIPA 4EOTA 2H89C 1P84D 2O01N 2AXTH 3MHVA 1M8OB 1FC2C 4D6TE 1SQQK 4MN4C 2E76B 1JY2N 4I7ZB 3VN0A 3TSIA 2A06E 2N1TB 3HD7D 3R4YA 2WT7A 5APQA 1M7LA 1HGZA 2AXCA 2QJYC 3IFMA 1M1JA 3B4SA 3TGUE 3P8CD 1YQ3C 3U59A 1RF1A 1RE3C 2XNDH 2M5AB 5AW7B 1FOSF 1BSHA 3N4XA 3L35A 3AEBC 3BCCD 4WY4B 4D6TG 1H0TB 3CCRP 1SQVK 1LTAC 1BE3E 1KFMA 1VF5C 2WPSA 3VP9A 2P10A 4Y99C 3L71E 4O9BA 2CPBA 1AV1A 4KHXA 5AW5B 4C46A 4IFMA 2ZXEB 2FYUD 1JY3P 2OTKE 2R3SA 1QVFO 1LGHB 1FZBA 2NPSD 4I6MC 4RESB 1EDJA 1GK6A 1VQPP 1LP1A 4N78E 2J58A 1OMIA 3MZWB 5KAFE 3KXDA 3A0HE 3CCMP 4L73A 2HPCB 1SQQJ 2KYVA 1NU1J 1CSBA 3P32A 4JYCA 1KZUB 4JYBA 4AYCA 2FYUG 4DZOA 1ZMEC 2CPSA 1UIIA 2LXBA 5BVZA 3SSUA 3KZIE 4GOFA 2PFXA 2POHA 1MV8A 3HD7A 1WRGA 3P8MC 1GU5A 4N78D 4DOJA 1YTZI 2V4HA 2JWDA 3JCUE 2QIWA 4WY4D 1ZRTE 3H1IE 4QMAA 1SQXE 1SQXD 3BCCG 1BCCE 3H32B 1XTGB 1L0NK
chains in the Genus database with same CATH topology
4UB8H 5KAIH 5B66H 3KZIH 5KAFH 5GTHH 2AXTH 4UB6H 4PJ0H 3WU2H 5GTIH 5TISH 3JCUH 5E79H 1S5LH 5H2FH 4IL6H 5B5EH 3A0BH 3A0HH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB8 H;  5KAI H;  5B66 H;  3KZI H;  5KAF H;  5GTH H;  2AXT H;  4UB6 H;  4PJ0 H;  3WU2 H;  5GTI H;  5TIS H;  3JCU H;  5E79 H;  1S5L H;  5H2F H;  4IL6 H;  5B5E H;  3A0B H;  3A0H H; 
#chains in the Genus database with same CATH topology
 3EWK A;  1GL2 B;  3V5B A;  3H1J J;  1VQO P;  2W6A A;  3TYY A;  3V4Q A;  1QVG O;  2M8R A;  4PJ0 H;  2FBW C;  4ASW A;  1W5C E;  3H1L G;  1IZN B;  3SFE C;  1HWT C;  5L8R J;  2GUS A;  2IZ0 A;  1PL5 A;  1L0L K;  1URQ A;  2Q3E A;  1NVO A;  2P1J A;  1T8Z A;  2NPS B;  1SFC D;  2GUV A;  1LT9 A;  5APV A;  3A5T A;  1HJB A;  2IYO A;  2RH0 A;  3PTZ A;  2YMY A;  3V2R A;  4C7N A;  1CI6 A;  1S9K D;  1PPJ E;  4GOD A;  3H1L E;  1YHQ P;  4HB1 A;  3RL0 B;  3AE8 C;  1S4X A;  3GF7 A;  4EYY Q;  1LTJ B;  1N2D C;  3L75 J;  1KIL B;  2Z5I A;  2A45 G;  1LT9 B;  1FZG A;  2QJK B;  3GLM A;  3A3Y B;  3HUS C;  3PH0 A;  5CCH A;  2R5B A;  3K5B A;  2KIK A;  4LLH A;  3AE4 C;  1QGK B;  4DJG A;  3D71 A;  3PJS K;  3KYQ A;  1R5L A;  3CXH D;  2KNC B;  1KYO E;  1NH4 A;  3CI9 A;  1OIP A;  1Z56 A;  2JKV A;  3KPE A;  1PP9 G;  1EZV E;  1NWQ A;  4PV1 C;  1JY2 O;  2HPC A;  2XNX A;  2M3B A;  4GIF A;  3L72 G;  3P8C E;  1L0L J;  2E75 D;  1HH0 A;  1KIL E;  1SS1 A;  2A06 D;  3NMD A;  4H0L B;  4TLF A;  4W7Z A;  1M1J C;  4PD4 E;  3C9I A;  2G8Y A;  3TGU G;  1VQ4 P;  2B9B A;  2I1J A;  3CWB J;  3CMA P;  2XDJ A;  3CL3 D;  5KLV J;  3CME P;  2WQY C;  1KB9 I;  2E75 C;  2ZYG A;  2R3C A;  4L74 A;  2ZYD A;  3M91 A;  1LTT C;  4OVN F;  1RF0 C;  2B87 A;  2HR3 A;  4GOE A;  5B66 E;  1NJI Q;  2J5U A;  2KUB A;  1T2K D;  1USD A;  2KSJ A;  2GM4 A;  1FZA A;  1LP1 B;  3L70 J;  3IAO A;  3RBX A;  2JO1 A;  3SWF A;  1JNM A;  1GZL A;  2WVR A;  3JCU H;  4EDF A;  1SQV D;  2IYP A;  2ZT9 C;  3CCQ P;  4LGD E;  3CC4 P;  3Q5S A;  1AQ5 A;  1IFJ A;  1M90 Q;  3G4S P;  1H89 A;  2IX7 C;  1HVV A;  1SFC C;  4IL6 H;  1FJK A;  3OJA B;  3O8Z A;  4WVZ A;  3CWB E;  4Z1M H;  5KKZ C;  1H8A A;  1J2J B;  2KS1 B;  2QJP C;  3AE3 C;  2OYH C;  1SVF A;  2YO2 A;  3MGN A;  1SQP D;  3TDK A;  2FYU E;  1H0T A;  3FX0 A;  3SWK A;  2M0B A;  2WSE H;  3HD7 C;  3AE9 C;  4PD4 D;  1N8R Q;  5KLI B;  1BDC A;  1FDI A;  2B87 B;  2VRS A;  1KYO H;  3ABV C;  4H13 B;  1JCC A;  4OH8 B;  3VMY A;  3NFQ A;  3L71 J;  3MD0 A;  2YKQ A;  2IDB A;  1GW3 A;  1KYO D;  4H44 C;  4OGQ B;  1EC5 A;  1BCC G;  3AEF C;  3L75 D;  2B88 A;  5TJH A;  3CC2 P;  1J1D B;  3GW6 A;  1EDK A;  4PV1 D;  1MZ9 A;  2ZT9 D;  2FYN C;  1URQ C;  2KK7 A;  4OWF A;  2V7Q J;  1NTM E;  2E74 C;  2E5Y A;  2PP6 A;  1FZF A;  4K3A A;  2MKV A;  5AW1 B;  2C9N Y;  1JY3 O;  2O01 H;  3CC7 P;  1DD3 A;  2W8Z A;  3RK3 E;  2YIU B;  2KNC A;  2E42 A;  2OAR A;  3RK2 C;  5DJT B;  1ZRT D;  3H1I D;  4N6J A;  4U3F G;  2FFD C;  1BE3 G;  3CWB D;  2BEZ F;  5KAI E;  4D6T J;  1S9K E;  1VQ7 P;  2FXP A;  1WT6 A;  3B71 A;  1BE3 D;  1FOS E;  2HFE D;  4U3F D;  1LWU C;  3L70 G;  1FBM A;  1NU1 K;  1S2E A;  1W2B O;  1P84 I;  3GHG B;  4PJ0 E;  3JSV C;  1IFP A;  2N9B A;  1FE6 A;  1LTJ A;  1JY2 P;  3V2N A;  5CMZ A;  3ZDM A;  1Q82 Q;  4GDO A;  4U3F E;  1Q2N A;  4BXL A;  2UWJ E;  4C7R A;  5TIS H;  2KI7 B;  4JF7 A;  2L91 A;  1SQP K;  2OYI B;  3TK1 A;  2KP8 A;  3RK2 B;  1RF1 C;  3RGU A;  1ZR2 A;  2A45 I;  3CX5 I;  1RY3 A;  1RE3 A;  2KZJ A;  4CPG A;  3D70 A;  1L0N J;  3L73 D;  1KC8 Q;  1EZV G;  2ZXX A;  1N73 A;  1URQ B;  1X79 B;  1SQQ D;  1E79 H;  3L72 J;  1AQT A;  2HOD A;  2W6B A;  3TNU A;  3S4R A;  1MFZ A;  1ZLL A;  2HG5 D;  1SLQ A;  4H44 B;  4RO0 A;  1PZQ A;  3L36 A;  1IK7 A;  1G1I A;  2Z4E A;  4H13 C;  3RL0 g;  1FJP A;  4IL6 E;  2JDI H;  1L4A D;  5KLI C;  3RBZ A;  2Q7C A;  1HTL C;  5BU8 B;  1EXJ A;  1VQK P;  3O6Q A;  1AVY A;  3RK3 D;  1VQ6 P;  1RQU A;  3H1H E;  2OYO A;  1NTK J;  2WIT A;  1EXI A;  2D2C B;  1L4A C;  1MUU A;  1EDL A;  1NYH A;  2CK3 H;  2BEQ D;  2K9Y A;  2Q6Q A;  1SQB G;  3VYI A;  2RKL A;  3AE1 C;  3HE5 A;  1KTM A;  1KB9 D;  3PP5 A;  3Q5R A;  3L4F A;  3IN6 A;  1U7M A;  2LXC B;  4KJM A;  1LNQ A;  3JC2 2;  1AA0 A;  3TNU B;  5KLV G;  1T2K C;  4PD4 I;  3CCL P;  1N73 B;  3B5N D;  1IFM A;  5H2F H;  1J1E B;  3CXH H;  3EQ2 A;  3MUD A;  2K88 A;  3N7N A;  1VQM P;  1FDM A;  4PD4 H;  1NTZ G;  1HBW A;  5AW8 B;  1GD2 E;  1L0N G;  2W83 C;  1PV3 A;  3T97 A;  2A06 G;  5CCG A;  2WSC J;  3S9O A;  5GTI H;  5K5G B;  2OYI A;  1BGY G;  1VDF A;  1VPC A;  2WSC H;  2XKM A;  3Q5P A;  2M3E A;  1N7L A;  2AEJ A;  4AQR D;  2M5A A;  1PP9 D;  3WUU A;  3L72 E;  2H8P D;  3GHG A;  2QEX P;  2I8D A;  1T3J A;  3HTK B;  1RF1 B;  1X9V A;  1U7J A;  2PGD A;  1S3J A;  2N1T A;  1IFI A;  3LW5 H;  1L0N E;  5DJU B;  1AVO A;  5APX A;  1KIL D;  3AE6 C;  1KQG B;  4W7Y A;  3WU2 E;  1BGY E;  1IFN A;  3WMM 0;  1GK4 A;  1L0L D;  1NAY A;  3I5C A;  4PV1 B;  3F5H A;  1HF9 A;  5E79 E;  1QEX A;  2QM8 A;  3A0B H;  4GT1 A;  3HUS A;  3P7K A;  2QRX A;  5CCH C;  1NKZ B;  2ITA A;  3AE2 C;  2XV5 A;  1RE4 A;  4L76 A;  1FZC B;  5AVX B;  3HUS B;  2FFD B;  1LWU A;  1NOH A;  2QJK C;  1YIT P;  1IO4 A;  3VMX A;  1FAV A;  5GTH H;  4BRY A;  3Q2Y A;  1K9M Q;  1GMJ A;  1KB9 H;  3AEE C;  3E1I A;  2E74 B;  1DX7 A;  2JJL A;  5KLV E;  2R32 A;  1JM0 A;  5KJ7 C;  2FYU K;  3H1L D;  1EQ7 A;  1J1D C;  2G3A A;  1JB0 J;  3AEC C;  5APU A;  5CCG D;  1SQX G;  1Y9B A;  2YXQ B;  3M0A A;  1BDD A;  1P84 H;  5B5E H;  2BCC J;  1RF0 A;  3F89 A;  1URQ D;  3IR9 A;  4K35 A;  1OW8 A;  1YYC A;  3L74 G;  1GL2 C;  3VP8 A;  1H88 A;  1LTB C;  5KTB A;  4WB4 A;  3KZI H;  3CD6 P;  3V4W A;  1DEE G;  1PGP A;  1VL2 A;  2IBZ D;  2WZ7 A;  2Y9Y A;  3M0D A;  4HJG H;  2D2C C;  3CCU P;  2Y0D A;  2QA4 P;  4R4L A;  2OYH B;  5AVU B;  2Q3I A;  3BAT A;  1HUC A;  2K9J A;  3A0H H;  3CLQ A;  5CCH D;  3HE5 B;  1SFC B;  2WPR A;  4NPF X;  5KAF H;  5KLV K;  2FYU J;  3FXE A;  2FXO A;  3H1K D;  4KT0 J;  3H1K G;  3LID A;  5AW3 B;  1YI2 P;  1Q86 Q;  1RHZ B;  1PP9 J;  2WSE J;  2HLO A;  1OFC X;  1X8Y A;  3RL0 D;  2OQQ A;  3W68 A;  4JBZ A;  5AVW B;  1N86 A;  2O3J A;  1L4A A;  1PGQ A;  3CX5 E;  3KDP B;  3O6Q B;  2IBZ G;  4NPE A;  2N1T D;  1VQN P;  3MTU E;  1ZN5 A;  4HKZ H;  3G6E P;  3L74 D;  1OVU A;  1S1C X;  2IBZ I;  2E5T A;  1SQP J;  3H1K E;  3NXS A;  1OXZ A;  4I2L C;  1KYO I;  1NKN A;  1T3U A;  1ZOY C;  2YO3 A;  4UB6 H;  3L70 E;  2Y9Z A;  1M57 D;  2Y0C A;  4D6T D;  1M56 D;  2IPP A;  1NAF A;  1OVR A;  2KOG A;  1YJN P;  2YXR B;  4U3F J;  5C39 A;  3CCE P;  1CW5 A;  3PRJ A;  3S1K A;  3G71 P;  1NTZ E;  1WMK A;  3BCC J;  3BAS A;  1JMB A;  5BU5 A;  1PIX A;  1FZC C;  1IK9 A;  4H0L D;  4IFF A;  1Y47 A;  3FWN A;  4WY4 C;  1JOC A;  3FGA D;  2LKM A;  2AXT E;  2YKO A;  5AW0 B;  1DEB A;  5AW2 B;  4YXD C;  3M9Q A;  1YTZ T;  1S5L H;  1L0L E;  1OX3 A;  1KIL A;  1TU3 F;  1PGO A;  4I7Z C;  3Q3D A;  1UIX A;  2E76 C;  1HJ0 A;  2LR2 A;  2WWW A;  3AE5 C;  4B86 A;  3CCS P;  3EFF K;  1IFD A;  1NTM J;  4C7N B;  3GG2 A;  4XE5 B;  4UB8 H;  4W80 A;  4ZMD A;  1FU1 A;  3LW5 J;  1NTK K;  5AW9 B;  1LTJ C;  2NPS A;  1L0L G;  1JTH A;  4L75 A;  1K73 Q;  2WSS H;  1KFN A;  1JY3 N;  4YXW H;  1GTW A;  1N7S A;  5KJ7 D;  1NHL A;  1PGJ A;  3L75 E;  3SWY A;  1S72 P;  2BAS A;  1QL1 A;  1D7M A;  4OGQ C;  3G3Z A;  1J1E C;  5APY A;  2FY8 A;  3BRT B;  3RK3 C;  1N73 C;  1BGY D;  5CHX A;  5KJ7 A;  4ZNC A;  3U1C A;  1BSN A;  1L0N D;  2E74 D;  3L73 J;  4A7P A;  1NU1 G;  5GTI E;  3PHL A;  1NTZ D;  2KLV A;  3HD7 B;  2N9Y B;  4RJT A;  1OWA A;  1USE A;  5H2F E;  1U57 A;  1L4A B;  2C0X A;  3VMA A;  1X22 A;  3WUT A;  1PFI A;  3HE4 B;  3E7K A;  1VQ8 P;  5KLV D;  4DT0 A;  1BCC J;  1ZP0 C;  2JEE A;  3GF3 A;  3M9B A;  5EFW B;  1L2P A;  1SQB D;  2YMK A;  2ZYA A;  3H1I J;  1W2E A;  3L74 E;  3L74 J;  3V2Q A;  2ZT9 B;  1MKM A;  3Q1M A;  4UB6 E;  2K9J B;  1Q81 Q;  1KD1 Q;  3BVH A;  2H7H A;  2Y0E A;  2KS1 A;  4WBA A;  2PAJ A;  3MP7 B;  1ZR4 A;  2Q1K A;  1OZH A;  3OAK A;  4EIJ A;  3CPW O;  3EFG A;  1NTK D;  3B8E B;  4LC1 A;  1VQ9 P;  1N7S D;  2KZI A;  1QLE D;  1LJ2 A;  1SQQ E;  2P7J A;  1PP9 E;  2P58 A;  1E5W A;  1G1J A;  4YTP C;  2E43 A;  2K3R A;  3C8V A;  2Q5U A;  2E75 B;  2O1J A;  3L73 E;  2P2U A;  3C1L A;  3ITK A;  4N3Y B;  2BCC G;  4YPC A;  1KQF B;  3MUD C;  2XU6 A;  4BWN A;  1K8A Q;  1QX8 A;  1NTM D;  1VF5 B;  1M1J B;  1Y8A A;  1PPJ D;  3L71 D;  4I1L A;  4NPD A;  2FFD A;  2QM7 A;  3HE4 A;  5CCG C;  1QL2 A;  1R8E A;  1SQQ G;  3USS A;  2OYI C;  1EZV D;  3BRV B;  3V6I A;  3L73 G;  1ZV8 A;  1NTZ K;  2BCC E;  2AEF A;  1AFO A;  1T6A A;  3GHG C;  1K04 A;  1SP4 A;  2DW3 A;  1LWU B;  1GL2 D;  2IZ1 A;  2N1T C;  1CZQ A;  2GA1 A;  1ZW0 A;  2WMM A;  1G2C A;  1SQB K;  4UB8 E;  5B5E E;  1FZC A;  1OVV A;  1VQL P;  2WSF J;  2K37 A;  2V7Q H;  2O01 J;  3L37 A;  4Y28 J;  2WSF H;  2WPQ A;  1YQ4 C;  3AED C;  3H1H D;  1FDO A;  2IFN A;  3H1L J;  3HRN A;  1LT9 C;  4M3L A;  3TGU J;  2Q9I A;  1LTG C;  2YIU C;  3B5N C;  1KIL C;  1KQS O;  3L70 D;  3H1J G;  3A2A A;  1N7S B;  1S5L X;  2MJZ A;  1YIJ P;  1KN7 A;  1RE4 C;  2B89 A;  2FYN B;  1JTH B;  3CWB G;  1AJY A;  3M06 A;  5KAI H;  5GTH E;  3H1J D;  3H1I G;  2QE7 H;  4IOI H;  5APT A;  3HTK A;  1Q7Y Q;  3BCC E;  3G9R A;  1NTZ J;  3H1H G;  3CCV P;  3LIE A;  2ZAE B;  3MIW A;  1DH3 A;  1VF5 D;  3H6P A;  4XA4 A;  3H1J E;  3SFD C;  3VMZ A;  1FZE A;  2D2C D;  2YKP A;  1CI6 B;  2AEM A;  1SQB E;  3QWO C;  1OW7 A;  1SQX K;  3AEG C;  3A0B E;  1SQX J;  4HH2 A;  5CJ0 A;  5APS A;  3T97 B;  3TF5 A;  1YJW P;  5AVV B;  3L75 G;  1BCC D;  4ZKU A;  1EDI A;  1SQP E;  2P67 A;  3H1K J;  2OTJ P;  2FXM A;  2IBZ E;  2O1K A;  2RN0 A;  3UIA A;  1VQ5 P;  1Q90 D;  2A45 H;  2QJP B;  2ZFC A;  3CX5 H;  4TT3 H;  2ZVN B;  5AVQ B;  2QSI A;  5CBN A;  1PPJ G;  4ASV A;  2C9L Y;  3L71 G;  5KKZ B;  1NTM G;  2OTL P;  1YJ9 P;  1GL2 A;  3CCJ P;  1NU1 E;  2QG4 A;  3H32 A;  2BCC D;  3WUV A;  3E1R A;  3M0D C;  2Z5H A;  1SQP G;  3D6Z A;  1NGM B;  3NTN A;  2QVA A;  1IC2 A;  2ZVO B;  1RQV A;  2JP3 A;  4U7J A;  3OW2 O;  1KV4 A;  2WPV B;  2YNY A;  2I1K A;  1YBK A;  3CXH E;  1NTK G;  1A02 J;  1SQV J;  2RMZ A;  1LTI C;  2KLU A;  3U1A A;  5AVZ B;  1SQV G;  2PRR A;  2H88 C;  1X0T A;  2W27 A;  3D6Y A;  1BE3 J;  1P84 E;  3AE7 C;  3II6 A;  4IL6 X;  4EI2 A;  2SPZ A;  2WTY A;  1EZV I;  3RK2 D;  3W67 A;  1NTK E;  2JWA A;  1OW6 A;  1SFC A;  2L5G B;  1GW4 A;  3H1H J;  4XFJ A;  1LTS C;  4HYT B;  5AVS B;  2NZ2 A;  2HOD B;  4H0L C;  5B66 H;  2K1A A;  5CBO A;  3V2P A;  1SQV E;  4RKU J;  1FS0 E;  5CJ4 A;  1M1K Q;  2OYH A;  3VTP C;  2KB7 P;  3A7O A;  1KMI Z;  2W6J H;  5APW A;  2C0W A;  3R2P A;  3TGU D;  1KB9 E;  1NU1 D;  4H44 D;  1DD4 A;  2QJY B;  2ZJS E;  2E76 D;  4ZKP A;  2J59 M;  2FYZ A;  1JEK A;  3I56 P;  1JCD A;  3AEA C;  1MFT A;  3GMA A;  3KHU A;  1NO4 A;  3L72 D;  2FKW B;  4H13 D;  4WY4 A;  1LT1 A;  4WWI A;  2KSE A;  5M1B A;  4DCK A;  3H25 A;  1JO5 A;  5AVT B;  1NTM K;  4OGQ D;  1ZXG A;  2R44 A;  5E79 H;  2WT7 B;  3I55 P;  1R5S A;  1GU4 A;  2W90 A;  3RK3 B;  2NRG A;  3OA7 A;  3CXH I;  1KQL A;  1XTC C;  3KQG A;  4JPZ B;  3RL0 C;  1BGY J;  3WU2 H;  4GKG A;  1GDT A;  3FWL A;  1RH5 B;  2KXP B;  4Y99 B;  5AVY B;  1IJD B;  3M9H A;  3VOP A;  1SQB J;  1HGV A;  3CX5 D;  4BRY B;  3B5N A;  2R5D A;  2IFM A;  2OGU A;  3FXD A;  3IF4 A;  2NPS C;  1JMM A;  4JQ0 D;  2XZR A;  1KOR A;  5AW6 B;  5TIS E;  3QH9 A;  1A02 F;  1K05 A;  1N7S C;  1G2C B;  3PLN A;  4R4M A;  5AVR B;  2HYN A;  2H43 A;  1JUN A;  4IFD K;  2JR8 A;  1S5L E;  4AUW A;  3B5N B;  5AW4 B;  1DIP A;  4EOT A;  2H89 C;  1P84 D;  2O01 N;  2AXT H;  3MHV A;  1M8O B;  1FC2 C;  4D6T E;  1SQQ K;  4MN4 C;  2E76 B;  1JY2 N;  4I7Z B;  3VN0 A;  3TSI A;  2A06 E;  2N1T B;  3HD7 D;  3R4Y A;  2WT7 A;  5APQ A;  1M7L A;  1HGZ A;  2AXC A;  2QJY C;  3IFM A;  1M1J A;  3B4S A;  3TGU E;  3P8C D;  1YQ3 C;  3U59 A;  1RF1 A;  1RE3 C;  2XND H;  2M5A B;  5AW7 B;  1FOS F;  1BSH A;  3N4X A;  3L35 A;  3AEB C;  3BCC D;  4WY4 B;  4D6T G;  1H0T B;  3CCR P;  1SQV K;  1LTA C;  1BE3 E;  1KFM A;  1VF5 C;  2WPS A;  3VP9 A;  2P10 A;  4Y99 C;  3L71 E;  4O9B A;  2CPB A;  1AV1 A;  4KHX A;  5AW5 B;  4C46 A;  4IFM A;  2ZXE B;  2FYU D;  1JY3 P;  2OTK E;  2R3S A;  1QVF O;  1LGH B;  1FZB A;  2NPS D;  4I6M C;  4RES B;  1EDJ A;  1GK6 A;  1VQP P;  1LP1 A;  4N78 E;  2J58 A;  1OMI A;  3MZW B;  5KAF E;  3KXD A;  3A0H E;  3CCM P;  4L73 A;  2HPC B;  1SQQ J;  2KYV A;  1NU1 J;  1CSB A;  3P32 A;  4JYC A;  1KZU B;  4JYB A;  4AYC A;  2FYU G;  4DZO A;  1ZME C;  2CPS A;  1UII A;  2LXB A;  5BVZ A;  3SSU A;  3KZI E;  4GOF A;  2PFX A;  2POH A;  1MV8 A;  3HD7 A;  1WRG A;  3P8M C;  1GU5 A;  4N78 D;  4DOJ A;  1YTZ I;  2V4H A;  2JWD A;  3JCU E;  2QIW A;  4WY4 D;  1ZRT E;  3H1I E;  4QMA A;  1SQX E;  1SQX D;  3BCC G;  1BCC E;  3H32 B;  1XTG B;  1L0N K; 
#chains in the Genus database with same CATH homology
 4UB8 H;  5KAI H;  5B66 H;  3KZI H;  5KAF H;  5GTH H;  2AXT H;  4UB6 H;  4PJ0 H;  3WU2 H;  5GTI H;  5TIS H;  3JCU H;  5E79 H;  1S5L H;  5H2F H;  4IL6 H;  5B5E H;  3A0B H;  3A0H H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...