2IBZG

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
93
Chain Sequence
GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
total genus 16
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 2ibzG00
1SQQG 1P84H 1SQBG 4PD4H 1SQVG 1SQXG 1NTKG 2FYUG 1BGYG 1SQPG 1BCCG 1NTZG 3H1JG 1NTMG 3H1HG 3L73G 1EZVG 3L72G 3H1LG 2IBZG 4D6TG 1NU1G 3L75G 5KLVG 3H1KG 1L0LG 1KB9H 1KYOH 1L0NG 3H1IG 1BE3G 4U3FG 2A06G 3L71G 2BCCG 3BCCG 3TGUG 1PPJG 3CXHH 3CX5H 1PP9G 3CWBG 3L70G 3L74G
chains in the Genus database with same CATH superfamily
1Y9BA 2MKVA 3M0DC 5TISH 2E74B 1KQSO 5AW6B 1SQXK 2W83C 3L73D 1NTKK 1BDCA 3L73J 1PFIA 1L0NJ 1NTMD 4JF7A 3CCVP 1KQLA 2H8PD 1KYOI 4GT1A 2RMZA 1MZ9A 2KLVA 3H1KJ 5KAIH 3MZWB 2YKOA 4NPEA 3RBZA 1NU1D 1VQMP 4BXLA 2FXPA 3L72G 3AE5C 5E79E 2LXBA 1T2KD 1FZCC 2OYHC 1OVVA 3L71E 2N9BA 2QE7H 3AE3C 1LT1A 4ZKUA 1GZLA 4UB6E 3V2PA 1J1DB 1KYOH 2G8YA 5AW4B 1M1JB 5KLVK 2Y9ZA 1NJIQ 5APTA 2Q1KA 1LTJA 1CI6A 2BCCJ 2CK3H 2NPSD 2W6AA 2W6JH 2Y0DA 3O6QA 1LJ2A 3K5BA 2WPVB 2VRSA 3MHVA 2W27A 3L4FA 3M9QA 1HH0A 4WVZA 3L70G 3L36A 3V2QA 1FZFA 1RE4A 3AEFC 5KKZB 2UWJE 2FYUK 1Q81Q 1NGMB 1DIPA 3AE6C 3A0BE 1MFZA 2IBZE 3CX5E 3L70D 3L37A 1ZR2A 3A0HE 1JCCA 3AE9C 1IFJA 4IL6X 2QRXA 5KLVJ 1JO5A 1U7MA 5B5EH 5CJ4A 2O01H 3C1LA 3L73G 4KJMA 5GTIE 3HUSA 2BEQD 2L5GB 1JY2O 3TDKA 1YI2P 2IBZG 3VYIA 3KZIE 1FZGA 4AYCA 3KHUA 1SQXE 4WWIA 3CCJP 3OAKA 3FXEA 4NPFX 1N73B 1IK9A 1N7LA 1U57A 1XTGB 4PD4D 3PTZA 1KV4A 1JB0J 2C0XA 1HF9A 3TK1A 1OWAA 1AA0A 2IPPA 3FWNA 3B5ND 4JQ0D 1NKNA 1YYCA 2FYUE 4KHXA 4R4LA 3H1ID 1M1KQ 3WUVA 2HPCA 4IOIH 2FYZA 1M90Q 5AVQB 3HE5B 1MFTA 3CX5D 3L70E 1HVVA 4PV1B 1CZQA 2E76D 2QJYB 3MD0A 4IFMA 1FOSF 5AVTB 4YXDC 1OVUA 4AUWA 2HODB 1X8YA 2LXCB 2BCCE 2XNXA 5APWA 1K8AQ 1Q7YQ 1BE3D 3M0DA 1LP1B 1ZR4A 1P84D 5KLVG 3H1JJ 1NO4A 2OYHB 1FDOA 5GTIH 2JDIH 1PP9J 2FYNB 4RJTA 1YJWP 1FZCB 2JJLA 4DCKA 2Q9IA 3CC2P 2NPSB 2E5YA 2WT7A 3BRTB 1FZAA 1USEA 1EDKA 2M5AA 1XTCC 4BWNA 1SQBD 1VQNP 2J5UA 1HJ0A 3WU2E 4HB1A 1GU5A 1PGQA 2FYUD 1L0NE 4M3LA 1GTWA 1U7JA 1DD3A 2WSFJ 1NOHA 1N7SA 1SLQA 4OWFA 1SQBG 3V2NA 4D6TJ 1FDMA 2GUVA 1YQ3C 2O1JA 2KNCB 2QJKC 1EZVD 1MUUA 3A0HH 3T97B 2FYUG 4K35A 3H1IJ 1BGYG 1JY2N 3KXDA 1FZCA 1FZEA 1VL2A 1EDLA 1ZRTD 4TT3H 2C9LY 3TF5A 3W68A 1NTZJ 2K9YA 2ZXEB 2KS1B 1SQQJ 3G6EP 2NPSC 5APYA 3IR9A 1BE3E 2JR8A 2C9NY 3PLNA 1QL1A 2WTYA 1BGYE 2KZIA 4H0LD 4U7JA 3RL0D 3S4RA 4I7ZC 2K3RA 4Y28J 3V2RA 3WUTA 3H1HD 2PGDA 3HD7A 1EDJA 1KYOE 4XA4A 1L0NG 1NYHA 2QJKB 1BE3G 3HRNA 3KPEA 5KLVE 2WMMA 3JCUE 5TISE 3AECC 4B86A 4Z1MH 3EWKA 1FJKA 1L0LD 1NHLA 5CJ0A 1VQOP 3IF4A 1J1EB 5EFWB 3T97A 2AEJA 5KLIB 4N78E 1LT9C 1KD1Q 1VQKP 4OGQC 1VQ6P 3SWKA 2QM7A 2YIUC 4N3YB 4PD4E 2Q3EA 1LT9B 4C46A 4WY4B 2OARA 1NKZB 4C7NA 1IFPA 3N4XA 4CPGA 3HUSC 1FE6A 2NRGA 2YO2A 3BASA 4UB8E 1UIIA 2OQQA 3B71A 3W67A 2ZFCA 2WSSH 2QEXP 4EOTA 1J2JB 3VP9A 1YQ4C 4H44C 3VMXA 1NTKD 1EZVG 2OYHA 1DX7A 1BGYD 1SQXJ 4EIJA 1GL2B 1L0NK 1LWUB 4HYTB 3VN0A 2KOGA 4OGQB 3L35A 3CPWO 2QJPC 2E76B 3AEDC 3C8VA 2JP3A 1X0TA 2HLOA 3I5CA 4MN4C 1N7SC 1GMJA 3F5HA 3QWOC 3TGUJ 1ZOYC 1NU1J 2KLUA 1G1JA 2ZVNB 1SQPJ 3HTKA 1S5LH 3HD7C 4DOJA 3SWFA 3G71P 4IFDK 3H1KD 1X22A 5KJ7C 1FAVA 1ZMEC 1IJDB 3CXHE 1LWUA 3S1KA 4ZKPA 1L0ND 1NTMJ 2GUSA 2HPCB 4WB4A 2AXTE 1G2CB 1SQVG 2R44A 3GF3A 1BDDA 4LLHA 3CMAP 1S1CX 3TNUA 4LC1A 1USDA 5APUA 2K9JA 2N1TB 1FC2C 2Y9YA 1QX8A 5KLIC 2YXRB 3L74D 2P2UA 1KILC 2R3CA 5AW7B 1PP9E 1GK6A 2KYVA 2XZRA 1PGJA 5B5EE 2E74C 1SQPK 3M9BA 3LIEA 4IL6E 1RF1A 2XV5A 1K05A 3L71D 5B66H 2FFDB 1P84I 2Y0EA 4Y99B 3CC7P 1T3JA 1IFIA 1Z56A 5CCHA 1WT6A 3FWLA 1RH5B 3EQ2A 3BVHA 1Q2NA 5APQA 3L71G 3BCCJ 2ZT9D 3AEBC 2DW3A 1GW4A 2E75D 3AE1C 3M06A 4OH8B 5KAFE 1CW5A 2IFMA 1GL2A 3KYQA 1LWUC 1OW8A 3HE4A 3NXSA 2WSCH 3H1IE 3H32B 3II6A 3OA7A 1J1DC 2JEEA 3L74J 1JY2P 1RF1C 2E42A 1WMKA 4D6TE 3B4SA 1AQ5A 4NPDA 3HTKB 2IBZD 1L0LJ 1HTLC 2H88C 2Q6QA 2V4HA 1T8ZA 3AEAC 3AE4C 1YHQP 3CX5I 2A45H 2PAJA 1NTMG 3L75D 4L75A 3VMYA 3PH0A 2KI7B 3R2PA 1VQ8P 2IZ1A 5TJHA 1RE3C 1SQPD 5H2FE 1HJBA 2R5DA 1NU1G 1JY3N 1QVGO 3VTPC 1T6AA 4EI2A 3M0AA 2GM4A 2QIWA 3U1AA 3H1IG 2YKQA 1WRGA 1SQQD 2WZ7A 1LNQA 1S5LX 3HD7B 4UB6H 4XE5B 3TGUG 1NTMK 4I2LC 5KTBA 1BGYJ 1SQXD 2P10A 4JYBA 3CXHI 1NTKJ 1L4AA 3CWBJ 4H44D 3MUDA 3WU2H 3ZDMA 5KAFH 3GHGC 3USSA 2WVRA 1W5CE 4PD4H 3KZIH 3Q3DA 1S72P 1NWQA 1VQ7P 2IBZI 2ZVOB 3KQGA 3GHGB 2ZYDA 1JM0A 3G3ZA 5L8RJ 1URQB 1ZRTE 2N9YB 3G9RA 2KB7P 3UIAA 4TLFA 3QH9A 2XNDH 3H1JG 1K9MQ 1LTAC 1N7SD 1HWTC 2CPBA 1H0TA 3I55P 1AVYA 1N7SB 4HKZH 4ZMDA 3A7OA 5DJTB 2FY8A 2KSEA 1H0TB 3H1JD 1FDIA 4PD4I 1PPJD 4WY4C 3TGUE 3KDPB 4PV1C 1DD4A 1FBMA 1P84E 3LIDA 4GOEA 2M5AB 1SQBE 2HYNA 1BE3J 1LTBC 2KXPB 1YJNP 3RK3E 2KS1A 2KSJA 1SFCD 3IAOA 1J1EC 1S3JA 1N73A 4C7NB 2D2CD 3D71A 2JWDA 3JCUH 2V7QJ 3U1CA 1KILD 2KNCA 1S2EA 3E1RA 3G4SP 1SQQG 1S4XA 2FFDC 1NTZD 3HUSB 4JPZB 4YTPC 1SQVK 2Z5HA 4N6JA 4BRYB 3SFEC 2OYIB 1AFOA 5AVUB 4I7ZB 3GF7A 2ZYGA 1QL2A 4I1LA 1MKMA 3E1IA 2AXCA 1ZV8A 3PRJA 2E75B 1S9KD 2P67A 1NTZG 2NPSA 2ZAEB 2O3JA 3HE5A 3RK2B 3Q5SA 1Q86Q 5CCHD 4D6TD 3CL3D 2E75C 1NTME 2M8RA 3NMDA 2FYUJ 2OTKE 5M1BA 3SFDC 3M91A 4RESB 1LP1A 1LTSC 1SQBJ 2FXMA 1RQUA 4H44B 1YTZI 4IL6H 3RL0g 1M1JC 1NU1E 3A5TA 2XU6A 4HH2A 3U59A 2MJZA 1PGOA 1L2PA 3TYYA 3O8ZA 1GK4A 1T3UA 1RF0A 4L74A 5BVZA 4RKUJ 3RK2D 3GHGA 5KLVD 2Q7CA 1PPJG 4EDFA 1L4AC 2WWWA 4EYYQ 2IZ0A 3L70J 1PP9G 1MV8A 5APXA 3CCQP 1NH4A 4N78D 1L4AB 3CLQA 2QA4P 2AXTH 1LTIC 2H43A 1L0LE 1QLED 1ZLLA 2Q5UA 1VF5C 3RK3C 4ASWA 1NTKG 4PJ0H 1AV1A 2I8DA 2WT7B 4H13D 5AVWB 3H25A 3D70A 1KB9I 1M7LA 1PGPA 3A0BH 4W7ZA 2YKPA 1IK7A 1H88A 2IFNA 2JO1A 1G2CA 4HJGH 1PZQA 1IFDA 2RN0A 5BU8B 1JY3P 2Q3IA 5CCGA 1KQGB 2RKLA 3V5BA 3CCLP 1K04A 5AVXB 3AE7C 2H7HA 4OVNF 3H1KG 1OXZA 3F89A 4QMAA 2WSCJ 2R3SA 1SQVE 5CCGD 2ITAA 1SQBK 4H0LC 4IFFA 3E7KA 3RL0C 3MTUE 3AEGC 3NTNA 2A06G 3CCRP 3CCUP 1X79B 1SVFA 3JSVC 4UB8H 2C0WA 2JWAA 2E5TA 1OVRA 2W90A 5AVRB 1YTZT 1KILE 3H32A 3Q5RA 3L74G 3CXHD 5DJUB 3V6IA 1P84H 4WY4D 2QJYC 1GL2D 4PV1D 3PJSK 4OGQD 1SQQK 1VQPP 1TU3F 2P7JA 3O6QB 3SSUA 2ZT9B 1M56D 1S9KE 1BCCG 1A02F 3VP8A 3WUUA 4DT0A 4WY4A 1M1JA 3L74E 3L72E 3AEEC 2D2CC 1ZP0C 3LW5J 1R5LA 3P8CE 4ZNCA 5CBOA 1YBKA 1OW7A 2FXOA 1BCCD 3P32A 4LGDE 3BCCD 4YXWH 3Q5PA 1W2BO 2BCCD 1R8EA 4W80A 1L0LK 1KQFB 1RE4C 2K9JB 2N1TA 3CMEP 1SQQE 2QSIA 3TNUB 5AVSB 1D7MA 2BCCG 5AW8B 2J58A 5H2FH 5AW5B 1OIPA 2FKWB 3L73E 5CCHC 2NZ2A 3Q2YA 1JCDA 1PL5A 1BSHA 3L72J 3H6PA 2WSEJ 5CMZA 3V4WA 3OW2O 3GLMA 3VOPA 3RL0B 5KJ7D 1N73C 1CI6B 2I1KA 2M3EA 1FS0E 1SQPG 1GD2E 4PJ0E 1AVOA 1G1IA 1IZNB 2J59M 3FX0A 1CSBA 3AE8C 3H1HE 5AW1B 1L4AD 5AW9B 2IDBA 3FGAD 4GKGA 3CCSP 3H1JE 1PPJE 1LTTC 3TGUD 3CCEP 1GDTA 2OGUA 1SQPE 2V7QH 1JEKA 3H1LJ 1IO4A 2E74D 1VF5D 4U3FJ 3NFQA 3RK3D 1JOCA 1VF5B 3RK3B 2D2CB 1HBWA 2IYPA 3BCCG 1SFCB 4DZOA 1JNMA 2H89C 3H1LE 4L73A 5GTHE 5AW3B 3D6YA 1LT9A 2YIUB 2R32A 1KYOD 3MUDC 2LKMA 4KT0J 4ASVA 1LGHB 1RHZB 1EDIA 2E76C 2O01N 2SPZA 5B66E 1OZHA 1DEBA 2CPSA 2B9BA 2IX7C 5C39A 3V4QA 3CD6P 2HODA 2WPSA 1RF0C 4WBAA 1NAFA 5AVYB 2W8ZA 1HGZA 2WSEH 3CWBE 2K37A 4GODA 4RO0A 5CCGC 1KC8Q 2M0BA 2A45G 2LR2A 1Y8AA 1KTMA 2HFED 1VQLP 1SS1A 1OX3A 1Q82Q 3MP7B 4DJGA 1VQ9P 2GA1A 2BASA 1JTHB 1KILA 3MIWA 1SQVJ 3A3YB 3SWYA 1VDFA 1EXJA 2HG5D 2I1JA 3BCCE 1S5LE 3OJAB 1YJ9P 3L75G 5K5GB 3P8CD 1IFNA 3BRVB 1KORA 1GL2C 3H1HJ 3PP5A 1KB9E 2YMYA 4W7YA 1E5WA 1FJPA 2AEFA 1EC5A 5AW2B 2B88A 3R4YA 5GTHH 2B89A 2B87B 1LTGC 1NTZE 1PIXA 5KJ7A 3CX5H 2R5BA 2Y0CA 5CBNA 1QGKB 3CWBG 1M57D 3PHLA 2WPRA 1PV3A 1JTHA 1URQC 5AVVB 1SQXG 1VPCA 3VMAA 2N1TC 1JMBA 1EQ7A 1KMIZ 2KK7A 3H1KE 1EXIA 5CHXA 4GIFA 4I6MC 1JY3O 2K1AA 2KZJA 3ITKA 2KUBA 5BU5A 1FOSE 4R4MA 3H1HG 1AQTA 3IN6A 3I56P 1VQ5P 4Y99C 3B5NA 3B5NB 1HUCA 2E43A 4H0LB 1VQ4P 1AJYA 2L91A 1PP9D 1L0LG 5E79H 1K73Q 1ZXGA 2Z4EA 1KB9H 1R5SA 3M9HA 5APVA 1SFCA 2KIKA 1UIXA 2M3BA 2O01J 1YITP 1Q90D 3B8EB 3JC22 5KAIE 3BATA 1KFNA 3CCMP 1T2KC 3FXDA 1H8AA 1SFCC 2KP8A 2W6BA 1E79H 1QEXA 2G3AA 3LW5H 2YO3A 3ABVC 3S9OA 1IC2A 1N2DC 4XFJA 4GOFA 4K3AA 2B87A 2QVAA 3CWBD 3A2AA 1BSNA 3TSIA 3C9IA 1EZVE 1OW6A 1Y47A 1FZBA 4L76A 1BCCE 4U3FD 3Q1MA 2RH0A 2WQYC 2YNYA 1JUNA 2HR3A 2QJPB 3H1LG 3P7KA 2OTJP 3N7NA 2FYNC 2AEMA 4D6TG 2FBWC 3L75E 4JYCA 1SP4A 1NU1K 1OMIA 1DEEG 3HD7D 2OYIC 2ZJSE 1KFMA 3IFMA 3AE2C 3RBXA 4AQRD 1H89A 1EZVI 3L75J 1A02J 1FU1A 1NVOA 3CXHH 3GW6A 1DH3A 4O9BA 1SQVD 5AVZB 5KKZC 1KB9D 1NTZK 1W2EA 1RQVA 3RK2C 3MGNA 4BRYA 2OYIA 1JMMA 2OTLP 2A06E 1LTJC 2Z5IA 1QVFO 2PRRA 3CI9A 1RE3A 2YXQB 3L72D 1LTJB 2P1JA 1YIJP 1NTKE 3GG2A 3WMM0 1N8RQ 2P58A 2PFXA 4GDOA 4H13B 2K88A 5APSA 3EFGA 2OYOA 2WSFH 1X9VA 3D6ZA 4H13C 2IYOA 1OFCX 2POHA 3B5NC 4U3FE 5AW0B 3RGUA 1ZN5A 2A45I 1GW3A 1KILB 2QG4A 2XKMA 2WPQA 2YMKA 2PP6A 4C7RA 2BEZF 3HE4B 2ZT9C 2ZXXA 3L71J 1BCCJ 1URQD 3VMZA 3CC4P 4A7PA 2N1TD 1M8OB 2JKVA 3EFFK 2O1KA 1RY3A 3P8MC 4U3FG 1KN7A 3GMAA 3H1LD 1URQA 1N86A 2WITA 2XDJA 1IFMA 1KZUB 1GU4A 1HGVA 2QM8A 1NAYA 4YPCA 1ZW0A 2FFDA 2ZYAA 2A06D 1RF1B 4JBZA
chains in the Genus database with same CATH topology
1SQQG 1P84H 1SQBG 4PD4H 1SQVG 1SQXG 1NTKG 2FYUG 1BGYG 1SQPG 1BCCG 1NTZG 3H1JG 1NTMG 3H1HG 3L73G 1EZVG 3L72G 3H1LG 2IBZG 4D6TG 1NU1G 3L75G 5KLVG 3H1KG 1L0LG 1KB9H 1KYOH 1L0NG 3H1IG 1BE3G 4U3FG 2A06G 3L71G 2BCCG 3BCCG 3TGUG 1PPJG 3CXHH 3CX5H 1PP9G 3CWBG 3L70G 3L74G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQQ G;  1P84 H;  1SQB G;  4PD4 H;  1SQV G;  1SQX G;  1NTK G;  2FYU G;  1BGY G;  1SQP G;  1BCC G;  1NTZ G;  3H1J G;  1NTM G;  3H1H G;  3L73 G;  1EZV G;  3L72 G;  3H1L G;  2IBZ G;  4D6T G;  1NU1 G;  3L75 G;  5KLV G;  3H1K G;  1L0L G;  1KB9 H;  1KYO H;  1L0N G;  3H1I G;  1BE3 G;  4U3F G;  2A06 G;  3L71 G;  2BCC G;  3BCC G;  3TGU G;  1PPJ G;  3CXH H;  3CX5 H;  1PP9 G;  3CWB G;  3L70 G;  3L74 G; 
#chains in the Genus database with same CATH topology
 1Y9B A;  2MKV A;  3M0D C;  5TIS H;  2E74 B;  1KQS O;  5AW6 B;  1SQX K;  2W83 C;  3L73 D;  1NTK K;  1BDC A;  3L73 J;  1PFI A;  1L0N J;  1NTM D;  4JF7 A;  3CCV P;  1KQL A;  2H8P D;  1KYO I;  4GT1 A;  2RMZ A;  1MZ9 A;  2KLV A;  3H1K J;  5KAI H;  3MZW B;  2YKO A;  4NPE A;  3RBZ A;  1NU1 D;  1VQM P;  4BXL A;  2FXP A;  3L72 G;  3AE5 C;  5E79 E;  2LXB A;  1T2K D;  1FZC C;  2OYH C;  1OVV A;  3L71 E;  2N9B A;  2QE7 H;  3AE3 C;  1LT1 A;  4ZKU A;  1GZL A;  4UB6 E;  3V2P A;  1J1D B;  1KYO H;  2G8Y A;  5AW4 B;  1M1J B;  5KLV K;  2Y9Z A;  1NJI Q;  5APT A;  2Q1K A;  1LTJ A;  1CI6 A;  2BCC J;  2CK3 H;  2NPS D;  2W6A A;  2W6J H;  2Y0D A;  3O6Q A;  1LJ2 A;  3K5B A;  2WPV B;  2VRS A;  3MHV A;  2W27 A;  3L4F A;  3M9Q A;  1HH0 A;  4WVZ A;  3L70 G;  3L36 A;  3V2Q A;  1FZF A;  1RE4 A;  3AEF C;  5KKZ B;  2UWJ E;  2FYU K;  1Q81 Q;  1NGM B;  1DIP A;  3AE6 C;  3A0B E;  1MFZ A;  2IBZ E;  3CX5 E;  3L70 D;  3L37 A;  1ZR2 A;  3A0H E;  1JCC A;  3AE9 C;  1IFJ A;  4IL6 X;  2QRX A;  5KLV J;  1JO5 A;  1U7M A;  5B5E H;  5CJ4 A;  2O01 H;  3C1L A;  3L73 G;  4KJM A;  5GTI E;  3HUS A;  2BEQ D;  2L5G B;  1JY2 O;  3TDK A;  1YI2 P;  2IBZ G;  3VYI A;  3KZI E;  1FZG A;  4AYC A;  3KHU A;  1SQX E;  4WWI A;  3CCJ P;  3OAK A;  3FXE A;  4NPF X;  1N73 B;  1IK9 A;  1N7L A;  1U57 A;  1XTG B;  4PD4 D;  3PTZ A;  1KV4 A;  1JB0 J;  2C0X A;  1HF9 A;  3TK1 A;  1OWA A;  1AA0 A;  2IPP A;  3FWN A;  3B5N D;  4JQ0 D;  1NKN A;  1YYC A;  2FYU E;  4KHX A;  4R4L A;  3H1I D;  1M1K Q;  3WUV A;  2HPC A;  4IOI H;  2FYZ A;  1M90 Q;  5AVQ B;  3HE5 B;  1MFT A;  3CX5 D;  3L70 E;  1HVV A;  4PV1 B;  1CZQ A;  2E76 D;  2QJY B;  3MD0 A;  4IFM A;  1FOS F;  5AVT B;  4YXD C;  1OVU A;  4AUW A;  2HOD B;  1X8Y A;  2LXC B;  2BCC E;  2XNX A;  5APW A;  1K8A Q;  1Q7Y Q;  1BE3 D;  3M0D A;  1LP1 B;  1ZR4 A;  1P84 D;  5KLV G;  3H1J J;  1NO4 A;  2OYH B;  1FDO A;  5GTI H;  2JDI H;  1PP9 J;  2FYN B;  4RJT A;  1YJW P;  1FZC B;  2JJL A;  4DCK A;  2Q9I A;  3CC2 P;  2NPS B;  2E5Y A;  2WT7 A;  3BRT B;  1FZA A;  1USE A;  1EDK A;  2M5A A;  1XTC C;  4BWN A;  1SQB D;  1VQN P;  2J5U A;  1HJ0 A;  3WU2 E;  4HB1 A;  1GU5 A;  1PGQ A;  2FYU D;  1L0N E;  4M3L A;  1GTW A;  1U7J A;  1DD3 A;  2WSF J;  1NOH A;  1N7S A;  1SLQ A;  4OWF A;  1SQB G;  3V2N A;  4D6T J;  1FDM A;  2GUV A;  1YQ3 C;  2O1J A;  2KNC B;  2QJK C;  1EZV D;  1MUU A;  3A0H H;  3T97 B;  2FYU G;  4K35 A;  3H1I J;  1BGY G;  1JY2 N;  3KXD A;  1FZC A;  1FZE A;  1VL2 A;  1EDL A;  1ZRT D;  4TT3 H;  2C9L Y;  3TF5 A;  3W68 A;  1NTZ J;  2K9Y A;  2ZXE B;  2KS1 B;  1SQQ J;  3G6E P;  2NPS C;  5APY A;  3IR9 A;  1BE3 E;  2JR8 A;  2C9N Y;  3PLN A;  1QL1 A;  2WTY A;  1BGY E;  2KZI A;  4H0L D;  4U7J A;  3RL0 D;  3S4R A;  4I7Z C;  2K3R A;  4Y28 J;  3V2R A;  3WUT A;  3H1H D;  2PGD A;  3HD7 A;  1EDJ A;  1KYO E;  4XA4 A;  1L0N G;  1NYH A;  2QJK B;  1BE3 G;  3HRN A;  3KPE A;  5KLV E;  2WMM A;  3JCU E;  5TIS E;  3AEC C;  4B86 A;  4Z1M H;  3EWK A;  1FJK A;  1L0L D;  1NHL A;  5CJ0 A;  1VQO P;  3IF4 A;  1J1E B;  5EFW B;  3T97 A;  2AEJ A;  5KLI B;  4N78 E;  1LT9 C;  1KD1 Q;  1VQK P;  4OGQ C;  1VQ6 P;  3SWK A;  2QM7 A;  2YIU C;  4N3Y B;  4PD4 E;  2Q3E A;  1LT9 B;  4C46 A;  4WY4 B;  2OAR A;  1NKZ B;  4C7N A;  1IFP A;  3N4X A;  4CPG A;  3HUS C;  1FE6 A;  2NRG A;  2YO2 A;  3BAS A;  4UB8 E;  1UII A;  2OQQ A;  3B71 A;  3W67 A;  2ZFC A;  2WSS H;  2QEX P;  4EOT A;  1J2J B;  3VP9 A;  1YQ4 C;  4H44 C;  3VMX A;  1NTK D;  1EZV G;  2OYH A;  1DX7 A;  1BGY D;  1SQX J;  4EIJ A;  1GL2 B;  1L0N K;  1LWU B;  4HYT B;  3VN0 A;  2KOG A;  4OGQ B;  3L35 A;  3CPW O;  2QJP C;  2E76 B;  3AED C;  3C8V A;  2JP3 A;  1X0T A;  2HLO A;  3I5C A;  4MN4 C;  1N7S C;  1GMJ A;  3F5H A;  3QWO C;  3TGU J;  1ZOY C;  1NU1 J;  2KLU A;  1G1J A;  2ZVN B;  1SQP J;  3HTK A;  1S5L H;  3HD7 C;  4DOJ A;  3SWF A;  3G71 P;  4IFD K;  3H1K D;  1X22 A;  5KJ7 C;  1FAV A;  1ZME C;  1IJD B;  3CXH E;  1LWU A;  3S1K A;  4ZKP A;  1L0N D;  1NTM J;  2GUS A;  2HPC B;  4WB4 A;  2AXT E;  1G2C B;  1SQV G;  2R44 A;  3GF3 A;  1BDD A;  4LLH A;  3CMA P;  1S1C X;  3TNU A;  4LC1 A;  1USD A;  5APU A;  2K9J A;  2N1T B;  1FC2 C;  2Y9Y A;  1QX8 A;  5KLI C;  2YXR B;  3L74 D;  2P2U A;  1KIL C;  2R3C A;  5AW7 B;  1PP9 E;  1GK6 A;  2KYV A;  2XZR A;  1PGJ A;  5B5E E;  2E74 C;  1SQP K;  3M9B A;  3LIE A;  4IL6 E;  1RF1 A;  2XV5 A;  1K05 A;  3L71 D;  5B66 H;  2FFD B;  1P84 I;  2Y0E A;  4Y99 B;  3CC7 P;  1T3J A;  1IFI A;  1Z56 A;  5CCH A;  1WT6 A;  3FWL A;  1RH5 B;  3EQ2 A;  3BVH A;  1Q2N A;  5APQ A;  3L71 G;  3BCC J;  2ZT9 D;  3AEB C;  2DW3 A;  1GW4 A;  2E75 D;  3AE1 C;  3M06 A;  4OH8 B;  5KAF E;  1CW5 A;  2IFM A;  1GL2 A;  3KYQ A;  1LWU C;  1OW8 A;  3HE4 A;  3NXS A;  2WSC H;  3H1I E;  3H32 B;  3II6 A;  3OA7 A;  1J1D C;  2JEE A;  3L74 J;  1JY2 P;  1RF1 C;  2E42 A;  1WMK A;  4D6T E;  3B4S A;  1AQ5 A;  4NPD A;  3HTK B;  2IBZ D;  1L0L J;  1HTL C;  2H88 C;  2Q6Q A;  2V4H A;  1T8Z A;  3AEA C;  3AE4 C;  1YHQ P;  3CX5 I;  2A45 H;  2PAJ A;  1NTM G;  3L75 D;  4L75 A;  3VMY A;  3PH0 A;  2KI7 B;  3R2P A;  1VQ8 P;  2IZ1 A;  5TJH A;  1RE3 C;  1SQP D;  5H2F E;  1HJB A;  2R5D A;  1NU1 G;  1JY3 N;  1QVG O;  3VTP C;  1T6A A;  4EI2 A;  3M0A A;  2GM4 A;  2QIW A;  3U1A A;  3H1I G;  2YKQ A;  1WRG A;  1SQQ D;  2WZ7 A;  1LNQ A;  1S5L X;  3HD7 B;  4UB6 H;  4XE5 B;  3TGU G;  1NTM K;  4I2L C;  5KTB A;  1BGY J;  1SQX D;  2P10 A;  4JYB A;  3CXH I;  1NTK J;  1L4A A;  3CWB J;  4H44 D;  3MUD A;  3WU2 H;  3ZDM A;  5KAF H;  3GHG C;  3USS A;  2WVR A;  1W5C E;  4PD4 H;  3KZI H;  3Q3D A;  1S72 P;  1NWQ A;  1VQ7 P;  2IBZ I;  2ZVO B;  3KQG A;  3GHG B;  2ZYD A;  1JM0 A;  3G3Z A;  5L8R J;  1URQ B;  1ZRT E;  2N9Y B;  3G9R A;  2KB7 P;  3UIA A;  4TLF A;  3QH9 A;  2XND H;  3H1J G;  1K9M Q;  1LTA C;  1N7S D;  1HWT C;  2CPB A;  1H0T A;  3I55 P;  1AVY A;  1N7S B;  4HKZ H;  4ZMD A;  3A7O A;  5DJT B;  2FY8 A;  2KSE A;  1H0T B;  3H1J D;  1FDI A;  4PD4 I;  1PPJ D;  4WY4 C;  3TGU E;  3KDP B;  4PV1 C;  1DD4 A;  1FBM A;  1P84 E;  3LID A;  4GOE A;  2M5A B;  1SQB E;  2HYN A;  1BE3 J;  1LTB C;  2KXP B;  1YJN P;  3RK3 E;  2KS1 A;  2KSJ A;  1SFC D;  3IAO A;  1J1E C;  1S3J A;  1N73 A;  4C7N B;  2D2C D;  3D71 A;  2JWD A;  3JCU H;  2V7Q J;  3U1C A;  1KIL D;  2KNC A;  1S2E A;  3E1R A;  3G4S P;  1SQQ G;  1S4X A;  2FFD C;  1NTZ D;  3HUS B;  4JPZ B;  4YTP C;  1SQV K;  2Z5H A;  4N6J A;  4BRY B;  3SFE C;  2OYI B;  1AFO A;  5AVU B;  4I7Z B;  3GF7 A;  2ZYG A;  1QL2 A;  4I1L A;  1MKM A;  3E1I A;  2AXC A;  1ZV8 A;  3PRJ A;  2E75 B;  1S9K D;  2P67 A;  1NTZ G;  2NPS A;  2ZAE B;  2O3J A;  3HE5 A;  3RK2 B;  3Q5S A;  1Q86 Q;  5CCH D;  4D6T D;  3CL3 D;  2E75 C;  1NTM E;  2M8R A;  3NMD A;  2FYU J;  2OTK E;  5M1B A;  3SFD C;  3M91 A;  4RES B;  1LP1 A;  1LTS C;  1SQB J;  2FXM A;  1RQU A;  4H44 B;  1YTZ I;  4IL6 H;  3RL0 g;  1M1J C;  1NU1 E;  3A5T A;  2XU6 A;  4HH2 A;  3U59 A;  2MJZ A;  1PGO A;  1L2P A;  3TYY A;  3O8Z A;  1GK4 A;  1T3U A;  1RF0 A;  4L74 A;  5BVZ A;  4RKU J;  3RK2 D;  3GHG A;  5KLV D;  2Q7C A;  1PPJ G;  4EDF A;  1L4A C;  2WWW A;  4EYY Q;  2IZ0 A;  3L70 J;  1PP9 G;  1MV8 A;  5APX A;  3CCQ P;  1NH4 A;  4N78 D;  1L4A B;  3CLQ A;  2QA4 P;  2AXT H;  1LTI C;  2H43 A;  1L0L E;  1QLE D;  1ZLL A;  2Q5U A;  1VF5 C;  3RK3 C;  4ASW A;  1NTK G;  4PJ0 H;  1AV1 A;  2I8D A;  2WT7 B;  4H13 D;  5AVW B;  3H25 A;  3D70 A;  1KB9 I;  1M7L A;  1PGP A;  3A0B H;  4W7Z A;  2YKP A;  1IK7 A;  1H88 A;  2IFN A;  2JO1 A;  1G2C A;  4HJG H;  1PZQ A;  1IFD A;  2RN0 A;  5BU8 B;  1JY3 P;  2Q3I A;  5CCG A;  1KQG B;  2RKL A;  3V5B A;  3CCL P;  1K04 A;  5AVX B;  3AE7 C;  2H7H A;  4OVN F;  3H1K G;  1OXZ A;  3F89 A;  4QMA A;  2WSC J;  2R3S A;  1SQV E;  5CCG D;  2ITA A;  1SQB K;  4H0L C;  4IFF A;  3E7K A;  3RL0 C;  3MTU E;  3AEG C;  3NTN A;  2A06 G;  3CCR P;  3CCU P;  1X79 B;  1SVF A;  3JSV C;  4UB8 H;  2C0W A;  2JWA A;  2E5T A;  1OVR A;  2W90 A;  5AVR B;  1YTZ T;  1KIL E;  3H32 A;  3Q5R A;  3L74 G;  3CXH D;  5DJU B;  3V6I A;  1P84 H;  4WY4 D;  2QJY C;  1GL2 D;  4PV1 D;  3PJS K;  4OGQ D;  1SQQ K;  1VQP P;  1TU3 F;  2P7J A;  3O6Q B;  3SSU A;  2ZT9 B;  1M56 D;  1S9K E;  1BCC G;  1A02 F;  3VP8 A;  3WUU A;  4DT0 A;  4WY4 A;  1M1J A;  3L74 E;  3L72 E;  3AEE C;  2D2C C;  1ZP0 C;  3LW5 J;  1R5L A;  3P8C E;  4ZNC A;  5CBO A;  1YBK A;  1OW7 A;  2FXO A;  1BCC D;  3P32 A;  4LGD E;  3BCC D;  4YXW H;  3Q5P A;  1W2B O;  2BCC D;  1R8E A;  4W80 A;  1L0L K;  1KQF B;  1RE4 C;  2K9J B;  2N1T A;  3CME P;  1SQQ E;  2QSI A;  3TNU B;  5AVS B;  1D7M A;  2BCC G;  5AW8 B;  2J58 A;  5H2F H;  5AW5 B;  1OIP A;  2FKW B;  3L73 E;  5CCH C;  2NZ2 A;  3Q2Y A;  1JCD A;  1PL5 A;  1BSH A;  3L72 J;  3H6P A;  2WSE J;  5CMZ A;  3V4W A;  3OW2 O;  3GLM A;  3VOP A;  3RL0 B;  5KJ7 D;  1N73 C;  1CI6 B;  2I1K A;  2M3E A;  1FS0 E;  1SQP G;  1GD2 E;  4PJ0 E;  1AVO A;  1G1I A;  1IZN B;  2J59 M;  3FX0 A;  1CSB A;  3AE8 C;  3H1H E;  5AW1 B;  1L4A D;  5AW9 B;  2IDB A;  3FGA D;  4GKG A;  3CCS P;  3H1J E;  1PPJ E;  1LTT C;  3TGU D;  3CCE P;  1GDT A;  2OGU A;  1SQP E;  2V7Q H;  1JEK A;  3H1L J;  1IO4 A;  2E74 D;  1VF5 D;  4U3F J;  3NFQ A;  3RK3 D;  1JOC A;  1VF5 B;  3RK3 B;  2D2C B;  1HBW A;  2IYP A;  3BCC G;  1SFC B;  4DZO A;  1JNM A;  2H89 C;  3H1L E;  4L73 A;  5GTH E;  5AW3 B;  3D6Y A;  1LT9 A;  2YIU B;  2R32 A;  1KYO D;  3MUD C;  2LKM A;  4KT0 J;  4ASV A;  1LGH B;  1RHZ B;  1EDI A;  2E76 C;  2O01 N;  2SPZ A;  5B66 E;  1OZH A;  1DEB A;  2CPS A;  2B9B A;  2IX7 C;  5C39 A;  3V4Q A;  3CD6 P;  2HOD A;  2WPS A;  1RF0 C;  4WBA A;  1NAF A;  5AVY B;  2W8Z A;  1HGZ A;  2WSE H;  3CWB E;  2K37 A;  4GOD A;  4RO0 A;  5CCG C;  1KC8 Q;  2M0B A;  2A45 G;  2LR2 A;  1Y8A A;  1KTM A;  2HFE D;  1VQL P;  1SS1 A;  1OX3 A;  1Q82 Q;  3MP7 B;  4DJG A;  1VQ9 P;  2GA1 A;  2BAS A;  1JTH B;  1KIL A;  3MIW A;  1SQV J;  3A3Y B;  3SWY A;  1VDF A;  1EXJ A;  2HG5 D;  2I1J A;  3BCC E;  1S5L E;  3OJA B;  1YJ9 P;  3L75 G;  5K5G B;  3P8C D;  1IFN A;  3BRV B;  1KOR A;  1GL2 C;  3H1H J;  3PP5 A;  1KB9 E;  2YMY A;  4W7Y A;  1E5W A;  1FJP A;  2AEF A;  1EC5 A;  5AW2 B;  2B88 A;  3R4Y A;  5GTH H;  2B89 A;  2B87 B;  1LTG C;  1NTZ E;  1PIX A;  5KJ7 A;  3CX5 H;  2R5B A;  2Y0C A;  5CBN A;  1QGK B;  3CWB G;  1M57 D;  3PHL A;  2WPR A;  1PV3 A;  1JTH A;  1URQ C;  5AVV B;  1SQX G;  1VPC A;  3VMA A;  2N1T C;  1JMB A;  1EQ7 A;  1KMI Z;  2KK7 A;  3H1K E;  1EXI A;  5CHX A;  4GIF A;  4I6M C;  1JY3 O;  2K1A A;  2KZJ A;  3ITK A;  2KUB A;  5BU5 A;  1FOS E;  4R4M A;  3H1H G;  1AQT A;  3IN6 A;  3I56 P;  1VQ5 P;  4Y99 C;  3B5N A;  3B5N B;  1HUC A;  2E43 A;  4H0L B;  1VQ4 P;  1AJY A;  2L91 A;  1PP9 D;  1L0L G;  5E79 H;  1K73 Q;  1ZXG A;  2Z4E A;  1KB9 H;  1R5S A;  3M9H A;  5APV A;  1SFC A;  2KIK A;  1UIX A;  2M3B A;  2O01 J;  1YIT P;  1Q90 D;  3B8E B;  3JC2 2;  5KAI E;  3BAT A;  1KFN A;  3CCM P;  1T2K C;  3FXD A;  1H8A A;  1SFC C;  2KP8 A;  2W6B A;  1E79 H;  1QEX A;  2G3A A;  3LW5 H;  2YO3 A;  3ABV C;  3S9O A;  1IC2 A;  1N2D C;  4XFJ A;  4GOF A;  4K3A A;  2B87 A;  2QVA A;  3CWB D;  3A2A A;  1BSN A;  3TSI A;  3C9I A;  1EZV E;  1OW6 A;  1Y47 A;  1FZB A;  4L76 A;  1BCC E;  4U3F D;  3Q1M A;  2RH0 A;  2WQY C;  2YNY A;  1JUN A;  2HR3 A;  2QJP B;  3H1L G;  3P7K A;  2OTJ P;  3N7N A;  2FYN C;  2AEM A;  4D6T G;  2FBW C;  3L75 E;  4JYC A;  1SP4 A;  1NU1 K;  1OMI A;  1DEE G;  3HD7 D;  2OYI C;  2ZJS E;  1KFM A;  3IFM A;  3AE2 C;  3RBX A;  4AQR D;  1H89 A;  1EZV I;  3L75 J;  1A02 J;  1FU1 A;  1NVO A;  3CXH H;  3GW6 A;  1DH3 A;  4O9B A;  1SQV D;  5AVZ B;  5KKZ C;  1KB9 D;  1NTZ K;  1W2E A;  1RQV A;  3RK2 C;  3MGN A;  4BRY A;  2OYI A;  1JMM A;  2OTL P;  2A06 E;  1LTJ C;  2Z5I A;  1QVF O;  2PRR A;  3CI9 A;  1RE3 A;  2YXQ B;  3L72 D;  1LTJ B;  2P1J A;  1YIJ P;  1NTK E;  3GG2 A;  3WMM 0;  1N8R Q;  2P58 A;  2PFX A;  4GDO A;  4H13 B;  2K88 A;  5APS A;  3EFG A;  2OYO A;  2WSF H;  1X9V A;  3D6Z A;  4H13 C;  2IYO A;  1OFC X;  2POH A;  3B5N C;  4U3F E;  5AW0 B;  3RGU A;  1ZN5 A;  2A45 I;  1GW3 A;  1KIL B;  2QG4 A;  2XKM A;  2WPQ A;  2YMK A;  2PP6 A;  4C7R A;  2BEZ F;  3HE4 B;  2ZT9 C;  2ZXX A;  3L71 J;  1BCC J;  1URQ D;  3VMZ A;  3CC4 P;  4A7P A;  2N1T D;  1M8O B;  2JKV A;  3EFF K;  2O1K A;  1RY3 A;  3P8M C;  4U3F G;  1KN7 A;  3GMA A;  3H1L D;  1URQ A;  1N86 A;  2WIT A;  2XDJ A;  1IFM A;  1KZU B;  1GU4 A;  1HGV A;  2QM8 A;  1NAY A;  4YPC A;  1ZW0 A;  2FFD A;  2ZYA A;  2A06 D;  1RF1 B;  4JBZ A; 
#chains in the Genus database with same CATH homology
 1SQQ G;  1P84 H;  1SQB G;  4PD4 H;  1SQV G;  1SQX G;  1NTK G;  2FYU G;  1BGY G;  1SQP G;  1BCC G;  1NTZ G;  3H1J G;  1NTM G;  3H1H G;  3L73 G;  1EZV G;  3L72 G;  3H1L G;  2IBZ G;  4D6T G;  1NU1 G;  3L75 G;  5KLV G;  3H1K G;  1L0L G;  1KB9 H;  1KYO H;  1L0N G;  3H1I G;  1BE3 G;  4U3F G;  2A06 G;  3L71 G;  2BCC G;  3BCC G;  3TGU G;  1PPJ G;  3CXH H;  3CX5 H;  1PP9 G;  3CWB G;  3L70 G;  3L74 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...