2IBZG

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
93
Chain Sequence
GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 16
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 2ibzG00
3L71G 1SQQG 2IBZG 3CWBG 5KLVG 1NU1G 1PPJG 3H1JG 2FYUG 3CXHH 1NTZG 1SQVG 1SQBG 3H1LG 3CX5H 3H1KG 4PD4H 4D6TG 1BE3G 1KB9H 3TGUG 1P84H 1BGYG 3BCCG 3H1IG 1L0NG 4U3FG 3L70G 1NTMG 1KYOH 2A06G 3L73G 3L72G 1NTKG 2BCCG 1SQXG 1SQPG 1L0LG 3H1HG 3L75G 1EZVG 1BCCG 3L74G 1PP9G
chains in the Genus database with same CATH superfamily
1CSBA 2AEMA 4NPFX 1LTIC 4IOIH 1SQBG 1LTJA 5APXA 2WTYA 3M9QA 2KK7A 4YPCA 2IBZE 1FJPA 1KYOD 1N2DC 1JY2N 1GMJA 2N9BA 1S5LX 1SQQG 1FZFA 2WSEJ 3H1KD 3GHGA 3HD7A 3L70E 2WT7A 1OVUA 4GIFA 2KOGA 1NTKG 1ZV8A 1NKZB 1JY2P 1NU1D 1K73Q 4Z1MH 3GLMA 2IZ0A 4H13B 1QGKB 1H8AA 3L72D 5APTA 2FYNC 2WSFJ 1RE3C 2P58A 3H1JJ 1AVOA 1KB9E 2QJPB 5KLIC 2O01J 4RO0A 3M0DC 4DT0A 1U57A 1OZHA 1L0LD 3A0BH 1OX3A 2WITA 1WMKA 1PP9G 3MZWB 4XA4A 1BSNA 3CD6P 2FXOA 3EFFK 2WPRA 1QL2A 2L91A 4U3FJ 3P8CD 3TSIA 2CK3H 1IJDB 3H1JE 1VQNP 4PJ0H 3PH0A 2J59M 3CWBD 1LJ2A 2YMYA 1NOHA 2OYHC 3USSA 4WY4C 1SQVJ 3FX0A 4H0LB 1BGYJ 2GM4A 5APUA 1SFCB 3D70A 2RN0A 1GD2E 4UB6E 3KXDA 1JB0J 1EDIA 3P7KA 1Z56A 2Q6QA 3HUSC 5BU5A 4U3FE 3H1LD 1NTZJ 2XDJA 2I1KA 3CCMP 1OFCX 2JO1A 1BSHA 3MP7B 4OGQC 4PV1D 4ZNCA 3CCEP 1NTMJ 1HUCA 4MN4C 1W2EA 3M0AA 3O6QB 4PD4E 1BGYE 2H8PD 2FYUJ 3RBZA 3D71A 2IX7C 3CXHH 1FU1A 4I2LC 1LWUC 3GF3A 3L35A 4LC1A 3CCVP 1X8YA 4I7ZB 1LTJB 3RL0D 4HYTB 1PGOA 3WUUA 5KAFE 3NTNA 1SQXJ 1MFZA 1NAFA 1GL2B 3H1HG 1NTZE 2OTKE 3CXHD 4M3LA 1QX8A 1RE4C 3Q5RA 4WY4A 1NTME 2ZYGA 3HD7B 2WT7B 3T97B 1QL1A 2A06G 2FYUE 3V6IA 2BCCG 3L71D 5CMZA 1SQPJ 3ITKA 1LT9C 2AEJA 2R32A 3HUSA 1KMIZ 2M8RA 3NXSA 2GUSA 4HJGH 1GZLA 3VMAA 3BCCJ 3HE5A 1G1JA 1OIPA 4K35A 4EI2A 3L74D 1FZAA 2JDIH 3P8MC 1FS0E 1LTTC 1JM0A 5B5EH 2QJYC 5AW4B 1T2KC 3TNUA 3H1ID 2SPZA 1LWUA 2Q7CA 1K05A 3TF5A 1BE3G 1NU1K 2JP3A 1SQPE 4C7RA 3L73D 3W68A 1GTWA 5TISE 1WT6A 1YJWP 3G9RA 1RF0A 4H13D 3TYYA 4QMAA 2Y0CA 3BCCE 1KFNA 2ZYDA 1HJBA 1L4AC 2LKMA 1ZR2A 3H1KG 4EOTA 4IL6H 1HBWA 1RE4A 3TGUG 4GODA 3GW6A 1LTAC 4GKGA 4TT3H 1X0TA 1RH5B 4A7PA 3QH9A 1JY3P 1L0LK 1Q86Q 1LT9A 5GTHH 1JOCA 2YKOA 2UWJE 4U7JA 1NTKD 4UB8H 3KZIH 5GTIH 2QE7H 3MUDC 2FYNB 1DEEG 1SLQA 2K1AA 1T3JA 1NHLA 3KYQA 4NPDA 3VMYA 2Y0EA 5KLIB 3AEEC 2QRXA 4H0LD 3WUTA 3SFEC 2IFNA 1L0LG 1VQKP 3SWFA 1OWAA 4D6TJ 3A5TA 1L4AA 1PFIA 3VMXA 5APQA 3AE2C 1VDFA 1EZVE 5AW5B 2ZT9D 1PP9D 1BCCJ 1FOSF 2WPVB 4GDOA 3CWBG 1VQ7P 3RK2C 1JMMA 2W27A 2OYHB 2IDBA 1IZNB 1A02J 2AXTH 2OYOA 3L70D 1RQUA 5AW7B 1YYCA 4D6TE 3MUDA 1RHZB 3GMAA 1SFCC 3HUSB 2JWAA 2JJLA 1KB9H 4LLHA 5H2FE 1BCCE 4IFMA 3HD7D 4OGQB 4H44C 4BXLA 3LIDA 5CBNA 5KLVJ 2GUVA 3EFGA 5AVUB 5CCHC 1SQBJ 2QJKC 1YQ3C 3TNUB 1LWUB 3L75D 3CC2P 1G1IA 2FXMA 2HR3A 3AE4C 2E75C 4W7ZA 1SQQJ 3ZDMA 2O01H 1P84E 1USEA 5AVWB 2NPSC 1GL2C 2WWWA 2YO2A 5KLVE 1KQFB 2YKQA 1Y47A 1IC2A 1URQC 2FKWB 1EXIA 1GK6A 4AYCA 3L71G 2IBZI 3PP5A 1KILC 1E5WA 1N7LA 1NKNA 3NMDA 2V7QH 3PTZA 1LT9B 1SFCA 1WRGA 3S9OA 1SQQE 2WSCH 1T6AA 4OVNF 3L74G 1L2PA 1AVYA 4I1LA 2LXBA 3JCUH 5AW0B 4PD4H 2QJYB 3GG2A 1LT1A 3H1IG 4YXDC 1J2JB 1X22A 5AW1B 3L73G 3I55P 4Y28J 1ZRTD 5AVRB 3O6QA 5KAFH 2HLOA 1NTKK 1S5LE 3N7NA 1BE3D 1DX7A 3H32B 1N86A 2QM8A 1L4AB 3B71A 4DCKA 2E42A 1KB9I 3II6A 3AEFC 4R4MA 3LW5J 2NPSA 1GL2A 1ZMEC 3VP8A 2PRRA 3Q5PA 1VL2A 1NTZD 2KUBA 3TGUD 4IFDK 1Y9BA 3T97A 3BRVB 5EFWB 3WU2E 2CPBA 1IFMA 2R3SA 1ZR4A 4KHXA 4LGDE 2QIWA 3M9HA 1AQTA 4XE5B 4DOJA 2E76C 1S3JA 3TK1A 1S4XA 1L0ND 2ITAA 1KILE 1ZXGA 2Y9ZA 4WY4D 1HH0A 3PRJA 1OW7A 2P67A 2E74C 3P32A 4RESB 2K9JA 3HE4A 2N9YB 2KXPB 2QVAA 1RF1B 1DH3A 2YNYA 2KI7B 1N8RQ 3VOPA 1YTZT 1XTCC 2PFXA 5M1BA 5AVVB 2B88A 3H1HJ 2G8YA 3A2AA 1GU5A 1IK7A 1VF5D 2XZRA 2HG5D 1LP1A 1J1DC 4PD4I 1IK9A 3RK2B 3L70G 1QVFO 2BCCJ 1KC8Q 5AVTB 3SSUA 1FDOA 2Z4EA 2KS1A 1H88A 1OVRA 3H1HE 2D2CD 4GOEA 1Q81Q 4EYYQ 1VQ8P 2W6BA 1PGJA 2WZ7A 3V2NA 2FFDB 2OYIC 1PPJD 2JR8A 3PJSK 1N7SD 1RE3A 4H44B 1M1KQ 4L76A 3TDKA 2A06E 1Q90D 3NFQA 5CCGC 1TU3F 5K5GB 4JBZA 1BDCA 1M56D 5KTBA 2QJKB 1VQ6P 3M0DA 1M7LA 4ZKUA 2QA4P 1EXJA 3L75G 1SQVE 1FC2C 3E1IA 2PAJA 2XNXA 2HFED 2E75B 3H1KJ 4NPEA 1VQLP 3B4SA 2HPCA 3KQGA 3R4YA 5TJHA 2NPSB 1T2KD 2NRGA 3EWKA 3CI9A 2CPSA 2A45I 3H1JG 1NU1J 1QLED 2R5DA 1URQB 4N78D 2OYHA 3ABVC 1S9KD 1CW5A 4EDFA 2WPSA 3CX5I 1VQ5P 1KILB 1KYOE 1Q2NA 3AEAC 3A0HE 2B89A 1PZQA 3L72J 5H2FH 1L4AD 3H1KE 3C8VA 2LR2A 2RKLA 2Y9YA 4OWFA 1OXZA 5APSA 1R8EA 2ZVOB 3KPEA 1SQXE 5CCGA 4W80A 4U3FG 1NTZK 2E5TA 1K8AQ 1XTGB 1VQMP 1NU1E 2XV5A 1L0LJ 1KQLA 3FGAD 2ZXXA 3CMEP 2RMZA 2K9JB 3HE4B 3D6YA 3MGNA 3L72E 2HODA 3G6EP 5CHXA 3RL0C 1L0NK 1FZCC 5AVYB 1FE6A 3CWBJ 3CX5E 2QG4A 1KORA 1LGHB 4AQRD 1NTZG 1PV3A 2C0WA 2R5BA 4ASVA 1L0LE 1LP1B 3IAOA 3AE5C 1NTMG 2B87B 2L5GB 3CC7P 1EZVI 1U7JA 2H88C 4RKUJ 5AVZB 2ZJSE 3U1CA 5KJ7C 3H1LJ 2MKVA 2KS1B 1G2CA 2O1JA 3AE6C 1YITP 3LIEA 1L0NG 4IFFA 2E76B 3CWBE 3RK2D 3CPWO 2KSEA 3AEBC 3AE9C 2J58A 1YBKA 3AE3C 3Q5SA 3VYIA 2R3CA 1MZ9A 1IFPA 2E74B 1EDLA 1S5LH 3HTKB 3S4RA 3RBXA 2FY8A 2JEEA 1SQPG 3H1LE 1SFCD 2KLUA 1FZCA 1JY3O 1JTHB 1RF1C 1KN7A 1DIPA 1ZW0A 3C1LA 3VMZA 1KZUB 3H32A 1HWTC 2BEZF 3KDPB 3F89A 4H44D 2HPCB 1J1DB 2IBZD 2B9BA 3G4SP 3L71J 1HF9A 1KD1Q 5DJUB 2WPQA 4GOFA 1EC5A 1FAVA 3AEDC 1NYHA 2Q1KA 5KJ7A 3CCQP 1P84I 1ZN5A 3LW5H 1IFDA 1VQ9P 1YTZI 1D7MA 1MV8A 3VN0A 1PPJG 2OYIB 2WSEH 3RL0g 4HB1A 1GL2D 3MTUE 3OJAB 2FFDC 3L73J 3IN6A 4K3AA 2BEQD 1KV4A 2IYOA 3AE1C 4DZOA 3CCRP 3M9BA 1AA0A 2H43A 1RF1A 1FJKA 1KB9D 3EQ2A 1FDIA 3M91A 2HODB 2IYPA 2OQQA 2Z5IA 2ZT9C 2WSFH 3A3YB 1SVFA 2MJZA 2LXCB 1JCCA 2WSSH 2IZ1A 2ZAEB 3AE7C 3VTPC 5AW8B 1HTLC 2V4HA 5B66E 5AW9B 1ZLLA 5KAIE 4C7NA 4BRYB 1NTKJ 1ZP0C 1SQBE 3H1JD 4UB6H 3RK3C 4WWIA 1SP4A 2FYZA 2RH0A 4L75A 1M90Q 1G2CB 5AVXB 2FFDA 3CCLP 1IFJA 3WUVA 4YXWH 1H0TB 2QSIA 1NJIQ 1BCCG 5BU8B 5AW6B 1MUUA 1DD4A 3H25A 1FZBA 1X9VA 2Q9IA 5CCHA 1NTKE 4U3FD 1MFTA 2I1JA 4Y99B 3PHLA 2KP8A 4IL6X 1YHQP 2OTJP 1PP9J 2E76D 3B8EB 1W2BO 3RL0B 2KSJA 1SQVD 1FZCB 3V2RA 1IFNA 4PD4D 1BGYD 3KZIE 3WMM0 5GTIE 1KYOH 2N1TC 2KIKA 3A0HH 1A02F 2C0XA 4WB4A 2W83C 1URQA 5KLVG 3JC22 2J5UA 4JYBA 1RY3A 1M57D 3H6PA 1KILA 1S1CX 1FBMA 2ZYAA 3L36A 1EDJA 1NTMD 2JWDA 1PP9E 1LTBC 1M8OB 1K9MQ 4KJMA 1PIXA 3D6ZA 3A7OA 1J1EC 2FYUD 1YIJP 3B5NC 1M1JC 1LTSC 1LNQA 2YMKA 3MD0A 2YXQB 1SQXD 1AV1A 3RK3E 3L75J 2PGDA 5TISH 2A45H 1EDKA 3QWOC 1CI6A 2AXTE 3CX5H 2M5AA 5KKZC 3Q1MA 1VPCA 1SQPD 2N1TA 4B86A 2XKMA 1JY2O 1NH4A 1FZGA 2IBZG 5CCGD 1JO5A 3CX5D 1RQVA 4OGQD 3BCCD 5CJ4A 3L75E 1FZEA 3JSVC 5AVSB 2B87A 2E5YA 1OVVA 3C9IA 4AUWA 2KZIA 2WVRA 4C7NB 3BATA 2P2UA 2WMMA 1NWQA 1Q7YQ 5E79E 3B5NA 1M1JA 2V7QJ 3I5CA 1N73B 4L74A 4W7YA 2OGUA 2WSCJ 1KYOI 3MHVA 2W90A 3L37A 3OW2O 3I56P 3V2PA 3U1AA 2ZFCA 3CMAP 3GF7A 3BVHA 1GK4A 1HJ0A 4N6JA 3HTKA 2POHA 1BE3J 2BCCE 2KB7P 1KTMA 3BRTB 2P1JA 3CCUP 1R5LA 5AVQB 1JTHA 2GA1A 3FWNA 1PGPA 4JPZB 1AFOA 2ZT9B 3W67A 5L8RJ 3Q3DA 3TGUJ 1VF5C 2ZXEB 3R2PA 1ZRTE 4CPGA 1PGQA 2P10A 1EZVD 1H89A 3CLQA 2YO3A 3JCUE 3CL3D 1BE3E 1NGMB 2DW3A 3BASA 1HGVA 3V2QA 3VP9A 1L0NJ 2AXCA 1RF0C 1SQVK 3RK3B 3OAKA 3CC4P 1KQSO 2D2CC 3UIAA 1GW3A 3MIWA 2YIUC 1JUNA 1S2EA 2OYIA 1R5SA 3TGUE 1AQ5A 4D6TD 1AJYA 3GHGB 3F5HA 1N7SC 5AW3B 3IR9A 1JMBA 3V4WA 2QM7A 2XU6A 1BCCD 5KJ7D 2Y0DA 4PV1C 3L4FA 1NTMK 1L0NE 1CI6B 2O1KA 1W5CE 2H7HA 1SQVG 2KNCA 1P84H 1BGYG 4Y99C 2FYUK 2M5AB 3OA7A 2FBWC 2C9NY 3E1RA 5B66H 5C39A 5KAIH 2N1TB 4DJGA 2HYNA 4ZMDA 1SQXK 1FOSE 3FWLA 1X79B 1UIXA 3SWKA 5BVZA 1SS1A 1P84D 1PL5A 1EQ7A 2FXPA 2K37A 2W6AA 3CCJP 4BRYA 2W6JH 1KFMA 1JY3N 5KLVD 5APVA 5APWA 1MKMA 1SQBD 2FYUG 2M0BA 3O8ZA 1J1EB 1SQPK 4L73A 3B5NB 3P8CE 2OARA 1GW4A 1M1JB 3A0BE 2Z5HA 1N7SA 1H0TA 1Q82Q 2NZ2A 3Q2YA 1SQXG 1SQQD 3AECC 4JF7A 4HH2A 1NU1G 3KHUA 1JEKA 3CXHI 2YKPA 2W8ZA 4PJ0E 1T3UA 5KKZB 1PPJE 2K88A 1T8ZA 2BASA 5DJTB 3L72G 2JKVA 3K5BA 1YQ4C 2A45G 2O01N 3HRNA 3G3ZA 4H13C 1ZOYC 4I6MC 4WBAA 3BCCG 1VQOP 4R4LA 3U59A 1GU4A 3WU2H 2QJPC 5CJ0A 5CCHD 2M3BA 1IO4A 3V4QA 1K04A 1S72P 2E75D 1NAYA 4HKZH 1FDMA 3L74J 3CXHE 4N78E 1S9KE 1CZQA 4EIJA 2G3AA 1N73C 5APYA 1JNMA 2NPSD 1QEXA 4WY4B 1E79H 1NO4A 1BDDA 2VRSA 3H1IJ 2Q3EA 3M06A 1URQD 4N3YB 3SWYA 3L71E 4JQ0D 4WVZA 2IFMA 1KILD 1QVGO 1JCDA 2KLVA 3RK3D 4H0LC 2QEXP 3G71P 3S1KA 2PP6A 3AE8C 1DD3A 5AW2B 3H1LG 3FXEA 2XNDH 4GT1A 2KNCB 3E7KA 4BWNA 2AEFA 1VQ4P 3L74E 3HE5B 3N4XA 2ZVNB 1VF5B 2M3EA 1EZVG 2YXRB 1YJNP 3H1IE 2K3RA 3L73E 5E79H 4JYCA 3V5BA 1NVOA 3SFDC 1YJ9P 3RGUA 1LTGC 2Q3IA 5B5EE 2R44A 2KZJA 4C46A 2IPPA 2D2CB 1OMIA 2KYVA 4I7ZC 1LTJC 2YIUB 1HVVA 4D6TG 1N73A 2N1TD 3PLNA 1YI2P 1VQPP 1N7SB 3H1HD 1USDA 4OH8B 3IF4A 3FXDA 4O9BA 1HGZA 1KQGB 3GHGC 3HD7C 4IL6E 4ASWA 4XFJA 4PV1B 2O3JA 1OW6A 2K9YA 2WQYC 4RJTA 1GDTA 1U7MA 5KLVK 2OTLP 2E43A 5CBOA 2A06D 2Q5UA 1SQBK 2BCCD 3B5ND 1UIIA 5GTHE 2P7JA 2I8DA 1DEBA 3IFMA 1SQQK 2C9LY 3AEGC 4UB8E 1IFIA 4TLFA 3CCSP 4YTPC 2H89C 3L70J 1OW8A 2E74D 4KT0J 1Y8AA 4ZKPA
chains in the Genus database with same CATH topology
3L71G 1SQQG 2IBZG 3CWBG 5KLVG 1NU1G 1PPJG 3H1JG 2FYUG 3CXHH 1NTZG 1SQVG 1SQBG 3H1LG 3CX5H 3H1KG 4PD4H 4D6TG 1BE3G 1KB9H 3TGUG 1P84H 1BGYG 3BCCG 3H1IG 1L0NG 4U3FG 3L70G 1NTMG 1KYOH 2A06G 3L73G 3L72G 1NTKG 2BCCG 1SQXG 1SQPG 1L0LG 3H1HG 3L75G 1EZVG 1BCCG 3L74G 1PP9G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L71 G;  1SQQ G;  2IBZ G;  3CWB G;  5KLV G;  1NU1 G;  1PPJ G;  3H1J G;  2FYU G;  3CXH H;  1NTZ G;  1SQV G;  1SQB G;  3H1L G;  3CX5 H;  3H1K G;  4PD4 H;  4D6T G;  1BE3 G;  1KB9 H;  3TGU G;  1P84 H;  1BGY G;  3BCC G;  3H1I G;  1L0N G;  4U3F G;  3L70 G;  1NTM G;  1KYO H;  2A06 G;  3L73 G;  3L72 G;  1NTK G;  2BCC G;  1SQX G;  1SQP G;  1L0L G;  3H1H G;  3L75 G;  1EZV G;  1BCC G;  3L74 G;  1PP9 G; 
#chains in the Genus database with same CATH topology
 1CSB A;  2AEM A;  4NPF X;  1LTI C;  4IOI H;  1SQB G;  1LTJ A;  5APX A;  2WTY A;  3M9Q A;  2KK7 A;  4YPC A;  2IBZ E;  1FJP A;  1KYO D;  1N2D C;  1JY2 N;  1GMJ A;  2N9B A;  1S5L X;  1SQQ G;  1FZF A;  2WSE J;  3H1K D;  3GHG A;  3HD7 A;  3L70 E;  2WT7 A;  1OVU A;  4GIF A;  2KOG A;  1NTK G;  1ZV8 A;  1NKZ B;  1JY2 P;  1NU1 D;  1K73 Q;  4Z1M H;  3GLM A;  2IZ0 A;  4H13 B;  1QGK B;  1H8A A;  3L72 D;  5APT A;  2FYN C;  2WSF J;  1RE3 C;  2P58 A;  3H1J J;  1AVO A;  1KB9 E;  2QJP B;  5KLI C;  2O01 J;  4RO0 A;  3M0D C;  4DT0 A;  1U57 A;  1OZH A;  1L0L D;  3A0B H;  1OX3 A;  2WIT A;  1WMK A;  1PP9 G;  3MZW B;  4XA4 A;  1BSN A;  3CD6 P;  2FXO A;  3EFF K;  2WPR A;  1QL2 A;  2L91 A;  4U3F J;  3P8C D;  3TSI A;  2CK3 H;  1IJD B;  3H1J E;  1VQN P;  4PJ0 H;  3PH0 A;  2J59 M;  3CWB D;  1LJ2 A;  2YMY A;  1NOH A;  2OYH C;  3USS A;  4WY4 C;  1SQV J;  3FX0 A;  4H0L B;  1BGY J;  2GM4 A;  5APU A;  1SFC B;  3D70 A;  2RN0 A;  1GD2 E;  4UB6 E;  3KXD A;  1JB0 J;  1EDI A;  3P7K A;  1Z56 A;  2Q6Q A;  3HUS C;  5BU5 A;  4U3F E;  3H1L D;  1NTZ J;  2XDJ A;  2I1K A;  3CCM P;  1OFC X;  2JO1 A;  1BSH A;  3MP7 B;  4OGQ C;  4PV1 D;  4ZNC A;  3CCE P;  1NTM J;  1HUC A;  4MN4 C;  1W2E A;  3M0A A;  3O6Q B;  4PD4 E;  1BGY E;  2H8P D;  2FYU J;  3RBZ A;  3D71 A;  2IX7 C;  3CXH H;  1FU1 A;  4I2L C;  1LWU C;  3GF3 A;  3L35 A;  4LC1 A;  3CCV P;  1X8Y A;  4I7Z B;  1LTJ B;  3RL0 D;  4HYT B;  1PGO A;  3WUU A;  5KAF E;  3NTN A;  1SQX J;  1MFZ A;  1NAF A;  1GL2 B;  3H1H G;  1NTZ E;  2OTK E;  3CXH D;  4M3L A;  1QX8 A;  1RE4 C;  3Q5R A;  4WY4 A;  1NTM E;  2ZYG A;  3HD7 B;  2WT7 B;  3T97 B;  1QL1 A;  2A06 G;  2FYU E;  3V6I A;  2BCC G;  3L71 D;  5CMZ A;  1SQP J;  3ITK A;  1LT9 C;  2AEJ A;  2R32 A;  3HUS A;  1KMI Z;  2M8R A;  3NXS A;  2GUS A;  4HJG H;  1GZL A;  3VMA A;  3BCC J;  3HE5 A;  1G1J A;  1OIP A;  4K35 A;  4EI2 A;  3L74 D;  1FZA A;  2JDI H;  3P8M C;  1FS0 E;  1LTT C;  1JM0 A;  5B5E H;  2QJY C;  5AW4 B;  1T2K C;  3TNU A;  3H1I D;  2SPZ A;  1LWU A;  2Q7C A;  1K05 A;  3TF5 A;  1BE3 G;  1NU1 K;  2JP3 A;  1SQP E;  4C7R A;  3L73 D;  3W68 A;  1GTW A;  5TIS E;  1WT6 A;  1YJW P;  3G9R A;  1RF0 A;  4H13 D;  3TYY A;  4QMA A;  2Y0C A;  3BCC E;  1KFN A;  2ZYD A;  1HJB A;  1L4A C;  2LKM A;  1ZR2 A;  3H1K G;  4EOT A;  4IL6 H;  1HBW A;  1RE4 A;  3TGU G;  4GOD A;  3GW6 A;  1LTA C;  4GKG A;  4TT3 H;  1X0T A;  1RH5 B;  4A7P A;  3QH9 A;  1JY3 P;  1L0L K;  1Q86 Q;  1LT9 A;  5GTH H;  1JOC A;  2YKO A;  2UWJ E;  4U7J A;  1NTK D;  4UB8 H;  3KZI H;  5GTI H;  2QE7 H;  3MUD C;  2FYN B;  1DEE G;  1SLQ A;  2K1A A;  1T3J A;  1NHL A;  3KYQ A;  4NPD A;  3VMY A;  2Y0E A;  5KLI B;  3AEE C;  2QRX A;  4H0L D;  3WUT A;  3SFE C;  2IFN A;  1L0L G;  1VQK P;  3SWF A;  1OWA A;  4D6T J;  3A5T A;  1L4A A;  1PFI A;  3VMX A;  5APQ A;  3AE2 C;  1VDF A;  1EZV E;  5AW5 B;  2ZT9 D;  1PP9 D;  1BCC J;  1FOS F;  2WPV B;  4GDO A;  3CWB G;  1VQ7 P;  3RK2 C;  1JMM A;  2W27 A;  2OYH B;  2IDB A;  1IZN B;  1A02 J;  2AXT H;  2OYO A;  3L70 D;  1RQU A;  5AW7 B;  1YYC A;  4D6T E;  3MUD A;  1RHZ B;  3GMA A;  1SFC C;  3HUS B;  2JWA A;  2JJL A;  1KB9 H;  4LLH A;  5H2F E;  1BCC E;  4IFM A;  3HD7 D;  4OGQ B;  4H44 C;  4BXL A;  3LID A;  5CBN A;  5KLV J;  2GUV A;  3EFG A;  5AVU B;  5CCH C;  1SQB J;  2QJK C;  1YQ3 C;  3TNU B;  1LWU B;  3L75 D;  3CC2 P;  1G1I A;  2FXM A;  2HR3 A;  3AE4 C;  2E75 C;  4W7Z A;  1SQQ J;  3ZDM A;  2O01 H;  1P84 E;  1USE A;  5AVW B;  2NPS C;  1GL2 C;  2WWW A;  2YO2 A;  5KLV E;  1KQF B;  2YKQ A;  1Y47 A;  1IC2 A;  1URQ C;  2FKW B;  1EXI A;  1GK6 A;  4AYC A;  3L71 G;  2IBZ I;  3PP5 A;  1KIL C;  1E5W A;  1N7L A;  1NKN A;  3NMD A;  2V7Q H;  3PTZ A;  1LT9 B;  1SFC A;  1WRG A;  3S9O A;  1SQQ E;  2WSC H;  1T6A A;  4OVN F;  3L74 G;  1L2P A;  1AVY A;  4I1L A;  2LXB A;  3JCU H;  5AW0 B;  4PD4 H;  2QJY B;  3GG2 A;  1LT1 A;  3H1I G;  4YXD C;  1J2J B;  1X22 A;  5AW1 B;  3L73 G;  3I55 P;  4Y28 J;  1ZRT D;  5AVR B;  3O6Q A;  5KAF H;  2HLO A;  1NTK K;  1S5L E;  3N7N A;  1BE3 D;  1DX7 A;  3H32 B;  1N86 A;  2QM8 A;  1L4A B;  3B71 A;  4DCK A;  2E42 A;  1KB9 I;  3II6 A;  3AEF C;  4R4M A;  3LW5 J;  2NPS A;  1GL2 A;  1ZME C;  3VP8 A;  2PRR A;  3Q5P A;  1VL2 A;  1NTZ D;  2KUB A;  3TGU D;  4IFD K;  1Y9B A;  3T97 A;  3BRV B;  5EFW B;  3WU2 E;  2CPB A;  1IFM A;  2R3S A;  1ZR4 A;  4KHX A;  4LGD E;  2QIW A;  3M9H A;  1AQT A;  4XE5 B;  4DOJ A;  2E76 C;  1S3J A;  3TK1 A;  1S4X A;  1L0N D;  2ITA A;  1KIL E;  1ZXG A;  2Y9Z A;  4WY4 D;  1HH0 A;  3PRJ A;  1OW7 A;  2P67 A;  2E74 C;  3P32 A;  4RES B;  2K9J A;  3HE4 A;  2N9Y B;  2KXP B;  2QVA A;  1RF1 B;  1DH3 A;  2YNY A;  2KI7 B;  1N8R Q;  3VOP A;  1YTZ T;  1XTC C;  2PFX A;  5M1B A;  5AVV B;  2B88 A;  3H1H J;  2G8Y A;  3A2A A;  1GU5 A;  1IK7 A;  1VF5 D;  2XZR A;  2HG5 D;  1LP1 A;  1J1D C;  4PD4 I;  1IK9 A;  3RK2 B;  3L70 G;  1QVF O;  2BCC J;  1KC8 Q;  5AVT B;  3SSU A;  1FDO A;  2Z4E A;  2KS1 A;  1H88 A;  1OVR A;  3H1H E;  2D2C D;  4GOE A;  1Q81 Q;  4EYY Q;  1VQ8 P;  2W6B A;  1PGJ A;  2WZ7 A;  3V2N A;  2FFD B;  2OYI C;  1PPJ D;  2JR8 A;  3PJS K;  1N7S D;  1RE3 A;  4H44 B;  1M1K Q;  4L76 A;  3TDK A;  2A06 E;  1Q90 D;  3NFQ A;  5CCG C;  1TU3 F;  5K5G B;  4JBZ A;  1BDC A;  1M56 D;  5KTB A;  2QJK B;  1VQ6 P;  3M0D A;  1M7L A;  4ZKU A;  2QA4 P;  1EXJ A;  3L75 G;  1SQV E;  1FC2 C;  3E1I A;  2PAJ A;  2XNX A;  2HFE D;  2E75 B;  3H1K J;  4NPE A;  1VQL P;  3B4S A;  2HPC A;  3KQG A;  3R4Y A;  5TJH A;  2NPS B;  1T2K D;  2NRG A;  3EWK A;  3CI9 A;  2CPS A;  2A45 I;  3H1J G;  1NU1 J;  1QLE D;  2R5D A;  1URQ B;  4N78 D;  2OYH A;  3ABV C;  1S9K D;  1CW5 A;  4EDF A;  2WPS A;  3CX5 I;  1VQ5 P;  1KIL B;  1KYO E;  1Q2N A;  3AEA C;  3A0H E;  2B89 A;  1PZQ A;  3L72 J;  5H2F H;  1L4A D;  3H1K E;  3C8V A;  2LR2 A;  2RKL A;  2Y9Y A;  4OWF A;  1OXZ A;  5APS A;  1R8E A;  2ZVO B;  3KPE A;  1SQX E;  5CCG A;  4W80 A;  4U3F G;  1NTZ K;  2E5T A;  1K8A Q;  1XTG B;  1VQM P;  1NU1 E;  2XV5 A;  1L0L J;  1KQL A;  3FGA D;  2ZXX A;  3CME P;  2RMZ A;  2K9J B;  3HE4 B;  3D6Y A;  3MGN A;  3L72 E;  2HOD A;  3G6E P;  5CHX A;  3RL0 C;  1L0N K;  1FZC C;  5AVY B;  1FE6 A;  3CWB J;  3CX5 E;  2QG4 A;  1KOR A;  1LGH B;  4AQR D;  1NTZ G;  1PV3 A;  2C0W A;  2R5B A;  4ASV A;  1L0L E;  1LP1 B;  3IAO A;  3AE5 C;  1NTM G;  2B87 B;  2L5G B;  3CC7 P;  1EZV I;  1U7J A;  2H88 C;  4RKU J;  5AVZ B;  2ZJS E;  3U1C A;  5KJ7 C;  3H1L J;  2MKV A;  2KS1 B;  1G2C A;  2O1J A;  3AE6 C;  1YIT P;  3LIE A;  1L0N G;  4IFF A;  2E76 B;  3CWB E;  3RK2 D;  3CPW O;  2KSE A;  3AEB C;  3AE9 C;  2J58 A;  1YBK A;  3AE3 C;  3Q5S A;  3VYI A;  2R3C A;  1MZ9 A;  1IFP A;  2E74 B;  1EDL A;  1S5L H;  3HTK B;  3S4R A;  3RBX A;  2FY8 A;  2JEE A;  1SQP G;  3H1L E;  1SFC D;  2KLU A;  1FZC A;  1JY3 O;  1JTH B;  1RF1 C;  1KN7 A;  1DIP A;  1ZW0 A;  3C1L A;  3VMZ A;  1KZU B;  3H32 A;  1HWT C;  2BEZ F;  3KDP B;  3F89 A;  4H44 D;  2HPC B;  1J1D B;  2IBZ D;  2B9B A;  3G4S P;  3L71 J;  1HF9 A;  1KD1 Q;  5DJU B;  2WPQ A;  4GOF A;  1EC5 A;  1FAV A;  3AED C;  1NYH A;  2Q1K A;  5KJ7 A;  3CCQ P;  1P84 I;  1ZN5 A;  3LW5 H;  1IFD A;  1VQ9 P;  1YTZ I;  1D7M A;  1MV8 A;  3VN0 A;  1PPJ G;  2OYI B;  2WSE H;  3RL0 g;  4HB1 A;  1GL2 D;  3MTU E;  3OJA B;  2FFD C;  3L73 J;  3IN6 A;  4K3A A;  2BEQ D;  1KV4 A;  2IYO A;  3AE1 C;  4DZO A;  3CCR P;  3M9B A;  1AA0 A;  2H43 A;  1RF1 A;  1FJK A;  1KB9 D;  3EQ2 A;  1FDI A;  3M91 A;  2HOD B;  2IYP A;  2OQQ A;  2Z5I A;  2ZT9 C;  2WSF H;  3A3Y B;  1SVF A;  2MJZ A;  2LXC B;  1JCC A;  2WSS H;  2IZ1 A;  2ZAE B;  3AE7 C;  3VTP C;  5AW8 B;  1HTL C;  2V4H A;  5B66 E;  5AW9 B;  1ZLL A;  5KAI E;  4C7N A;  4BRY B;  1NTK J;  1ZP0 C;  1SQB E;  3H1J D;  4UB6 H;  3RK3 C;  4WWI A;  1SP4 A;  2FYZ A;  2RH0 A;  4L75 A;  1M90 Q;  1G2C B;  5AVX B;  2FFD A;  3CCL P;  1IFJ A;  3WUV A;  4YXW H;  1H0T B;  2QSI A;  1NJI Q;  1BCC G;  5BU8 B;  5AW6 B;  1MUU A;  1DD4 A;  3H25 A;  1FZB A;  1X9V A;  2Q9I A;  5CCH A;  1NTK E;  4U3F D;  1MFT A;  2I1J A;  4Y99 B;  3PHL A;  2KP8 A;  4IL6 X;  1YHQ P;  2OTJ P;  1PP9 J;  2E76 D;  3B8E B;  1W2B O;  3RL0 B;  2KSJ A;  1SQV D;  1FZC B;  3V2R A;  1IFN A;  4PD4 D;  1BGY D;  3KZI E;  3WMM 0;  5GTI E;  1KYO H;  2N1T C;  2KIK A;  3A0H H;  1A02 F;  2C0X A;  4WB4 A;  2W83 C;  1URQ A;  5KLV G;  3JC2 2;  2J5U A;  4JYB A;  1RY3 A;  1M57 D;  3H6P A;  1KIL A;  1S1C X;  1FBM A;  2ZYA A;  3L36 A;  1EDJ A;  1NTM D;  2JWD A;  1PP9 E;  1LTB C;  1M8O B;  1K9M Q;  4KJM A;  1PIX A;  3D6Z A;  3A7O A;  1J1E C;  2FYU D;  1YIJ P;  3B5N C;  1M1J C;  1LTS C;  1LNQ A;  2YMK A;  3MD0 A;  2YXQ B;  1SQX D;  1AV1 A;  3RK3 E;  3L75 J;  2PGD A;  5TIS H;  2A45 H;  1EDK A;  3QWO C;  1CI6 A;  2AXT E;  3CX5 H;  2M5A A;  5KKZ C;  3Q1M A;  1VPC A;  1SQP D;  2N1T A;  4B86 A;  2XKM A;  1JY2 O;  1NH4 A;  1FZG A;  2IBZ G;  5CCG D;  1JO5 A;  3CX5 D;  1RQV A;  4OGQ D;  3BCC D;  5CJ4 A;  3L75 E;  1FZE A;  3JSV C;  5AVS B;  2B87 A;  2E5Y A;  1OVV A;  3C9I A;  4AUW A;  2KZI A;  2WVR A;  4C7N B;  3BAT A;  2P2U A;  2WMM A;  1NWQ A;  1Q7Y Q;  5E79 E;  3B5N A;  1M1J A;  2V7Q J;  3I5C A;  1N73 B;  4L74 A;  4W7Y A;  2OGU A;  2WSC J;  1KYO I;  3MHV A;  2W90 A;  3L37 A;  3OW2 O;  3I56 P;  3V2P A;  3U1A A;  2ZFC A;  3CMA P;  3GF7 A;  3BVH A;  1GK4 A;  1HJ0 A;  4N6J A;  3HTK A;  2POH A;  1BE3 J;  2BCC E;  2KB7 P;  1KTM A;  3BRT B;  2P1J A;  3CCU P;  1R5L A;  5AVQ B;  1JTH A;  2GA1 A;  3FWN A;  1PGP A;  4JPZ B;  1AFO A;  2ZT9 B;  3W67 A;  5L8R J;  3Q3D A;  3TGU J;  1VF5 C;  2ZXE B;  3R2P A;  1ZRT E;  4CPG A;  1PGQ A;  2P10 A;  1EZV D;  1H89 A;  3CLQ A;  2YO3 A;  3JCU E;  3CL3 D;  1BE3 E;  1NGM B;  2DW3 A;  3BAS A;  1HGV A;  3V2Q A;  3VP9 A;  1L0N J;  2AXC A;  1RF0 C;  1SQV K;  3RK3 B;  3OAK A;  3CC4 P;  1KQS O;  2D2C C;  3UIA A;  1GW3 A;  3MIW A;  2YIU C;  1JUN A;  1S2E A;  2OYI A;  1R5S A;  3TGU E;  1AQ5 A;  4D6T D;  1AJY A;  3GHG B;  3F5H A;  1N7S C;  5AW3 B;  3IR9 A;  1JMB A;  3V4W A;  2QM7 A;  2XU6 A;  1BCC D;  5KJ7 D;  2Y0D A;  4PV1 C;  3L4F A;  1NTM K;  1L0N E;  1CI6 B;  2O1K A;  1W5C E;  2H7H A;  1SQV G;  2KNC A;  1P84 H;  1BGY G;  4Y99 C;  2FYU K;  2M5A B;  3OA7 A;  2FBW C;  2C9N Y;  3E1R A;  5B66 H;  5C39 A;  5KAI H;  2N1T B;  4DJG A;  2HYN A;  4ZMD A;  1SQX K;  1FOS E;  3FWL A;  1X79 B;  1UIX A;  3SWK A;  5BVZ A;  1SS1 A;  1P84 D;  1PL5 A;  1EQ7 A;  2FXP A;  2K37 A;  2W6A A;  3CCJ P;  4BRY A;  2W6J H;  1KFM A;  1JY3 N;  5KLV D;  5APV A;  5APW A;  1MKM A;  1SQB D;  2FYU G;  2M0B A;  3O8Z A;  1J1E B;  1SQP K;  4L73 A;  3B5N B;  3P8C E;  2OAR A;  1GW4 A;  1M1J B;  3A0B E;  2Z5H A;  1N7S A;  1H0T A;  1Q82 Q;  2NZ2 A;  3Q2Y A;  1SQX G;  1SQQ D;  3AEC C;  4JF7 A;  4HH2 A;  1NU1 G;  3KHU A;  1JEK A;  3CXH I;  2YKP A;  2W8Z A;  4PJ0 E;  1T3U A;  5KKZ B;  1PPJ E;  2K88 A;  1T8Z A;  2BAS A;  5DJT B;  3L72 G;  2JKV A;  3K5B A;  1YQ4 C;  2A45 G;  2O01 N;  3HRN A;  3G3Z A;  4H13 C;  1ZOY C;  4I6M C;  4WBA A;  3BCC G;  1VQO P;  4R4L A;  3U59 A;  1GU4 A;  3WU2 H;  2QJP C;  5CJ0 A;  5CCH D;  2M3B A;  1IO4 A;  3V4Q A;  1K04 A;  1S72 P;  2E75 D;  1NAY A;  4HKZ H;  1FDM A;  3L74 J;  3CXH E;  4N78 E;  1S9K E;  1CZQ A;  4EIJ A;  2G3A A;  1N73 C;  5APY A;  1JNM A;  2NPS D;  1QEX A;  4WY4 B;  1E79 H;  1NO4 A;  1BDD A;  2VRS A;  3H1I J;  2Q3E A;  3M06 A;  1URQ D;  4N3Y B;  3SWY A;  3L71 E;  4JQ0 D;  4WVZ A;  2IFM A;  1KIL D;  1QVG O;  1JCD A;  2KLV A;  3RK3 D;  4H0L C;  2QEX P;  3G71 P;  3S1K A;  2PP6 A;  3AE8 C;  1DD3 A;  5AW2 B;  3H1L G;  3FXE A;  2XND H;  4GT1 A;  2KNC B;  3E7K A;  4BWN A;  2AEF A;  1VQ4 P;  3L74 E;  3HE5 B;  3N4X A;  2ZVN B;  1VF5 B;  2M3E A;  1EZV G;  2YXR B;  1YJN P;  3H1I E;  2K3R A;  3L73 E;  5E79 H;  4JYC A;  3V5B A;  1NVO A;  3SFD C;  1YJ9 P;  3RGU A;  1LTG C;  2Q3I A;  5B5E E;  2R44 A;  2KZJ A;  4C46 A;  2IPP A;  2D2C B;  1OMI A;  2KYV A;  4I7Z C;  1LTJ C;  2YIU B;  1HVV A;  4D6T G;  1N73 A;  2N1T D;  3PLN A;  1YI2 P;  1VQP P;  1N7S B;  3H1H D;  1USD A;  4OH8 B;  3IF4 A;  3FXD A;  4O9B A;  1HGZ A;  1KQG B;  3GHG C;  3HD7 C;  4IL6 E;  4ASW A;  4XFJ A;  4PV1 B;  2O3J A;  1OW6 A;  2K9Y A;  2WQY C;  4RJT A;  1GDT A;  1U7M A;  5KLV K;  2OTL P;  2E43 A;  5CBO A;  2A06 D;  2Q5U A;  1SQB K;  2BCC D;  3B5N D;  1UII A;  5GTH E;  2P7J A;  2I8D A;  1DEB A;  3IFM A;  1SQQ K;  2C9L Y;  3AEG C;  4UB8 E;  1IFI A;  4TLF A;  3CCS P;  4YTP C;  2H89 C;  3L70 J;  1OW8 A;  2E74 D;  4KT0 J;  1Y8A A;  4ZKP A; 
#chains in the Genus database with same CATH homology
 3L71 G;  1SQQ G;  2IBZ G;  3CWB G;  5KLV G;  1NU1 G;  1PPJ G;  3H1J G;  2FYU G;  3CXH H;  1NTZ G;  1SQV G;  1SQB G;  3H1L G;  3CX5 H;  3H1K G;  4PD4 H;  4D6T G;  1BE3 G;  1KB9 H;  3TGU G;  1P84 H;  1BGY G;  3BCC G;  3H1I G;  1L0N G;  4U3F G;  3L70 G;  1NTM G;  1KYO H;  2A06 G;  3L73 G;  3L72 G;  1NTK G;  2BCC G;  1SQX G;  1SQP G;  1L0L G;  3H1H G;  3L75 G;  1EZV G;  1BCC G;  3L74 G;  1PP9 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...