2IBZG

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
93
Chain Sequence
GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
total genus 16
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 2ibzG00
1L0NG 2BCCG 1BE3G 1SQVG 2IBZG 3L73G 3L71G 3CX5H 3CWBG 1NTKG 1KB9H 1PP9G 2A06G 4D6TG 1SQBG 1KYOH 3L75G 4PD4H 1SQPG 1NTMG 1EZVG 1SQQG 2FYUG 3L72G 1L0LG 4U3FG 1BGYG 3H1HG 1NU1G 1P84H 1BCCG 3BCCG 3L74G 3L70G 3TGUG 5KLVG 1SQXG 3H1IG 1NTZG 3H1LG 3CXHH 3H1KG 3H1JG 1PPJG
chains in the Genus database with same CATH superfamily
2KIKA 3VP9A 3MD0A 1GU4A 4WVZA 3RBZA 4H13D 1N2DC 3EQ2A 3L74G 1EQ7A 4D6TJ 3G9RA 2D2CB 1D7MA 2IZ1A 3L72D 3WUTA 1SQPJ 2NZ2A 3O6QA 1DEBA 3B5NB 2Y0EA 4EDFA 5BU5A 2AEMA 3L35A 1NOHA 1S1CX 1NTKD 2O01H 5DJUB 1OW8A 2FY8A 1QVGO 3FX0A 1RH5B 4QMAA 1IK7A 1BCCE 3GW6A 4KHXA 1HJ0A 4HKZH 2CPSA 1U7MA 2KNCA 3K5BA 3AEEC 3U1AA 1CW5A 2E74D 5AW6B 2G8YA 1BCCG 2WQYC 3I55P 3R4YA 5APUA 1SQQJ 1N7SB 1LTJC 3A0HH 3BASA 2ZT9B 1FZGA 2IBZE 4W7YA 5AW5B 1RY3A 2WPRA 1KILD 3H1LJ 4N3YB 4HJGH 1URQC 5AW2B 2E42A 3HE4B 4L73A 2P67A 4RJTA 1NTMD 4JPZB 4DCKA 2IBZG 4BRYB 1GW3A 1SQXJ 4IFFA 3MUDA 2OYIB 5AW7B 3L71J 1J1DB 2FBWC 2WPQA 4KT0J 1ZR2A 1FOSE 1S3JA 1GTWA 1NKNA 3GHGB 3IR9A 3Q5SA 1LTBC 2N9YB 1SVFA 2QRXA 3H1KD 1L0NJ 2ZYDA 1YQ4C 2A45I 2WSFJ 1N73A 2G3AA 1FS0E 5AW4B 4Y99C 3N4XA 3L72J 1LTGC 2K37A 4GOFA 3LW5J 4L74A 1SQVK 3TGUD 5KLVJ 2OQQA 1CZQA 3OAKA 3A3YB 2N1TD 3AECC 2OYHC 2NPSB 2KS1B 1NTKJ 3CWBD 1CI6A 2I8DA 4RKUJ 2XNDH 1EZVE 3KXDA 5KTBA 2W6BA 3MGNA 4JF7A 4BXLA 2FYNB 2FXMA 4A7PA 3CC2P 3CX5E 3PJSK 2Q1KA 1S72P 1EZVG 3RK3C 3A7OA 2CK3H 2MKVA 1VQKP 1ZRTD 3OW2O 4U3FE 3M9QA 3TSIA 1KMIZ 1AQTA 2KSJA 5AVUB 2Q3IA 3L4FA 3B5NA 2JR8A 2Q5UA 4W80A 1BGYD 3V5BA 4H13C 3GF7A 4WY4D 1KB9E 4U3FG 4UB6H 1J2JB 1LWUB 2FFDB 4PD4E 1SQBJ 2QE7H 3IN6A 1NTMJ 3CCLP 4BWNA 1LTTC 4HB1A 2E5TA 5AW0B 5CBNA 2BCCE 3L37A 2XKMA 4RESB 4EIJA 1G1JA 2BASA 3SWKA 2KP8A 3HD7D 3L75D 3L70E 1N7SA 1BDDA 3KHUA 3RGUA 1L0LJ 2BCCG 2B9BA 2C0XA 3SWFA 5CHXA 2E74C 1FZEA 2I1JA 3H1KJ 2Q6QA 3B4SA 2WSEH 4Z1MH 1YJ9P 3HE4A 1QEXA 3L70G 1PGPA 2FYUD 4BRYA 2LKMA 2Y0DA 3TGUJ 2OYIA 1KILC 4M3LA 3P7KA 3H1IJ 1NTZJ 1Q82Q 4C7NB 2V7QH 2W83C 3CXHI 4I7ZC 1GZLA 2K9JB 1OX3A 2K3RA 4LLHA 1L4AD 1Y47A 3GHGA 1YBKA 4OH8B 1NAFA 3CCJP 3E1RA 2KI7B 3AE1C 4WWIA 5APWA 1KYOH 2E43A 4EOTA 1UIXA 3R2PA 1PP9J 5H2FE 3GF3A 1EC5A 1NU1D 1Q2NA 1CSBA 2IDBA 1BGYJ 2NPSA 2KS1A 4O9BA 1NKZB 3W68A 5APVA 1KFNA 1AJYA 1P84E 4DZOA 3Q1MA 5APQA 3AEGC 2WPSA 2E5YA 2N1TC 2QJYC 1VQMP 2YO3A 3L75J 2RMZA 4AYCA 1OZHA 5B5EE 2O01J 3A2AA 1SQVE 2RN0A 3AE2C 1LTJB 3AEBC 1FOSF 5AVXB 2B88A 2XZRA 1MV8A 1LWUA 1URQB 2FFDA 3CX5I 1L2PA 3V2QA 1IFDA 1LT9C 4GT1A 2FYUJ 4ZKUA 3BRTB 2KK7A 1DH3A 1SQVG 1AFOA 2XDJA 1QL2A 4WY4C 1LT1A 3W67A 3CI9A 4H0LD 4EI2A 1SQPD 1MKMA 5AVSB 1KB9H 4ZMDA 4PD4H 4JQ0D 3FXDA 1JMMA 2GUVA 3H6PA 3HD7C 3TYYA 3P8CE 3H1HE 4YXDC 5CJ4A 1RF1C 1HGZA 1NU1J 4Y99B 3AE7C 1R5LA 2AXTE 3NTNA 4I6MC 4C7NA 3Q5PA 2B89A 1VL2A 1X0TA 2K9JA 3H1HG 3KZIH 4KJMA 2OYHB 1MZ9A 1BCCD 2A45G 2QJPC 1N8RQ 5CCHD 1MUUA 1GL2D 3WUVA 3B8EB 4R4MA 2ZYGA 3H1LD 3CMEP 3SWYA 5CJ0A 5CCGD 1L4AC 3EWKA 3RK3B 2ZVNB 3E1IA 2L5GB 1RQUA 1PL5A 3V2PA 1OW6A 1T3UA 3CCMP 1SQXD 4OVNF 2HPCB 3SFDC 1AA0A 2IBZD 1ZMEC 4H13B 5TISH 2OARA 2Q9IA 1KYOD 4YTPC 1AV1A 3VMXA 1L0ND 2J59M 1Q7YQ 2PAJA 2IYOA 2MJZA 3NFQA 4DJGA 1M8OB 1VPCA 1DEEG 1AQ5A 3L74J 3HE5B 5KLVD 3VMZA 1K9MQ 1ZXGA 1P84I 2K9YA 4U7JA 3NMDA 2C0WA 2E74B 1URQA 1P84H 1HGVA 3HUSC 3S4RA 5CMZA 2QG4A 3GG2A 5KJ7D 2M0BA 3FXEA 1IFJA 1ZLLA 1HVVA 2WMMA 3HRNA 5KAIE 1SLQA 2PFXA 2JO1A 2ZAEB 1Z56A 5EFWB 4YPCA 1KILB 2WTYA 1VQ5P 2VRSA 4I7ZB 1FE6A 5B5EH 2KLVA 1EZVD 1KQFB 1BCCJ 2WSEJ 2ZJSE 1IO4A 3CXHE 2IFMA 2W27A 4OGQD 1JNMA 5AVWB 4R4LA 1OVRA 4H0LC 1SQBD 2WWWA 2UWJE 5AW1B 4K35A 4L75A 1K73Q 2V7QJ 1U57A 3L71E 3RK3E 1M56D 3V2RA 1E79H 2OYHA 4JYCA 1FZBA 1H89A 1KZUB 3KPEA 5GTHE 1KB9D 3KQGA 3PP5A 3I5CA 2W6JH 4PD4D 1L0LD 5GTIE 4GKGA 3E7KA 5KKZC 2BCCD 2N1TB 2QJYB 3L72E 1QLED 3AE3C 3M0DC 1KFMA 2KLUA 3N7NA 2A45H 5CCHC 3L70D 1GL2C 5BU8B 2HPCA 5CCGC 3H1ID 1NTZD 1VQ8P 2KXPB 2RH0A 2AEJA 1GW4A 1Y9BA 1S2EA 3UIAA 3RL0D 1JCCA 1IFPA 2I1KA 3U1CA 1LT9B 3JCUE 2WPVB 2ZYAA 1OWAA 4WY4B 2K1AA 2YMKA 4C46A 1ZW0A 1PP9D 2J5UA 3GLMA 1FDMA 2HLOA 1S5LX 4ZNCA 3HE5A 3GMAA 3WU2E 1KILE 1LP1B 2YXQB 1LTAC 1A02F 2W90A 1HWTC 1RE3C 1IZNB 1N73C 5APSA 3AE9C 3TNUB 3BATA 4XA4A 3HD7B 4TT3H 1YJNP 4U3FJ 5TJHA 1RF1B 1JTHB 2P10A 1BE3E 1KILA 1FC2C 1EDIA 1QL1A 2O3JA 1YHQP 2WSSH 2W8ZA 5KJ7C 2E75D 2WSCH 4WB4A 3AE6C 1USEA 5KAFE 1BE3G 3D70A 4B86A 1EXJA 2QJPB 1G2CB 1S5LE 2XV5A 1FDIA 4HYTB 2BCCJ 2YKPA 1FZCC 3AEDC 1E5WA 1SFCD 1L4AB 5KAIH 4ASVA 3CLQA 2JDIH 1U7JA 3L70J 1GD2E 2ZVOB 3ZDMA 2OGUA 4OGQC 3CWBE 2Z5HA 5APYA 1SQVD 3RK2D 2KYVA 1K05A 2IYPA 1JB0J 2RKLA 3B71A 3CXHH 3CWBG 3H1JE 5AVYB 1RE4C 2QM8A 2M5AB 2QJKC 2Z4EA 1WT6A 1ZRTE 2N1TA 1SQPK 3S1KA 2A06D 2PGDA 1W5CE 4L76A 2XNXA 1OFCX 3H1JG 1PZQA 1M90Q 1KV4A 5DJTB 4PV1D 1VQ9P 1T6AA 5GTHH 2KZIA 2ITAA 3PHLA 2QM7A 1Q86Q 2HODB 2P58A 1VDFA 3HUSB 2HFED 5APXA 1EDJA 1LT9A 3M9HA 2FXPA 3TF5A 5AVRB 3JSVC 2AXCA 2N9BA 4WY4A 3KYQA 1PV3A 1SQQK 5KLIC 2WITA 3RL0C 1QX8A 1XTGB 1H0TB 1LP1A 1HTLC 4K3AA 2ZFCA 2HG5D 2IFNA 1PPJE 3L73E 3V4QA 2OYOA 3CL3D 1LGHB 3AEFC 1PGJA 2YNYA 3TNUA 2H43A 3M06A 3HD7A 1LJ2A 3JCUH 1NYHA 1SQXK 5C39A 3MIWA 2P7JA 1OXZA 4H0LB 1PPJG 3L73G 2B87B 1S9KE 1RF1A 1JTHA 3CX5H 4ASWA 2JP3A 2R5DA 3A0HE 4DOJA 3A5TA 1SQVJ 1GK6A 3IF4A 1YYCA 1USDA 2QVAA 1M1JC 3WU2H 2H89C 1VQNP 3G3ZA 5AW9B 4IFDK 1L0NK 2KUBA 5AVZB 3L74D 2R3SA 1G2CA 1ZP0C 4PJ0E 5KKZB 3KDPB 4TLFA 2NRGA 1NWQA 2E75C 1L4AA 2E76D 3MZWB 2WZ7A 5KLVK 3FWLA 2KZJA 2BEQD 2YO2A 1J1EC 4AQRD 1NTKK 1BSNA 1GL2B 2OTKE 2O1JA 3P32A 1SFCC 5AW8B 5KAFH 3VYIA 3S9OA 3NXSA 1OIPA 4I2LC 1S5LH 1X79B 3F89A 4H44D 3H1HJ 1DD3A 3VMYA 2L91A 2M5AA 3CCSP 3RK2C 2QA4P 4RO0A 1YTZT 2WT7B 2YIUC 2K88A 3QH9A 3BCCE 1A02J 1RF0C 3CD6P 4LC1A 1HF9A 2R32A 5AVTB 4LGDE 3OA7A 1OVUA 1OMIA 1ZR4A 4Y28J 1SQBK 5K5GB 2YKQA 1NTMK 1IFMA 1LNQA 2HODA 3BCCG 3T97B 1PGQA 2R5BA 3HUSA 4WBAA 4W7ZA 1VF5D 4XE5B 4PV1C 1UIIA 3PTZA 5B66E 2M3BA 1T2KD 1YJWP 3IFMA 3PLNA 2PP6A 5H2FH 2H88C 2ZXXA 3PRJA 2W6AA 3QWOC 4D6TE 3SFEC 1L0LK 1NH4A 3CCVP 1SQPE 4N6JA 2POHA 1KN7A 2FXOA 2ZXEB 3I56P 3TK1A 1H0TA 5M1BA 2JWAA 3F5HA 5AW3B 1LTJA 1JY3P 4D6TG 4OWFA 2QEXP 1SQPG 2P1JA 3G71P 2O01N 3JC22 1FZCB 3BRVB 3RL0g 1NTZK 2B87A 1WRGA 3SSUA 1BDCA 1PIXA 4OGQB 2WSCJ 3L36A 1S4XA 1SQQE 2IPPA 1IJDB 5BVZA 2D2CD 2Y9ZA 2Y9YA 2JJLA 3RBXA 1JEKA 4IOIH 3H1LE 3B5ND 1NVOA 3MP7B 1SQQG 2QJKB 1FZFA 3D71A 2LXBA 2DW3A 2C9LY 1NO4A 3CX5D 1EXIA 2M3EA 3M0DA 2WVRA 1SQXE 3H1LG 4U3FD 5CCHA 1VQ6P 1GL2A 3CCUP 1Y8AA 3HTKB 4EYYQ 1YIJP 5CCGA 3A0BE 1YITP 2E76C 3TDKA 1KYOE 3VP8A 1SQXG 4N78E 1GDTA 2HR3A 2HYNA 1OVVA 2QIWA 1N7SD 3L71G 1NJIQ 4PJ0H 2ZT9D 2IX7C 1L0NE 3II6A 1JY3O 1IK9A 1BE3D 1QVFO 3USSA 3WMM0 2WT7A 2Z5IA 3M0AA 1X9VA 1R8EA 5KLIB 5KLVE 4H44C 1IFIA 2AXTH 3RL0B 1L0NG 1W2BO 1H88A 3CPWO 1JCDA 1NTKE 1K04A 1RE3A 3VN0A 3CCQP 3L72G 1YTZI 3AE5C 3PH0A 2LR2A 2FYUK 4JBZA 1FZAA 2JEEA 3T97A 5KLVG 3BVHA 3D6YA 1IFNA 4JYBA 1Q90D 1SP4A 1NTKG 3C8VA 3MUDC 1HJBA 3FGAD 1W2EA 2V4HA 1X8YA 1JUNA 1JMBA 5KJ7A 1VF5C 1ZV8A 1M1JB 1FDOA 4NPDA 4XFJA 1T2KC 3EFFK 2KOGA 1KQGB 1MFZA 3H1JD 1YQ3C 2NPSD 2C9NY 1EDLA 1AVYA 1SQBE 4YXWH 2GA1A 1FZCA 3VMAA 1NU1K 1NTME 5APTA 2YKOA 1M1KQ 2E75B 5B66H 3AEAC 1R5SA 3V6IA 2JKVA 1KTMA 1JY3N 3M9BA 1J1EB 4IL6X 1SQBG 2IZ0A 4DT0A 4UB8E 1NTMG 4GIFA 5E79E 2KSEA 3CMAP 1SFCB 1L0LE 2OTJP 3CCEP 3V2NA 3CCRP 3OJAB 3Q3DA 1GMJA 2R3CA 3H1KE 1N7LA 1P84D 1FJKA 3MHVA 1RE4A 1BE3J 1L0LG 3RK2B 2LXCB 3D6ZA 1AVOA 2D2CC 3C1LA 3WUUA 4GDOA 2YIUB 3TGUE 3KZIE 1NGMB 3H1KG 1DX7A 1M57D 1X22A 3H1IE 1NTZE 3B5NC 4ZKPA 3FWNA 4HH2A 3HTKA 1ZOYC 3C9IA 1M7LA 1FJPA 1PPJD 1JOCA 2FYZA 1T8ZA 3L73D 4IL6E 1RHZB 3MTUE 4GOEA 3TGUG 1BSHA 3H1IG 1NTZG 1VQOP 5CBOA 2H7HA 1JY2P 1PFIA 4PV1B 4I1LA 5AVQB 1S9KD 4AUWA 1PP9E 2IBZI 3CWBJ 3G4SP 1QGKB 1N7SC 3AE4C 1KYOI 5TISE 2ZT9C 3LIDA 4NPEA 1BGYE 3A0BH 1PP9G 1KORA 3H1JJ 1JO5A 3V4WA 2FKWB 2O1KA 1LTIC 5GTIH 3P8CD 2WSFH 1BGYG 3ABVC 3H1HD 2OYIC 3H32B 1KC8Q 2JWDA 1FBMA 2Q7CA 1H8AA 1J1DC 3LW5H 1TU3F 3L75E 3GHGC 1M1JA 1HH0A 1WMKA 3G6EP 2Q3EA 4C7RA 3L75G 2SPZA 2XU6A 2FYUE 2BEZF 2GUSA 1DIPA 1EZVI 1FAVA 3P8MC 1YI2P 3BCCD 3O6QB 1JY2O 2H8PD 1KQSO 2NPSC 4IFMA 1EDKA 3U59A 5L8RJ 2FYUG 3L73J 1SFCA 1N86A 2E76B 1SS1A 1XTCC 2FYNC 3M91A 2KNCB 1NHLA 2Y0CA 1VQLP 3AE8C 2A06E 2PRRA 5AVVB 1HBWA 2R44A 1URQD 3CC4P 2QSIA 2AEFA 1LTSC 4D6TD 1VQPP 1KB9I 1NU1E 1MFTA 1RF0A 4PD4I 1KQLA 1G1IA 4H44B 4UB8H 1JM0A 2YXRB 5E79H 2A06G 4MN4C 1LWUC 3VTPC 3LIEA 2FFDC 1GK4A 1NU1G 3EFGA 2KB7P 1PGOA 2J58A 1Q81Q 4CPGA 3Q5RA 1K8AQ 1ZN5A 1FU1A 3H25A 1IC2A 4GODA 1JY2N 2GM4A 1SQQD 1VF5B 2CPBA 3VOPA 4IL6H 1GU5A 1NAYA 3CC7P 1HUCA 2M8RA 3CXHD 1N73B 2YMYA 1KD1Q 3IAOA 1VQ7P 1T3JA 2P2UA 2OTLP 1DD4A 3H32A 1VQ4P 3BCCJ 3ITKA 3O8ZA 1RQVA 3L71D 1OW7A 4NPFX 3RK3D 1CI6B 3Q2YA 3L74E 4N78D 4UB6E
chains in the Genus database with same CATH topology
1L0NG 2BCCG 1BE3G 1SQVG 2IBZG 3L73G 3L71G 3CX5H 3CWBG 1NTKG 1KB9H 1PP9G 2A06G 4D6TG 1SQBG 1KYOH 3L75G 4PD4H 1SQPG 1NTMG 1EZVG 1SQQG 2FYUG 3L72G 1L0LG 4U3FG 1BGYG 3H1HG 1NU1G 1P84H 1BCCG 3BCCG 3L74G 3L70G 3TGUG 5KLVG 1SQXG 3H1IG 1NTZG 3H1LG 3CXHH 3H1KG 3H1JG 1PPJG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0N G;  2BCC G;  1BE3 G;  1SQV G;  2IBZ G;  3L73 G;  3L71 G;  3CX5 H;  3CWB G;  1NTK G;  1KB9 H;  1PP9 G;  2A06 G;  4D6T G;  1SQB G;  1KYO H;  3L75 G;  4PD4 H;  1SQP G;  1NTM G;  1EZV G;  1SQQ G;  2FYU G;  3L72 G;  1L0L G;  4U3F G;  1BGY G;  3H1H G;  1NU1 G;  1P84 H;  1BCC G;  3BCC G;  3L74 G;  3L70 G;  3TGU G;  5KLV G;  1SQX G;  3H1I G;  1NTZ G;  3H1L G;  3CXH H;  3H1K G;  3H1J G;  1PPJ G; 
#chains in the Genus database with same CATH topology
 2KIK A;  3VP9 A;  3MD0 A;  1GU4 A;  4WVZ A;  3RBZ A;  4H13 D;  1N2D C;  3EQ2 A;  3L74 G;  1EQ7 A;  4D6T J;  3G9R A;  2D2C B;  1D7M A;  2IZ1 A;  3L72 D;  3WUT A;  1SQP J;  2NZ2 A;  3O6Q A;  1DEB A;  3B5N B;  2Y0E A;  4EDF A;  5BU5 A;  2AEM A;  3L35 A;  1NOH A;  1S1C X;  1NTK D;  2O01 H;  5DJU B;  1OW8 A;  2FY8 A;  1QVG O;  3FX0 A;  1RH5 B;  4QMA A;  1IK7 A;  1BCC E;  3GW6 A;  4KHX A;  1HJ0 A;  4HKZ H;  2CPS A;  1U7M A;  2KNC A;  3K5B A;  3AEE C;  3U1A A;  1CW5 A;  2E74 D;  5AW6 B;  2G8Y A;  1BCC G;  2WQY C;  3I55 P;  3R4Y A;  5APU A;  1SQQ J;  1N7S B;  1LTJ C;  3A0H H;  3BAS A;  2ZT9 B;  1FZG A;  2IBZ E;  4W7Y A;  5AW5 B;  1RY3 A;  2WPR A;  1KIL D;  3H1L J;  4N3Y B;  4HJG H;  1URQ C;  5AW2 B;  2E42 A;  3HE4 B;  4L73 A;  2P67 A;  4RJT A;  1NTM D;  4JPZ B;  4DCK A;  2IBZ G;  4BRY B;  1GW3 A;  1SQX J;  4IFF A;  3MUD A;  2OYI B;  5AW7 B;  3L71 J;  1J1D B;  2FBW C;  2WPQ A;  4KT0 J;  1ZR2 A;  1FOS E;  1S3J A;  1GTW A;  1NKN A;  3GHG B;  3IR9 A;  3Q5S A;  1LTB C;  2N9Y B;  1SVF A;  2QRX A;  3H1K D;  1L0N J;  2ZYD A;  1YQ4 C;  2A45 I;  2WSF J;  1N73 A;  2G3A A;  1FS0 E;  5AW4 B;  4Y99 C;  3N4X A;  3L72 J;  1LTG C;  2K37 A;  4GOF A;  3LW5 J;  4L74 A;  1SQV K;  3TGU D;  5KLV J;  2OQQ A;  1CZQ A;  3OAK A;  3A3Y B;  2N1T D;  3AEC C;  2OYH C;  2NPS B;  2KS1 B;  1NTK J;  3CWB D;  1CI6 A;  2I8D A;  4RKU J;  2XND H;  1EZV E;  3KXD A;  5KTB A;  2W6B A;  3MGN A;  4JF7 A;  4BXL A;  2FYN B;  2FXM A;  4A7P A;  3CC2 P;  3CX5 E;  3PJS K;  2Q1K A;  1S72 P;  1EZV G;  3RK3 C;  3A7O A;  2CK3 H;  2MKV A;  1VQK P;  1ZRT D;  3OW2 O;  4U3F E;  3M9Q A;  3TSI A;  1KMI Z;  1AQT A;  2KSJ A;  5AVU B;  2Q3I A;  3L4F A;  3B5N A;  2JR8 A;  2Q5U A;  4W80 A;  1BGY D;  3V5B A;  4H13 C;  3GF7 A;  4WY4 D;  1KB9 E;  4U3F G;  4UB6 H;  1J2J B;  1LWU B;  2FFD B;  4PD4 E;  1SQB J;  2QE7 H;  3IN6 A;  1NTM J;  3CCL P;  4BWN A;  1LTT C;  4HB1 A;  2E5T A;  5AW0 B;  5CBN A;  2BCC E;  3L37 A;  2XKM A;  4RES B;  4EIJ A;  1G1J A;  2BAS A;  3SWK A;  2KP8 A;  3HD7 D;  3L75 D;  3L70 E;  1N7S A;  1BDD A;  3KHU A;  3RGU A;  1L0L J;  2BCC G;  2B9B A;  2C0X A;  3SWF A;  5CHX A;  2E74 C;  1FZE A;  2I1J A;  3H1K J;  2Q6Q A;  3B4S A;  2WSE H;  4Z1M H;  1YJ9 P;  3HE4 A;  1QEX A;  3L70 G;  1PGP A;  2FYU D;  4BRY A;  2LKM A;  2Y0D A;  3TGU J;  2OYI A;  1KIL C;  4M3L A;  3P7K A;  3H1I J;  1NTZ J;  1Q82 Q;  4C7N B;  2V7Q H;  2W83 C;  3CXH I;  4I7Z C;  1GZL A;  2K9J B;  1OX3 A;  2K3R A;  4LLH A;  1L4A D;  1Y47 A;  3GHG A;  1YBK A;  4OH8 B;  1NAF A;  3CCJ P;  3E1R A;  2KI7 B;  3AE1 C;  4WWI A;  5APW A;  1KYO H;  2E43 A;  4EOT A;  1UIX A;  3R2P A;  1PP9 J;  5H2F E;  3GF3 A;  1EC5 A;  1NU1 D;  1Q2N A;  1CSB A;  2IDB A;  1BGY J;  2NPS A;  2KS1 A;  4O9B A;  1NKZ B;  3W68 A;  5APV A;  1KFN A;  1AJY A;  1P84 E;  4DZO A;  3Q1M A;  5APQ A;  3AEG C;  2WPS A;  2E5Y A;  2N1T C;  2QJY C;  1VQM P;  2YO3 A;  3L75 J;  2RMZ A;  4AYC A;  1OZH A;  5B5E E;  2O01 J;  3A2A A;  1SQV E;  2RN0 A;  3AE2 C;  1LTJ B;  3AEB C;  1FOS F;  5AVX B;  2B88 A;  2XZR A;  1MV8 A;  1LWU A;  1URQ B;  2FFD A;  3CX5 I;  1L2P A;  3V2Q A;  1IFD A;  1LT9 C;  4GT1 A;  2FYU J;  4ZKU A;  3BRT B;  2KK7 A;  1DH3 A;  1SQV G;  1AFO A;  2XDJ A;  1QL2 A;  4WY4 C;  1LT1 A;  3W67 A;  3CI9 A;  4H0L D;  4EI2 A;  1SQP D;  1MKM A;  5AVS B;  1KB9 H;  4ZMD A;  4PD4 H;  4JQ0 D;  3FXD A;  1JMM A;  2GUV A;  3H6P A;  3HD7 C;  3TYY A;  3P8C E;  3H1H E;  4YXD C;  5CJ4 A;  1RF1 C;  1HGZ A;  1NU1 J;  4Y99 B;  3AE7 C;  1R5L A;  2AXT E;  3NTN A;  4I6M C;  4C7N A;  3Q5P A;  2B89 A;  1VL2 A;  1X0T A;  2K9J A;  3H1H G;  3KZI H;  4KJM A;  2OYH B;  1MZ9 A;  1BCC D;  2A45 G;  2QJP C;  1N8R Q;  5CCH D;  1MUU A;  1GL2 D;  3WUV A;  3B8E B;  4R4M A;  2ZYG A;  3H1L D;  3CME P;  3SWY A;  5CJ0 A;  5CCG D;  1L4A C;  3EWK A;  3RK3 B;  2ZVN B;  3E1I A;  2L5G B;  1RQU A;  1PL5 A;  3V2P A;  1OW6 A;  1T3U A;  3CCM P;  1SQX D;  4OVN F;  2HPC B;  3SFD C;  1AA0 A;  2IBZ D;  1ZME C;  4H13 B;  5TIS H;  2OAR A;  2Q9I A;  1KYO D;  4YTP C;  1AV1 A;  3VMX A;  1L0N D;  2J59 M;  1Q7Y Q;  2PAJ A;  2IYO A;  2MJZ A;  3NFQ A;  4DJG A;  1M8O B;  1VPC A;  1DEE G;  1AQ5 A;  3L74 J;  3HE5 B;  5KLV D;  3VMZ A;  1K9M Q;  1ZXG A;  1P84 I;  2K9Y A;  4U7J A;  3NMD A;  2C0W A;  2E74 B;  1URQ A;  1P84 H;  1HGV A;  3HUS C;  3S4R A;  5CMZ A;  2QG4 A;  3GG2 A;  5KJ7 D;  2M0B A;  3FXE A;  1IFJ A;  1ZLL A;  1HVV A;  2WMM A;  3HRN A;  5KAI E;  1SLQ A;  2PFX A;  2JO1 A;  2ZAE B;  1Z56 A;  5EFW B;  4YPC A;  1KIL B;  2WTY A;  1VQ5 P;  2VRS A;  4I7Z B;  1FE6 A;  5B5E H;  2KLV A;  1EZV D;  1KQF B;  1BCC J;  2WSE J;  2ZJS E;  1IO4 A;  3CXH E;  2IFM A;  2W27 A;  4OGQ D;  1JNM A;  5AVW B;  4R4L A;  1OVR A;  4H0L C;  1SQB D;  2WWW A;  2UWJ E;  5AW1 B;  4K35 A;  4L75 A;  1K73 Q;  2V7Q J;  1U57 A;  3L71 E;  3RK3 E;  1M56 D;  3V2R A;  1E79 H;  2OYH A;  4JYC A;  1FZB A;  1H89 A;  1KZU B;  3KPE A;  5GTH E;  1KB9 D;  3KQG A;  3PP5 A;  3I5C A;  2W6J H;  4PD4 D;  1L0L D;  5GTI E;  4GKG A;  3E7K A;  5KKZ C;  2BCC D;  2N1T B;  2QJY B;  3L72 E;  1QLE D;  3AE3 C;  3M0D C;  1KFM A;  2KLU A;  3N7N A;  2A45 H;  5CCH C;  3L70 D;  1GL2 C;  5BU8 B;  2HPC A;  5CCG C;  3H1I D;  1NTZ D;  1VQ8 P;  2KXP B;  2RH0 A;  2AEJ A;  1GW4 A;  1Y9B A;  1S2E A;  3UIA A;  3RL0 D;  1JCC A;  1IFP A;  2I1K A;  3U1C A;  1LT9 B;  3JCU E;  2WPV B;  2ZYA A;  1OWA A;  4WY4 B;  2K1A A;  2YMK A;  4C46 A;  1ZW0 A;  1PP9 D;  2J5U A;  3GLM A;  1FDM A;  2HLO A;  1S5L X;  4ZNC A;  3HE5 A;  3GMA A;  3WU2 E;  1KIL E;  1LP1 B;  2YXQ B;  1LTA C;  1A02 F;  2W90 A;  1HWT C;  1RE3 C;  1IZN B;  1N73 C;  5APS A;  3AE9 C;  3TNU B;  3BAT A;  4XA4 A;  3HD7 B;  4TT3 H;  1YJN P;  4U3F J;  5TJH A;  1RF1 B;  1JTH B;  2P10 A;  1BE3 E;  1KIL A;  1FC2 C;  1EDI A;  1QL1 A;  2O3J A;  1YHQ P;  2WSS H;  2W8Z A;  5KJ7 C;  2E75 D;  2WSC H;  4WB4 A;  3AE6 C;  1USE A;  5KAF E;  1BE3 G;  3D70 A;  4B86 A;  1EXJ A;  2QJP B;  1G2C B;  1S5L E;  2XV5 A;  1FDI A;  4HYT B;  2BCC J;  2YKP A;  1FZC C;  3AED C;  1E5W A;  1SFC D;  1L4A B;  5KAI H;  4ASV A;  3CLQ A;  2JDI H;  1U7J A;  3L70 J;  1GD2 E;  2ZVO B;  3ZDM A;  2OGU A;  4OGQ C;  3CWB E;  2Z5H A;  5APY A;  1SQV D;  3RK2 D;  2KYV A;  1K05 A;  2IYP A;  1JB0 J;  2RKL A;  3B71 A;  3CXH H;  3CWB G;  3H1J E;  5AVY B;  1RE4 C;  2QM8 A;  2M5A B;  2QJK C;  2Z4E A;  1WT6 A;  1ZRT E;  2N1T A;  1SQP K;  3S1K A;  2A06 D;  2PGD A;  1W5C E;  4L76 A;  2XNX A;  1OFC X;  3H1J G;  1PZQ A;  1M90 Q;  1KV4 A;  5DJT B;  4PV1 D;  1VQ9 P;  1T6A A;  5GTH H;  2KZI A;  2ITA A;  3PHL A;  2QM7 A;  1Q86 Q;  2HOD B;  2P58 A;  1VDF A;  3HUS B;  2HFE D;  5APX A;  1EDJ A;  1LT9 A;  3M9H A;  2FXP A;  3TF5 A;  5AVR B;  3JSV C;  2AXC A;  2N9B A;  4WY4 A;  3KYQ A;  1PV3 A;  1SQQ K;  5KLI C;  2WIT A;  3RL0 C;  1QX8 A;  1XTG B;  1H0T B;  1LP1 A;  1HTL C;  4K3A A;  2ZFC A;  2HG5 D;  2IFN A;  1PPJ E;  3L73 E;  3V4Q A;  2OYO A;  3CL3 D;  1LGH B;  3AEF C;  1PGJ A;  2YNY A;  3TNU A;  2H43 A;  3M06 A;  3HD7 A;  1LJ2 A;  3JCU H;  1NYH A;  1SQX K;  5C39 A;  3MIW A;  2P7J A;  1OXZ A;  4H0L B;  1PPJ G;  3L73 G;  2B87 B;  1S9K E;  1RF1 A;  1JTH A;  3CX5 H;  4ASW A;  2JP3 A;  2R5D A;  3A0H E;  4DOJ A;  3A5T A;  1SQV J;  1GK6 A;  3IF4 A;  1YYC A;  1USD A;  2QVA A;  1M1J C;  3WU2 H;  2H89 C;  1VQN P;  3G3Z A;  5AW9 B;  4IFD K;  1L0N K;  2KUB A;  5AVZ B;  3L74 D;  2R3S A;  1G2C A;  1ZP0 C;  4PJ0 E;  5KKZ B;  3KDP B;  4TLF A;  2NRG A;  1NWQ A;  2E75 C;  1L4A A;  2E76 D;  3MZW B;  2WZ7 A;  5KLV K;  3FWL A;  2KZJ A;  2BEQ D;  2YO2 A;  1J1E C;  4AQR D;  1NTK K;  1BSN A;  1GL2 B;  2OTK E;  2O1J A;  3P32 A;  1SFC C;  5AW8 B;  5KAF H;  3VYI A;  3S9O A;  3NXS A;  1OIP A;  4I2L C;  1S5L H;  1X79 B;  3F89 A;  4H44 D;  3H1H J;  1DD3 A;  3VMY A;  2L91 A;  2M5A A;  3CCS P;  3RK2 C;  2QA4 P;  4RO0 A;  1YTZ T;  2WT7 B;  2YIU C;  2K88 A;  3QH9 A;  3BCC E;  1A02 J;  1RF0 C;  3CD6 P;  4LC1 A;  1HF9 A;  2R32 A;  5AVT B;  4LGD E;  3OA7 A;  1OVU A;  1OMI A;  1ZR4 A;  4Y28 J;  1SQB K;  5K5G B;  2YKQ A;  1NTM K;  1IFM A;  1LNQ A;  2HOD A;  3BCC G;  3T97 B;  1PGQ A;  2R5B A;  3HUS A;  4WBA A;  4W7Z A;  1VF5 D;  4XE5 B;  4PV1 C;  1UII A;  3PTZ A;  5B66 E;  2M3B A;  1T2K D;  1YJW P;  3IFM A;  3PLN A;  2PP6 A;  5H2F H;  2H88 C;  2ZXX A;  3PRJ A;  2W6A A;  3QWO C;  4D6T E;  3SFE C;  1L0L K;  1NH4 A;  3CCV P;  1SQP E;  4N6J A;  2POH A;  1KN7 A;  2FXO A;  2ZXE B;  3I56 P;  3TK1 A;  1H0T A;  5M1B A;  2JWA A;  3F5H A;  5AW3 B;  1LTJ A;  1JY3 P;  4D6T G;  4OWF A;  2QEX P;  1SQP G;  2P1J A;  3G71 P;  2O01 N;  3JC2 2;  1FZC B;  3BRV B;  3RL0 g;  1NTZ K;  2B87 A;  1WRG A;  3SSU A;  1BDC A;  1PIX A;  4OGQ B;  2WSC J;  3L36 A;  1S4X A;  1SQQ E;  2IPP A;  1IJD B;  5BVZ A;  2D2C D;  2Y9Z A;  2Y9Y A;  2JJL A;  3RBX A;  1JEK A;  4IOI H;  3H1L E;  3B5N D;  1NVO A;  3MP7 B;  1SQQ G;  2QJK B;  1FZF A;  3D71 A;  2LXB A;  2DW3 A;  2C9L Y;  1NO4 A;  3CX5 D;  1EXI A;  2M3E A;  3M0D A;  2WVR A;  1SQX E;  3H1L G;  4U3F D;  5CCH A;  1VQ6 P;  1GL2 A;  3CCU P;  1Y8A A;  3HTK B;  4EYY Q;  1YIJ P;  5CCG A;  3A0B E;  1YIT P;  2E76 C;  3TDK A;  1KYO E;  3VP8 A;  1SQX G;  4N78 E;  1GDT A;  2HR3 A;  2HYN A;  1OVV A;  2QIW A;  1N7S D;  3L71 G;  1NJI Q;  4PJ0 H;  2ZT9 D;  2IX7 C;  1L0N E;  3II6 A;  1JY3 O;  1IK9 A;  1BE3 D;  1QVF O;  3USS A;  3WMM 0;  2WT7 A;  2Z5I A;  3M0A A;  1X9V A;  1R8E A;  5KLI B;  5KLV E;  4H44 C;  1IFI A;  2AXT H;  3RL0 B;  1L0N G;  1W2B O;  1H88 A;  3CPW O;  1JCD A;  1NTK E;  1K04 A;  1RE3 A;  3VN0 A;  3CCQ P;  3L72 G;  1YTZ I;  3AE5 C;  3PH0 A;  2LR2 A;  2FYU K;  4JBZ A;  1FZA A;  2JEE A;  3T97 A;  5KLV G;  3BVH A;  3D6Y A;  1IFN A;  4JYB A;  1Q90 D;  1SP4 A;  1NTK G;  3C8V A;  3MUD C;  1HJB A;  3FGA D;  1W2E A;  2V4H A;  1X8Y A;  1JUN A;  1JMB A;  5KJ7 A;  1VF5 C;  1ZV8 A;  1M1J B;  1FDO A;  4NPD A;  4XFJ A;  1T2K C;  3EFF K;  2KOG A;  1KQG B;  1MFZ A;  3H1J D;  1YQ3 C;  2NPS D;  2C9N Y;  1EDL A;  1AVY A;  1SQB E;  4YXW H;  2GA1 A;  1FZC A;  3VMA A;  1NU1 K;  1NTM E;  5APT A;  2YKO A;  1M1K Q;  2E75 B;  5B66 H;  3AEA C;  1R5S A;  3V6I A;  2JKV A;  1KTM A;  1JY3 N;  3M9B A;  1J1E B;  4IL6 X;  1SQB G;  2IZ0 A;  4DT0 A;  4UB8 E;  1NTM G;  4GIF A;  5E79 E;  2KSE A;  3CMA P;  1SFC B;  1L0L E;  2OTJ P;  3CCE P;  3V2N A;  3CCR P;  3OJA B;  3Q3D A;  1GMJ A;  2R3C A;  3H1K E;  1N7L A;  1P84 D;  1FJK A;  3MHV A;  1RE4 A;  1BE3 J;  1L0L G;  3RK2 B;  2LXC B;  3D6Z A;  1AVO A;  2D2C C;  3C1L A;  3WUU A;  4GDO A;  2YIU B;  3TGU E;  3KZI E;  1NGM B;  3H1K G;  1DX7 A;  1M57 D;  1X22 A;  3H1I E;  1NTZ E;  3B5N C;  4ZKP A;  3FWN A;  4HH2 A;  3HTK A;  1ZOY C;  3C9I A;  1M7L A;  1FJP A;  1PPJ D;  1JOC A;  2FYZ A;  1T8Z A;  3L73 D;  4IL6 E;  1RHZ B;  3MTU E;  4GOE A;  3TGU G;  1BSH A;  3H1I G;  1NTZ G;  1VQO P;  5CBO A;  2H7H A;  1JY2 P;  1PFI A;  4PV1 B;  4I1L A;  5AVQ B;  1S9K D;  4AUW A;  1PP9 E;  2IBZ I;  3CWB J;  3G4S P;  1QGK B;  1N7S C;  3AE4 C;  1KYO I;  5TIS E;  2ZT9 C;  3LID A;  4NPE A;  1BGY E;  3A0B H;  1PP9 G;  1KOR A;  3H1J J;  1JO5 A;  3V4W A;  2FKW B;  2O1K A;  1LTI C;  5GTI H;  3P8C D;  2WSF H;  1BGY G;  3ABV C;  3H1H D;  2OYI C;  3H32 B;  1KC8 Q;  2JWD A;  1FBM A;  2Q7C A;  1H8A A;  1J1D C;  3LW5 H;  1TU3 F;  3L75 E;  3GHG C;  1M1J A;  1HH0 A;  1WMK A;  3G6E P;  2Q3E A;  4C7R A;  3L75 G;  2SPZ A;  2XU6 A;  2FYU E;  2BEZ F;  2GUS A;  1DIP A;  1EZV I;  1FAV A;  3P8M C;  1YI2 P;  3BCC D;  3O6Q B;  1JY2 O;  2H8P D;  1KQS O;  2NPS C;  4IFM A;  1EDK A;  3U59 A;  5L8R J;  2FYU G;  3L73 J;  1SFC A;  1N86 A;  2E76 B;  1SS1 A;  1XTC C;  2FYN C;  3M91 A;  2KNC B;  1NHL A;  2Y0C A;  1VQL P;  3AE8 C;  2A06 E;  2PRR A;  5AVV B;  1HBW A;  2R44 A;  1URQ D;  3CC4 P;  2QSI A;  2AEF A;  1LTS C;  4D6T D;  1VQP P;  1KB9 I;  1NU1 E;  1MFT A;  1RF0 A;  4PD4 I;  1KQL A;  1G1I A;  4H44 B;  4UB8 H;  1JM0 A;  2YXR B;  5E79 H;  2A06 G;  4MN4 C;  1LWU C;  3VTP C;  3LIE A;  2FFD C;  1GK4 A;  1NU1 G;  3EFG A;  2KB7 P;  1PGO A;  2J58 A;  1Q81 Q;  4CPG A;  3Q5R A;  1K8A Q;  1ZN5 A;  1FU1 A;  3H25 A;  1IC2 A;  4GOD A;  1JY2 N;  2GM4 A;  1SQQ D;  1VF5 B;  2CPB A;  3VOP A;  4IL6 H;  1GU5 A;  1NAY A;  3CC7 P;  1HUC A;  2M8R A;  3CXH D;  1N73 B;  2YMY A;  1KD1 Q;  3IAO A;  1VQ7 P;  1T3J A;  2P2U A;  2OTL P;  1DD4 A;  3H32 A;  1VQ4 P;  3BCC J;  3ITK A;  3O8Z A;  1RQV A;  3L71 D;  1OW7 A;  4NPF X;  3RK3 D;  1CI6 B;  3Q2Y A;  3L74 E;  4N78 D;  4UB6 E; 
#chains in the Genus database with same CATH homology
 1L0N G;  2BCC G;  1BE3 G;  1SQV G;  2IBZ G;  3L73 G;  3L71 G;  3CX5 H;  3CWB G;  1NTK G;  1KB9 H;  1PP9 G;  2A06 G;  4D6T G;  1SQB G;  1KYO H;  3L75 G;  4PD4 H;  1SQP G;  1NTM G;  1EZV G;  1SQQ G;  2FYU G;  3L72 G;  1L0L G;  4U3F G;  1BGY G;  3H1H G;  1NU1 G;  1P84 H;  1BCC G;  3BCC G;  3L74 G;  3L70 G;  3TGU G;  5KLV G;  1SQX G;  3H1I G;  1NTZ G;  3H1L G;  3CXH H;  3H1K G;  3H1J G;  1PPJ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...