2IBZG

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
93
structure length
93
Chain Sequence
b'GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
molecule tags Oxidoreductase
source organism Mus musculus
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
total genus 16
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 2ibzG00
1SQXG 1NTMG 3CXHH 1BE3G 2IBZG 3H1LG 3L71G 3L75G 2BCCG 3H1KG 5KLVG 4U3FG 1EZVG 1PPJG 1NTKG 4PD4H 4D6TG 3H1IG 1BGYG 3L73G 3L72G 1SQPG 1KYOH 3BCCG 3L70G 2A06G 1L0NG 3TGUG 3L74G 1SQQG 1KB9H 1SQBG 1NTZG 1PP9G 1BCCG 1P84H 1L0LG 2FYUG 3CWBG 3H1JG 1SQVG 3H1HG 3CX5H 1NU1G
chains in the Genus database with same CATH superfamily
1SQXE 2JWDA 1NTMJ 4DZOA 1A02F 1MKMA 1L2PA 1LTJC 1YQ3C 2O1JA 3AE3C 1AJYA 4IFMA 1NTKK 2BCCG 2Q7CA 1NAFA 1VQ7P 1EZVG 2YXQB 2W6AA 3AE6C 5M1BA 2E74B 4UB6H 1QVGO 1HH0A 1IFPA 2ITAA 1QVFO 5K5GB 1OFCX 3KXDA 4H44C 1KORA 1W5CE 4D6TG 1LTJA 2YXRB 3D70A 1N73C 5GTHH 1RE3C 1KB9I 1URQD 3QWOC 2OARA 2A06G 2H89C 2IBZD 2FKWB 3TGUJ 1DD3A 4HJGH 1Z56A 1LT1A 5AVUB 4Z1MH 5GTIE 5AW9B 4EOTA 2OTLP 3I5CA 3V6IA 3L75J 1BCCG 5TISH 2HODB 1VQ9P 1YI2P 1VQLP 2FYNB 3CX5I 3WUVA 4GOFA 4BWNA 5APXA 1X79B 3L72D 1SQQK 1BDDA 1R5SA 1YQ4C 2AEFA 3H1LD 1IFJA 2Y0DA 1LWUC 5CCGC 1SQXG 4ZMDA 2KNCA 3D6YA 1WT6A 3ZDMA 1BE3D 4BXLA 3NXSA 2D2CC 3A3YB 1VQ5P 1N73B 2JP3A 3L71G 1QGKB 2E75C 3VN0A 5APTA 5CBOA 3H1KG 1FZAA 3H1KJ 1EZVE 1G2CB 5DJUB 5KLVD 1KB9E 2Y0CA 3Q2YA 1AVOA 3VP9A 2O3JA 2M3EA 3G9RA 2KSEA 3H1IG 2YKQA 2BEZF 3CWBD 5APSA 5KJ7D 1S2EA 4WWIA 1OMIA 3SSUA 2W6BA 2A06E 2Q1KA 3HTKA 2RMZA 3GHGB 4EIJA 3NTNA 1XTGB 2R3CA 4EI2A 1NTZJ 2ZYGA 1CSBA 4JYBA 1T2KC 3C9IA 1IFDA 3MUDA 4GODA 4H0LD 1R8EA 2FYUG 2FYUJ 1PV3A 1RH5B 4I7ZB 1YJWP 1ZW0A 2BEQD 3RGUA 4IL6X 3CCQP 3TDKA 1NU1E 1OW7A 4AYCA 1U7JA 1GD2E 1VQKP 2K3RA 3MD0A 4OGQB 3CI9A 3CMAP 1J1DB 3A2AA 3B71A 1SFCC 1GZLA 3A7OA 3AE8C 3CCEP 1FE6A 4XE5B 2CPSA 2A45I 2WPRA 3USSA 2KB7P 2H88C 2YKPA 5EFWB 4ZKPA 3RK3E 2QJYC 2V7QJ 4ZNCA 1MZ9A 4OVNF 2WSFH 4UB8E 1YJNP 1GU5A 2QVAA 3LW5J 1HF9A 2A45G 5DJTB 5E79E 3AEBC 3SFDC 1KYOE 1RE4C 3TGUE 2WPVB 1NU1J 3KZIH 2NPSD 1JB0J 4RJTA 2FYUK 2KNCB 1FZBA 2FYUE 3MHVA 2YIUB 2D2CB 3E7KA 2Z4EA 1JCCA 3M9HA 4PD4I 3L74J 1DD4A 1RE3A 2QJPC 3IR9A 1L0NG 5B5EH 1NTMG 1ZRTE 1H0TB 3H32A 2E76B 1LT9A 2N1TA 5AW6B 3VMZA 3CX5E 4YPCA 3CL3D 1JCDA 3A0BE 1USEA 1NGMB 3MUDC 2G8YA 4H13B 2IYOA 2WPQA 5AVTB 2PP6A 3EFFK 4L74A 4HB1A 4WB4A 3CD6P 1QEXA 3MP7B 1KYOI 1NTKE 4MN4C 1IK7A 1M90Q 4O9BA 1ZLLA 3EFGA 5AW0B 2GUSA 1HUCA 1BGYE 5KJ7C 1EZVI 3L72E 3OA7A 2CPBA 1KV4A 1HTLC 5KLIB 1XTCC 2KXPB 1M1JB 1URQB 2Q6QA 2WITA 1KB9H 1SQBD 2MJZA 2MKVA 3JCUE 4KT0J 1N7SC 3CCRP 1H89A 3OW2O 1KB9D 1P84H 4WBAA 1VF5B 3CCVP 2G3AA 3C1LA 3CLQA 3CWBE 1GL2C 4H44D 2I1KA 1Q82Q 2P10A 1A02J 2XNDH 2JDIH 2IX7C 1LWUA 1EDKA 1OVVA 1RQVA 3CX5H 2WSEJ 5CHXA 3M0DA 1K73Q 2FFDB 3U1CA 1X8YA 1SLQA 2P58A 2N9BA 3Q5RA 4GIFA 2WPSA 4OWFA 3BATA 5KLVJ 3H1KD 4N78E 1CI6B 2QJKB 4C7NB 5KLVG 4IL6E 2C9NY 3EWKA 4H13D 1KMIZ 1KD1Q 2E42A 1HJBA 1S1CX 4PJ0H 5H2FE 1SQXD 1VL2A 3H1IJ 1JTHB 3MIWA 3HD7D 5AW8B 2E76D 4W7YA 3L72G 2N9YB 3RL0D 1OX3A 1GW3A 1OWAA 1JOCA 1JY2O 3JCUH 1OW8A 1N73A 3TNUA 3WUUA 2D2CD 3PJSK 1PP9D 2KUBA 1M7LA 1L4AD 1NTKJ 3FXEA 1KFMA 1JO5A 2Q5UA 3B4SA 2XZRA 5BU5A 1L0LD 5AVQB 1HGVA 2R5BA 1LTTC 3R2PA 4U3FD 3G71P 1AV1A 1YHQP 3PRJA 1GK4A 4U7JA 3PH0A 1SQXK 5APVA 1KZUB 2LKMA 4OH8B 3MZWB 1EQ7A 3ITKA 5CCHC 2K9JA 5CCGD 2Z5IA 2B9BA 4PD4E 4PD4D 3V2QA 3H25A 3TNUB 1KILB 2KP8A 1S9KD 4Y99B 1NJIQ 1T3UA 5APWA 1QL1A 1Q7YQ 4HH2A 1JTHA 2XU6A 5B5EE 3RK3D 1SQPK 4D6TJ 1H0TA 3RK2D 1JY3P 4OGQD 4RO0A 2WWWA 3BCCG 2LXBA 2B87B 1UIIA 2LR2A 1OVRA 2V7QH 2VRSA 2ZXEB 3A0HE 2BCCJ 3AE7C 1NU1D 1SQPJ 2HR3A 3G6EP 4I6MC 4A7PA 1BCCE 1Y47A 3AEAC 2E76C 4I2LC 1ZR4A 2WSSH 3N7NA 4JQ0D 4XA4A 1M1JC 1S5LE 1JEKA 1URQC 1EDLA 1S5LX 2R44A 1KILD 5BU8B 1Q81Q 1SQVJ 1SQVE 3L74D 1GK6A 4Y99C 2IZ1A 2M8RA 2XV5A 1X9VA 1KQSO 1KTMA 3PTZA 3F89A 5AVSB 3M0AA 4NPDA 3L71J 3L75G 2FFDC 2RN0A 4JPZB 3HE5B 2OYHA 1ZP0C 3Q5PA 1R5LA 3HE4A 1DIPA 2JJLA 4H13C 3NFQA 1NVOA 4UB8H 4WY4D 3D71A 2JKVA 3L73D 5BVZA 1CW5A 1KYOH 3KDPB 3BCCE 3GG2A 3L70E 2QA4P 1USDA 2M0BA 3M06A 3L74E 1QX8A 3GMAA 3SWYA 1L0NJ 1Q2NA 1SQBJ 1SQBG 2R5DA 4IL6H 3RL0B 1GMJA 1NTZG 1S72P 1S5LH 3H1JJ 1VQNP 2I1JA 2P67A 3HUSB 5KAIH 4R4LA 2YMKA 1GTWA 5GTHE 2Y0EA 1MUUA 1ZN5A 2HODA 2WT7A 2E74D 1FZCA 3L70J 5AW2B 3AE9C 3GF7A 1SQVK 1SQQD 4HKZH 1J1EC 1X0TA 2WSEH 1EC5A 2IPPA 1D7MA 1NU1G 4YXWH 1T2KD 1FZCB 1IO4A 2NPSA 1IZNB 1QL2A 3P7KA 3BCCD 4WY4A 3V2RA 2OQQA 3FXDA 3JSVC 1FDIA 3L37A 1VDFA 3GHGC 3HRNA 2OYIC 2C0XA 3ABVC 1FDMA 1OXZA 4H44B 1PFIA 2YIUC 1AQTA 1JMMA 1ZV8A 4LGDE 4PV1B 3RK3C 2FXPA 3WU2H 2E74C 3AECC 3WUTA 2KZIA 1L4AC 1QLED 2N1TD 2YMYA 3B5NA 3H1ID 1RF0C 1RQUA 3AE2C 4XFJA 3KZIE 3L70G 1E5WA 1NKNA 3V5BA 3H1HD 2NPSB 1LTSC 2FXMA 1JNMA 1NTKD 3PHLA 4HYTB 1AQ5A 3O6QA 1L0LG 1L0LJ 2W83C 1PGPA 3RK2B 1N8RQ 2A45H 5CJ0A 1U57A 1KILC 3CMEP 2B88A 1NYHA 2ZT9C 1PP9G 4TLFA 1NTME 1X22A 3TYYA 3V4QA 4AUWA 3CXHH 4LLHA 1M56D 5KKZB 3II6A 1KQGB 3RL0C 2NRGA 2E75B 1JMBA 2C0WA 2UWJE 3IN6A 2K88A 2P2UA 1NTKG 3B5NB 4TT3H 4C7NA 1T3JA 1VPCA 4D6TD 2M5AB 2QJKC 2J5UA 1BGYG 1BGYJ 4RKUJ 5C39A 1NWQA 3P8MC 4Y28J 3VP8A 1RF1C 1ZXGA 1WMKA 3TSIA 1EZVD 3Q1MA 2AXTE 2V4HA 1N7LA 2BCCD 3Q5SA 5KAFE 3CCSP 3K5BA 5AW1B 1NTZK 3NMDA 1FU1A 3H6PA 1L0LK 5AVVB 5AW7B 3HD7A 5B66H 2QG4A 1IC2A 2H43A 5KKZC 2H8PD 2ZXXA 3CWBG 1VQ4P 2GUVA 2K9YA 2QIWA 1SQVD 2J59M 3AEDC 1PP9E 1N7SD 3HTKB 2OYIB 1L4AA 1BE3E 1PGQA 1P84D 3B5NC 1S3JA 3RBZA 3W67A 1S4XA 2XKMA 3L71D 2K1AA 1N86A 4GOEA 5KLVE 3IAOA 2QM7A 1DH3A 2LXCB 1M8OB 1DEBA 1LTJB 2FYZA 2KOGA 1NAYA 2IDBA 2NPSC 3FWNA 1Y8AA 2O1KA 3E1IA 1RF1A 1M57D 4C7RA 5CBNA 2I8DA 5KAFH 1CI6A 4B86A 1E79H 1L4AB 3OAKA 1L0ND 2L5GB 3P32A 2E75D 1SVFA 2YKOA 3RK2C 2HPCA 3BRTB 3KHUA 3T97A 4BRYA 1KN7A 1RHZB 3B8EB 3OJAB 2IYPA 2QM8A 1ZR2A 1SQBK 2B89A 1NU1K 3L72J 1GL2D 2BASA 1KYOD 2JEEA 3H1HG 4UB6E 5AVWB 2QJYB 1NHLA 3HUSC 1BE3J 1BE3G 1JY3N 1G1JA 1LTGC 2ZYDA 3H1LE 3AEGC 3C8VA 3M91A 4YTPC 2WTYA 3R4YA 4EYYQ 2HYNA 2HLOA 1KILE 1UIXA 3S4RA 1J2JB 4ASWA 1LGHB 2WMMA 4H0LC 3V2NA 1JM0A 3CC4P 3V4WA 3PLNA 1Q90D 5APUA 3I55P 2YNYA 3HE4B 3CXHD 1BSHA 2Q3EA 2R32A 1IK9A 1LT9B 1N2DC 2N1TB 4WY4B 1GDTA 3VMAA 1LTAC 4DOJA 1YTZI 2AEMA 3H1HJ 4LC1A 3AEFC 5AVRB 3L35A 3WU2E 3V2PA 1NKZB 5E79H 4PJ0E 3FGAD 2OYIA 1VQMP 4YXDC 2FYUD 1VQ8P 2XNXA 4W7ZA 1FZEA 2IFMA 3HUSA 3EQ2A 2WSCH 1YBKA 1SQVG 2WSFJ 2KYVA 4RESB 1GL2B 1DX7A 3A0BH 1LTIC 1OZHA 2W27A 2IBZE 2J58A 2BCCE 3L75E 3S9OA 4KHXA 4U3FG 3WMM0 4CPGA 5B66E 3VMXA 1H88A 3N4XA 2WZ7A 1IFIA 5TJHA 1JY2P 2NZ2A 1MV8A 1NH4A 1RF1B 4D6TE 2QEXP 1AA0A 2K9JB 2XDJA 1BGYD 1SFCD 4JBZA 5CJ4A 1SP4A 1W2EA 1EDIA 2PAJA 1KILA 2QRXA 1VQ6P 2HFED 1JY2N 1YYCA 3L74G 3M9BA 2Y9ZA 1PP9J 1SQBE 3AE5C 4K3AA 4L76A 2OYOA 1NTZE 5APQA 2KS1B 1YITP 2OYHC 2ZYAA 3B5ND 2FFDA 2OGUA 3FWLA 3A5TA 4N3YB 1EXIA 4U3FJ 2IBZI 4DT0A 3GW6A 3CPWO 2R3SA 1AVYA 3G4SP 3O8ZA 1BCCD 1N7SB 3S1KA 1G1IA 1SQQE 1BSNA 2AXTH 2PRRA 2JR8A 3KQGA 1RF0A 4EDFA 3RBXA 1M1KQ 2A06D 2IBZG 4IOIH 3VYIA 1SS1A 2M3BA 2WVRA 1M1JA 1URQA 3L71E 4K35A 3HD7C 3H1KE 5KAIE 2KLVA 4N6JA 4U3FE 2SPZA 2ZT9D 1FZGA 2M5AA 3GHGA 2C9LY 1GW4A 3TK1A 2GM4A 3CCUP 4WY4C 1BDCA 1FAVA 3H1IE 3M9QA 1HBWA 3M0DC 1FJPA 1OIPA 1H8AA 1SQPG 2ZVNB 3W68A 5H2FH 2E43A 1GU4A 3UIAA 3IF4A 2Q9IA 2Q3IA 3G3ZA 1VQPP 1G2CA 2FY8A 3FX0A 5KLIC 2W8ZA 3MGNA 4L73A 4GT1A 3GLMA 1L0LE 5AW3B 4N78D 4C46A 1PGOA 2OTKE 3H1JG 3SWKA 2WT7B 2K37A 1SQQG 2FBWC 2L91A 5AVZB 3RL0g 3IFMA 1NTMD 2CK3H 4KJMA 2DW3A 1HJ0A 1PPJD 3LIEA 5KJ7A 4IFDK 4NPEA 1K05A 1KQFB 2OTJP 2PGDA 4QMAA 2YO3A 3TF5A 1FOSF 2PFXA 1PPJG 1CZQA 5KTBA 1EXJA 4PD4H 3Q3DA 2Y9YA 3LW5H 1SQXJ 3MTUE 2YO2A 1HWTC 2H7HA 3F5HA 3L73J 1MFZA 1P84E 3A0HH 1SQPE 1DEEG 1Y9BA 3AE1C 3L73G 1T6AA 3JC22 3L36A 3P8CE 2Z5HA 5AVXB 1FDOA 3TGUG 3SWFA 3TGUD 1WRGA 2E5TA 2QE7H 1PZQA 2WSCJ 4L75A 5CCHD 1J1EB 3CXHI 1JUNA 1EDJA 1Q86Q 3L4FA 2FYNC 2KLUA 3L75D 4JYCA 4M3LA 3VOPA 1FZFA 3CCLP 3CC7P 1IFNA 1AFOA 4WVZA 3L70D 1LWUB 1MFTA 3O6QB 3H1JE 4BRYB 1L0NK 3GF3A 3H1LJ 4ASVA 3BASA 3CCJP 1L0NE 1ZRTD 2B87A 4NPFX 1YJ9P 1OVUA 3BCCJ 3P8CD 1FZCC 4I1LA 1K8AQ 5KLVK 1P84I 2ZAEB 4DJGA 1FBMA 1KQLA 1PPJE 2AEJA 1IFMA 4W80A 5APYA 3U1AA 5GTIH 2O01J 2HG5D 1KC8Q 5TISE 5CCHA 2AXCA 2KZJA 3CC2P 1IJDB 3CWBJ 3HE5A 1FC2C 3L73E 2OYHB 1HGZA 3QH9A 1NOHA 1FS0E 2IFNA 1OW6A 1T8ZA 2O01H 1PL5A 2KSJA 2QJPB 1NO4A 1FOSE 1SQPD 2GA1A 1YIJP 1NTZD 2P7JA 4H0LB 3LIDA 4R4MA 3D6ZA 4IFFA 4OGQC 3I56P 4GDOA 2RKLA 1SFCB 1RY3A 1ZOYC 2ZFCA 2ZT9B 1BCCJ 1LT9C 2N1TC 4JF7A 1FJKA 1LP1B 3H1HE 4AQRD 3KYQA 2HPCB 2KIKA 1NTMK 2E5YA 5AVYB 3HD7B 4ZKUA 3KPEA 3H1LG 1U7MA 1W2BO 2KS1A 2P1JA 2JO1A 5CMZA 1VQOP 2ZVOB 1JY3O 2POHA 2O01N 2W90A 1PGJA 2IZ0A 1RE4A 1PIXA 1J1DC 1VF5C 3SFEC 3CX5D 3AE4C 1K04A 3U59A 2QSIA 5L8RJ 3PP5A 5CCGA 2W6JH 4PV1C 4GKGA 5AW5B 2RH0A 1GL2A 3RK3B 4DCKA 3CCMP 3BVHA 1KFNA 3H32B 1ZMEC 2KI7B 1VF5D 3E1RA 4I7ZC 2FXOA 1LJ2A 3H1JD 1N7SA 1YTZT 2ZJSE 4PV1D 3AEEC 5AW4B 3VMYA 1SFCA 3VTPC 3T97B 1S9KE 3BRVB 2WQYC 2JWAA 1LTBC 1K9MQ 2KK7A 1LP1A 3CXHE 1LNQA 1SQQJ 1TU3F 1HVVA
chains in the Genus database with same CATH topology
1SQXG 1NTMG 3CXHH 1BE3G 2IBZG 3H1LG 3L71G 3L75G 2BCCG 3H1KG 5KLVG 4U3FG 1EZVG 1PPJG 1NTKG 4PD4H 4D6TG 3H1IG 1BGYG 3L73G 3L72G 1SQPG 1KYOH 3BCCG 3L70G 2A06G 1L0NG 3TGUG 3L74G 1SQQG 1KB9H 1SQBG 1NTZG 1PP9G 1BCCG 1P84H 1L0LG 2FYUG 3CWBG 3H1JG 1SQVG 3H1HG 3CX5H 1NU1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQX G;  1NTM G;  3CXH H;  1BE3 G;  2IBZ G;  3H1L G;  3L71 G;  3L75 G;  2BCC G;  3H1K G;  5KLV G;  4U3F G;  1EZV G;  1PPJ G;  1NTK G;  4PD4 H;  4D6T G;  3H1I G;  1BGY G;  3L73 G;  3L72 G;  1SQP G;  1KYO H;  3BCC G;  3L70 G;  2A06 G;  1L0N G;  3TGU G;  3L74 G;  1SQQ G;  1KB9 H;  1SQB G;  1NTZ G;  1PP9 G;  1BCC G;  1P84 H;  1L0L G;  2FYU G;  3CWB G;  3H1J G;  1SQV G;  3H1H G;  3CX5 H;  1NU1 G; 
#chains in the Genus database with same CATH topology
 1SQX E;  2JWD A;  1NTM J;  4DZO A;  1A02 F;  1MKM A;  1L2P A;  1LTJ C;  1YQ3 C;  2O1J A;  3AE3 C;  1AJY A;  4IFM A;  1NTK K;  2BCC G;  2Q7C A;  1NAF A;  1VQ7 P;  1EZV G;  2YXQ B;  2W6A A;  3AE6 C;  5M1B A;  2E74 B;  4UB6 H;  1QVG O;  1HH0 A;  1IFP A;  2ITA A;  1QVF O;  5K5G B;  1OFC X;  3KXD A;  4H44 C;  1KOR A;  1W5C E;  4D6T G;  1LTJ A;  2YXR B;  3D70 A;  1N73 C;  5GTH H;  1RE3 C;  1KB9 I;  1URQ D;  3QWO C;  2OAR A;  2A06 G;  2H89 C;  2IBZ D;  2FKW B;  3TGU J;  1DD3 A;  4HJG H;  1Z56 A;  1LT1 A;  5AVU B;  4Z1M H;  5GTI E;  5AW9 B;  4EOT A;  2OTL P;  3I5C A;  3V6I A;  3L75 J;  1BCC G;  5TIS H;  2HOD B;  1VQ9 P;  1YI2 P;  1VQL P;  2FYN B;  3CX5 I;  3WUV A;  4GOF A;  4BWN A;  5APX A;  1X79 B;  3L72 D;  1SQQ K;  1BDD A;  1R5S A;  1YQ4 C;  2AEF A;  3H1L D;  1IFJ A;  2Y0D A;  1LWU C;  5CCG C;  1SQX G;  4ZMD A;  2KNC A;  3D6Y A;  1WT6 A;  3ZDM A;  1BE3 D;  4BXL A;  3NXS A;  2D2C C;  3A3Y B;  1VQ5 P;  1N73 B;  2JP3 A;  3L71 G;  1QGK B;  2E75 C;  3VN0 A;  5APT A;  5CBO A;  3H1K G;  1FZA A;  3H1K J;  1EZV E;  1G2C B;  5DJU B;  5KLV D;  1KB9 E;  2Y0C A;  3Q2Y A;  1AVO A;  3VP9 A;  2O3J A;  2M3E A;  3G9R A;  2KSE A;  3H1I G;  2YKQ A;  2BEZ F;  3CWB D;  5APS A;  5KJ7 D;  1S2E A;  4WWI A;  1OMI A;  3SSU A;  2W6B A;  2A06 E;  2Q1K A;  3HTK A;  2RMZ A;  3GHG B;  4EIJ A;  3NTN A;  1XTG B;  2R3C A;  4EI2 A;  1NTZ J;  2ZYG A;  1CSB A;  4JYB A;  1T2K C;  3C9I A;  1IFD A;  3MUD A;  4GOD A;  4H0L D;  1R8E A;  2FYU G;  2FYU J;  1PV3 A;  1RH5 B;  4I7Z B;  1YJW P;  1ZW0 A;  2BEQ D;  3RGU A;  4IL6 X;  3CCQ P;  3TDK A;  1NU1 E;  1OW7 A;  4AYC A;  1U7J A;  1GD2 E;  1VQK P;  2K3R A;  3MD0 A;  4OGQ B;  3CI9 A;  3CMA P;  1J1D B;  3A2A A;  3B71 A;  1SFC C;  1GZL A;  3A7O A;  3AE8 C;  3CCE P;  1FE6 A;  4XE5 B;  2CPS A;  2A45 I;  2WPR A;  3USS A;  2KB7 P;  2H88 C;  2YKP A;  5EFW B;  4ZKP A;  3RK3 E;  2QJY C;  2V7Q J;  4ZNC A;  1MZ9 A;  4OVN F;  2WSF H;  4UB8 E;  1YJN P;  1GU5 A;  2QVA A;  3LW5 J;  1HF9 A;  2A45 G;  5DJT B;  5E79 E;  3AEB C;  3SFD C;  1KYO E;  1RE4 C;  3TGU E;  2WPV B;  1NU1 J;  3KZI H;  2NPS D;  1JB0 J;  4RJT A;  2FYU K;  2KNC B;  1FZB A;  2FYU E;  3MHV A;  2YIU B;  2D2C B;  3E7K A;  2Z4E A;  1JCC A;  3M9H A;  4PD4 I;  3L74 J;  1DD4 A;  1RE3 A;  2QJP C;  3IR9 A;  1L0N G;  5B5E H;  1NTM G;  1ZRT E;  1H0T B;  3H32 A;  2E76 B;  1LT9 A;  2N1T A;  5AW6 B;  3VMZ A;  3CX5 E;  4YPC A;  3CL3 D;  1JCD A;  3A0B E;  1USE A;  1NGM B;  3MUD C;  2G8Y A;  4H13 B;  2IYO A;  2WPQ A;  5AVT B;  2PP6 A;  3EFF K;  4L74 A;  4HB1 A;  4WB4 A;  3CD6 P;  1QEX A;  3MP7 B;  1KYO I;  1NTK E;  4MN4 C;  1IK7 A;  1M90 Q;  4O9B A;  1ZLL A;  3EFG A;  5AW0 B;  2GUS A;  1HUC A;  1BGY E;  5KJ7 C;  1EZV I;  3L72 E;  3OA7 A;  2CPB A;  1KV4 A;  1HTL C;  5KLI B;  1XTC C;  2KXP B;  1M1J B;  1URQ B;  2Q6Q A;  2WIT A;  1KB9 H;  1SQB D;  2MJZ A;  2MKV A;  3JCU E;  4KT0 J;  1N7S C;  3CCR P;  1H89 A;  3OW2 O;  1KB9 D;  1P84 H;  4WBA A;  1VF5 B;  3CCV P;  2G3A A;  3C1L A;  3CLQ A;  3CWB E;  1GL2 C;  4H44 D;  2I1K A;  1Q82 Q;  2P10 A;  1A02 J;  2XND H;  2JDI H;  2IX7 C;  1LWU A;  1EDK A;  1OVV A;  1RQV A;  3CX5 H;  2WSE J;  5CHX A;  3M0D A;  1K73 Q;  2FFD B;  3U1C A;  1X8Y A;  1SLQ A;  2P58 A;  2N9B A;  3Q5R A;  4GIF A;  2WPS A;  4OWF A;  3BAT A;  5KLV J;  3H1K D;  4N78 E;  1CI6 B;  2QJK B;  4C7N B;  5KLV G;  4IL6 E;  2C9N Y;  3EWK A;  4H13 D;  1KMI Z;  1KD1 Q;  2E42 A;  1HJB A;  1S1C X;  4PJ0 H;  5H2F E;  1SQX D;  1VL2 A;  3H1I J;  1JTH B;  3MIW A;  3HD7 D;  5AW8 B;  2E76 D;  4W7Y A;  3L72 G;  2N9Y B;  3RL0 D;  1OX3 A;  1GW3 A;  1OWA A;  1JOC A;  1JY2 O;  3JCU H;  1OW8 A;  1N73 A;  3TNU A;  3WUU A;  2D2C D;  3PJS K;  1PP9 D;  2KUB A;  1M7L A;  1L4A D;  1NTK J;  3FXE A;  1KFM A;  1JO5 A;  2Q5U A;  3B4S A;  2XZR A;  5BU5 A;  1L0L D;  5AVQ B;  1HGV A;  2R5B A;  1LTT C;  3R2P A;  4U3F D;  3G71 P;  1AV1 A;  1YHQ P;  3PRJ A;  1GK4 A;  4U7J A;  3PH0 A;  1SQX K;  5APV A;  1KZU B;  2LKM A;  4OH8 B;  3MZW B;  1EQ7 A;  3ITK A;  5CCH C;  2K9J A;  5CCG D;  2Z5I A;  2B9B A;  4PD4 E;  4PD4 D;  3V2Q A;  3H25 A;  3TNU B;  1KIL B;  2KP8 A;  1S9K D;  4Y99 B;  1NJI Q;  1T3U A;  5APW A;  1QL1 A;  1Q7Y Q;  4HH2 A;  1JTH A;  2XU6 A;  5B5E E;  3RK3 D;  1SQP K;  4D6T J;  1H0T A;  3RK2 D;  1JY3 P;  4OGQ D;  4RO0 A;  2WWW A;  3BCC G;  2LXB A;  2B87 B;  1UII A;  2LR2 A;  1OVR A;  2V7Q H;  2VRS A;  2ZXE B;  3A0H E;  2BCC J;  3AE7 C;  1NU1 D;  1SQP J;  2HR3 A;  3G6E P;  4I6M C;  4A7P A;  1BCC E;  1Y47 A;  3AEA C;  2E76 C;  4I2L C;  1ZR4 A;  2WSS H;  3N7N A;  4JQ0 D;  4XA4 A;  1M1J C;  1S5L E;  1JEK A;  1URQ C;  1EDL A;  1S5L X;  2R44 A;  1KIL D;  5BU8 B;  1Q81 Q;  1SQV J;  1SQV E;  3L74 D;  1GK6 A;  4Y99 C;  2IZ1 A;  2M8R A;  2XV5 A;  1X9V A;  1KQS O;  1KTM A;  3PTZ A;  3F89 A;  5AVS B;  3M0A A;  4NPD A;  3L71 J;  3L75 G;  2FFD C;  2RN0 A;  4JPZ B;  3HE5 B;  2OYH A;  1ZP0 C;  3Q5P A;  1R5L A;  3HE4 A;  1DIP A;  2JJL A;  4H13 C;  3NFQ A;  1NVO A;  4UB8 H;  4WY4 D;  3D71 A;  2JKV A;  3L73 D;  5BVZ A;  1CW5 A;  1KYO H;  3KDP B;  3BCC E;  3GG2 A;  3L70 E;  2QA4 P;  1USD A;  2M0B A;  3M06 A;  3L74 E;  1QX8 A;  3GMA A;  3SWY A;  1L0N J;  1Q2N A;  1SQB J;  1SQB G;  2R5D A;  4IL6 H;  3RL0 B;  1GMJ A;  1NTZ G;  1S72 P;  1S5L H;  3H1J J;  1VQN P;  2I1J A;  2P67 A;  3HUS B;  5KAI H;  4R4L A;  2YMK A;  1GTW A;  5GTH E;  2Y0E A;  1MUU A;  1ZN5 A;  2HOD A;  2WT7 A;  2E74 D;  1FZC A;  3L70 J;  5AW2 B;  3AE9 C;  3GF7 A;  1SQV K;  1SQQ D;  4HKZ H;  1J1E C;  1X0T A;  2WSE H;  1EC5 A;  2IPP A;  1D7M A;  1NU1 G;  4YXW H;  1T2K D;  1FZC B;  1IO4 A;  2NPS A;  1IZN B;  1QL2 A;  3P7K A;  3BCC D;  4WY4 A;  3V2R A;  2OQQ A;  3FXD A;  3JSV C;  1FDI A;  3L37 A;  1VDF A;  3GHG C;  3HRN A;  2OYI C;  2C0X A;  3ABV C;  1FDM A;  1OXZ A;  4H44 B;  1PFI A;  2YIU C;  1AQT A;  1JMM A;  1ZV8 A;  4LGD E;  4PV1 B;  3RK3 C;  2FXP A;  3WU2 H;  2E74 C;  3AEC C;  3WUT A;  2KZI A;  1L4A C;  1QLE D;  2N1T D;  2YMY A;  3B5N A;  3H1I D;  1RF0 C;  1RQU A;  3AE2 C;  4XFJ A;  3KZI E;  3L70 G;  1E5W A;  1NKN A;  3V5B A;  3H1H D;  2NPS B;  1LTS C;  2FXM A;  1JNM A;  1NTK D;  3PHL A;  4HYT B;  1AQ5 A;  3O6Q A;  1L0L G;  1L0L J;  2W83 C;  1PGP A;  3RK2 B;  1N8R Q;  2A45 H;  5CJ0 A;  1U57 A;  1KIL C;  3CME P;  2B88 A;  1NYH A;  2ZT9 C;  1PP9 G;  4TLF A;  1NTM E;  1X22 A;  3TYY A;  3V4Q A;  4AUW A;  3CXH H;  4LLH A;  1M56 D;  5KKZ B;  3II6 A;  1KQG B;  3RL0 C;  2NRG A;  2E75 B;  1JMB A;  2C0W A;  2UWJ E;  3IN6 A;  2K88 A;  2P2U A;  1NTK G;  3B5N B;  4TT3 H;  4C7N A;  1T3J A;  1VPC A;  4D6T D;  2M5A B;  2QJK C;  2J5U A;  1BGY G;  1BGY J;  4RKU J;  5C39 A;  1NWQ A;  3P8M C;  4Y28 J;  3VP8 A;  1RF1 C;  1ZXG A;  1WMK A;  3TSI A;  1EZV D;  3Q1M A;  2AXT E;  2V4H A;  1N7L A;  2BCC D;  3Q5S A;  5KAF E;  3CCS P;  3K5B A;  5AW1 B;  1NTZ K;  3NMD A;  1FU1 A;  3H6P A;  1L0L K;  5AVV B;  5AW7 B;  3HD7 A;  5B66 H;  2QG4 A;  1IC2 A;  2H43 A;  5KKZ C;  2H8P D;  2ZXX A;  3CWB G;  1VQ4 P;  2GUV A;  2K9Y A;  2QIW A;  1SQV D;  2J59 M;  3AED C;  1PP9 E;  1N7S D;  3HTK B;  2OYI B;  1L4A A;  1BE3 E;  1PGQ A;  1P84 D;  3B5N C;  1S3J A;  3RBZ A;  3W67 A;  1S4X A;  2XKM A;  3L71 D;  2K1A A;  1N86 A;  4GOE A;  5KLV E;  3IAO A;  2QM7 A;  1DH3 A;  2LXC B;  1M8O B;  1DEB A;  1LTJ B;  2FYZ A;  2KOG A;  1NAY A;  2IDB A;  2NPS C;  3FWN A;  1Y8A A;  2O1K A;  3E1I A;  1RF1 A;  1M57 D;  4C7R A;  5CBN A;  2I8D A;  5KAF H;  1CI6 A;  4B86 A;  1E79 H;  1L4A B;  3OAK A;  1L0N D;  2L5G B;  3P32 A;  2E75 D;  1SVF A;  2YKO A;  3RK2 C;  2HPC A;  3BRT B;  3KHU A;  3T97 A;  4BRY A;  1KN7 A;  1RHZ B;  3B8E B;  3OJA B;  2IYP A;  2QM8 A;  1ZR2 A;  1SQB K;  2B89 A;  1NU1 K;  3L72 J;  1GL2 D;  2BAS A;  1KYO D;  2JEE A;  3H1H G;  4UB6 E;  5AVW B;  2QJY B;  1NHL A;  3HUS C;  1BE3 J;  1BE3 G;  1JY3 N;  1G1J A;  1LTG C;  2ZYD A;  3H1L E;  3AEG C;  3C8V A;  3M91 A;  4YTP C;  2WTY A;  3R4Y A;  4EYY Q;  2HYN A;  2HLO A;  1KIL E;  1UIX A;  3S4R A;  1J2J B;  4ASW A;  1LGH B;  2WMM A;  4H0L C;  3V2N A;  1JM0 A;  3CC4 P;  3V4W A;  3PLN A;  1Q90 D;  5APU A;  3I55 P;  2YNY A;  3HE4 B;  3CXH D;  1BSH A;  2Q3E A;  2R32 A;  1IK9 A;  1LT9 B;  1N2D C;  2N1T B;  4WY4 B;  1GDT A;  3VMA A;  1LTA C;  4DOJ A;  1YTZ I;  2AEM A;  3H1H J;  4LC1 A;  3AEF C;  5AVR B;  3L35 A;  3WU2 E;  3V2P A;  1NKZ B;  5E79 H;  4PJ0 E;  3FGA D;  2OYI A;  1VQM P;  4YXD C;  2FYU D;  1VQ8 P;  2XNX A;  4W7Z A;  1FZE A;  2IFM A;  3HUS A;  3EQ2 A;  2WSC H;  1YBK A;  1SQV G;  2WSF J;  2KYV A;  4RES B;  1GL2 B;  1DX7 A;  3A0B H;  1LTI C;  1OZH A;  2W27 A;  2IBZ E;  2J58 A;  2BCC E;  3L75 E;  3S9O A;  4KHX A;  4U3F G;  3WMM 0;  4CPG A;  5B66 E;  3VMX A;  1H88 A;  3N4X A;  2WZ7 A;  1IFI A;  5TJH A;  1JY2 P;  2NZ2 A;  1MV8 A;  1NH4 A;  1RF1 B;  4D6T E;  2QEX P;  1AA0 A;  2K9J B;  2XDJ A;  1BGY D;  1SFC D;  4JBZ A;  5CJ4 A;  1SP4 A;  1W2E A;  1EDI A;  2PAJ A;  1KIL A;  2QRX A;  1VQ6 P;  2HFE D;  1JY2 N;  1YYC A;  3L74 G;  3M9B A;  2Y9Z A;  1PP9 J;  1SQB E;  3AE5 C;  4K3A A;  4L76 A;  2OYO A;  1NTZ E;  5APQ A;  2KS1 B;  1YIT P;  2OYH C;  2ZYA A;  3B5N D;  2FFD A;  2OGU A;  3FWL A;  3A5T A;  4N3Y B;  1EXI A;  4U3F J;  2IBZ I;  4DT0 A;  3GW6 A;  3CPW O;  2R3S A;  1AVY A;  3G4S P;  3O8Z A;  1BCC D;  1N7S B;  3S1K A;  1G1I A;  1SQQ E;  1BSN A;  2AXT H;  2PRR A;  2JR8 A;  3KQG A;  1RF0 A;  4EDF A;  3RBX A;  1M1K Q;  2A06 D;  2IBZ G;  4IOI H;  3VYI A;  1SS1 A;  2M3B A;  2WVR A;  1M1J A;  1URQ A;  3L71 E;  4K35 A;  3HD7 C;  3H1K E;  5KAI E;  2KLV A;  4N6J A;  4U3F E;  2SPZ A;  2ZT9 D;  1FZG A;  2M5A A;  3GHG A;  2C9L Y;  1GW4 A;  3TK1 A;  2GM4 A;  3CCU P;  4WY4 C;  1BDC A;  1FAV A;  3H1I E;  3M9Q A;  1HBW A;  3M0D C;  1FJP A;  1OIP A;  1H8A A;  1SQP G;  2ZVN B;  3W68 A;  5H2F H;  2E43 A;  1GU4 A;  3UIA A;  3IF4 A;  2Q9I A;  2Q3I A;  3G3Z A;  1VQP P;  1G2C A;  2FY8 A;  3FX0 A;  5KLI C;  2W8Z A;  3MGN A;  4L73 A;  4GT1 A;  3GLM A;  1L0L E;  5AW3 B;  4N78 D;  4C46 A;  1PGO A;  2OTK E;  3H1J G;  3SWK A;  2WT7 B;  2K37 A;  1SQQ G;  2FBW C;  2L91 A;  5AVZ B;  3RL0 g;  3IFM A;  1NTM D;  2CK3 H;  4KJM A;  2DW3 A;  1HJ0 A;  1PPJ D;  3LIE A;  5KJ7 A;  4IFD K;  4NPE A;  1K05 A;  1KQF B;  2OTJ P;  2PGD A;  4QMA A;  2YO3 A;  3TF5 A;  1FOS F;  2PFX A;  1PPJ G;  1CZQ A;  5KTB A;  1EXJ A;  4PD4 H;  3Q3D A;  2Y9Y A;  3LW5 H;  1SQX J;  3MTU E;  2YO2 A;  1HWT C;  2H7H A;  3F5H A;  3L73 J;  1MFZ A;  1P84 E;  3A0H H;  1SQP E;  1DEE G;  1Y9B A;  3AE1 C;  3L73 G;  1T6A A;  3JC2 2;  3L36 A;  3P8C E;  2Z5H A;  5AVX B;  1FDO A;  3TGU G;  3SWF A;  3TGU D;  1WRG A;  2E5T A;  2QE7 H;  1PZQ A;  2WSC J;  4L75 A;  5CCH D;  1J1E B;  3CXH I;  1JUN A;  1EDJ A;  1Q86 Q;  3L4F A;  2FYN C;  2KLU A;  3L75 D;  4JYC A;  4M3L A;  3VOP A;  1FZF A;  3CCL P;  3CC7 P;  1IFN A;  1AFO A;  4WVZ A;  3L70 D;  1LWU B;  1MFT A;  3O6Q B;  3H1J E;  4BRY B;  1L0N K;  3GF3 A;  3H1L J;  4ASV A;  3BAS A;  3CCJ P;  1L0N E;  1ZRT D;  2B87 A;  4NPF X;  1YJ9 P;  1OVU A;  3BCC J;  3P8C D;  1FZC C;  4I1L A;  1K8A Q;  5KLV K;  1P84 I;  2ZAE B;  4DJG A;  1FBM A;  1KQL A;  1PPJ E;  2AEJ A;  1IFM A;  4W80 A;  5APY A;  3U1A A;  5GTI H;  2O01 J;  2HG5 D;  1KC8 Q;  5TIS E;  5CCH A;  2AXC A;  2KZJ A;  3CC2 P;  1IJD B;  3CWB J;  3HE5 A;  1FC2 C;  3L73 E;  2OYH B;  1HGZ A;  3QH9 A;  1NOH A;  1FS0 E;  2IFN A;  1OW6 A;  1T8Z A;  2O01 H;  1PL5 A;  2KSJ A;  2QJP B;  1NO4 A;  1FOS E;  1SQP D;  2GA1 A;  1YIJ P;  1NTZ D;  2P7J A;  4H0L B;  3LID A;  4R4M A;  3D6Z A;  4IFF A;  4OGQ C;  3I56 P;  4GDO A;  2RKL A;  1SFC B;  1RY3 A;  1ZOY C;  2ZFC A;  2ZT9 B;  1BCC J;  1LT9 C;  2N1T C;  4JF7 A;  1FJK A;  1LP1 B;  3H1H E;  4AQR D;  3KYQ A;  2HPC B;  2KIK A;  1NTM K;  2E5Y A;  5AVY B;  3HD7 B;  4ZKU A;  3KPE A;  3H1L G;  1U7M A;  1W2B O;  2KS1 A;  2P1J A;  2JO1 A;  5CMZ A;  1VQO P;  2ZVO B;  1JY3 O;  2POH A;  2O01 N;  2W90 A;  1PGJ A;  2IZ0 A;  1RE4 A;  1PIX A;  1J1D C;  1VF5 C;  3SFE C;  3CX5 D;  3AE4 C;  1K04 A;  3U59 A;  2QSI A;  5L8R J;  3PP5 A;  5CCG A;  2W6J H;  4PV1 C;  4GKG A;  5AW5 B;  2RH0 A;  1GL2 A;  3RK3 B;  4DCK A;  3CCM P;  3BVH A;  1KFN A;  3H32 B;  1ZME C;  2KI7 B;  1VF5 D;  3E1R A;  4I7Z C;  2FXO A;  1LJ2 A;  3H1J D;  1N7S A;  1YTZ T;  2ZJS E;  4PV1 D;  3AEE C;  5AW4 B;  3VMY A;  1SFC A;  3VTP C;  3T97 B;  1S9K E;  3BRV B;  2WQY C;  2JWA A;  1LTB C;  1K9M Q;  2KK7 A;  1LP1 A;  3CXH E;  1LNQ A;  1SQQ J;  1TU3 F;  1HVV A; 
#chains in the Genus database with same CATH homology
 1SQX G;  1NTM G;  3CXH H;  1BE3 G;  2IBZ G;  3H1L G;  3L71 G;  3L75 G;  2BCC G;  3H1K G;  5KLV G;  4U3F G;  1EZV G;  1PPJ G;  1NTK G;  4PD4 H;  4D6T G;  3H1I G;  1BGY G;  3L73 G;  3L72 G;  1SQP G;  1KYO H;  3BCC G;  3L70 G;  2A06 G;  1L0N G;  3TGU G;  3L74 G;  1SQQ G;  1KB9 H;  1SQB G;  1NTZ G;  1PP9 G;  1BCC G;  1P84 H;  1L0L G;  2FYU G;  3CWB G;  3H1J G;  1SQV G;  3H1H G;  3CX5 H;  1NU1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...