2FFDA

Fibrinogen fragment d with "a" knob peptide mimic gprvve
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E Chain
publication title The structure of fibrinogen fragment D with the 'A' knob peptide GPRVVE.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 65
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2005-12-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ffdA00
3HUSC 3GHGC 3HUSB 1RE3A 2A45H 3GHGB 1LTJA 1M1JC 1M1JB 1RF1A 2HPCB 1LWUA 1FZCA 2OYIB 2A45G 2OYIC 1RF0C 3HUSA 3GHGA 1FZBA 1JY3N 1M1JA 3BVHA 2HPCA 2FFDC 2OYIA 1JY3O 1FZAA 1RF0A 1RE4C 2FFDB 2Z4EA 1FZEA 2XNXA 2H43A 1JY2P 3E1IA 3H32B 1RE4A 2FFDA 2HODB 2OYHB 1FZGA 2OYHC 1N73B 1W2EA 3H32A 1N73C 1LT9B 1T3UA 2A45I 1LT9C 2HODA 1N86A 2OYHA 1JY2O 2HLOA 1N73A 1JY3P 1RE3C 1LT9A 1LTJB 2Q9IA 1LTJC 1FZCB 1FZFA 1LWUC 1FZCC 1RF1B 1JY2N 1LWUB 1RF1C
chains in the Genus database with same CATH superfamily
1X0TA 5KJ7D 1XTGB 1QGKB 3HRNA 3OAKA 1EDJA 5CCHC 4H44C 1AQTA 1NH4A 3CX5I 1SQPG 3II6A 4A7PA 2J5UA 5AVZB 4OH8B 4H0LC 3M0AA 1AV1A 5CBOA 5KKZC 3P8CD 3HTKA 2OYIB 4W7YA 1GK6A 3H1HG 1M1JA 4YPCA 2IDBA 1NTKD 2HODB 1L0LK 3H1KD 4EI2A 4IFMA 1SS1A 1HF9A 1CSBA 1URQA 2ZAEB 1VQ4P 4WWIA 3LIDA 3P8CE 2R44A 1JM0A 2R32A 3H1JJ 2FBWC 1DH3A 1H88A 1H0TA 1VDFA 1S5LX 2A06D 1NTKE 1L0LG 3H1KE 1AVYA 2GUSA 2C9NY 1QEXA 1OFCX 1X9VA 2KI7B 2N1TD 2D2CD 1L0NJ 1N7LA 1HJBA 2WT7A 3I55P 1K9MQ 5AW4B 1LT9B 3PRJA 3LIEA 2K88A 2ZYDA 1NTZE 1T8ZA 2Y0EA 5KLIB 2A45H 5APQA 1GU4A 4LGDE 3B8EB 2QJPC 1BGYJ 1LTSC 1ZP0C 1RQUA 3T97B 2E75C 1PZQA 3ABVC 3RGUA 1LWUC 2KLUA 1PFIA 1Q82Q 3M06A 1PL5A 3D6ZA 3L4FA 3W67A 4XA4A 1DEBA 3UIAA 3IR9A 4EDFA 3L73D 2PRRA 4UB6E 2YKPA 3O8ZA 1RF1B 1RQVA 1BE3E 2W90A 3AE9C 1NTKK 1ZR2A 3JC22 1FZBA 3USSA 3R4YA 4KHXA 3WUVA 1GL2D 2XKMA 2IPPA 4IL6X 2SPZA 4L74A 3L73E 3CCMP 3CD6P 3Q5SA 4RKUJ 2J58A 4IFDK 3P7KA 1NTKG 1NTZK 2B89A 1TU3F 3H1KG 5AVTB 1CW5A 1K05A 4DZOA 2UWJE 1JOCA 1UIIA 3AEGC 4BXLA 3CI9A 2K1AA 2N9YB 3RL0C 3G71P 4UB8H 2NRGA 1S2EA 3IFMA 4C7RA 2N1TB 2QA4P 2D2CB 2OTKE 1SQQJ 2YIUB 1NTZG 4NPDA 2IFMA 1VQ9P 4L76A 1YBKA 3L70E 3A0HH 2HLOA 3MP7B 3LW5J 3MGNA 2K37A 4IFFA 1IFPA 1KILA 3L74D 3CCSP 2V7QJ 5CMZA 4PV1C 2G3AA 2AEFA 3CWBD 1ZN5A 3WUUA 1EC5A 2QSIA 3G4SP 1PGJA 3PLNA 1SQXE 1FZCC 2YMYA 3E1RA 4H13C 4HYTB 1RF0C 3QH9A 4ZNCA 1OIPA 5AVQB 5AW6B 3L74E 1IFJA 2FFDA 2ZVOB 4Y28J 5AW0B 1J2JB 2K9JA 2QG4A 2O1JA 2H89C 5AW8B 3QWOC 1LGHB 3L73G 2GUVA 1BDCA 2JJLA 4M3LA 3N7NA 1KQFB 5M1BA 1BE3J 2XU6A 1HBWA 1KZUB 4IL6E 1LT9A 1YITP 2NZ2A 1JTHA 3ITKA 4B86A 1H89A 2RKLA 2Z4EA 2JEEA 3V4WA 1NTMJ 2NPSC 2WSCH 1OVRA 5CJ4A 1N7SC 1M7LA 5B66H 2P1JA 1GZLA 3PJSK 3L70G 2WSSH 1JB0J 1G1JA 1SQXK 2W8ZA 3H1LE 1BSHA 2B9BA 5K5GB 3KYQA 3HTKB 3U1CA 4D6TE 1YQ4C 3HUSC 1RE3A 3WUTA 1M1JB 2GM4A 2E43A 3BVHA 1BCCJ 3V5BA 3FGAD 1HJ0A 3L70J 2N9BA 3CL3D 1SQXG 4HH2A 1JUNA 4CPGA 1KB9H 1VQNP 1IK7A 1JY2N 2YXQB 3L74G 3L37A 1PIXA 1ZV8A 2LKMA 1FDMA 3VMXA 3H1ID 3L72E 2O1KA 5CCHA 1KV4A 1SQVJ 5KAIH 1KYOE 3L75J 2YMKA 1S1CX 1OVUA 1LJ2A 4OGQC 3NXSA 1Q86Q 4R4MA 2WT7B 3AEEC 1CI6A 2IYOA 1GU5A 1QVFO 1H8AA 4HKZH 5AW2B 1VQPP 1AQ5A 4C7NA 3HD7D 1KQGB 1DD3A 1L4AD 2QJYC 1LTJC 3PH0A 5CHXA 1KILD 1SVFA 1T6AA 2XNXA 1MZ9A 4ASWA 1L0ND 1T3JA 2E74C 2Z5HA 1N73C 1T2KD 3H1JE 5APXA 1KD1Q 4GOEA 3B5NA 3EQ2A 1HGZA 1L0LD 2P67A 1M56D 5H2FE 4WY4C 2FXMA 3BCCJ 3AECC 4JBZA 5KAFE 1S3JA 3CCEP 1YQ3C 4D6TG 1J1DB 1L0NE 3N4XA 3O6QA 1PV3A 3C1LA 1YJWP 4N78D 4WB4A 1NKNA 3CX5H 2M3BA 3VP8A 4GIFA 2KZIA 1Q2NA 3EWKA 1FBMA 1USDA 3H1LJ 3CPWO 3CXHE 2FYUJ 3IAOA 2BCCJ 1KQSO 2Q7CA 2KYVA 2QJKB 2WPQA 4RO0A 3P8MC 1GL2A 1BGYE 4U7JA 3KZIH 4N78E 2L91A 2I8DA 3OJAB 4YXWH 2QEXP 2C0XA 3A2AA 1ZRTD 3WU2E 2CPSA 1JNMA 3NFQA 1Y8AA 1YI2P 2E76C 3B71A 5BU8B 2OQQA 3L72J 2Q6QA 3I56P 4HB1A 1YTZI 1FS0E 1OMIA 2AXTH 2DW3A 4AQRD 1ZRTE 4PD4D 4W7ZA 1BDDA 1ZLLA 3VN0A 1L4AB 3C8VA 1M1KQ 3RK2D 2FXPA 1L0NK 3FXEA 1KILB 3FXDA 3TK1A 4GT1A 4I2LC 3H1JG 1EDLA 1S72P 2C0WA 3AE8C 1J1EB 2XV5A 4PD4E 4BRYA 5EFWB 3RK3D 4Y99B 2KIKA 2Q1KA 5APYA 1YJNP 1M90Q 5CCHD 1QVGO 4H44D 1L0NG 2J59M 2FFDB 2KP8A 3CCRP 3AE3C 1R8EA 3Q3DA 2O01J 4H0LD 1M57D 1SQQE 1NTZD 4PD4I 2Q3EA 1HWTC 1GW4A 3RK3E 2K9JB 1IK9A 4N3YB 5B5EH 1JEKA 4R4LA 1BGYG 2YKQA 2FXOA 1KN7A 1VQ5P 1U7MA 1KMIZ 2Y0CA 2KS1A 3H32A 4I7ZC 1IZNB 3CMAP 3NMDA 3GG2A 1JTHB 1E79H 1OX3A 2WTYA 2QM8A 1RF0A 3F89A 3AE4C 3B5ND 1BE3D 2JWDA 1FDOA 1DD4A 2Q3IA 2KK7A 2KNCA 1EQ7A 4PJ0E 2R5BA 2KLVA 1NTMD 1OVVA 5AVSB 1EXIA 3RK2B 3M9HA 1S5LH 3KHUA 1SQQK 4DCKA 2JP3A 1ZW0A 3TF5A 1R5LA 1IFDA 2OYHC 2E75D 2NPSA 2HFED 1VQ7P 3RK3B 1NTME 3GMAA 1N7SA 4H44B 3A7OA 1N8RQ 2FY8A 1SQQG 4RESB 3JCUH 3L70D 4JF7A 4H0LB 4K35A 4YXDC 3Q2YA 5KKZB 1XTCC 5AW3B 1M1JC 1CI6B 5GTHE 1PP9J 3M0DC 1FOSF 3Q5PA 4XFJA 4C7NB 4HJGH 1GW3A 2KUBA 1URQC 1SP4A 1BCCE 1A02J 1SQXD 5AVUB 1SQVD 2KXPB 5KLVJ 3Q5RA 3HD7A 2XZRA 1L4AA 1QLED 3V2PA 2HG5D 1VF5C 3V4QA 1HH0A 3VMAA 5C39A 2E42A 3B5NB 3RL0D 2R3CA 1SQVE 3L75E 1FE6A 2WITA 3D70A 2JR8A 3O6QB 4UB8E 1NTMK 2JWAA 2WVRA 1BE3G 1UIXA 4AUWA 5AVVB 4MN4C 3WMM0 2FYZA 3AEBC 3MTUE 1LTJA 5BVZA 3A0HE 1YJ9P 1HGVA 1KFNA 2K9YA 4PV1D 4GKGA 1RE4C 4DJGA 2ZXXA 1GL2B 1RY3A 1JMBA 1SFCC 1D7MA 1NOHA 3AE7C 1NTMG 3BCCD 1N73A 1JY3P 3GF7A 1NU1J 2I1JA 5TISE 1JMMA 1VPCA 1YTZT 4H13D 1IO4A 2YNYA 2IX7C 1VQ6P 2YKOA 2QIWA 4WY4A 3KDPB 2MKVA 1VQLP 3H1LD 2BEZF 3RBZA 3G9RA 2BASA 3BCCE 2KSEA 4D6TD 3U1AA 2B88A 3VP9A 1KQLA 2ZXEB 2M5AA 3FWNA 1BCCG 1QL1A 1SQVK 2PP6A 1ZXGA 2FYUE 5CJ0A 2IBZD 2BEQD 2BCCE 2WPSA 3MUDA 2YO3A 1S9KD 1OWAA 3A0BE 1OW7A 3GHGA 3L72D 1Q90D 1GK4A 4ZKPA 3S4RA 3TGUE 1Z56A 1IJDB 2NPSD 3TYYA 4BRYB 4C46A 2WSEH 1KORA 3KQGA 3I5CA 1KYOD 1SQVG 2I1KA 3L75G 5APWA 3AE2C 2IZ0A 2YXRB 3V2QA 2IBZE 1N7SD 3RL0B 3M9BA 3SFEC 2C9LY 3EFGA 2ZYGA 3L71J 5CCGC 1S9KE 3GLMA 2CK3H 1FZAA 2H43A 2K3RA 1K73Q 5AW7B 1MUUA 1AJYA 1P84H 1NWQA 2VRSA 3H25A 3G3ZA 1FOSE 4GOFA 1FZFA 2IBZI 2QVAA 2OYIC 1S4XA 1JY3N 4PV1B 5E79H 2KS1B 3H32B 1J1EC 1IFMA 2XNDH 3H1JD 3BASA 5GTIE 2KOGA 2CPBA 1A02F 1KYOI 5KAFH 1FZCB 2B87A 3CCUP 2P7JA 4H13B 1NKZB 2FYUK 4ZKUA 2FFDC 1JY3O 3BCCG 1KB9E 2R5DA 3CCLP 4EIJA 4EYYQ 4OGQD 3G6EP 2Y9ZA 1LP1A 3CXHD 3H1LG 2KNCB 2FYUG 5DJTB 1PGPA 2W6BA 2BCCG 3KXDA 2JDIH 2OTJP 4WVZA 2ZJSE 2W27A 1BGYD 1T3UA 1LT9C 3W68A 4LLHA 5KLIC 1VL2A 1L2PA 3TGUG 3AE6C 3TNUA 3HE4A 3V6IA 1NAYA 1FU1A 4U3FJ 4KT0J 2E74D 1DX7A 4TT3H 1FAVA 2IBZG 2NPSB 2IZ1A 3V2RA 1EZVE 3IN6A 1NVOA 3L72G 1N7SB 4W80A 1G2CA 3TGUJ 5KJ7C 4WY4D 1LWUA 2PAJA 2ZT9D 1EDKA 3CXHI 1OW8A 2LXCB 4KJMA 4NPFX 1QX8A 2P58A 2WSCJ 1RE3C 1U7JA 1KC8Q 3RK2C 1RF1C 1OXZA 2JO1A 5AVXB 4PD4H 3GF3A 3M9QA 1SQBJ 2OYHA 2KB7P 2QM7A 3HD7B 3AEAC 5KTBA 2O3JA 3KZIE 1FDIA 2W6AA 1N2DC 4JQ0D 2WSEJ 1PP9D 2E76D 1SQQD 3LW5H 3H1IJ 4OGQB 4Z1MH 2N1TC 2D2CC 2PGDA 2V7QH 5AW5B 5KLVD 2YIUC 1SQPJ 3M0DA 1VQ8P 2FYNB 5AW9B 1OZHA 1PP9E 4GDOA 2AXTE 3PP5A 2QJYB 1LTJB 2RH0A 3HE5A 1WRGA 1VQOP 5AVWB 3H1HJ 3CC7P 3CLQA 1EZVG 2HPCA 3MD0A 1FZEA 5KLVE 2E74B 4JYCA 4I6MC 2MJZA 1N73B 1JO5A 1K8AQ 3B5NC 1NHLA 2GA1A 3MHVA 2P2UA 1FJPA 3S9OA 1FZCA 4PJ0H 4WY4B 4NPEA 1PGQA 1NAFA 2ZT9B 4UB6H 1K04A 1MFZA 1MV8A 2AXCA 2RMZA 2A06E 1R5SA 2KZJA 1L0LJ 4OVNF 3E7KA 1LTGC 3MIWA 1GTWA 2M5AB 1NU1D 2POHA 3CCJP 2OARA 1GL2C 1RE4A 4DT0A 5B5EE 3SSUA 1SFCA 2XDJA 3BATA 1GMJA 4ASVA 2W6JH 3RL0g 3SFDC 3GHGB 1JCDA 2IFNA 1NU1E 4YTPC 2M3EA 5APUA 3E1IA 3RBXA 3FX0A 4OWFA 4DOJA 2E76B 2RN0A 5GTHH 5KLVK 2ITAA 1NYHA 2WQYC 2W83C 4RJTA 1PP9G 1LNQA 2WWWA 2A45I 1KTMA 1BCCD 1GD2E 1OW6A 5KLVG 3SWYA 2Y9YA 3HUSA 1HTLC 1NGMB 1NO4A 2WSFH 1IFIA 2AEMA 3L71D 2P10A 5AW1B 2OYOA 3F5HA 1S5LE 1W2EA 2WPVB 1JCCA 3VYIA 4WBAA 2B87B 4K3AA 1CZQA 3L75D 2A06G 1NTKJ 5CCGA 2R3SA 3H1KJ 3D6YA 3ZDMA 3L71E 3VMZA 1NU1K 1RH5B 3Q1MA 1LP1B 2YO2A 3AEDC 3C9IA 3JCUE 3M91A 1DEEG 2OYIA 4IL6H 1NTZJ 2QE7H 4EOTA 5TISH 1LTIC 2PFXA 3OW2O 1X22A 1URQD 2KSJA 1FZGA 4I7ZB 2HODA 1WT6A 1YIJP 1NU1G 3TNUB 3HE4B 1BSNA 3B4SA 2FKWB 4ZMDA 2LR2A 2A45G 1VF5D 2QJPB 3VMYA 1JY2P 2H88C 2LXBA 1X8YA 3CWBE 5APSA 2QRXA 2E75B 3S1KA 1EDIA 1G2CB 1QL2A 4JPZB 1LWUB 1FC2C 4QMAA 1YYCA 1HUCA 2ZFCA 3BRTB 5CBNA 1J1DC 1Y9BA 3JSVC 4U3FD 3A0BH 2FYUD 2BCCD 1G1IA 5BU5A 2L5GB 1AVOA 1ZMEC 1USEA 5DJUB 2H7HA 3K5BA 4JYBA 3D71A 1AFOA 2Y0DA 3NTNA 3TGUD 3L73J 1SFCD 1PPJD 2E5YA 2E5TA 2OYHB 2QJKC 1HVVA 4U3FE 3T97A 3P32A 1LT1A 3CC2P 3L71G 1KYOH 3AEFC 5KJ7A 3SWFA 4AYCA 3PHLA 5APTA 1PPJE 1VQKP 3CC4P 2O01N 1SLQA 1W2BO 2M8RA 1IC2A 1SQBD 1RF1A 5GTIH 3AE1C 1FJKA 3SWKA 2ZVNB 5B66E 1WMKA 1URQB 2H8PD 1ZR4A 3HD7C 2V4HA 3KPEA 1L4AC 3TSIA 3HE5B 3IF4A 1MKMA 4L73A 1SQBE 4O9BA 2HPCB 1KILC 3CWBG 1H0TB 1DIPA 1PGOA 1VF5B 2ZYAA 1KB9D 1YHQP 2WSFJ 1X79B 3AE5C 3VTPC 1SQXJ 2O01H 2HYNA 5H2FH 1IFNA 1T2KC 3BRVB 4Y99C 3A3YB 1SQPD 2Q9IA 1P84D 1N86A 1JY2O 3L74J 5CCGD 3CWBJ 2WMMA 2N1TA 3H1IE 4BWNA 2HR3A 1MFTA 1LTBC 3H1HD 2FYNC 1W5CE 1E5WA 3CXHH 3L36A 1SQPE 2JKVA 1P84E 2AEJA 4TLFA 1KFMA 1Q81Q 5KAIE 2G8YA 2OGUA 4XE5B 4U3FG 1LTAC 1SFCB 1LTTC 1KB9I 1EZVD 3H1HE 2WZ7A 1ZOYC 3A5TA 3L35A 4GODA 2WPRA 1M8OB 5E79E 3CMEP 3WU2H 1KILE 2Q5UA 1P84I 1VQMP 1PPJG 3TDKA 2ZT9C 3PTZA 5AVYB 3GW6A 3OA7A 1SQBK 2M0BA 1U57A 5APVA 4N6JA 4I1LA 1RHZB 1L0LE 2Z5IA 5AVRB 3CX5D 4LC1A 3FWLA 4L75A 4D6TJ 1Y47A 1SQBG 3MUDC 1EZVI 1EXJA 3R2PA 1AA0A 3V2NA 2OTLP 3GHGC 3HUSB 5TJHA 3VOPA 2IYPA 3U59A 4IOIH 1GDTA 5L8RJ 1NJIQ 3CX5E 1SQPK 1Q7YQ 3MZWB 3EFFK 3CCVP 3H6PA 3CCQP 3H1IG 3RK3C
chains in the Genus database with same CATH topology
5KJ7D 1XTGB 3OAKA 3HRNA 3GHGB 1JCDA 1LTJA 3NXSA 5CCHC 5BVZA 2WT7B 1NH4A 1CI6A 2IFNA 1HGVA 1KFNA 4GKGA 1RE4C 1GU5A 5APUA 1H8AA 3E1IA 1GL2B 1RY3A 1SFCC 1NOHA 3II6A 5AW2B 4DOJA 5AVZB 1AQ5A 4OH8B 4C7NA 3HD7D 1L4AD 1N73A 1JY3P 3M0AA 2I1JA 5KLVK 1LTJC 1JMMA 3P8CD 5CHXA 1VPCA 1KILD 3HTKA 1YTZT 1IO4A 1SVFA 4W7YA 2OYIB 1GK6A 2YNYA 2IX7C 1M1JA 2YKOA 4WY4A 3KDPB 2XNXA 1MZ9A 1T3JA 2Z5HA 2HODB 1L0LK 2WWWA 1N73C 2A45I 1T2KD 2BASA 4IFMA 1GD2E 5APXA 1CSBA 1URQA 3B5NA 3U1AA 3EQ2A 1HGZA 3SWYA 3VP9A 2P67A 3LIDA 3P8CE 1KQLA 3HUSA 2ZXEB 4WY4C 1HTLC 2FXMA 2R32A 1NO4A 1QL1A 2WSFH 1IFIA 1DH3A 1H88A 5AW1B 1VDFA 1SQVK 1J1DB 3N4XA 1W2EA 2PP6A 1JCCA 5CJ0A 2GUSA 3VYIA 4N78D 2C9NY 4WBAA 4WB4A 2WPSA 1X9VA 1NKNA 3MUDA 2M3BA 3VP8A 4GIFA 2N1TD 1CZQA 2YO3A 1S9KD 1FBMA 1OWAA 1N7LA 3GHGA 5CCGA 1HJBA 2WT7A 1GK4A 4ZKPA 1Z56A 1IJDB 2NPSD 2Q7CA 3TYYA 4C46A 2WSEH 2KYVA 2WPQA 3VMZA 3KQGA 5AW4B 3I5CA 3P8MC 1GL2A 1LT9B 3LIEA 2I1KA 5APWA 1NU1K 1T8ZA 3V2QA 3RL0B 1N7SD 4N78E 3M9BA 2YO2A 3OJAB 2C9LY 3EFGA 3C9IA 2A45H 5APQA 1GU4A 5CCGC 4LGDE 1S9KE 2C0XA 3B8EB 3M91A 1LTSC 2OYIA 1FZAA 3A2AA 4EOTA 2H43A 1LTIC 2CPSA 5AW7B 1MUUA 1JNMA 3NFQA 1URQD 2KSJA 1FZGA 1NWQA 2VRSA 2HODA 1WT6A 3G3ZA 1FOSE 5BU8B 1FZFA 1LWUC 1PFIA 3TNUB 3HE4B 2FKWB 1YTZI 2A45G 2OYIC 3M06A 1JY3N 3VMYA 1JY2P 3H32B 4AQRD 3L4FA 1J1EC 1IFMA 1X8YA 4W7ZA 4XA4A 1DEBA 3UIAA 3IR9A 5APSA 1ZLLA 3BASA 3VN0A 2KOGA 2CPBA 1G2CB 1L4AB 1QL2A 1A02F 2YKPA 1FZCB 3RK2D 3O8ZA 1RF1B 1LWUB 1L0NK 1ZR2A 1NTKK 1KILB 2P7JA 1YYCA 1NKZB 1FZBA 2FYUK 4ZKUA 1HUCA 2ZFCA 3TK1A 4GT1A 2FFDC 4KHXA 1JY3O 4I2LC 1GL2D 2XKMA 3BRTB 2C0WA 2R5DA 1J1DC 1J1EB 2IPPA 2XV5A 4EIJA 3RK3D 4Y99B 1G1IA 5BU5A 2L5GB 5APYA 5CCHD 2H7HA 2J58A 4JYBA 4IFDK 3P7KA 1AFOA 2J59M 1NTZK 3NTNA 2FFDB 5AVTB 1SFCD 2KP8A 1CW5A 2W6BA 4DZOA 2OYHB 1JOCA 1HVVA 2W27A 1T3UA 1LT9C 3T97A 3CI9A 4LLHA 1GW4A 1HWTC 3P32A 3RL0C 1IK9A 3IFMA 4N3YB 4C7RA 2N1TB 3TNUA 3HE4A 1FU1A 5KJ7A 2YKQA 3SWFA 4AYCA 1DX7A 5APTA 2IFMA 1FAVA 2NPSB 3V2RA 3H32A 1SLQA 2HLOA 3NMDA 1JTHB 3MGNA 1N7SB 2M8RA 1G2CA 1IC2A 4W80A 4IFFA 5KJ7C 4WY4D 1RF1A 1LWUA 2PAJA 2WTYA 1KILA 2QM8A 1RF0A 1FJKA 5CMZA 1URQB 1ZN5A 3B5ND 2H8PD 1ZR4A 3HD7C 1RE3C 3KPEA 1L4AC 3TSIA 3HE5B 1FZCC 2YMYA 3RK2C 1RF1C 1OXZA 4O9BA 2HPCB 5AVXB 1KILC 4HYTB 1RF0C 5AVQB 5AW6B 2Q3IA 1X79B 1EQ7A 1IFJA 3VTPC 2FFDA 3M9QA 2O01H 2HYNA 2OYHA 1IFNA 1T2KC 3BRVB 2KB7P 2QM7A 5AW0B 4Y99C 2R5BA 3HD7B 2KLVA 3A3YB 2Q9IA 5AVSB 1N86A 1JY2O 5CCGD 3RK2B 1J2JB 3M9HA 2O1JA 5KTBA 1SQQK 2N1TA 5AW8B 2W6AA 1N2DC 1LGHB 2GUVA 2JJLA 4M3LA 1IFDA 1LTBC 3N7NA 2OYHC 2XU6A 2NPSA 1HBWA 1KZUB 2HFED 3LW5H 1E5WA 3L36A 1LT9A 3RK3B 1JTHA 1KFMA 2N1TC 1N7SA 4B86A 4XE5B 3A7OA 1H89A 5AW5B 4RESB 1LTAC 2Z4EA 2JEEA 1SFCB 1LTTC 3V4WA 3M0DA 2NPSC 2WZ7A 5AW9B 4JF7A 2WSCH 3A5TA 3L35A 2WPRA 3PP5A 1LTJB 5CJ4A 1N7SC 1M7LA 1XTCC 5AW3B 3HE5A 1M1JC 1CI6B 1WRGA 2Q5UA 5AVWB 2P1JA 1GZLA 3CLQA 2HPCA 3MD0A 1G1JA 1FZEA 1SQXK 3M0DC 5AVYB 1FOSF 3OA7A 4JYCA 4C7NB 4I6MC 1SQBK 1GW3A 2MJZA 1N73B 5APVA 4N6JA 1URQC 1SP4A 1JO5A 3B5NC 1NHLA 3KYQA 1A02J 3HTKB 3U1CA 5AVUB 2P2UA 4I1LA 3HUSC 3HD7A 1RE3A 2XZRA 1L4AA 1FJPA 1M1JB 2GM4A 2Z5IA 1FZCA 3V2PA 2HG5D 2E43A 4WY4B 3BVHA 5AVRB 1NAFA 3V5BA 3V4QA 2N9BA 1HH0A 4LC1A 1MFZA 3CL3D 1MV8A 2E42A 3B5NB 4HH2A 3RL0D 1JUNA 3R2PA 3V2NA 2R3CA 1JY2N 1LTGC 3GHGC 3HUSB 3MIWA 1GTWA 3L37A 1ZV8A 2LKMA 2WITA 3VOPA 1FDMA 3VMXA 2POHA 3U59A 2O1KA 5CCHA 1GDTA 2OARA 1SQPK 1GL2C 1NTMK 1RE4A 1SFCA 2XDJA 3BATA 4AUWA 5AVVB 3WMM0 3H6PA 2FYZA 3MTUE 3RK3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUS C;  3GHG C;  3HUS B;  1RE3 A;  2A45 H;  3GHG B;  1LTJ A;  1M1J C;  1M1J B;  1RF1 A;  2HPC B;  1LWU A;  1FZC A;  2OYI B;  2A45 G;  2OYI C;  1RF0 C;  3HUS A;  3GHG A;  1FZB A;  1JY3 N;  1M1J A;  3BVH A;  2HPC A;  2FFD C;  2OYI A;  1JY3 O;  1FZA A;  1RF0 A;  1RE4 C;  2FFD B;  2Z4E A;  1FZE A;  2XNX A;  2H43 A;  1JY2 P;  3E1I A;  3H32 B;  1RE4 A;  2FFD A;  2HOD B;  2OYH B;  1FZG A;  2OYH C;  1N73 B;  1W2E A;  3H32 A;  1N73 C;  1LT9 B;  1T3U A;  2A45 I;  1LT9 C;  2HOD A;  1N86 A;  2OYH A;  1JY2 O;  2HLO A;  1N73 A;  1JY3 P;  1RE3 C;  1LT9 A;  1LTJ B;  2Q9I A;  1LTJ C;  1FZC B;  1FZF A;  1LWU C;  1FZC C;  1RF1 B;  1JY2 N;  1LWU B;  1RF1 C; 
#chains in the Genus database with same CATH topology
 1X0T A;  5KJ7 D;  1XTG B;  1QGK B;  3HRN A;  3OAK A;  1EDJ A;  5CCH C;  4H44 C;  1AQT A;  1NH4 A;  3CX5 I;  1SQP G;  3II6 A;  4A7P A;  2J5U A;  5AVZ B;  4OH8 B;  4H0L C;  3M0A A;  1AV1 A;  5CBO A;  5KKZ C;  3P8C D;  3HTK A;  2OYI B;  4W7Y A;  1GK6 A;  3H1H G;  1M1J A;  4YPC A;  2IDB A;  1NTK D;  2HOD B;  1L0L K;  3H1K D;  4EI2 A;  4IFM A;  1SS1 A;  1HF9 A;  1CSB A;  1URQ A;  2ZAE B;  1VQ4 P;  4WWI A;  3LID A;  3P8C E;  2R44 A;  1JM0 A;  2R32 A;  3H1J J;  2FBW C;  1DH3 A;  1H88 A;  1H0T A;  1VDF A;  1S5L X;  2A06 D;  1NTK E;  1L0L G;  3H1K E;  1AVY A;  2GUS A;  2C9N Y;  1QEX A;  1OFC X;  1X9V A;  2KI7 B;  2N1T D;  2D2C D;  1L0N J;  1N7L A;  1HJB A;  2WT7 A;  3I55 P;  1K9M Q;  5AW4 B;  1LT9 B;  3PRJ A;  3LIE A;  2K88 A;  2ZYD A;  1NTZ E;  1T8Z A;  2Y0E A;  5KLI B;  2A45 H;  5APQ A;  1GU4 A;  4LGD E;  3B8E B;  2QJP C;  1BGY J;  1LTS C;  1ZP0 C;  1RQU A;  3T97 B;  2E75 C;  1PZQ A;  3ABV C;  3RGU A;  1LWU C;  2KLU A;  1PFI A;  1Q82 Q;  3M06 A;  1PL5 A;  3D6Z A;  3L4F A;  3W67 A;  4XA4 A;  1DEB A;  3UIA A;  3IR9 A;  4EDF A;  3L73 D;  2PRR A;  4UB6 E;  2YKP A;  3O8Z A;  1RF1 B;  1RQV A;  1BE3 E;  2W90 A;  3AE9 C;  1NTK K;  1ZR2 A;  3JC2 2;  1FZB A;  3USS A;  3R4Y A;  4KHX A;  3WUV A;  1GL2 D;  2XKM A;  2IPP A;  4IL6 X;  2SPZ A;  4L74 A;  3L73 E;  3CCM P;  3CD6 P;  3Q5S A;  4RKU J;  2J58 A;  4IFD K;  3P7K A;  1NTK G;  1NTZ K;  2B89 A;  1TU3 F;  3H1K G;  5AVT B;  1CW5 A;  1K05 A;  4DZO A;  2UWJ E;  1JOC A;  1UII A;  3AEG C;  4BXL A;  3CI9 A;  2K1A A;  2N9Y B;  3RL0 C;  3G71 P;  4UB8 H;  2NRG A;  1S2E A;  3IFM A;  4C7R A;  2N1T B;  2QA4 P;  2D2C B;  2OTK E;  1SQQ J;  2YIU B;  1NTZ G;  4NPD A;  2IFM A;  1VQ9 P;  4L76 A;  1YBK A;  3L70 E;  3A0H H;  2HLO A;  3MP7 B;  3LW5 J;  3MGN A;  2K37 A;  4IFF A;  1IFP A;  1KIL A;  3L74 D;  3CCS P;  2V7Q J;  5CMZ A;  4PV1 C;  2G3A A;  2AEF A;  3CWB D;  1ZN5 A;  3WUU A;  1EC5 A;  2QSI A;  3G4S P;  1PGJ A;  3PLN A;  1SQX E;  1FZC C;  2YMY A;  3E1R A;  4H13 C;  4HYT B;  1RF0 C;  3QH9 A;  4ZNC A;  1OIP A;  5AVQ B;  5AW6 B;  3L74 E;  1IFJ A;  2FFD A;  2ZVO B;  4Y28 J;  5AW0 B;  1J2J B;  2K9J A;  2QG4 A;  2O1J A;  2H89 C;  5AW8 B;  3QWO C;  1LGH B;  3L73 G;  2GUV A;  1BDC A;  2JJL A;  4M3L A;  3N7N A;  1KQF B;  5M1B A;  1BE3 J;  2XU6 A;  1HBW A;  1KZU B;  4IL6 E;  1LT9 A;  1YIT P;  2NZ2 A;  1JTH A;  3ITK A;  4B86 A;  1H89 A;  2RKL A;  2Z4E A;  2JEE A;  3V4W A;  1NTM J;  2NPS C;  2WSC H;  1OVR A;  5CJ4 A;  1N7S C;  1M7L A;  5B66 H;  2P1J A;  1GZL A;  3PJS K;  3L70 G;  2WSS H;  1JB0 J;  1G1J A;  1SQX K;  2W8Z A;  3H1L E;  1BSH A;  2B9B A;  5K5G B;  3KYQ A;  3HTK B;  3U1C A;  4D6T E;  1YQ4 C;  3HUS C;  1RE3 A;  3WUT A;  1M1J B;  2GM4 A;  2E43 A;  3BVH A;  1BCC J;  3V5B A;  3FGA D;  1HJ0 A;  3L70 J;  2N9B A;  3CL3 D;  1SQX G;  4HH2 A;  1JUN A;  4CPG A;  1KB9 H;  1VQN P;  1IK7 A;  1JY2 N;  2YXQ B;  3L74 G;  3L37 A;  1PIX A;  1ZV8 A;  2LKM A;  1FDM A;  3VMX A;  3H1I D;  3L72 E;  2O1K A;  5CCH A;  1KV4 A;  1SQV J;  5KAI H;  1KYO E;  3L75 J;  2YMK A;  1S1C X;  1OVU A;  1LJ2 A;  4OGQ C;  3NXS A;  1Q86 Q;  4R4M A;  2WT7 B;  3AEE C;  1CI6 A;  2IYO A;  1GU5 A;  1QVF O;  1H8A A;  4HKZ H;  5AW2 B;  1VQP P;  1AQ5 A;  4C7N A;  3HD7 D;  1KQG B;  1DD3 A;  1L4A D;  2QJY C;  1LTJ C;  3PH0 A;  5CHX A;  1KIL D;  1SVF A;  1T6A A;  2XNX A;  1MZ9 A;  4ASW A;  1L0N D;  1T3J A;  2E74 C;  2Z5H A;  1N73 C;  1T2K D;  3H1J E;  5APX A;  1KD1 Q;  4GOE A;  3B5N A;  3EQ2 A;  1HGZ A;  1L0L D;  2P67 A;  1M56 D;  5H2F E;  4WY4 C;  2FXM A;  3BCC J;  3AEC C;  4JBZ A;  5KAF E;  1S3J A;  3CCE P;  1YQ3 C;  4D6T G;  1J1D B;  1L0N E;  3N4X A;  3O6Q A;  1PV3 A;  3C1L A;  1YJW P;  4N78 D;  4WB4 A;  1NKN A;  3CX5 H;  2M3B A;  3VP8 A;  4GIF A;  2KZI A;  1Q2N A;  3EWK A;  1FBM A;  1USD A;  3H1L J;  3CPW O;  3CXH E;  2FYU J;  3IAO A;  2BCC J;  1KQS O;  2Q7C A;  2KYV A;  2QJK B;  2WPQ A;  4RO0 A;  3P8M C;  1GL2 A;  1BGY E;  4U7J A;  3KZI H;  4N78 E;  2L91 A;  2I8D A;  3OJA B;  4YXW H;  2QEX P;  2C0X A;  3A2A A;  1ZRT D;  3WU2 E;  2CPS A;  1JNM A;  3NFQ A;  1Y8A A;  1YI2 P;  2E76 C;  3B71 A;  5BU8 B;  2OQQ A;  3L72 J;  2Q6Q A;  3I56 P;  4HB1 A;  1YTZ I;  1FS0 E;  1OMI A;  2AXT H;  2DW3 A;  4AQR D;  1ZRT E;  4PD4 D;  4W7Z A;  1BDD A;  1ZLL A;  3VN0 A;  1L4A B;  3C8V A;  1M1K Q;  3RK2 D;  2FXP A;  1L0N K;  3FXE A;  1KIL B;  3FXD A;  3TK1 A;  4GT1 A;  4I2L C;  3H1J G;  1EDL A;  1S72 P;  2C0W A;  3AE8 C;  1J1E B;  2XV5 A;  4PD4 E;  4BRY A;  5EFW B;  3RK3 D;  4Y99 B;  2KIK A;  2Q1K A;  5APY A;  1YJN P;  1M90 Q;  5CCH D;  1QVG O;  4H44 D;  1L0N G;  2J59 M;  2FFD B;  2KP8 A;  3CCR P;  3AE3 C;  1R8E A;  3Q3D A;  2O01 J;  4H0L D;  1M57 D;  1SQQ E;  1NTZ D;  4PD4 I;  2Q3E A;  1HWT C;  1GW4 A;  3RK3 E;  2K9J B;  1IK9 A;  4N3Y B;  5B5E H;  1JEK A;  4R4L A;  1BGY G;  2YKQ A;  2FXO A;  1KN7 A;  1VQ5 P;  1U7M A;  1KMI Z;  2Y0C A;  2KS1 A;  3H32 A;  4I7Z C;  1IZN B;  3CMA P;  3NMD A;  3GG2 A;  1JTH B;  1E79 H;  1OX3 A;  2WTY A;  2QM8 A;  1RF0 A;  3F89 A;  3AE4 C;  3B5N D;  1BE3 D;  2JWD A;  1FDO A;  1DD4 A;  2Q3I A;  2KK7 A;  2KNC A;  1EQ7 A;  4PJ0 E;  2R5B A;  2KLV A;  1NTM D;  1OVV A;  5AVS B;  1EXI A;  3RK2 B;  3M9H A;  1S5L H;  3KHU A;  1SQQ K;  4DCK A;  2JP3 A;  1ZW0 A;  3TF5 A;  1R5L A;  1IFD A;  2OYH C;  2E75 D;  2NPS A;  2HFE D;  1VQ7 P;  3RK3 B;  1NTM E;  3GMA A;  1N7S A;  4H44 B;  3A7O A;  1N8R Q;  2FY8 A;  1SQQ G;  4RES B;  3JCU H;  3L70 D;  4JF7 A;  4H0L B;  4K35 A;  4YXD C;  3Q2Y A;  5KKZ B;  1XTC C;  5AW3 B;  1M1J C;  1CI6 B;  5GTH E;  1PP9 J;  3M0D C;  1FOS F;  3Q5P A;  4XFJ A;  4C7N B;  4HJG H;  1GW3 A;  2KUB A;  1URQ C;  1SP4 A;  1BCC E;  1A02 J;  1SQX D;  5AVU B;  1SQV D;  2KXP B;  5KLV J;  3Q5R A;  3HD7 A;  2XZR A;  1L4A A;  1QLE D;  3V2P A;  2HG5 D;  1VF5 C;  3V4Q A;  1HH0 A;  3VMA A;  5C39 A;  2E42 A;  3B5N B;  3RL0 D;  2R3C A;  1SQV E;  3L75 E;  1FE6 A;  2WIT A;  3D70 A;  2JR8 A;  3O6Q B;  4UB8 E;  1NTM K;  2JWA A;  2WVR A;  1BE3 G;  1UIX A;  4AUW A;  5AVV B;  4MN4 C;  3WMM 0;  2FYZ A;  3AEB C;  3MTU E;  1LTJ A;  5BVZ A;  3A0H E;  1YJ9 P;  1HGV A;  1KFN A;  2K9Y A;  4PV1 D;  4GKG A;  1RE4 C;  4DJG A;  2ZXX A;  1GL2 B;  1RY3 A;  1JMB A;  1SFC C;  1D7M A;  1NOH A;  3AE7 C;  1NTM G;  3BCC D;  1N73 A;  1JY3 P;  3GF7 A;  1NU1 J;  2I1J A;  5TIS E;  1JMM A;  1VPC A;  1YTZ T;  4H13 D;  1IO4 A;  2YNY A;  2IX7 C;  1VQ6 P;  2YKO A;  2QIW A;  4WY4 A;  3KDP B;  2MKV A;  1VQL P;  3H1L D;  2BEZ F;  3RBZ A;  3G9R A;  2BAS A;  3BCC E;  2KSE A;  4D6T D;  3U1A A;  2B88 A;  3VP9 A;  1KQL A;  2ZXE B;  2M5A A;  3FWN A;  1BCC G;  1QL1 A;  1SQV K;  2PP6 A;  1ZXG A;  2FYU E;  5CJ0 A;  2IBZ D;  2BEQ D;  2BCC E;  2WPS A;  3MUD A;  2YO3 A;  1S9K D;  1OWA A;  3A0B E;  1OW7 A;  3GHG A;  3L72 D;  1Q90 D;  1GK4 A;  4ZKP A;  3S4R A;  3TGU E;  1Z56 A;  1IJD B;  2NPS D;  3TYY A;  4BRY B;  4C46 A;  2WSE H;  1KOR A;  3KQG A;  3I5C A;  1KYO D;  1SQV G;  2I1K A;  3L75 G;  5APW A;  3AE2 C;  2IZ0 A;  2YXR B;  3V2Q A;  2IBZ E;  1N7S D;  3RL0 B;  3M9B A;  3SFE C;  2C9L Y;  3EFG A;  2ZYG A;  3L71 J;  5CCG C;  1S9K E;  3GLM A;  2CK3 H;  1FZA A;  2H43 A;  2K3R A;  1K73 Q;  5AW7 B;  1MUU A;  1AJY A;  1P84 H;  1NWQ A;  2VRS A;  3H25 A;  3G3Z A;  1FOS E;  4GOF A;  1FZF A;  2IBZ I;  2QVA A;  2OYI C;  1S4X A;  1JY3 N;  4PV1 B;  5E79 H;  2KS1 B;  3H32 B;  1J1E C;  1IFM A;  2XND H;  3H1J D;  3BAS A;  5GTI E;  2KOG A;  2CPB A;  1A02 F;  1KYO I;  5KAF H;  1FZC B;  2B87 A;  3CCU P;  2P7J A;  4H13 B;  1NKZ B;  2FYU K;  4ZKU A;  2FFD C;  1JY3 O;  3BCC G;  1KB9 E;  2R5D A;  3CCL P;  4EIJ A;  4EYY Q;  4OGQ D;  3G6E P;  2Y9Z A;  1LP1 A;  3CXH D;  3H1L G;  2KNC B;  2FYU G;  5DJT B;  1PGP A;  2W6B A;  2BCC G;  3KXD A;  2JDI H;  2OTJ P;  4WVZ A;  2ZJS E;  2W27 A;  1BGY D;  1T3U A;  1LT9 C;  3W68 A;  4LLH A;  5KLI C;  1VL2 A;  1L2P A;  3TGU G;  3AE6 C;  3TNU A;  3HE4 A;  3V6I A;  1NAY A;  1FU1 A;  4U3F J;  4KT0 J;  2E74 D;  1DX7 A;  4TT3 H;  1FAV A;  2IBZ G;  2NPS B;  2IZ1 A;  3V2R A;  1EZV E;  3IN6 A;  1NVO A;  3L72 G;  1N7S B;  4W80 A;  1G2C A;  3TGU J;  5KJ7 C;  4WY4 D;  1LWU A;  2PAJ A;  2ZT9 D;  1EDK A;  3CXH I;  1OW8 A;  2LXC B;  4KJM A;  4NPF X;  1QX8 A;  2P58 A;  2WSC J;  1RE3 C;  1U7J A;  1KC8 Q;  3RK2 C;  1RF1 C;  1OXZ A;  2JO1 A;  5AVX B;  4PD4 H;  3GF3 A;  3M9Q A;  1SQB J;  2OYH A;  2KB7 P;  2QM7 A;  3HD7 B;  3AEA C;  5KTB A;  2O3J A;  3KZI E;  1FDI A;  2W6A A;  1N2D C;  4JQ0 D;  2WSE J;  1PP9 D;  2E76 D;  1SQQ D;  3LW5 H;  3H1I J;  4OGQ B;  4Z1M H;  2N1T C;  2D2C C;  2PGD A;  2V7Q H;  5AW5 B;  5KLV D;  2YIU C;  1SQP J;  3M0D A;  1VQ8 P;  2FYN B;  5AW9 B;  1OZH A;  1PP9 E;  4GDO A;  2AXT E;  3PP5 A;  2QJY B;  1LTJ B;  2RH0 A;  3HE5 A;  1WRG A;  1VQO P;  5AVW B;  3H1H J;  3CC7 P;  3CLQ A;  1EZV G;  2HPC A;  3MD0 A;  1FZE A;  5KLV E;  2E74 B;  4JYC A;  4I6M C;  2MJZ A;  1N73 B;  1JO5 A;  1K8A Q;  3B5N C;  1NHL A;  2GA1 A;  3MHV A;  2P2U A;  1FJP A;  3S9O A;  1FZC A;  4PJ0 H;  4WY4 B;  4NPE A;  1PGQ A;  1NAF A;  2ZT9 B;  4UB6 H;  1K04 A;  1MFZ A;  1MV8 A;  2AXC A;  2RMZ A;  2A06 E;  1R5S A;  2KZJ A;  1L0L J;  4OVN F;  3E7K A;  1LTG C;  3MIW A;  1GTW A;  2M5A B;  1NU1 D;  2POH A;  3CCJ P;  2OAR A;  1GL2 C;  1RE4 A;  4DT0 A;  5B5E E;  3SSU A;  1SFC A;  2XDJ A;  3BAT A;  1GMJ A;  4ASV A;  2W6J H;  3RL0 g;  3SFD C;  3GHG B;  1JCD A;  2IFN A;  1NU1 E;  4YTP C;  2M3E A;  5APU A;  3E1I A;  3RBX A;  3FX0 A;  4OWF A;  4DOJ A;  2E76 B;  2RN0 A;  5GTH H;  5KLV K;  2ITA A;  1NYH A;  2WQY C;  2W83 C;  4RJT A;  1PP9 G;  1LNQ A;  2WWW A;  2A45 I;  1KTM A;  1BCC D;  1GD2 E;  1OW6 A;  5KLV G;  3SWY A;  2Y9Y A;  3HUS A;  1HTL C;  1NGM B;  1NO4 A;  2WSF H;  1IFI A;  2AEM A;  3L71 D;  2P10 A;  5AW1 B;  2OYO A;  3F5H A;  1S5L E;  1W2E A;  2WPV B;  1JCC A;  3VYI A;  4WBA A;  2B87 B;  4K3A A;  1CZQ A;  3L75 D;  2A06 G;  1NTK J;  5CCG A;  2R3S A;  3H1K J;  3D6Y A;  3ZDM A;  3L71 E;  3VMZ A;  1NU1 K;  1RH5 B;  3Q1M A;  1LP1 B;  2YO2 A;  3AED C;  3C9I A;  3JCU E;  3M91 A;  1DEE G;  2OYI A;  4IL6 H;  1NTZ J;  2QE7 H;  4EOT A;  5TIS H;  1LTI C;  2PFX A;  3OW2 O;  1X22 A;  1URQ D;  2KSJ A;  1FZG A;  4I7Z B;  2HOD A;  1WT6 A;  1YIJ P;  1NU1 G;  3TNU B;  3HE4 B;  1BSN A;  3B4S A;  2FKW B;  4ZMD A;  2LR2 A;  2A45 G;  1VF5 D;  2QJP B;  3VMY A;  1JY2 P;  2H88 C;  2LXB A;  1X8Y A;  3CWB E;  5APS A;  2QRX A;  2E75 B;  3S1K A;  1EDI A;  1G2C B;  1QL2 A;  4JPZ B;  1LWU B;  1FC2 C;  4QMA A;  1YYC A;  1HUC A;  2ZFC A;  3BRT B;  5CBN A;  1J1D C;  1Y9B A;  3JSV C;  4U3F D;  3A0B H;  2FYU D;  2BCC D;  1G1I A;  5BU5 A;  2L5G B;  1AVO A;  1ZME C;  1USE A;  5DJU B;  2H7H A;  3K5B A;  4JYB A;  3D71 A;  1AFO A;  2Y0D A;  3NTN A;  3TGU D;  3L73 J;  1SFC D;  1PPJ D;  2E5Y A;  2E5T A;  2OYH B;  2QJK C;  1HVV A;  4U3F E;  3T97 A;  3P32 A;  1LT1 A;  3CC2 P;  3L71 G;  1KYO H;  3AEF C;  5KJ7 A;  3SWF A;  4AYC A;  3PHL A;  5APT A;  1PPJ E;  1VQK P;  3CC4 P;  2O01 N;  1SLQ A;  1W2B O;  2M8R A;  1IC2 A;  1SQB D;  1RF1 A;  5GTI H;  3AE1 C;  1FJK A;  3SWK A;  2ZVN B;  5B66 E;  1WMK A;  1URQ B;  2H8P D;  1ZR4 A;  3HD7 C;  2V4H A;  3KPE A;  1L4A C;  3TSI A;  3HE5 B;  3IF4 A;  1MKM A;  4L73 A;  1SQB E;  4O9B A;  2HPC B;  1KIL C;  3CWB G;  1H0T B;  1DIP A;  1PGO A;  1VF5 B;  2ZYA A;  1KB9 D;  1YHQ P;  2WSF J;  1X79 B;  3AE5 C;  3VTP C;  1SQX J;  2O01 H;  2HYN A;  5H2F H;  1IFN A;  1T2K C;  3BRV B;  4Y99 C;  3A3Y B;  1SQP D;  2Q9I A;  1P84 D;  1N86 A;  1JY2 O;  3L74 J;  5CCG D;  3CWB J;  2WMM A;  2N1T A;  3H1I E;  4BWN A;  2HR3 A;  1MFT A;  1LTB C;  3H1H D;  2FYN C;  1W5C E;  1E5W A;  3CXH H;  3L36 A;  1SQP E;  2JKV A;  1P84 E;  2AEJ A;  4TLF A;  1KFM A;  1Q81 Q;  5KAI E;  2G8Y A;  2OGU A;  4XE5 B;  4U3F G;  1LTA C;  1SFC B;  1LTT C;  1KB9 I;  1EZV D;  3H1H E;  2WZ7 A;  1ZOY C;  3A5T A;  3L35 A;  4GOD A;  2WPR A;  1M8O B;  5E79 E;  3CME P;  3WU2 H;  1KIL E;  2Q5U A;  1P84 I;  1VQM P;  1PPJ G;  3TDK A;  2ZT9 C;  3PTZ A;  5AVY B;  3GW6 A;  3OA7 A;  1SQB K;  2M0B A;  1U57 A;  5APV A;  4N6J A;  4I1L A;  1RHZ B;  1L0L E;  2Z5I A;  5AVR B;  3CX5 D;  4LC1 A;  3FWL A;  4L75 A;  4D6T J;  1Y47 A;  1SQB G;  3MUD C;  1EZV I;  1EXJ A;  3R2P A;  1AA0 A;  3V2N A;  2OTL P;  3GHG C;  3HUS B;  5TJH A;  3VOP A;  2IYP A;  3U59 A;  4IOI H;  1GDT A;  5L8R J;  1NJI Q;  3CX5 E;  1SQP K;  1Q7Y Q;  3MZW B;  3EFF K;  3CCV P;  3H6P A;  3CCQ P;  3H1I G;  3RK3 C; 
#chains in the Genus database with same CATH homology
 5KJ7 D;  1XTG B;  3OAK A;  3HRN A;  3GHG B;  1JCD A;  1LTJ A;  3NXS A;  5CCH C;  5BVZ A;  2WT7 B;  1NH4 A;  1CI6 A;  2IFN A;  1HGV A;  1KFN A;  4GKG A;  1RE4 C;  1GU5 A;  5APU A;  1H8A A;  3E1I A;  1GL2 B;  1RY3 A;  1SFC C;  1NOH A;  3II6 A;  5AW2 B;  4DOJ A;  5AVZ B;  1AQ5 A;  4OH8 B;  4C7N A;  3HD7 D;  1L4A D;  1N73 A;  1JY3 P;  3M0A A;  2I1J A;  5KLV K;  1LTJ C;  1JMM A;  3P8C D;  5CHX A;  1VPC A;  1KIL D;  3HTK A;  1YTZ T;  1IO4 A;  1SVF A;  4W7Y A;  2OYI B;  1GK6 A;  2YNY A;  2IX7 C;  1M1J A;  2YKO A;  4WY4 A;  3KDP B;  2XNX A;  1MZ9 A;  1T3J A;  2Z5H A;  2HOD B;  1L0L K;  2WWW A;  1N73 C;  2A45 I;  1T2K D;  2BAS A;  4IFM A;  1GD2 E;  5APX A;  1CSB A;  1URQ A;  3B5N A;  3U1A A;  3EQ2 A;  1HGZ A;  3SWY A;  3VP9 A;  2P67 A;  3LID A;  3P8C E;  1KQL A;  3HUS A;  2ZXE B;  4WY4 C;  1HTL C;  2FXM A;  2R32 A;  1NO4 A;  1QL1 A;  2WSF H;  1IFI A;  1DH3 A;  1H88 A;  5AW1 B;  1VDF A;  1SQV K;  1J1D B;  3N4X A;  1W2E A;  2PP6 A;  1JCC A;  5CJ0 A;  2GUS A;  3VYI A;  4N78 D;  2C9N Y;  4WBA A;  4WB4 A;  2WPS A;  1X9V A;  1NKN A;  3MUD A;  2M3B A;  3VP8 A;  4GIF A;  2N1T D;  1CZQ A;  2YO3 A;  1S9K D;  1FBM A;  1OWA A;  1N7L A;  3GHG A;  5CCG A;  1HJB A;  2WT7 A;  1GK4 A;  4ZKP A;  1Z56 A;  1IJD B;  2NPS D;  2Q7C A;  3TYY A;  4C46 A;  2WSE H;  2KYV A;  2WPQ A;  3VMZ A;  3KQG A;  5AW4 B;  3I5C A;  3P8M C;  1GL2 A;  1LT9 B;  3LIE A;  2I1K A;  5APW A;  1NU1 K;  1T8Z A;  3V2Q A;  3RL0 B;  1N7S D;  4N78 E;  3M9B A;  2YO2 A;  3OJA B;  2C9L Y;  3EFG A;  3C9I A;  2A45 H;  5APQ A;  1GU4 A;  5CCG C;  4LGD E;  1S9K E;  2C0X A;  3B8E B;  3M91 A;  1LTS C;  2OYI A;  1FZA A;  3A2A A;  4EOT A;  2H43 A;  1LTI C;  2CPS A;  5AW7 B;  1MUU A;  1JNM A;  3NFQ A;  1URQ D;  2KSJ A;  1FZG A;  1NWQ A;  2VRS A;  2HOD A;  1WT6 A;  3G3Z A;  1FOS E;  5BU8 B;  1FZF A;  1LWU C;  1PFI A;  3TNU B;  3HE4 B;  2FKW B;  1YTZ I;  2A45 G;  2OYI C;  3M06 A;  1JY3 N;  3VMY A;  1JY2 P;  3H32 B;  4AQR D;  3L4F A;  1J1E C;  1IFM A;  1X8Y A;  4W7Z A;  4XA4 A;  1DEB A;  3UIA A;  3IR9 A;  5APS A;  1ZLL A;  3BAS A;  3VN0 A;  2KOG A;  2CPB A;  1G2C B;  1L4A B;  1QL2 A;  1A02 F;  2YKP A;  1FZC B;  3RK2 D;  3O8Z A;  1RF1 B;  1LWU B;  1L0N K;  1ZR2 A;  1NTK K;  1KIL B;  2P7J A;  1YYC A;  1NKZ B;  1FZB A;  2FYU K;  4ZKU A;  1HUC A;  2ZFC A;  3TK1 A;  4GT1 A;  2FFD C;  4KHX A;  1JY3 O;  4I2L C;  1GL2 D;  2XKM A;  3BRT B;  2C0W A;  2R5D A;  1J1D C;  1J1E B;  2IPP A;  2XV5 A;  4EIJ A;  3RK3 D;  4Y99 B;  1G1I A;  5BU5 A;  2L5G B;  5APY A;  5CCH D;  2H7H A;  2J58 A;  4JYB A;  4IFD K;  3P7K A;  1AFO A;  2J59 M;  1NTZ K;  3NTN A;  2FFD B;  5AVT B;  1SFC D;  2KP8 A;  1CW5 A;  2W6B A;  4DZO A;  2OYH B;  1JOC A;  1HVV A;  2W27 A;  1T3U A;  1LT9 C;  3T97 A;  3CI9 A;  4LLH A;  1GW4 A;  1HWT C;  3P32 A;  3RL0 C;  1IK9 A;  3IFM A;  4N3Y B;  4C7R A;  2N1T B;  3TNU A;  3HE4 A;  1FU1 A;  5KJ7 A;  2YKQ A;  3SWF A;  4AYC A;  1DX7 A;  5APT A;  2IFM A;  1FAV A;  2NPS B;  3V2R A;  3H32 A;  1SLQ A;  2HLO A;  3NMD A;  1JTH B;  3MGN A;  1N7S B;  2M8R A;  1G2C A;  1IC2 A;  4W80 A;  4IFF A;  5KJ7 C;  4WY4 D;  1RF1 A;  1LWU A;  2PAJ A;  2WTY A;  1KIL A;  2QM8 A;  1RF0 A;  1FJK A;  5CMZ A;  1URQ B;  1ZN5 A;  3B5N D;  2H8P D;  1ZR4 A;  3HD7 C;  1RE3 C;  3KPE A;  1L4A C;  3TSI A;  3HE5 B;  1FZC C;  2YMY A;  3RK2 C;  1RF1 C;  1OXZ A;  4O9B A;  2HPC B;  5AVX B;  1KIL C;  4HYT B;  1RF0 C;  5AVQ B;  5AW6 B;  2Q3I A;  1X79 B;  1EQ7 A;  1IFJ A;  3VTP C;  2FFD A;  3M9Q A;  2O01 H;  2HYN A;  2OYH A;  1IFN A;  1T2K C;  3BRV B;  2KB7 P;  2QM7 A;  5AW0 B;  4Y99 C;  2R5B A;  3HD7 B;  2KLV A;  3A3Y B;  2Q9I A;  5AVS B;  1N86 A;  1JY2 O;  5CCG D;  3RK2 B;  1J2J B;  3M9H A;  2O1J A;  5KTB A;  1SQQ K;  2N1T A;  5AW8 B;  2W6A A;  1N2D C;  1LGH B;  2GUV A;  2JJL A;  4M3L A;  1IFD A;  1LTB C;  3N7N A;  2OYH C;  2XU6 A;  2NPS A;  1HBW A;  1KZU B;  2HFE D;  3LW5 H;  1E5W A;  3L36 A;  1LT9 A;  3RK3 B;  1JTH A;  1KFM A;  2N1T C;  1N7S A;  4B86 A;  4XE5 B;  3A7O A;  1H89 A;  5AW5 B;  4RES B;  1LTA C;  2Z4E A;  2JEE A;  1SFC B;  1LTT C;  3V4W A;  3M0D A;  2NPS C;  2WZ7 A;  5AW9 B;  4JF7 A;  2WSC H;  3A5T A;  3L35 A;  2WPR A;  3PP5 A;  1LTJ B;  5CJ4 A;  1N7S C;  1M7L A;  1XTC C;  5AW3 B;  3HE5 A;  1M1J C;  1CI6 B;  1WRG A;  2Q5U A;  5AVW B;  2P1J A;  1GZL A;  3CLQ A;  2HPC A;  3MD0 A;  1G1J A;  1FZE A;  1SQX K;  3M0D C;  5AVY B;  1FOS F;  3OA7 A;  4JYC A;  4C7N B;  4I6M C;  1SQB K;  1GW3 A;  2MJZ A;  1N73 B;  5APV A;  4N6J A;  1URQ C;  1SP4 A;  1JO5 A;  3B5N C;  1NHL A;  3KYQ A;  1A02 J;  3HTK B;  3U1C A;  5AVU B;  2P2U A;  4I1L A;  3HUS C;  3HD7 A;  1RE3 A;  2XZR A;  1L4A A;  1FJP A;  1M1J B;  2GM4 A;  2Z5I A;  1FZC A;  3V2P A;  2HG5 D;  2E43 A;  4WY4 B;  3BVH A;  5AVR B;  1NAF A;  3V5B A;  3V4Q A;  2N9B A;  1HH0 A;  4LC1 A;  1MFZ A;  3CL3 D;  1MV8 A;  2E42 A;  3B5N B;  4HH2 A;  3RL0 D;  1JUN A;  3R2P A;  3V2N A;  2R3C A;  1JY2 N;  1LTG C;  3GHG C;  3HUS B;  3MIW A;  1GTW A;  3L37 A;  1ZV8 A;  2LKM A;  2WIT A;  3VOP A;  1FDM A;  3VMX A;  2POH A;  3U59 A;  2O1K A;  5CCH A;  1GDT A;  2OAR A;  1SQP K;  1GL2 C;  1NTM K;  1RE4 A;  1SFC A;  2XDJ A;  3BAT A;  4AUW A;  5AVV B;  3WMM 0;  3H6P A;  2FYZ A;  3MTU E;  3RK3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...