3TGUG

Cytochrome bc1 complex from chicken with pfvs-designed moa inhibitor bound
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Computational discovery of picomolar Q(o) site inhibitors of cytochrome bc1 complex.
pubmed doi rcsb
total genus 17
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3tguG00
1KYOH 3CXHH 3H1KG 4D6TG 2IBZG 3L72G 5KLVG 3L73G 1PP9G 3H1LG 4PD4H 3H1JG 3BCCG 1BGYG 1PPJG 3TGUG 1EZVG 1SQVG 1NTKG 3CWBG 2BCCG 1BE3G 1SQXG 1L0LG 2A06G 3L75G 1P84H 3H1HG 3L70G 1SQBG 1BCCG 3H1IG 3CX5H 1SQQG 3L71G 4U3FG 1L0NG 1NTZG 2FYUG 3L74G 1KB9H 1NTMG 1NU1G 1SQPG
chains in the Genus database with same CATH superfamily
1M57D 1T2KD 2WWWA 1DEBA 3L74D 2Y0DA 5AW0B 3V2PA 1VPCA 2UWJE 3WUUA 1NU1J 1GU4A 2JR8A 1FZCA 4K3AA 4L75A 2H8PD 2V4HA 3AE8C 4C7RA 4OWFA 1WT6A 2E76C 3AE6C 1BGYE 1QEXA 2ZFCA 1KZUB 2QJPC 1KB9E 3MZWB 3I56P 1JUNA 3OW2O 2O01J 1BDDA 1CI6A 1KILE 4WVZA 2GA1A 3H32B 1NTMG 2FYNC 3BATA 5KLIB 2E42A 4GKGA 3L72G 4W80A 4IL6H 1OVUA 3TGUG 2Z5HA 3CWBG 5BU8B 4GT1A 2Y0EA 2Q3EA 1EDLA 2W6JH 3M0DC 2WPRA 3BVHA 3H1KE 1OWAA 1L4AC 1R5LA 4C7NB 3PH0A 2QIWA 4JYCA 1RF0C 2Z5IA 1W2BO 2OTKE 3RBXA 4ZMDA 1AVYA 2E75B 1BDCA 3PLNA 1VF5C 2CPSA 3P8MC 1N7SD 1ZRTE 3V2QA 5APVA 1FOSE 1JCCA 1MZ9A 3RL0D 1SQBJ 5KLVG 3L75E 2IDBA 1NGMB 3VP9A 3KZIE 3BCCG 2Q7CA 2GM4A 2JP3A 3AEBC 1KTMA 3KXDA 2WVRA 3EWKA 1J1DC 3GF3A 4ZKUA 1J2JB 2ZYDA 3G6EP 2A45G 2P67A 3P8CE 3D71A 3V4QA 2E76D 1KYOE 1PPJG 3P7KA 2IYOA 3GW6A 1M56D 4BXLA 4XE5B 1FZGA 1EDIA 3U1CA 3H1JJ 5GTHE 2HR3A 3MUDC 2L91A 2H7HA 3SFDC 3S4RA 1NTKE 3PTZA 1SQXE 1LTIC 2A45H 3KPEA 1S1CX 2RN0A 4WY4A 2BEQD 3AE9C 1S9KE 1KQGB 1EXIA 3CCEP 1JTHB 3E1RA 4H13D 1AFOA 1L4AD 1PP9G 1JOCA 1SP4A 2OYHB 3H1LG 1N7SA 3L74E 1P84D 1SQPE 2K1AA 2YXQB 3GLMA 2HYNA 3C1LA 4K35A 1HJBA 1VQPP 2C9LY 3CCLP 3CXHH 3P32A 1VF5D 2PAJA 1L0NK 3LIDA 1A02F 1RF1A 2XNDH 4U3FJ 1HWTC 1URQC 4KJMA 2L5GB 1LNQA 2Q1KA 4OGQD 1SVFA 1M1JC 1T6AA 2ZYGA 1LP1A 1NU1K 4BWNA 4N3YB 1FJPA 3VMAA 4LLHA 1N73C 2JWDA 3E1IA 3CCRP 3C9IA 3AEEC 3A0BE 2YKOA 3HTKA 4EI2A 3H1HJ 1QL1A 5CJ0A 1ZN5A 2FFDC 3AE3C 1L4AA 1JEKA 3H6PA 4BRYA 3QWOC 5KAIH 4H0LB 4AUWA 4U3FD 4JQ0D 1BCCJ 1VQ9P 2ZT9B 1GK4A 1BSHA 1GL2B 2ZXXA 5KKZB 2I1KA 3A3YB 1SQQG 1LT9B 4N78D 2DW3A 2NPSC 3LW5J 1FZBA 3VMXA 2R32A 2BCCE 2W6BA 2HODA 5APXA 5BVZA 5KLVK 1HGVA 3CX5D 2OYIC 2KLUA 2V7QH 3H1HD 2A45I 1URQD 4U7JA 1ZR2A 3BCCE 1AVOA 1NTZK 2QJKC 1BGYG 2CK3H 2E5YA 3A7OA 2IPPA 4HH2A 2M0BA 3O8ZA 3MD0A 2KNCA 2ZAEB 1ZW0A 3W67A 4PJ0E 3MUDA 4RJTA 2RMZA 1HF9A 3L73E 1BCCD 1RE3C 3L4FA 3L71J 2QVAA 3ABVC 3V5BA 3CXHI 4MN4C 1FDIA 3M9HA 1P84E 2FXPA 1USDA 3CCQP 3LIEA 4KT0J 1OW6A 3H1KG 2ZXEB 3GG2A 1U7MA 1USEA 4GOEA 5AW5B 1QLED 3CI9A 5AW9B 3T97B 4UB8H 4H44C 1DEEG 3RBZA 1WMKA 1J1EC 3CCUP 1URQA 2Q3IA 2JJLA 2NPSD 1U57A 3H32A 1PZQA 5AW4B 3AE2C 1Q86Q 3L75G 2WSEJ 1KV4A 4M3LA 4A7PA 1NJIQ 5BU5A 1IJDB 3L71D 4PV1B 2KZJA 3G4SP 1X8YA 2K9JB 1N73A 2Q5UA 3JCUH 3AEFC 2YMKA 2KS1B 4D6TJ 1JY2N 2A06D 2W27A 2K9YA 1W2EA 1DD3A 4L76A 3KZIH 1BSNA 1VQNP 5KKZC 3FXDA 3L36A 1NTKG 4U3FE 1SQXG 2W90A 3CC4P 2QSIA 1GW4A 1IK9A 2KSEA 1KYOH 1JY2O 2BEZF 2OQQA 1NKNA 3USSA 2JWAA 5E79H 5GTHH 3WU2E 4N6JA 2NPSA 4WY4C 3L74G 1SQPG 1OVRA 4DT0A 3CX5E 4C46A 4H44D 3D70A 2OARA 1L0NJ 2OYIA 1NOHA 1N7SC 5KJ7D 3KYQA 1IFMA 2E74C 4I7ZC 2NZ2A 3AEGC 2WSCH 1JY3N 5AVTB 1Y8AA 1EZVE 1G2CB 4W7YA 1N2DC 3L37A 2FY8A 1RF1C 1JTHA 1LWUC 1KB9I 2HPCB 1RE3A 1NAYA 2JKVA 5C39A 4DCKA 3B5NC 1Q2NA 4H0LD 2JO1A 1JY3O 2R3SA 3AE7C 1Q90D 1LTJB 3VN0A 2KIKA 1M8OB 3L72J 2XKMA 3A2AA 1EDJA 4ZKPA 1E5WA 3SWKA 1AJYA 3CWBJ 1NKZB 1X9VA 4UB8E 1L0ND 3D6YA 2ZJSE 2WSFH 2WSSH 1QVGO 5CCGD 4H13C 1JY3P 3A0BH 1K8AQ 3TDKA 3RK3B 1G1IA 4RESB 3FXEA 2KI7B 5KJ7A 2G8YA 4WY4D 1YBKA 1NU1D 4GOFA 2GUSA 1S5LX 3NTNA 2BCCG 2H89C 2QG4A 5KLVJ 2M3EA 3JCUE 4EIJA 2IYPA 2N1TB 2I1JA 2E74D 3VYIA 1A02J 2O3JA 3ITKA 2O01H 1NTZJ 3L72D 1G1JA 4TT3H 4OGQC 3HD7C 2OYOA 1KYOI 4GODA 4R4MA 3VOPA 1L0LK 3BASA 2Q6QA 1MV8A 1KILB 1X22A 3L73G 3L70J 1KFNA 1OZHA 1UIXA 2KB7P 3D6ZA 1LT9A 3C8VA 2IBZD 3SWFA 3B5ND 3VTPC 5APQA 2O01N 5E79E 1W5CE 2MJZA 3M0AA 5CCGA 1K05A 3HE4B 2YNYA 5AVXB 2HG5D 2P7JA 1RY3A 4PJ0H 3O6QB 5AVYB 1RHZB 1YQ3C 1GDTA 1SFCB 1S5LH 3FX0A 3EFFK 4NPFX 4RO0A 2WT7B 3F5HA 3A5TA 1YIJP 1SQBD 1OFCX 1NTZD 1SQPK 2FYUK 2KOGA 1PL5A 5B5EH 4YTPC 3CL3D 1P84H 2FXMA 1SQVK 1HUCA 3G3ZA 3L70D 1H0TB 1LTBC 3SFEC 4I2LC 4AYCA 1JMMA 1LWUA 1MUUA 2LKMA 1OVVA 1LTGC 2KK7A 5K5GB 3H1JD 3KHUA 3PRJA 5KLIC 3HD7D 1CI6B 3B5NA 5AW3B 4JYBA 3T97A 3OA7A 1PGPA 2WITA 1L0NE 2O1JA 3HUSB 3SSUA 3RL0g 4U3FG 4OVNF 2ZYAA 3E7KA 1ZMEC 2P10A 1KN7A 2HFED 1HH0A 1HGZA 1NTMK 2WTYA 1IK7A 2E75C 2C0XA 3G71P 3JSVC 1NU1E 2M5AB 2N1TC 4Y28J 2AXTE 2K9JA 4R4LA 2V7QJ 2KS1A 3RK2B 5H2FE 1HJ0A 1HBWA 3EQ2A 3L35A 3AE5C 2QJYB 3GMAA 3GHGB 1LT1A 1KFMA 1XTCC 2FXOA 1NHLA 3NFQA 1GMJA 1NYHA 3OAKA 2D2CB 2E5TA 3WU2H 2JDIH 3HD7A 4LGDE 1EZVG 4QMAA 3TNUA 3CX5H 1PGOA 2QE7H 2IBZE 1BGYJ 2PGDA 1ZXGA 4ZNCA 1ZLLA 1EC5A 3H25A 1IZNB 1SFCC 4HB1A 1M1KQ 1Y9BA 4YXDC 3AECC 1OX3A 5GTIE 2XDJA 1S5LE 3CCVP 2MKVA 2OYHC 1S2EA 1P84I 2QRXA 2P1JA 1DX7A 1SQBE 1NTZE 3WUVA 3Q2YA 2OGUA 3H1KJ 1FS0E 5B5EE 2PP6A 1G2CA 2E75D 4ASVA 1TU3F 3RL0B 3IN6A 2N1TD 4PD4D 3MGNA 2AEFA 2HPCA 3VMZA 1MKMA 1HTLC 3WUTA 5AVRB 1CW5A 4RKUJ 1PGJA 1KB9D 2WZ7A 1DIPA 3H1JE 2PFXA 3IAOA 3L75J 2E76B 1BE3J 4UB6E 1LTJA 2WPQA 3CPWO 2IFMA 3V6IA 1FC2C 2K3RA 5KJ7C 2QJPB 3KDPB 3CCSP 2K88A 2A06G 2N9YB 3A0HE 2HLOA 2BASA 2RKLA 3CC2P 2C9NY 3KQGA 1MFTA 5APWA 2FYNB 3QH9A 1L0LJ 1QL2A 1VQ4P 3H1IJ 5EFWB 2JEEA 1NH4A 1YTZT 3FWLA 2KP8A 1EXJA 4C7NA 3MHVA 1SFCD 4H0LC 1T8ZA 1NTKJ 1SQXJ 4XA4A 2ZT9C 1Y47A 1E79H 1GL2C 4JBZA 1FZFA 1ZRTD 2QJYC 4Y99B 2N1TA 3GHGC 1LT9C 4IOIH 3B4SA 2H43A 1JNMA 2YIUB 3UIAA 1BE3D 1VF5B 1YJNP 3IR9A 4JF7A 4N78E 5CCGC 4W7ZA 3VP8A 3L74J 3CX5I 2Q9IA 2WSEH 1SQPJ 2FYUJ 2XV5A 3P8CD 2KSJA 3R4YA 2HODB 1AQ5A 1IFIA 1KILA 1SS1A 3GF7A 5AVSB 5B66E 1L0LD 1KYOD 1J1DB 1SQVJ 3H1ID 4GDOA 1SQQK 1YQ4C 4IFFA 3H1HE 2QA4P 3V4WA 2W8ZA 1EZVI 4D6TD 1HVVA 3I55P 5CHXA 3HE4A 1LJ2A 4WB4A 2KNCB 1GW3A 2XNXA 3O6QA 1YITP 3PP5A 1FBMA 1SFCA 1SLQA 4KHXA 2LXBA 4EDFA 2WT7A 1BCCE 1YJ9P 2NRGA 1H8AA 3F89A 3I5CA 2KUBA 1L0NG 4WWIA 4DJGA 2OYHA 1JO5A 1AQTA 3U1AA 4EYYQ 1H89A 1SQPD 2FYUD 1IFDA 1VDFA 1KC8Q 1FDMA 3ZDMA 5CBNA 1LTAC 2KZIA 1NTMJ 2ZT9D 3CC7P 1GL2D 4PD4E 3RK2D 1FZAA 5AW8B 1H0TA 2M3BA 1SQVD 1VQLP 1NU1G 1VQ8P 3TGUJ 1JM0A 1U7JA 1CZQA 2D2CD 2YO2A 3B71A 1AV1A 1URQB 1M7LA 1VQ5P 2VRSA 4PV1C 3M06A 2BCCJ 5AW7B 3HUSA 1M1JB 2H88C 4NPEA 3JC22 2B9BA 1PIXA 3L71E 2R3CA 2AXTH 1QGKB 3BRVB 1N73B 1Q82Q 3BCCJ 1LGHB 2J5UA 2IBZG 1NTMD 1UIIA 2FKWB 5H2FH 2A06E 1L2PA 2M5AA 3Q1MA 1XTGB 4Y99C 5TISE 3IFMA 2YIUC 2FFDB 3AEDC 3TGUD 3L73J 2YMYA 3CWBD 3CD6P 1H88A 1KD1Q 1T3UA 1YI2P 1IO4A 1GTWA 1GL2A 4DOJA 1BE3E 5CJ4A 1OIPA 1QVFO 1QX8A 1RH5B 1OW8A 3GHGA 3Q5PA 1DH3A 3TF5A 3V2NA 1SQBG 3HE5B 2Y0CA 2ZVNB 2BCCD 5CCHC 1NTKK 1NTZG 4JPZB 1SQXK 1IFJA 2NPSB 1VQMP 1L0LE 1IFPA 3FWNA 1MFZA 3H1IE 3S9OA 5M1BA 1R5SA 5GTIH 5KLVD 2B87B 3Q5SA 3BCCD 3L70G 1PP9J 4D6TE 3H1LJ 2OYIB 1FZEA 3CLQA 5KAFE 3N4XA 1M90Q 2LXCB 3S1KA 4PV1D 3H1JG 2QJKB 3MIWA 4AQRD 3L73D 4IFDK 1IFNA 1ZOYC 5KTBA 1PPJD 2IZ0A 3Q5RA 1FZCB 3CCJP 4Z1MH 1FAVA 2YO3A 2B88A 2WPSA 2QM7A 1LTJC 1JCDA 2FYUE 2P2UA 2KLVA 1Q81Q 3II6A 2IZ1A 4UB6H 3CXHD 2Y9ZA 4HYTB 1SQVE 3CMEP 2Y9YA 3A0HH 3Q3DA 2C0WA 3K5BA 4EOTA 1PP9D 3H1LD 3RK3C 1GK6A 1RQUA 5AVQB 2XZRA 3IF4A 3R2PA 4H44B 5CCHD 1J1EB 3U59A 4IL6E 1ZR4A 4I1LA 1IC2A 3M91A 1N86A 3PJSK 1KQFB 1FJKA 5AVWB 2FBWC 1SQQJ 4B86A 1KQSO 3M0DA 1NTME 4L73A 3H1HG 1NO4A 4OH8B 1Z56A 2KYVA 5DJTB 3L72E 4IFMA 1FE6A 1KILC 1RF0A 3TGUE 2WMMA 2YKPA 2FYZA 3CWBE 2IBZI 1GD2E 1EQ7A 2IFNA 5B66H 2YKQA 1KORA 1RE4C 1BCCG 4LC1A 2O1KA 3CCMP 2POHA 4DZOA 1YYCA 1D7MA 5APSA 2AEMA 5CCHA 5CBOA 2RH0A 2I8DA 1S3JA 2XU6A 5KLVE 1AA0A 1SQBK 4WY4B 2LR2A 5CMZA 3OJAB 3RK3D 1K9MQ 1SQQD 1S4XA 1GZLA 1OXZA 2ZVOB 4O9BA 2J59M 1EZVD 4WBAA 1N7SB 1FZCC 2P58A 1FDOA 1PV3A 2E74B 4I7ZB 3LW5H 2QM8A 1PPJE 1PGQA 1YJWP 3NXSA 4PD4H 4YXWH 1KQLA 1Q7YQ 3L70E 1N7LA 2WQYC 2R5BA 1KMIZ 1RF1B 1LWUB 1BGYD 5APTA 2E43A 1VQKP 4I6MC 1R8EA 3M9BA 3L71G 1KB9H 2OTJP 3EFGA 3N7NA 3W68A 2W83C 5AW6B 1YHQP 3MTUE 2ITAA 5L8RJ 1KILD 3CXHE 1WRGA 3B5NB 1VQ7P 3HUSC 2PRRA 1JMBA 2W6AA 4YPCA 1LP1B 4ASWA 1X79B 3MP7B 4L74A 1YTZI 3HRNA 1PP9E 3H1LE 5AW2B 3AE4C 3CMAP 2OTLP 3BRTB 1LTTC 2YXRB 4NPDA 1K04A 3H1KD 3HTKB 1S72P 4GIFA 1BE3G 2G3AA 1T2KC 1M1JA 2R5DA 4H13B 2KXPB 1RQVA 2CPBA 1OMIA 3G9RA 1VQ6P 1L4AB 5AVUB 3TYYA 5TISH 1ZP0C 1T3JA 4HKZH 4BRYB 3RK2C 1N8RQ 1NVOA 1X0TA 1OW7A 1CSBA 3TSIA 4CPGA 1L0LG 1DD4A 3AEAC 3H1IG 5DJUB 2QEXP 3SWYA 3V2RA 2IX7C 3L75D 4TLFA 5APYA 2D2CC 2WSCJ 4XFJA 4D6TG 2FFDA 3B8EB 3TK1A 5KAIE 5AVZB 1FU1A 4OGQB 3HD7B 3NMDA 3TNUB 2SPZA 1NAFA 2AEJA 5AVVB 1JB0J 2GUVA 3HE5A 5TJHA 1RE4A 2R44A 3VMYA 2B89A 2K37A 3RGUA 1NWQA 5KAFH 1K73Q 2M8RA 1NTKD 2Z4EA 5APUA 1SQXD 2FYUG 1LTSC 3AE1C 1PFIA 1FOSF 4HJGH 4IL6X 2B87A 2WPVB 1S9KD 1ZV8A 3WMM0 5AW1B 3RK3E 2N9BA 1JY2P 1SQVG 1SQQE 2WSFJ 1GU5A 1VL2A 2AXCA 3FGAD 3PHLA 3RL0C 2J58A 1EDKA 3M9QA 4PD4I 1VQOP
chains in the Genus database with same CATH topology
1KYOH 3CXHH 3H1KG 4D6TG 2IBZG 3L72G 5KLVG 3L73G 1PP9G 3H1LG 4PD4H 3H1JG 3BCCG 1BGYG 1PPJG 3TGUG 1EZVG 1SQVG 1NTKG 3CWBG 2BCCG 1BE3G 1SQXG 1L0LG 2A06G 3L75G 1P84H 3H1HG 3L70G 1SQBG 1BCCG 3H1IG 3CX5H 1SQQG 3L71G 4U3FG 1L0NG 1NTZG 2FYUG 3L74G 1KB9H 1NTMG 1NU1G 1SQPG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO H;  3CXH H;  3H1K G;  4D6T G;  2IBZ G;  3L72 G;  5KLV G;  3L73 G;  1PP9 G;  3H1L G;  4PD4 H;  3H1J G;  3BCC G;  1BGY G;  1PPJ G;  3TGU G;  1EZV G;  1SQV G;  1NTK G;  3CWB G;  2BCC G;  1BE3 G;  1SQX G;  1L0L G;  2A06 G;  3L75 G;  1P84 H;  3H1H G;  3L70 G;  1SQB G;  1BCC G;  3H1I G;  3CX5 H;  1SQQ G;  3L71 G;  4U3F G;  1L0N G;  1NTZ G;  2FYU G;  3L74 G;  1KB9 H;  1NTM G;  1NU1 G;  1SQP G; 
#chains in the Genus database with same CATH topology
 1M57 D;  1T2K D;  2WWW A;  1DEB A;  3L74 D;  2Y0D A;  5AW0 B;  3V2P A;  1VPC A;  2UWJ E;  3WUU A;  1NU1 J;  1GU4 A;  2JR8 A;  1FZC A;  4K3A A;  4L75 A;  2H8P D;  2V4H A;  3AE8 C;  4C7R A;  4OWF A;  1WT6 A;  2E76 C;  3AE6 C;  1BGY E;  1QEX A;  2ZFC A;  1KZU B;  2QJP C;  1KB9 E;  3MZW B;  3I56 P;  1JUN A;  3OW2 O;  2O01 J;  1BDD A;  1CI6 A;  1KIL E;  4WVZ A;  2GA1 A;  3H32 B;  1NTM G;  2FYN C;  3BAT A;  5KLI B;  2E42 A;  4GKG A;  3L72 G;  4W80 A;  4IL6 H;  1OVU A;  3TGU G;  2Z5H A;  3CWB G;  5BU8 B;  4GT1 A;  2Y0E A;  2Q3E A;  1EDL A;  2W6J H;  3M0D C;  2WPR A;  3BVH A;  3H1K E;  1OWA A;  1L4A C;  1R5L A;  4C7N B;  3PH0 A;  2QIW A;  4JYC A;  1RF0 C;  2Z5I A;  1W2B O;  2OTK E;  3RBX A;  4ZMD A;  1AVY A;  2E75 B;  1BDC A;  3PLN A;  1VF5 C;  2CPS A;  3P8M C;  1N7S D;  1ZRT E;  3V2Q A;  5APV A;  1FOS E;  1JCC A;  1MZ9 A;  3RL0 D;  1SQB J;  5KLV G;  3L75 E;  2IDB A;  1NGM B;  3VP9 A;  3KZI E;  3BCC G;  2Q7C A;  2GM4 A;  2JP3 A;  3AEB C;  1KTM A;  3KXD A;  2WVR A;  3EWK A;  1J1D C;  3GF3 A;  4ZKU A;  1J2J B;  2ZYD A;  3G6E P;  2A45 G;  2P67 A;  3P8C E;  3D71 A;  3V4Q A;  2E76 D;  1KYO E;  1PPJ G;  3P7K A;  2IYO A;  3GW6 A;  1M56 D;  4BXL A;  4XE5 B;  1FZG A;  1EDI A;  3U1C A;  3H1J J;  5GTH E;  2HR3 A;  3MUD C;  2L91 A;  2H7H A;  3SFD C;  3S4R A;  1NTK E;  3PTZ A;  1SQX E;  1LTI C;  2A45 H;  3KPE A;  1S1C X;  2RN0 A;  4WY4 A;  2BEQ D;  3AE9 C;  1S9K E;  1KQG B;  1EXI A;  3CCE P;  1JTH B;  3E1R A;  4H13 D;  1AFO A;  1L4A D;  1PP9 G;  1JOC A;  1SP4 A;  2OYH B;  3H1L G;  1N7S A;  3L74 E;  1P84 D;  1SQP E;  2K1A A;  2YXQ B;  3GLM A;  2HYN A;  3C1L A;  4K35 A;  1HJB A;  1VQP P;  2C9L Y;  3CCL P;  3CXH H;  3P32 A;  1VF5 D;  2PAJ A;  1L0N K;  3LID A;  1A02 F;  1RF1 A;  2XND H;  4U3F J;  1HWT C;  1URQ C;  4KJM A;  2L5G B;  1LNQ A;  2Q1K A;  4OGQ D;  1SVF A;  1M1J C;  1T6A A;  2ZYG A;  1LP1 A;  1NU1 K;  4BWN A;  4N3Y B;  1FJP A;  3VMA A;  4LLH A;  1N73 C;  2JWD A;  3E1I A;  3CCR P;  3C9I A;  3AEE C;  3A0B E;  2YKO A;  3HTK A;  4EI2 A;  3H1H J;  1QL1 A;  5CJ0 A;  1ZN5 A;  2FFD C;  3AE3 C;  1L4A A;  1JEK A;  3H6P A;  4BRY A;  3QWO C;  5KAI H;  4H0L B;  4AUW A;  4U3F D;  4JQ0 D;  1BCC J;  1VQ9 P;  2ZT9 B;  1GK4 A;  1BSH A;  1GL2 B;  2ZXX A;  5KKZ B;  2I1K A;  3A3Y B;  1SQQ G;  1LT9 B;  4N78 D;  2DW3 A;  2NPS C;  3LW5 J;  1FZB A;  3VMX A;  2R32 A;  2BCC E;  2W6B A;  2HOD A;  5APX A;  5BVZ A;  5KLV K;  1HGV A;  3CX5 D;  2OYI C;  2KLU A;  2V7Q H;  3H1H D;  2A45 I;  1URQ D;  4U7J A;  1ZR2 A;  3BCC E;  1AVO A;  1NTZ K;  2QJK C;  1BGY G;  2CK3 H;  2E5Y A;  3A7O A;  2IPP A;  4HH2 A;  2M0B A;  3O8Z A;  3MD0 A;  2KNC A;  2ZAE B;  1ZW0 A;  3W67 A;  4PJ0 E;  3MUD A;  4RJT A;  2RMZ A;  1HF9 A;  3L73 E;  1BCC D;  1RE3 C;  3L4F A;  3L71 J;  2QVA A;  3ABV C;  3V5B A;  3CXH I;  4MN4 C;  1FDI A;  3M9H A;  1P84 E;  2FXP A;  1USD A;  3CCQ P;  3LIE A;  4KT0 J;  1OW6 A;  3H1K G;  2ZXE B;  3GG2 A;  1U7M A;  1USE A;  4GOE A;  5AW5 B;  1QLE D;  3CI9 A;  5AW9 B;  3T97 B;  4UB8 H;  4H44 C;  1DEE G;  3RBZ A;  1WMK A;  1J1E C;  3CCU P;  1URQ A;  2Q3I A;  2JJL A;  2NPS D;  1U57 A;  3H32 A;  1PZQ A;  5AW4 B;  3AE2 C;  1Q86 Q;  3L75 G;  2WSE J;  1KV4 A;  4M3L A;  4A7P A;  1NJI Q;  5BU5 A;  1IJD B;  3L71 D;  4PV1 B;  2KZJ A;  3G4S P;  1X8Y A;  2K9J B;  1N73 A;  2Q5U A;  3JCU H;  3AEF C;  2YMK A;  2KS1 B;  4D6T J;  1JY2 N;  2A06 D;  2W27 A;  2K9Y A;  1W2E A;  1DD3 A;  4L76 A;  3KZI H;  1BSN A;  1VQN P;  5KKZ C;  3FXD A;  3L36 A;  1NTK G;  4U3F E;  1SQX G;  2W90 A;  3CC4 P;  2QSI A;  1GW4 A;  1IK9 A;  2KSE A;  1KYO H;  1JY2 O;  2BEZ F;  2OQQ A;  1NKN A;  3USS A;  2JWA A;  5E79 H;  5GTH H;  3WU2 E;  4N6J A;  2NPS A;  4WY4 C;  3L74 G;  1SQP G;  1OVR A;  4DT0 A;  3CX5 E;  4C46 A;  4H44 D;  3D70 A;  2OAR A;  1L0N J;  2OYI A;  1NOH A;  1N7S C;  5KJ7 D;  3KYQ A;  1IFM A;  2E74 C;  4I7Z C;  2NZ2 A;  3AEG C;  2WSC H;  1JY3 N;  5AVT B;  1Y8A A;  1EZV E;  1G2C B;  4W7Y A;  1N2D C;  3L37 A;  2FY8 A;  1RF1 C;  1JTH A;  1LWU C;  1KB9 I;  2HPC B;  1RE3 A;  1NAY A;  2JKV A;  5C39 A;  4DCK A;  3B5N C;  1Q2N A;  4H0L D;  2JO1 A;  1JY3 O;  2R3S A;  3AE7 C;  1Q90 D;  1LTJ B;  3VN0 A;  2KIK A;  1M8O B;  3L72 J;  2XKM A;  3A2A A;  1EDJ A;  4ZKP A;  1E5W A;  3SWK A;  1AJY A;  3CWB J;  1NKZ B;  1X9V A;  4UB8 E;  1L0N D;  3D6Y A;  2ZJS E;  2WSF H;  2WSS H;  1QVG O;  5CCG D;  4H13 C;  1JY3 P;  3A0B H;  1K8A Q;  3TDK A;  3RK3 B;  1G1I A;  4RES B;  3FXE A;  2KI7 B;  5KJ7 A;  2G8Y A;  4WY4 D;  1YBK A;  1NU1 D;  4GOF A;  2GUS A;  1S5L X;  3NTN A;  2BCC G;  2H89 C;  2QG4 A;  5KLV J;  2M3E A;  3JCU E;  4EIJ A;  2IYP A;  2N1T B;  2I1J A;  2E74 D;  3VYI A;  1A02 J;  2O3J A;  3ITK A;  2O01 H;  1NTZ J;  3L72 D;  1G1J A;  4TT3 H;  4OGQ C;  3HD7 C;  2OYO A;  1KYO I;  4GOD A;  4R4M A;  3VOP A;  1L0L K;  3BAS A;  2Q6Q A;  1MV8 A;  1KIL B;  1X22 A;  3L73 G;  3L70 J;  1KFN A;  1OZH A;  1UIX A;  2KB7 P;  3D6Z A;  1LT9 A;  3C8V A;  2IBZ D;  3SWF A;  3B5N D;  3VTP C;  5APQ A;  2O01 N;  5E79 E;  1W5C E;  2MJZ A;  3M0A A;  5CCG A;  1K05 A;  3HE4 B;  2YNY A;  5AVX B;  2HG5 D;  2P7J A;  1RY3 A;  4PJ0 H;  3O6Q B;  5AVY B;  1RHZ B;  1YQ3 C;  1GDT A;  1SFC B;  1S5L H;  3FX0 A;  3EFF K;  4NPF X;  4RO0 A;  2WT7 B;  3F5H A;  3A5T A;  1YIJ P;  1SQB D;  1OFC X;  1NTZ D;  1SQP K;  2FYU K;  2KOG A;  1PL5 A;  5B5E H;  4YTP C;  3CL3 D;  1P84 H;  2FXM A;  1SQV K;  1HUC A;  3G3Z A;  3L70 D;  1H0T B;  1LTB C;  3SFE C;  4I2L C;  4AYC A;  1JMM A;  1LWU A;  1MUU A;  2LKM A;  1OVV A;  1LTG C;  2KK7 A;  5K5G B;  3H1J D;  3KHU A;  3PRJ A;  5KLI C;  3HD7 D;  1CI6 B;  3B5N A;  5AW3 B;  4JYB A;  3T97 A;  3OA7 A;  1PGP A;  2WIT A;  1L0N E;  2O1J A;  3HUS B;  3SSU A;  3RL0 g;  4U3F G;  4OVN F;  2ZYA A;  3E7K A;  1ZME C;  2P10 A;  1KN7 A;  2HFE D;  1HH0 A;  1HGZ A;  1NTM K;  2WTY A;  1IK7 A;  2E75 C;  2C0X A;  3G71 P;  3JSV C;  1NU1 E;  2M5A B;  2N1T C;  4Y28 J;  2AXT E;  2K9J A;  4R4L A;  2V7Q J;  2KS1 A;  3RK2 B;  5H2F E;  1HJ0 A;  1HBW A;  3EQ2 A;  3L35 A;  3AE5 C;  2QJY B;  3GMA A;  3GHG B;  1LT1 A;  1KFM A;  1XTC C;  2FXO A;  1NHL A;  3NFQ A;  1GMJ A;  1NYH A;  3OAK A;  2D2C B;  2E5T A;  3WU2 H;  2JDI H;  3HD7 A;  4LGD E;  1EZV G;  4QMA A;  3TNU A;  3CX5 H;  1PGO A;  2QE7 H;  2IBZ E;  1BGY J;  2PGD A;  1ZXG A;  4ZNC A;  1ZLL A;  1EC5 A;  3H25 A;  1IZN B;  1SFC C;  4HB1 A;  1M1K Q;  1Y9B A;  4YXD C;  3AEC C;  1OX3 A;  5GTI E;  2XDJ A;  1S5L E;  3CCV P;  2MKV A;  2OYH C;  1S2E A;  1P84 I;  2QRX A;  2P1J A;  1DX7 A;  1SQB E;  1NTZ E;  3WUV A;  3Q2Y A;  2OGU A;  3H1K J;  1FS0 E;  5B5E E;  2PP6 A;  1G2C A;  2E75 D;  4ASV A;  1TU3 F;  3RL0 B;  3IN6 A;  2N1T D;  4PD4 D;  3MGN A;  2AEF A;  2HPC A;  3VMZ A;  1MKM A;  1HTL C;  3WUT A;  5AVR B;  1CW5 A;  4RKU J;  1PGJ A;  1KB9 D;  2WZ7 A;  1DIP A;  3H1J E;  2PFX A;  3IAO A;  3L75 J;  2E76 B;  1BE3 J;  4UB6 E;  1LTJ A;  2WPQ A;  3CPW O;  2IFM A;  3V6I A;  1FC2 C;  2K3R A;  5KJ7 C;  2QJP B;  3KDP B;  3CCS P;  2K88 A;  2A06 G;  2N9Y B;  3A0H E;  2HLO A;  2BAS A;  2RKL A;  3CC2 P;  2C9N Y;  3KQG A;  1MFT A;  5APW A;  2FYN B;  3QH9 A;  1L0L J;  1QL2 A;  1VQ4 P;  3H1I J;  5EFW B;  2JEE A;  1NH4 A;  1YTZ T;  3FWL A;  2KP8 A;  1EXJ A;  4C7N A;  3MHV A;  1SFC D;  4H0L C;  1T8Z A;  1NTK J;  1SQX J;  4XA4 A;  2ZT9 C;  1Y47 A;  1E79 H;  1GL2 C;  4JBZ A;  1FZF A;  1ZRT D;  2QJY C;  4Y99 B;  2N1T A;  3GHG C;  1LT9 C;  4IOI H;  3B4S A;  2H43 A;  1JNM A;  2YIU B;  3UIA A;  1BE3 D;  1VF5 B;  1YJN P;  3IR9 A;  4JF7 A;  4N78 E;  5CCG C;  4W7Z A;  3VP8 A;  3L74 J;  3CX5 I;  2Q9I A;  2WSE H;  1SQP J;  2FYU J;  2XV5 A;  3P8C D;  2KSJ A;  3R4Y A;  2HOD B;  1AQ5 A;  1IFI A;  1KIL A;  1SS1 A;  3GF7 A;  5AVS B;  5B66 E;  1L0L D;  1KYO D;  1J1D B;  1SQV J;  3H1I D;  4GDO A;  1SQQ K;  1YQ4 C;  4IFF A;  3H1H E;  2QA4 P;  3V4W A;  2W8Z A;  1EZV I;  4D6T D;  1HVV A;  3I55 P;  5CHX A;  3HE4 A;  1LJ2 A;  4WB4 A;  2KNC B;  1GW3 A;  2XNX A;  3O6Q A;  1YIT P;  3PP5 A;  1FBM A;  1SFC A;  1SLQ A;  4KHX A;  2LXB A;  4EDF A;  2WT7 A;  1BCC E;  1YJ9 P;  2NRG A;  1H8A A;  3F89 A;  3I5C A;  2KUB A;  1L0N G;  4WWI A;  4DJG A;  2OYH A;  1JO5 A;  1AQT A;  3U1A A;  4EYY Q;  1H89 A;  1SQP D;  2FYU D;  1IFD A;  1VDF A;  1KC8 Q;  1FDM A;  3ZDM A;  5CBN A;  1LTA C;  2KZI A;  1NTM J;  2ZT9 D;  3CC7 P;  1GL2 D;  4PD4 E;  3RK2 D;  1FZA A;  5AW8 B;  1H0T A;  2M3B A;  1SQV D;  1VQL P;  1NU1 G;  1VQ8 P;  3TGU J;  1JM0 A;  1U7J A;  1CZQ A;  2D2C D;  2YO2 A;  3B71 A;  1AV1 A;  1URQ B;  1M7L A;  1VQ5 P;  2VRS A;  4PV1 C;  3M06 A;  2BCC J;  5AW7 B;  3HUS A;  1M1J B;  2H88 C;  4NPE A;  3JC2 2;  2B9B A;  1PIX A;  3L71 E;  2R3C A;  2AXT H;  1QGK B;  3BRV B;  1N73 B;  1Q82 Q;  3BCC J;  1LGH B;  2J5U A;  2IBZ G;  1NTM D;  1UII A;  2FKW B;  5H2F H;  2A06 E;  1L2P A;  2M5A A;  3Q1M A;  1XTG B;  4Y99 C;  5TIS E;  3IFM A;  2YIU C;  2FFD B;  3AED C;  3TGU D;  3L73 J;  2YMY A;  3CWB D;  3CD6 P;  1H88 A;  1KD1 Q;  1T3U A;  1YI2 P;  1IO4 A;  1GTW A;  1GL2 A;  4DOJ A;  1BE3 E;  5CJ4 A;  1OIP A;  1QVF O;  1QX8 A;  1RH5 B;  1OW8 A;  3GHG A;  3Q5P A;  1DH3 A;  3TF5 A;  3V2N A;  1SQB G;  3HE5 B;  2Y0C A;  2ZVN B;  2BCC D;  5CCH C;  1NTK K;  1NTZ G;  4JPZ B;  1SQX K;  1IFJ A;  2NPS B;  1VQM P;  1L0L E;  1IFP A;  3FWN A;  1MFZ A;  3H1I E;  3S9O A;  5M1B A;  1R5S A;  5GTI H;  5KLV D;  2B87 B;  3Q5S A;  3BCC D;  3L70 G;  1PP9 J;  4D6T E;  3H1L J;  2OYI B;  1FZE A;  3CLQ A;  5KAF E;  3N4X A;  1M90 Q;  2LXC B;  3S1K A;  4PV1 D;  3H1J G;  2QJK B;  3MIW A;  4AQR D;  3L73 D;  4IFD K;  1IFN A;  1ZOY C;  5KTB A;  1PPJ D;  2IZ0 A;  3Q5R A;  1FZC B;  3CCJ P;  4Z1M H;  1FAV A;  2YO3 A;  2B88 A;  2WPS A;  2QM7 A;  1LTJ C;  1JCD A;  2FYU E;  2P2U A;  2KLV A;  1Q81 Q;  3II6 A;  2IZ1 A;  4UB6 H;  3CXH D;  2Y9Z A;  4HYT B;  1SQV E;  3CME P;  2Y9Y A;  3A0H H;  3Q3D A;  2C0W A;  3K5B A;  4EOT A;  1PP9 D;  3H1L D;  3RK3 C;  1GK6 A;  1RQU A;  5AVQ B;  2XZR A;  3IF4 A;  3R2P A;  4H44 B;  5CCH D;  1J1E B;  3U59 A;  4IL6 E;  1ZR4 A;  4I1L A;  1IC2 A;  3M91 A;  1N86 A;  3PJS K;  1KQF B;  1FJK A;  5AVW B;  2FBW C;  1SQQ J;  4B86 A;  1KQS O;  3M0D A;  1NTM E;  4L73 A;  3H1H G;  1NO4 A;  4OH8 B;  1Z56 A;  2KYV A;  5DJT B;  3L72 E;  4IFM A;  1FE6 A;  1KIL C;  1RF0 A;  3TGU E;  2WMM A;  2YKP A;  2FYZ A;  3CWB E;  2IBZ I;  1GD2 E;  1EQ7 A;  2IFN A;  5B66 H;  2YKQ A;  1KOR A;  1RE4 C;  1BCC G;  4LC1 A;  2O1K A;  3CCM P;  2POH A;  4DZO A;  1YYC A;  1D7M A;  5APS A;  2AEM A;  5CCH A;  5CBO A;  2RH0 A;  2I8D A;  1S3J A;  2XU6 A;  5KLV E;  1AA0 A;  1SQB K;  4WY4 B;  2LR2 A;  5CMZ A;  3OJA B;  3RK3 D;  1K9M Q;  1SQQ D;  1S4X A;  1GZL A;  1OXZ A;  2ZVO B;  4O9B A;  2J59 M;  1EZV D;  4WBA A;  1N7S B;  1FZC C;  2P58 A;  1FDO A;  1PV3 A;  2E74 B;  4I7Z B;  3LW5 H;  2QM8 A;  1PPJ E;  1PGQ A;  1YJW P;  3NXS A;  4PD4 H;  4YXW H;  1KQL A;  1Q7Y Q;  3L70 E;  1N7L A;  2WQY C;  2R5B A;  1KMI Z;  1RF1 B;  1LWU B;  1BGY D;  5APT A;  2E43 A;  1VQK P;  4I6M C;  1R8E A;  3M9B A;  3L71 G;  1KB9 H;  2OTJ P;  3EFG A;  3N7N A;  3W68 A;  2W83 C;  5AW6 B;  1YHQ P;  3MTU E;  2ITA A;  5L8R J;  1KIL D;  3CXH E;  1WRG A;  3B5N B;  1VQ7 P;  3HUS C;  2PRR A;  1JMB A;  2W6A A;  4YPC A;  1LP1 B;  4ASW A;  1X79 B;  3MP7 B;  4L74 A;  1YTZ I;  3HRN A;  1PP9 E;  3H1L E;  5AW2 B;  3AE4 C;  3CMA P;  2OTL P;  3BRT B;  1LTT C;  2YXR B;  4NPD A;  1K04 A;  3H1K D;  3HTK B;  1S72 P;  4GIF A;  1BE3 G;  2G3A A;  1T2K C;  1M1J A;  2R5D A;  4H13 B;  2KXP B;  1RQV A;  2CPB A;  1OMI A;  3G9R A;  1VQ6 P;  1L4A B;  5AVU B;  3TYY A;  5TIS H;  1ZP0 C;  1T3J A;  4HKZ H;  4BRY B;  3RK2 C;  1N8R Q;  1NVO A;  1X0T A;  1OW7 A;  1CSB A;  3TSI A;  4CPG A;  1L0L G;  1DD4 A;  3AEA C;  3H1I G;  5DJU B;  2QEX P;  3SWY A;  3V2R A;  2IX7 C;  3L75 D;  4TLF A;  5APY A;  2D2C C;  2WSC J;  4XFJ A;  4D6T G;  2FFD A;  3B8E B;  3TK1 A;  5KAI E;  5AVZ B;  1FU1 A;  4OGQ B;  3HD7 B;  3NMD A;  3TNU B;  2SPZ A;  1NAF A;  2AEJ A;  5AVV B;  1JB0 J;  2GUV A;  3HE5 A;  5TJH A;  1RE4 A;  2R44 A;  3VMY A;  2B89 A;  2K37 A;  3RGU A;  1NWQ A;  5KAF H;  1K73 Q;  2M8R A;  1NTK D;  2Z4E A;  5APU A;  1SQX D;  2FYU G;  1LTS C;  3AE1 C;  1PFI A;  1FOS F;  4HJG H;  4IL6 X;  2B87 A;  2WPV B;  1S9K D;  1ZV8 A;  3WMM 0;  5AW1 B;  3RK3 E;  2N9B A;  1JY2 P;  1SQV G;  1SQQ E;  2WSF J;  1GU5 A;  1VL2 A;  2AXC A;  3FGA D;  3PHL A;  3RL0 C;  2J58 A;  1EDK A;  3M9Q A;  4PD4 I;  1VQO P; 
#chains in the Genus database with same CATH homology
 1KYO H;  3CXH H;  3H1K G;  4D6T G;  2IBZ G;  3L72 G;  5KLV G;  3L73 G;  1PP9 G;  3H1L G;  4PD4 H;  3H1J G;  3BCC G;  1BGY G;  1PPJ G;  3TGU G;  1EZV G;  1SQV G;  1NTK G;  3CWB G;  2BCC G;  1BE3 G;  1SQX G;  1L0L G;  2A06 G;  3L75 G;  1P84 H;  3H1H G;  3L70 G;  1SQB G;  1BCC G;  3H1I G;  3CX5 H;  1SQQ G;  3L71 G;  4U3F G;  1L0N G;  1NTZ G;  2FYU G;  3L74 G;  1KB9 H;  1NTM G;  1NU1 G;  1SQP G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...