3TGUG

Cytochrome bc1 complex from chicken with pfvs-designed moa inhibitor bound
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational discovery of picomolar Q(o) site inhibitors of cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 17
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3tguG00
3H1IG 4D6TG 3TGUG 3L70G 1NTMG 2BCCG 1SQPG 1PP9G 5KLVG 1L0NG 1KB9H 3L73G 1BCCG 3H1HG 3BCCG 1L0LG 2FYUG 3CXHH 1EZVG 3CWBG 4U3FG 3L75G 3L74G 1NTKG 2A06G 1SQQG 1P84H 1SQVG 1PPJG 3L71G 4PD4H 2IBZG 3L72G 1BE3G 1NU1G 1BGYG 3H1LG 1SQBG 1SQXG 3H1JG 3H1KG 3CX5H 1NTZG 1KYOH
chains in the Genus database with same CATH superfamily
1UIXA 1OIPA 1M57D 3EWKA 1GD2E 2IBZE 2LKMA 5GTHE 1NTMD 2Q9IA 1PPJE 2BCCJ 2J58A 5KLVG 3BVHA 1HH0A 3L70J 4AUWA 1M90Q 5APUA 2YKOA 3BCCD 2H89C 3G71P 1E79H 4DT0A 2E42A 4W7ZA 2AXTH 1G2CA 5APYA 3CWBG 1BSNA 3PP5A 4U3FG 3HE5B 1S1CX 3MP7B 1NTKK 1KYOE 3PJSK 1R5LA 3SFDC 1HJBA 1L0NE 2QJPC 4LLHA 3D71A 1H8AA 2C0WA 1LTIC 1J1EB 5CCHD 3HE4A 4W7YA 1Y9BA 1VF5C 1XTGB 2BASA 2G8YA 2KOGA 4UB8E 1GW3A 3V4WA 3TGUE 4PV1D 1CSBA 2KI7B 4DCKA 2SPZA 4IL6H 1RQVA 2KIKA 4JPZB 4PV1B 1AQ5A 1NKNA 4IOIH 1NVOA 5E79E 1DEEG 5KLIC 1GL2A 1NU1D 1JCCA 3TF5A 1ZRTD 2WT7A 5AW7B 2FKWB 1R8EA 4UB6H 3I5CA 3TGUG 1EXIA 1K05A 1NGMB 4GIFA 2ZXXA 1ZR2A 1L0NG 3P7KA 3AE7C 3AE8C 5GTIE 1VQ7P 2KUBA 3CWBE 4HYTB 3S9OA 1EDJA 5AW3B 3RK2D 3VN0A 2GA1A 3B5NB 3AE9C 3VYIA 1DX7A 2YIUB 2B9BA 2OARA 2E75D 3L75G 4DOJA 3OJAB 5AVYB 1A02F 3CCLP 3RBZA 3O8ZA 4PD4I 2IBZD 3HD7D 3JC22 3RL0D 3HUSB 4PJ0H 2P2UA 1LP1A 3CXHE 5KAIH 1SQXJ 1BDCA 3II6A 3P8CE 3CXHI 1MUUA 2QEXP 1VQPP 4IL6X 4I7ZC 3H1KG 3H1KE 1SQPK 3H1KJ 1IK7A 3BRTB 1K8AQ 1KQFB 4D6TJ 4WY4B 5DJTB 4Y28J 1YQ3C 4R4MA 1FDOA 3FGAD 3VMXA 2JO1A 4UB8H 4TT3H 2GUVA 1PL5A 4JYCA 1NTKD 1USDA 2E76D 2PAJA 4K35A 1UIIA 1LJ2A 2Y0CA 5AVVB 3BCCG 3V2RA 1N73B 1U57A 4KJMA 3FWLA 3BATA 2FXPA 4OGQD 5GTHH 1OW8A 1JUNA 2QIWA 5KKZB 3K5BA 3L70E 2RKLA 3JSVC 3OAKA 3Q2YA 1MZ9A 4XA4A 1VDFA 2YIUC 3L74D 2XKMA 5APSA 1KB9I 2H8PD 2V4HA 3B5NC 3KQGA 4AQRD 3SWFA 1FJPA 3V4QA 2ZVOB 2MKVA 1EC5A 1G1JA 1KORA 3KXDA 2IZ0A 3SWKA 1RF1B 2YKPA 3G9RA 1SQXE 3KPEA 3LW5H 3KZIE 2WVRA 1BGYD 4XE5B 1JNMA 3KHUA 2H7HA 3L70D 1OZHA 3MZWB 1L0LK 1S2EA 1VPCA 1PP9G 2ZT9B 3O6QA 3V6IA 3H25A 1YJ9P 2OYHA 1FOSE 1G1IA 1HWTC 2FYUJ 1QEXA 2KK7A 2FYNC 2P67A 2N9BA 3P32A 5KAIE 3CC4P 1X9VA 1GL2B 1L0LD 1IFDA 3CXHH 2CPSA 1AA0A 1EZVG 1JY2N 2OYHC 1VQ4P 1K73Q 2W8ZA 1S5LX 3B8EB 1OXZA 4PD4H 2XU6A 1QL2A 1NTME 1JMMA 1NYHA 2N1TA 3CLQA 3KZIH 3M9QA 4U7JA 5GTIH 1NWQA 2B89A 2IZ1A 5K5GB 4WVZA 1SQBG 1AFOA 1SQXD 3AE6C 1GTWA 3M91A 1NOHA 3SWYA 2PFXA 2C9LY 1DIPA 4GODA 3L73D 3V2NA 3HUSA 1PIXA 2E5TA 2PP6A 1GZLA 1L4AD 3AEDC 3H1HD 3IAOA 3MHVA 3RGUA 3TNUA 1PP9D 1QGKB 1SQPG 2D2CD 5AW4B 3V5BA 2FFDA 2YO2A 1GMJA 2PRRA 1BCCJ 3U59A 1LNQA 3C8VA 2KXPB 1SQVD 2XV5A 3CX5I 3HE4B 4WB4A 4WY4A 2Q1KA 3WUVA 3PTZA 3PRJA 1N7SA 1OMIA 2XNDH 1N8RQ 2W6BA 3GG2A 2O1KA 2Q6QA 5L8RJ 1Q7YQ 1NU1J 1W2EA 2BCCD 2R3CA 2WSEJ 4HKZH 5AVSB 3TGUD 2PGDA 2WT7B 1L2PA 2L91A 3L72J 1NU1G 2K37A 1Q90D 2NRGA 4MN4C 5APVA 5KAFH 4R4LA 2IFNA 1PGOA 4OVNF 1JTHA 1YJWP 4L73A 3A5TA 3NFQA 1SP4A 4H13B 2OYIC 2OYIA 1ZMEC 3LIEA 3AEGC 1NKZB 3AE3C 1FZGA 1AJYA 2HODA 1NHLA 3M9BA 1M1JA 3ZDMA 1YTZT 3L70G 2BCCG 4OH8B 3B71A 4YTPC 1LWUC 1SLQA 1L0NK 5KJ7C 5KLVJ 3GF7A 3GW6A 5BU8B 3A0BE 4U3FD 2A06D 5AW9B 3P8CD 2V7QJ 2OTKE 2WSFH 1YITP 3H1HJ 1LP1B 5B66H 5BVZA 2KZIA 2K9YA 3AE5C 1FE6A 1N7SC 1LT9B 3BCCE 3S1KA 1BCCE 1VF5D 3AECC 3BCCJ 3VMAA 2WPVB 1RF1A 1AQTA 1VQNP 1NTKG 4GOFA 2L5GB 4RJTA 4KHXA 1L4AA 3PH0A 1J1EC 3TSIA 4BXLA 3CMEP 1SQVJ 2QG4A 1CW5A 1BE3G 1N7LA 1HGZA 2KNCA 2FFDC 2IYPA 1LTBC 2K88A 1FBMA 1T8ZA 1EDKA 1HTLC 1NTZJ 3FWNA 2YMYA 1J1DB 1S5LE 3EFGA 1Z56A 2W6JH 3HD7A 1JY3P 1DD4A 4CPGA 2QM8A 1KYOH 1OW6A 2WSFJ 2KZJA 4HB1A 2V7QH 2M5AB 3A3YB 3H1IJ 3PLNA 2WITA 2QE7H 1NTMJ 3HTKB 2I1KA 1IFIA 2O1JA 2QVAA 3D6YA 3CCJP 3CPWO 2E76B 1FJKA 5APQA 1NAYA 3L74E 1K9MQ 4N6JA 3L75E 3LIDA 3G3ZA 5AW6B 2E75B 3T97B 3G6EP 1FZCA 4HJGH 1J1DC 3H1JD 5KAFE 2KP8A 1URQC 2YXQB 1JY2O 4KT0J 3R4YA 1KILD 1OVVA 4W80A 4A7PA 1GL2D 3RL0g 2FFDB 1KB9E 1M1JC 2H43A 3L71G 1DEBA 5CBOA 1NTKJ 4JF7A 3L75D 3SFEC 1N7SD 1BGYG 3AE4C 1JY3N 1Q81Q 2R3SA 1N7SB 2WSCH 1KQSO 4ASWA 1P84D 4RKUJ 5CMZA 3FXDA 5APWA 1RE4C 2M3EA 1YTZI 1CZQA 1PGQA 3CI9A 1PFIA 3CC2P 2M0BA 2LXBA 1QX8A 2ZFCA 1BGYE 1IFJA 1LTSC 2R32A 4OWFA 1Q86Q 2NPSC 1N2DC 3L72E 4ASVA 1GDTA 3L71E 1SQVE 3V2PA 5AVRB 1LTTC 4YXWH 1YJNP 1U7MA 4U3FE 1S9KD 2OYIB 2W6AA 3IFMA 3KDPB 4H13C 4PJ0E 2GUSA 4I2LC 4U3FJ 1JTHB 3F5HA 3U1CA 2OTJP 2KYVA 1JM0A 5AVWB 3F89A 3L73E 1IK9A 3L74G 1HJ0A 1WMKA 1PGJA 5KLVE 1KTMA 2IPPA 3ITKA 3P8MC 1HUCA 1W5CE 4B86A 3HUSC 2K9JA 1SQPD 2XDJA 1FZFA 3A0HH 2JEEA 5AVUB 2YNYA 4NPDA 1HGVA 3TNUB 4Z1MH 3CCEP 1OW7A 1URQB 1X22A 5AW8B 1SFCA 2KS1A 2P58A 3RK3D 1VQLP 2A45G 3JCUH 3VMYA 2XZRA 5KLVD 1KILE 2HYNA 2JDIH 2QJKB 2QSIA 2P10A 2D2CB 4H13D 2JWAA 2O01H 1L4AB 1FAVA 5DJUB 1R5SA 1JMBA 2M8RA 1NTKE 2IFMA 5KLVK 1SVFA 4HH2A 2HPCA 2NPSD 1M56D 1X79B 3LW5J 4EYYQ 4DJGA 2Y9ZA 5AW2B 2E74D 1VQ9P 3L73J 4ZKUA 3VP9A 5CBNA 4N78D 3VP8A 3L37A 3H1LD 1D7MA 4QMAA 2Y9YA 3Q3DA 4Y99B 1VQMP 2JR8A 3AEAC 2P7JA 4C7RA 2J59M 2LR2A 3HTKA 2BCCE 1T2KC 3L74J 4XFJA 2HODB 3CC7P 4AYCA 2K3RA 1FZCB 2QJPB 3RK3B 2I1JA 1RQUA 2HLOA 1HVVA 1GL2C 3H1JG 1Q2NA 3B5NA 4N78E 1M8OB 1P84E 1BE3D 1LTJC 3CCSP 4IFFA 2YKQA 3H1IG 2CPBA 2WSSH 3W68A 1U7JA 3AE2C 1QVFO 2WPQA 4H0LB 1DH3A 4I1LA 1SQQE 1HBWA 4RESB 2A06E 5KTBA 3MIWA 2D2CC 2K1AA 1WRGA 2RMZA 3Q5RA 2ZYDA 2OGUA 1H89A 3M0AA 2O01J 2FYUG 3JCUE 3KYQA 1RY3A 3D6ZA 3CCQP 2JWDA 1L0ND 3I55P 1USEA 1ZRTE 3RK2B 1YQ4C 3N7NA 1IFMA 4WBAA 1T2KD 2R5DA 3L71J 3H1ID 1P84H 3OA7A 1SQQD 1BDDA 3WU2H 3Q5PA 3TK1A 2E43A 1KILB 4OGQB 1YYCA 3U1AA 2CK3H 2UWJE 1KD1Q 1PV3A 3H1LJ 1N73C 1LGHB 1N73A 1TU3F 5AW0B 1KFMA 2FYUD 1SQBJ 1SQBE 4IFMA 4H0LD 4NPFX 3T97A 1KC8Q 1EDIA 2K9JB 1VQ8P 1EDLA 3B4SA 3S4RA 1T6AA 5H2FE 1EZVI 1LWUB 2FYUK 3CWBD 1MFZA 4ZNCA 3E1RA 3GLMA 3L73G 4IL6E 4JQ0D 4LC1A 4N3YB 2OYOA 5E79H 1OFCX 1RHZB 1DD3A 1IJDB 1J2JB 1SFCB 3H1HE 1FDIA 2R5BA 1FC2C 2IX7C 2MJZA 2ZYGA 3IF4A 1YBKA 3L4FA 2ZJSE 3RL0C 3O6QB 1SQQG 2KSJA 1SQVG 5B5EH 2J5UA 1PP9E 3L72D 5CCGC 1KMIZ 3E1IA 3MTUE 2WSCJ 3I56P 1H88A 1ZOYC 4TLFA 1LTJA 2Y0EA 4D6TE 2AXTE 2NPSA 2XNXA 1JOCA 3CX5D 3FX0A 3H6PA 3RK2C 3RK3E 2HPCB 1Q82Q 1JEKA 1GK6A 1NAFA 3H1JE 4L76A 1VQOP 2WQYC 1RE4A 1QL1A 2KLUA 5APTA 1VQ6P 1NTZD 3Q1MA 1Y47A 2WPSA 3D70A 2E74C 2JP3A 2P1JA 2ZXEB 4PD4D 3VOPA 1VQ5P 1RF0C 2E76C 1FU1A 5CJ0A 2O01N 2IYOA 1NJIQ 2W83C 2WZ7A 1JCDA 3CXHD 4GT1A 2Q5UA 2B87A 2OTLP 2C0XA 1IC2A 4PV1C 3RBXA 4GOEA 4UB6E 1URQA 2FBWC 4GDOA 3GF3A 3RK3C 1FZCC 4BRYB 2W27A 1YIJP 3M06A 2KS1B 1W2BO 1FDMA 3A7OA 1IFPA 1OVUA 1T3JA 2FYZA 2Q3EA 3L71D 5AW1B 2IDBA 4Y99C 4BWNA 2OYHB 2FXOA 2WPRA 4EDFA 1SQBK 1SFCC 1OWAA 2POHA 1NTZE 2QJYC 5AVZB 2AEJA 3AEBC 1LT9C 3ABVC 3AEEC 1NTMK 2B88A 2ZVNB 3CX5H 3H32A 1MKMA 1NTZG 2AEMA 5B66E 1ZLLA 1FS0E 2WTYA 2Z5HA 3MUDA 2JKVA 1SQBD 1RE3A 1KILA 1KYOD 1FOSF 4L74A 1SQPJ 1KQGB 3W67A 1CI6B 2N1TB 1FZBA 1VL2A 2QJKC 1KB9H 3GMAA 4DZOA 2E74B 1BCCG 5C39A 1QLED 2A45I 4H44C 1GK4A 4I6MC 2Q3IA 5TISH 1RF1C 5EFWB 2HFED 2Y0DA 1JB0J 2FY8A 2YO3A 4O9BA 3B5ND 3L75J 3L72G 1BSHA 3NXSA 4LGDE 1AVYA 1LWUA 3WMM0 1NTZK 5KJ7A 1EZVD 1GU5A 1NU1K 2Z4EA 1QVGO 5CCHC 1IFNA 3M0DA 1IO4A 3RL0B 2G3AA 1KYOI 3CL3D 3AE1C 2WSEH 3GHGA 3G4SP 4H44B 3WU2E 5KJ7D 5B5EE 3CCVP 1EXJA 4H44D 1NU1E 1X8YA 2O3JA 4D6TG 3M0DC 4ZMDA 2NPSB 3UIAA 2KNCB 1PGPA 3USSA 4JYBA 5KLIB 1LTGC 1LTJB 3A0HE 2WMMA 5APXA 2BEZF 3H1HG 2DW3A 4C7NB 2YMKA 1KZUB 3MD0A 3N4XA 3BRVB 1OVRA 2M3BA 1KQLA 2M5AA 2QJYB 5AVXB 1M1KQ 1H0TB 3EFFK 3NMDA 1IZNB 1VF5B 4JBZA 1EQ7A 3CCUP 4D6TD 1OX3A 1SFCD 1PPJG 4IFDK 3CMAP 1SQPE 1M1JB 1SS1A 2B87B 1AVOA 2IBZG 1RH5B 1KN7A 1KB9D 1PZQA 2I8DA 2RN0A 4M3LA 3HD7C 2BEQD 2QRXA 1MV8A 1S4XA 4L75A 2C9NY 1RE3C 4BRYA 3MUDC 2E75C 4EOTA 2HG5D 1AV1A 1GW4A 3A2AA 3HE5A 4PD4E 3TGUJ 1P84I 1LT9A 1FZEA 3E7KA 3QWOC 1NH4A 2FYNB 4RO0A 4YPCA 5TISE 1G2CB 2Q7CA 3OW2O 1L4AC 1BE3E 1KV4A 1JY2P 1NTMG 4WY4D 2QA4P 4H0LC 2ZT9C 1PP9J 1L0LJ 3IN6A 2E5YA 3SSUA 3VTPC 4K3AA 4EI2A 1YHQP 3EQ2A 3VMZA 2GM4A 4C46A 1EZVE 5AVTB 1BCCD 1YI2P 1L0LG 2A45H 2FYUE 1A02J 1K04A 3BASA 2YXRB 1LT1A 1S9KE 3HD7B 1S3JA 1WT6A 2VRSA 3MGNA 2LXCB 5BU5A 1KFNA 3PHLA 2A06G 3IR9A 1SQVK 1E5WA 1PPJD 1BGYJ 3TDKA 3CWBJ 4GKGA 5CHXA 2W90A 3TYYA 5CJ4A 1N86A 1CI6A 1XTCC 3L35A 5KKZC 3H1IE 3L36A 3WUTA 2RH0A 1RF0A 3GHGC 3H1LG 5H2FH 5CCGD 1SQXG 2KSEA 2H88C 2KB7P 3V2QA 5CCHA 1S72P 3CCMP 1ZP0C 3H1LE 1Y8AA 3QH9A 5AVQB 1HF9A 1ZR4A 2QM7A 1LTAC 4WWIA 3CD6P 2OQQA 2R44A 1ZXGA 2ZT9D 3CX5E 3HRNA 2KLVA 3M9HA 2HR3A 4WY4C 1S5LH 4ZKPA 2ZYAA 5CCGA 2ITAA 1ZV8A 1FZAA 1L0NJ 1SQQK 2FXMA 2N1TD 2NZ2A 2ZAEB 1M7LA 5AW5B 1L0LE 2IBZI 3Q5SA 4I7ZB 3GHGB 2JJLA 5M1BA 1MFTA 4EIJA 1SQQJ 3H32B 1JO5A 3C9IA 1SQXK 1X0TA 1T3UA 2Z5IA 3FXEA 3CCRP 1BE3J 3R2PA 2N9YB 1KILC 3C1LA 4OGQC 1GU4A 1URQD 3AEFC 3H1JJ 1JY3O 4YXDC 3NTNA 1VQKP 1ZW0A 3A0BH 1NO4A 3H1KD 4NPEA 5TJHA 3WUUA 4C7NA 1H0TA 2AEFA 1ZN5A 2WWWA 2N1TC 2AXCA
chains in the Genus database with same CATH topology
3H1IG 4D6TG 3TGUG 3L70G 1NTMG 2BCCG 1SQPG 1PP9G 5KLVG 1L0NG 1KB9H 3L73G 1BCCG 3H1HG 3BCCG 1L0LG 2FYUG 3CXHH 1EZVG 3CWBG 4U3FG 3L75G 3L74G 1NTKG 2A06G 1SQQG 1P84H 1SQVG 1PPJG 3L71G 4PD4H 2IBZG 3L72G 1BE3G 1NU1G 1BGYG 3H1LG 1SQBG 1SQXG 3H1JG 3H1KG 3CX5H 1NTZG 1KYOH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1I G;  4D6T G;  3TGU G;  3L70 G;  1NTM G;  2BCC G;  1SQP G;  1PP9 G;  5KLV G;  1L0N G;  1KB9 H;  3L73 G;  1BCC G;  3H1H G;  3BCC G;  1L0L G;  2FYU G;  3CXH H;  1EZV G;  3CWB G;  4U3F G;  3L75 G;  3L74 G;  1NTK G;  2A06 G;  1SQQ G;  1P84 H;  1SQV G;  1PPJ G;  3L71 G;  4PD4 H;  2IBZ G;  3L72 G;  1BE3 G;  1NU1 G;  1BGY G;  3H1L G;  1SQB G;  1SQX G;  3H1J G;  3H1K G;  3CX5 H;  1NTZ G;  1KYO H; 
#chains in the Genus database with same CATH topology
 1UIX A;  1OIP A;  1M57 D;  3EWK A;  1GD2 E;  2IBZ E;  2LKM A;  5GTH E;  1NTM D;  2Q9I A;  1PPJ E;  2BCC J;  2J58 A;  5KLV G;  3BVH A;  1HH0 A;  3L70 J;  4AUW A;  1M90 Q;  5APU A;  2YKO A;  3BCC D;  2H89 C;  3G71 P;  1E79 H;  4DT0 A;  2E42 A;  4W7Z A;  2AXT H;  1G2C A;  5APY A;  3CWB G;  1BSN A;  3PP5 A;  4U3F G;  3HE5 B;  1S1C X;  3MP7 B;  1NTK K;  1KYO E;  3PJS K;  1R5L A;  3SFD C;  1HJB A;  1L0N E;  2QJP C;  4LLH A;  3D71 A;  1H8A A;  2C0W A;  1LTI C;  1J1E B;  5CCH D;  3HE4 A;  4W7Y A;  1Y9B A;  1VF5 C;  1XTG B;  2BAS A;  2G8Y A;  2KOG A;  4UB8 E;  1GW3 A;  3V4W A;  3TGU E;  4PV1 D;  1CSB A;  2KI7 B;  4DCK A;  2SPZ A;  4IL6 H;  1RQV A;  2KIK A;  4JPZ B;  4PV1 B;  1AQ5 A;  1NKN A;  4IOI H;  1NVO A;  5E79 E;  1DEE G;  5KLI C;  1GL2 A;  1NU1 D;  1JCC A;  3TF5 A;  1ZRT D;  2WT7 A;  5AW7 B;  2FKW B;  1R8E A;  4UB6 H;  3I5C A;  3TGU G;  1EXI A;  1K05 A;  1NGM B;  4GIF A;  2ZXX A;  1ZR2 A;  1L0N G;  3P7K A;  3AE7 C;  3AE8 C;  5GTI E;  1VQ7 P;  2KUB A;  3CWB E;  4HYT B;  3S9O A;  1EDJ A;  5AW3 B;  3RK2 D;  3VN0 A;  2GA1 A;  3B5N B;  3AE9 C;  3VYI A;  1DX7 A;  2YIU B;  2B9B A;  2OAR A;  2E75 D;  3L75 G;  4DOJ A;  3OJA B;  5AVY B;  1A02 F;  3CCL P;  3RBZ A;  3O8Z A;  4PD4 I;  2IBZ D;  3HD7 D;  3JC2 2;  3RL0 D;  3HUS B;  4PJ0 H;  2P2U A;  1LP1 A;  3CXH E;  5KAI H;  1SQX J;  1BDC A;  3II6 A;  3P8C E;  3CXH I;  1MUU A;  2QEX P;  1VQP P;  4IL6 X;  4I7Z C;  3H1K G;  3H1K E;  1SQP K;  3H1K J;  1IK7 A;  3BRT B;  1K8A Q;  1KQF B;  4D6T J;  4WY4 B;  5DJT B;  4Y28 J;  1YQ3 C;  4R4M A;  1FDO A;  3FGA D;  3VMX A;  2JO1 A;  4UB8 H;  4TT3 H;  2GUV A;  1PL5 A;  4JYC A;  1NTK D;  1USD A;  2E76 D;  2PAJ A;  4K35 A;  1UII A;  1LJ2 A;  2Y0C A;  5AVV B;  3BCC G;  3V2R A;  1N73 B;  1U57 A;  4KJM A;  3FWL A;  3BAT A;  2FXP A;  4OGQ D;  5GTH H;  1OW8 A;  1JUN A;  2QIW A;  5KKZ B;  3K5B A;  3L70 E;  2RKL A;  3JSV C;  3OAK A;  3Q2Y A;  1MZ9 A;  4XA4 A;  1VDF A;  2YIU C;  3L74 D;  2XKM A;  5APS A;  1KB9 I;  2H8P D;  2V4H A;  3B5N C;  3KQG A;  4AQR D;  3SWF A;  1FJP A;  3V4Q A;  2ZVO B;  2MKV A;  1EC5 A;  1G1J A;  1KOR A;  3KXD A;  2IZ0 A;  3SWK A;  1RF1 B;  2YKP A;  3G9R A;  1SQX E;  3KPE A;  3LW5 H;  3KZI E;  2WVR A;  1BGY D;  4XE5 B;  1JNM A;  3KHU A;  2H7H A;  3L70 D;  1OZH A;  3MZW B;  1L0L K;  1S2E A;  1VPC A;  1PP9 G;  2ZT9 B;  3O6Q A;  3V6I A;  3H25 A;  1YJ9 P;  2OYH A;  1FOS E;  1G1I A;  1HWT C;  2FYU J;  1QEX A;  2KK7 A;  2FYN C;  2P67 A;  2N9B A;  3P32 A;  5KAI E;  3CC4 P;  1X9V A;  1GL2 B;  1L0L D;  1IFD A;  3CXH H;  2CPS A;  1AA0 A;  1EZV G;  1JY2 N;  2OYH C;  1VQ4 P;  1K73 Q;  2W8Z A;  1S5L X;  3B8E B;  1OXZ A;  4PD4 H;  2XU6 A;  1QL2 A;  1NTM E;  1JMM A;  1NYH A;  2N1T A;  3CLQ A;  3KZI H;  3M9Q A;  4U7J A;  5GTI H;  1NWQ A;  2B89 A;  2IZ1 A;  5K5G B;  4WVZ A;  1SQB G;  1AFO A;  1SQX D;  3AE6 C;  1GTW A;  3M91 A;  1NOH A;  3SWY A;  2PFX A;  2C9L Y;  1DIP A;  4GOD A;  3L73 D;  3V2N A;  3HUS A;  1PIX A;  2E5T A;  2PP6 A;  1GZL A;  1L4A D;  3AED C;  3H1H D;  3IAO A;  3MHV A;  3RGU A;  3TNU A;  1PP9 D;  1QGK B;  1SQP G;  2D2C D;  5AW4 B;  3V5B A;  2FFD A;  2YO2 A;  1GMJ A;  2PRR A;  1BCC J;  3U59 A;  1LNQ A;  3C8V A;  2KXP B;  1SQV D;  2XV5 A;  3CX5 I;  3HE4 B;  4WB4 A;  4WY4 A;  2Q1K A;  3WUV A;  3PTZ A;  3PRJ A;  1N7S A;  1OMI A;  2XND H;  1N8R Q;  2W6B A;  3GG2 A;  2O1K A;  2Q6Q A;  5L8R J;  1Q7Y Q;  1NU1 J;  1W2E A;  2BCC D;  2R3C A;  2WSE J;  4HKZ H;  5AVS B;  3TGU D;  2PGD A;  2WT7 B;  1L2P A;  2L91 A;  3L72 J;  1NU1 G;  2K37 A;  1Q90 D;  2NRG A;  4MN4 C;  5APV A;  5KAF H;  4R4L A;  2IFN A;  1PGO A;  4OVN F;  1JTH A;  1YJW P;  4L73 A;  3A5T A;  3NFQ A;  1SP4 A;  4H13 B;  2OYI C;  2OYI A;  1ZME C;  3LIE A;  3AEG C;  1NKZ B;  3AE3 C;  1FZG A;  1AJY A;  2HOD A;  1NHL A;  3M9B A;  1M1J A;  3ZDM A;  1YTZ T;  3L70 G;  2BCC G;  4OH8 B;  3B71 A;  4YTP C;  1LWU C;  1SLQ A;  1L0N K;  5KJ7 C;  5KLV J;  3GF7 A;  3GW6 A;  5BU8 B;  3A0B E;  4U3F D;  2A06 D;  5AW9 B;  3P8C D;  2V7Q J;  2OTK E;  2WSF H;  1YIT P;  3H1H J;  1LP1 B;  5B66 H;  5BVZ A;  2KZI A;  2K9Y A;  3AE5 C;  1FE6 A;  1N7S C;  1LT9 B;  3BCC E;  3S1K A;  1BCC E;  1VF5 D;  3AEC C;  3BCC J;  3VMA A;  2WPV B;  1RF1 A;  1AQT A;  1VQN P;  1NTK G;  4GOF A;  2L5G B;  4RJT A;  4KHX A;  1L4A A;  3PH0 A;  1J1E C;  3TSI A;  4BXL A;  3CME P;  1SQV J;  2QG4 A;  1CW5 A;  1BE3 G;  1N7L A;  1HGZ A;  2KNC A;  2FFD C;  2IYP A;  1LTB C;  2K88 A;  1FBM A;  1T8Z A;  1EDK A;  1HTL C;  1NTZ J;  3FWN A;  2YMY A;  1J1D B;  1S5L E;  3EFG A;  1Z56 A;  2W6J H;  3HD7 A;  1JY3 P;  1DD4 A;  4CPG A;  2QM8 A;  1KYO H;  1OW6 A;  2WSF J;  2KZJ A;  4HB1 A;  2V7Q H;  2M5A B;  3A3Y B;  3H1I J;  3PLN A;  2WIT A;  2QE7 H;  1NTM J;  3HTK B;  2I1K A;  1IFI A;  2O1J A;  2QVA A;  3D6Y A;  3CCJ P;  3CPW O;  2E76 B;  1FJK A;  5APQ A;  1NAY A;  3L74 E;  1K9M Q;  4N6J A;  3L75 E;  3LID A;  3G3Z A;  5AW6 B;  2E75 B;  3T97 B;  3G6E P;  1FZC A;  4HJG H;  1J1D C;  3H1J D;  5KAF E;  2KP8 A;  1URQ C;  2YXQ B;  1JY2 O;  4KT0 J;  3R4Y A;  1KIL D;  1OVV A;  4W80 A;  4A7P A;  1GL2 D;  3RL0 g;  2FFD B;  1KB9 E;  1M1J C;  2H43 A;  3L71 G;  1DEB A;  5CBO A;  1NTK J;  4JF7 A;  3L75 D;  3SFE C;  1N7S D;  1BGY G;  3AE4 C;  1JY3 N;  1Q81 Q;  2R3S A;  1N7S B;  2WSC H;  1KQS O;  4ASW A;  1P84 D;  4RKU J;  5CMZ A;  3FXD A;  5APW A;  1RE4 C;  2M3E A;  1YTZ I;  1CZQ A;  1PGQ A;  3CI9 A;  1PFI A;  3CC2 P;  2M0B A;  2LXB A;  1QX8 A;  2ZFC A;  1BGY E;  1IFJ A;  1LTS C;  2R32 A;  4OWF A;  1Q86 Q;  2NPS C;  1N2D C;  3L72 E;  4ASV A;  1GDT A;  3L71 E;  1SQV E;  3V2P A;  5AVR B;  1LTT C;  4YXW H;  1YJN P;  1U7M A;  4U3F E;  1S9K D;  2OYI B;  2W6A A;  3IFM A;  3KDP B;  4H13 C;  4PJ0 E;  2GUS A;  4I2L C;  4U3F J;  1JTH B;  3F5H A;  3U1C A;  2OTJ P;  2KYV A;  1JM0 A;  5AVW B;  3F89 A;  3L73 E;  1IK9 A;  3L74 G;  1HJ0 A;  1WMK A;  1PGJ A;  5KLV E;  1KTM A;  2IPP A;  3ITK A;  3P8M C;  1HUC A;  1W5C E;  4B86 A;  3HUS C;  2K9J A;  1SQP D;  2XDJ A;  1FZF A;  3A0H H;  2JEE A;  5AVU B;  2YNY A;  4NPD A;  1HGV A;  3TNU B;  4Z1M H;  3CCE P;  1OW7 A;  1URQ B;  1X22 A;  5AW8 B;  1SFC A;  2KS1 A;  2P58 A;  3RK3 D;  1VQL P;  2A45 G;  3JCU H;  3VMY A;  2XZR A;  5KLV D;  1KIL E;  2HYN A;  2JDI H;  2QJK B;  2QSI A;  2P10 A;  2D2C B;  4H13 D;  2JWA A;  2O01 H;  1L4A B;  1FAV A;  5DJU B;  1R5S A;  1JMB A;  2M8R A;  1NTK E;  2IFM A;  5KLV K;  1SVF A;  4HH2 A;  2HPC A;  2NPS D;  1M56 D;  1X79 B;  3LW5 J;  4EYY Q;  4DJG A;  2Y9Z A;  5AW2 B;  2E74 D;  1VQ9 P;  3L73 J;  4ZKU A;  3VP9 A;  5CBN A;  4N78 D;  3VP8 A;  3L37 A;  3H1L D;  1D7M A;  4QMA A;  2Y9Y A;  3Q3D A;  4Y99 B;  1VQM P;  2JR8 A;  3AEA C;  2P7J A;  4C7R A;  2J59 M;  2LR2 A;  3HTK A;  2BCC E;  1T2K C;  3L74 J;  4XFJ A;  2HOD B;  3CC7 P;  4AYC A;  2K3R A;  1FZC B;  2QJP B;  3RK3 B;  2I1J A;  1RQU A;  2HLO A;  1HVV A;  1GL2 C;  3H1J G;  1Q2N A;  3B5N A;  4N78 E;  1M8O B;  1P84 E;  1BE3 D;  1LTJ C;  3CCS P;  4IFF A;  2YKQ A;  3H1I G;  2CPB A;  2WSS H;  3W68 A;  1U7J A;  3AE2 C;  1QVF O;  2WPQ A;  4H0L B;  1DH3 A;  4I1L A;  1SQQ E;  1HBW A;  4RES B;  2A06 E;  5KTB A;  3MIW A;  2D2C C;  2K1A A;  1WRG A;  2RMZ A;  3Q5R A;  2ZYD A;  2OGU A;  1H89 A;  3M0A A;  2O01 J;  2FYU G;  3JCU E;  3KYQ A;  1RY3 A;  3D6Z A;  3CCQ P;  2JWD A;  1L0N D;  3I55 P;  1USE A;  1ZRT E;  3RK2 B;  1YQ4 C;  3N7N A;  1IFM A;  4WBA A;  1T2K D;  2R5D A;  3L71 J;  3H1I D;  1P84 H;  3OA7 A;  1SQQ D;  1BDD A;  3WU2 H;  3Q5P A;  3TK1 A;  2E43 A;  1KIL B;  4OGQ B;  1YYC A;  3U1A A;  2CK3 H;  2UWJ E;  1KD1 Q;  1PV3 A;  3H1L J;  1N73 C;  1LGH B;  1N73 A;  1TU3 F;  5AW0 B;  1KFM A;  2FYU D;  1SQB J;  1SQB E;  4IFM A;  4H0L D;  4NPF X;  3T97 A;  1KC8 Q;  1EDI A;  2K9J B;  1VQ8 P;  1EDL A;  3B4S A;  3S4R A;  1T6A A;  5H2F E;  1EZV I;  1LWU B;  2FYU K;  3CWB D;  1MFZ A;  4ZNC A;  3E1R A;  3GLM A;  3L73 G;  4IL6 E;  4JQ0 D;  4LC1 A;  4N3Y B;  2OYO A;  5E79 H;  1OFC X;  1RHZ B;  1DD3 A;  1IJD B;  1J2J B;  1SFC B;  3H1H E;  1FDI A;  2R5B A;  1FC2 C;  2IX7 C;  2MJZ A;  2ZYG A;  3IF4 A;  1YBK A;  3L4F A;  2ZJS E;  3RL0 C;  3O6Q B;  1SQQ G;  2KSJ A;  1SQV G;  5B5E H;  2J5U A;  1PP9 E;  3L72 D;  5CCG C;  1KMI Z;  3E1I A;  3MTU E;  2WSC J;  3I56 P;  1H88 A;  1ZOY C;  4TLF A;  1LTJ A;  2Y0E A;  4D6T E;  2AXT E;  2NPS A;  2XNX A;  1JOC A;  3CX5 D;  3FX0 A;  3H6P A;  3RK2 C;  3RK3 E;  2HPC B;  1Q82 Q;  1JEK A;  1GK6 A;  1NAF A;  3H1J E;  4L76 A;  1VQO P;  2WQY C;  1RE4 A;  1QL1 A;  2KLU A;  5APT A;  1VQ6 P;  1NTZ D;  3Q1M A;  1Y47 A;  2WPS A;  3D70 A;  2E74 C;  2JP3 A;  2P1J A;  2ZXE B;  4PD4 D;  3VOP A;  1VQ5 P;  1RF0 C;  2E76 C;  1FU1 A;  5CJ0 A;  2O01 N;  2IYO A;  1NJI Q;  2W83 C;  2WZ7 A;  1JCD A;  3CXH D;  4GT1 A;  2Q5U A;  2B87 A;  2OTL P;  2C0X A;  1IC2 A;  4PV1 C;  3RBX A;  4GOE A;  4UB6 E;  1URQ A;  2FBW C;  4GDO A;  3GF3 A;  3RK3 C;  1FZC C;  4BRY B;  2W27 A;  1YIJ P;  3M06 A;  2KS1 B;  1W2B O;  1FDM A;  3A7O A;  1IFP A;  1OVU A;  1T3J A;  2FYZ A;  2Q3E A;  3L71 D;  5AW1 B;  2IDB A;  4Y99 C;  4BWN A;  2OYH B;  2FXO A;  2WPR A;  4EDF A;  1SQB K;  1SFC C;  1OWA A;  2POH A;  1NTZ E;  2QJY C;  5AVZ B;  2AEJ A;  3AEB C;  1LT9 C;  3ABV C;  3AEE C;  1NTM K;  2B88 A;  2ZVN B;  3CX5 H;  3H32 A;  1MKM A;  1NTZ G;  2AEM A;  5B66 E;  1ZLL A;  1FS0 E;  2WTY A;  2Z5H A;  3MUD A;  2JKV A;  1SQB D;  1RE3 A;  1KIL A;  1KYO D;  1FOS F;  4L74 A;  1SQP J;  1KQG B;  3W67 A;  1CI6 B;  2N1T B;  1FZB A;  1VL2 A;  2QJK C;  1KB9 H;  3GMA A;  4DZO A;  2E74 B;  1BCC G;  5C39 A;  1QLE D;  2A45 I;  4H44 C;  1GK4 A;  4I6M C;  2Q3I A;  5TIS H;  1RF1 C;  5EFW B;  2HFE D;  2Y0D A;  1JB0 J;  2FY8 A;  2YO3 A;  4O9B A;  3B5N D;  3L75 J;  3L72 G;  1BSH A;  3NXS A;  4LGD E;  1AVY A;  1LWU A;  3WMM 0;  1NTZ K;  5KJ7 A;  1EZV D;  1GU5 A;  1NU1 K;  2Z4E A;  1QVG O;  5CCH C;  1IFN A;  3M0D A;  1IO4 A;  3RL0 B;  2G3A A;  1KYO I;  3CL3 D;  3AE1 C;  2WSE H;  3GHG A;  3G4S P;  4H44 B;  3WU2 E;  5KJ7 D;  5B5E E;  3CCV P;  1EXJ A;  4H44 D;  1NU1 E;  1X8Y A;  2O3J A;  4D6T G;  3M0D C;  4ZMD A;  2NPS B;  3UIA A;  2KNC B;  1PGP A;  3USS A;  4JYB A;  5KLI B;  1LTG C;  1LTJ B;  3A0H E;  2WMM A;  5APX A;  2BEZ F;  3H1H G;  2DW3 A;  4C7N B;  2YMK A;  1KZU B;  3MD0 A;  3N4X A;  3BRV B;  1OVR A;  2M3B A;  1KQL A;  2M5A A;  2QJY B;  5AVX B;  1M1K Q;  1H0T B;  3EFF K;  3NMD A;  1IZN B;  1VF5 B;  4JBZ A;  1EQ7 A;  3CCU P;  4D6T D;  1OX3 A;  1SFC D;  1PPJ G;  4IFD K;  3CMA P;  1SQP E;  1M1J B;  1SS1 A;  2B87 B;  1AVO A;  2IBZ G;  1RH5 B;  1KN7 A;  1KB9 D;  1PZQ A;  2I8D A;  2RN0 A;  4M3L A;  3HD7 C;  2BEQ D;  2QRX A;  1MV8 A;  1S4X A;  4L75 A;  2C9N Y;  1RE3 C;  4BRY A;  3MUD C;  2E75 C;  4EOT A;  2HG5 D;  1AV1 A;  1GW4 A;  3A2A A;  3HE5 A;  4PD4 E;  3TGU J;  1P84 I;  1LT9 A;  1FZE A;  3E7K A;  3QWO C;  1NH4 A;  2FYN B;  4RO0 A;  4YPC A;  5TIS E;  1G2C B;  2Q7C A;  3OW2 O;  1L4A C;  1BE3 E;  1KV4 A;  1JY2 P;  1NTM G;  4WY4 D;  2QA4 P;  4H0L C;  2ZT9 C;  1PP9 J;  1L0L J;  3IN6 A;  2E5Y A;  3SSU A;  3VTP C;  4K3A A;  4EI2 A;  1YHQ P;  3EQ2 A;  3VMZ A;  2GM4 A;  4C46 A;  1EZV E;  5AVT B;  1BCC D;  1YI2 P;  1L0L G;  2A45 H;  2FYU E;  1A02 J;  1K04 A;  3BAS A;  2YXR B;  1LT1 A;  1S9K E;  3HD7 B;  1S3J A;  1WT6 A;  2VRS A;  3MGN A;  2LXC B;  5BU5 A;  1KFN A;  3PHL A;  2A06 G;  3IR9 A;  1SQV K;  1E5W A;  1PPJ D;  1BGY J;  3TDK A;  3CWB J;  4GKG A;  5CHX A;  2W90 A;  3TYY A;  5CJ4 A;  1N86 A;  1CI6 A;  1XTC C;  3L35 A;  5KKZ C;  3H1I E;  3L36 A;  3WUT A;  2RH0 A;  1RF0 A;  3GHG C;  3H1L G;  5H2F H;  5CCG D;  1SQX G;  2KSE A;  2H88 C;  2KB7 P;  3V2Q A;  5CCH A;  1S72 P;  3CCM P;  1ZP0 C;  3H1L E;  1Y8A A;  3QH9 A;  5AVQ B;  1HF9 A;  1ZR4 A;  2QM7 A;  1LTA C;  4WWI A;  3CD6 P;  2OQQ A;  2R44 A;  1ZXG A;  2ZT9 D;  3CX5 E;  3HRN A;  2KLV A;  3M9H A;  2HR3 A;  4WY4 C;  1S5L H;  4ZKP A;  2ZYA A;  5CCG A;  2ITA A;  1ZV8 A;  1FZA A;  1L0N J;  1SQQ K;  2FXM A;  2N1T D;  2NZ2 A;  2ZAE B;  1M7L A;  5AW5 B;  1L0L E;  2IBZ I;  3Q5S A;  4I7Z B;  3GHG B;  2JJL A;  5M1B A;  1MFT A;  4EIJ A;  1SQQ J;  3H32 B;  1JO5 A;  3C9I A;  1SQX K;  1X0T A;  1T3U A;  2Z5I A;  3FXE A;  3CCR P;  1BE3 J;  3R2P A;  2N9Y B;  1KIL C;  3C1L A;  4OGQ C;  1GU4 A;  1URQ D;  3AEF C;  3H1J J;  1JY3 O;  4YXD C;  3NTN A;  1VQK P;  1ZW0 A;  3A0B H;  1NO4 A;  3H1K D;  4NPE A;  5TJH A;  3WUU A;  4C7N A;  1H0T A;  2AEF A;  1ZN5 A;  2WWW A;  2N1T C;  2AXC A; 
#chains in the Genus database with same CATH homology
 3H1I G;  4D6T G;  3TGU G;  3L70 G;  1NTM G;  2BCC G;  1SQP G;  1PP9 G;  5KLV G;  1L0N G;  1KB9 H;  3L73 G;  1BCC G;  3H1H G;  3BCC G;  1L0L G;  2FYU G;  3CXH H;  1EZV G;  3CWB G;  4U3F G;  3L75 G;  3L74 G;  1NTK G;  2A06 G;  1SQQ G;  1P84 H;  1SQV G;  1PPJ G;  3L71 G;  4PD4 H;  2IBZ G;  3L72 G;  1BE3 G;  1NU1 G;  1BGY G;  3H1L G;  1SQB G;  1SQX G;  3H1J G;  3H1K G;  3CX5 H;  1NTZ G;  1KYO H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...