3TGUG

Cytochrome bc1 complex from chicken with pfvs-designed moa inhibitor bound
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational discovery of picomolar Q(o) site inhibitors of cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 17
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2011-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3tguG00
2FYUG 3L71G 1BE3G 4U3FG 1PPJG 1EZVG 1NTKG 4D6TG 1BGYG 3L75G 3L70G 3L74G 3TGUG 1NTMG 1SQQG 3BCCG 3H1JG 3L72G 1KB9H 1SQXG 3CXHH 1NTZG 3H1HG 1L0NG 1SQBG 3L73G 1P84H 2A06G 4PD4H 3H1IG 1PP9G 1SQPG 1L0LG 3CWBG 2IBZG 3H1KG 3H1LG 3CX5H 1BCCG 1SQVG 2BCCG 1KYOH 5KLVG 1NU1G
chains in the Genus database with same CATH superfamily
1MFZA 4RKUJ 2Q3EA 4RO0A 3RL0D 3TYYA 2OTLP 2H88C 1T2KC 2QG4A 1M7LA 4OWFA 2WMMA 1L0LE 1J1EC 3L70E 4C7NA 2N9YB 5GTIH 3L70G 4AUWA 3FWLA 4RJTA 5AW8B 3WMM0 2E76C 2L91A 1L4AA 2ZXEB 1M90Q 2IZ1A 2J58A 3T97B 2BEZF 2P2UA 2HLOA 1KQSO 1DEEG 2MJZA 2Q9IA 1SQVJ 2WPQA 1SQPD 1YTZI 1AJYA 1LTAC 4AQRD 5BU5A 2GUVA 1N73B 3N7NA 3W68A 1KB9D 1BSHA 3H1KG 1MV8A 2IBZG 3AECC 1GK6A 4OVNF 1NOHA 3CX5E 1VL2A 3HE4A 1FJKA 1P84I 5L8RJ 2AXTE 1HUCA 2W6JH 2YXQB 2ZVNB 4UB8H 3SFDC 2QJPB 2OYIB 1H0TB 3RBZA 1LGHB 4ZMDA 1BE3D 2NPSB 1WMKA 1CZQA 3RK2D 2FYZA 1SQBE 3K5BA 2Q7CA 4GT1A 1SFCA 1FAVA 2JEEA 2JWAA 3Q1MA 1FJPA 3GW6A 2B89A 2VRSA 3MD0A 3TNUA 3VTPC 1HF9A 2WSEJ 1OW8A 3AE1C 1FZEA 1KQLA 3F5HA 3A0BH 5KLIB 2WQYC 1KQGB 2B87B 2WSCJ 3TGUJ 3L73G 5K5GB 3KZIE 1FZFA 4LLHA 1GL2B 1LWUB 2Q6QA 3KXDA 1SQBD 1N86A 2O01N 1FZBA 4IFFA 4U3FE 3EQ2A 4H44B 2QJYC 4M3LA 2I1KA 1JOCA 4GDOA 1D7MA 1OZHA 1Y47A 1PPJD 3H1IE 1FZCA 1VQNP 1KFMA 4H13B 4WVZA 4JYBA 1KYOH 3AE5C 2W27A 5APYA 1OMIA 4H0LC 4KT0J 5CCGA 1KILA 3A2AA 3WU2H 1JMMA 1R5SA 1YYCA 1ZR2A 1SQBK 2QA4P 2LXBA 1Q90D 1RF1B 1SQQJ 1AVOA 1IK7A 1L0LK 2QIWA 1H89A 2KNCA 1VQPP 3CI9A 1QVGO 5CCGD 1NH4A 2NZ2A 3WUUA 2M3EA 4IFDK 3HUSB 1KV4A 3CCQP 4YXWH 1PGJA 3GF3A 1M1JB 1NO4A 1M57D 1OVRA 3H1JG 3HD7C 3A0HE 3CWBJ 4N3YB 3FX0A 1YJNP 1FOSE 5KJ7A 1VQLP 2YIUC 1VQ8P 1P84H 3A5TA 3CCLP 2H7HA 1YIJP 5AVUB 1G2CA 2QVAA 2Q5UA 3M06A 2WSCH 2WSSH 4XFJA 2A06E 2A45H 2OGUA 3HE4B 4U3FJ 2AEMA 2OARA 2BEQD 5TJHA 1TU3F 3S9OA 2KOGA 4GIFA 2N1TB 3B5NA 1MUUA 5AW0B 5GTHH 2RMZA 2IZ0A 4JYCA 5APSA 1BGYD 2R5BA 2D2CC 3C1LA 3EFGA 2V7QJ 2OTJP 1PV3A 1SQPK 2J59M 4UB6H 1KC8Q 2OYIA 1KD1Q 3P8MC 2AXCA 2YNYA 4GOEA 3KHUA 2A06D 1SVFA 5APWA 3V2NA 1L2PA 1NJIQ 4IOIH 1EDKA 1JM0A 1HGVA 2HG5D 1EC5A 1N8RQ 1OW7A 1YQ4C 1HWTC 2HPCB 2POHA 2Y0DA 1M8OB 3TF5A 3O6QA 1PP9G 1X9VA 4UB8E 3CPWO 2E75B 5APQA 2FXMA 2Z5IA 1K73Q 2GM4A 1AFOA 5EFWB 1K04A 3CX5H 1BE3J 2OYHB 3CWBD 4I7ZC 4H0LD 1T3JA 3H25A 3OW2O 2N9BA 1EDIA 1S9KE 2KZJA 3I55P 3E7KA 2WT7B 1QX8A 1ZV8A 2WTYA 5APUA 4BRYB 2W8ZA 1MZ9A 2QJYB 2IX7C 4BWNA 1QGKB 1K05A 1NTKG 4HB1A 3VP8A 2P1JA 5CCGC 3U1AA 5CJ4A 1GMJA 1LTIC 1E79H 1HGZA 2JJLA 4GKGA 1WRGA 3CC4P 3SWYA 1SQVE 1YBKA 2V7QH 3U1CA 5B66H 3SFEC 1VF5D 3P8CD 1SQQK 1IFDA 1SQXE 1KB9H 3RK3B 1A02F 3L70D 3KYQA 4ZNCA 2KS1A 3IFMA 1NTZD 3H1LE 4PV1C 5CMZA 1H88A 3CCUP 3VOPA 1IFNA 2KXPB 3EWKA 4Z1MH 1T3UA 5TISH 4UB6E 5CHXA 1JO5A 2FYNC 1RQVA 3E1RA 1NTMK 2R3SA 1EQ7A 4W7ZA 3CC7P 1VQ6P 2IDBA 1LTJB 4H44D 3TK1A 2KYVA 3IF4A 5H2FE 3P8CE 2B88A 2D2CD 1AA0A 1KB9E 1SFCB 2WPVB 5KLVE 3SSUA 5CCHD 3M9QA 1NGMB 1KYOI 5CBOA 3PP5A 1W5CE 3L73E 1N7SD 1LWUC 3L75G 3NXSA 5AVSB 1N73C 1G2CB 1YHQP 4D6TE 5B5EE 3CXHI 1VQ9P 2JO1A 4RESB 1DD4A 1HJ0A 1URQC 3M91A 2E42A 4D6TJ 4C46A 1OVUA 5AVWB 2RN0A 3D71A 1JMBA 1N7SB 1LT1A 1MKMA 1GK4A 2KK7A 3O8ZA 3Q5SA 1ZMEC 1KQFB 1UIXA 1FS0E 1U57A 2HR3A 3CWBG 3H1LG 1H8AA 2NPSC 1PGQA 4D6TD 3CL3D 3U59A 3VMZA 3F89A 2FY8A 2ZVOB 3LIEA 4XE5B 3V4WA 4YXDC 2RH0A 1AV1A 2FKWB 4PJ0E 4U3FD 5KAFH 3WU2E 2E5TA 2WZ7A 3CCEP 2KZIA 3PLNA 1PPJG 2ZT9C 2CPBA 1JNMA 1RHZB 3MHVA 3WUVA 3IR9A 1JY2N 3BCCD 3B5ND 3HUSC 3PH0A 2AEJA 2KLUA 5BVZA 2KI7B 3V2RA 3G3ZA 2FFDC 3L75E 3TGUG 1QLED 4Y28J 1BCCE 3Q3DA 1GDTA 3AE2C 4TLFA 1YI2P 3AE9C 1ZXGA 3KZIH 2PAJA 1W2EA 3VMAA 5DJUB 4EIJA 4NPEA 3VP9A 1NTZG 5GTHE 2ZYGA 1S5LH 3M0DA 1S3JA 3A0BE 3HTKB 2CK3H 2PFXA 3M9HA 4L76A 4U7JA 1S4XA 3H1IG 5KAIE 1N7LA 1Z56A 3TNUB 4ASWA 5KLVJ 1QL1A 3AEDC 3CCRP 4LGDE 1VQ4P 4W7YA 5M1BA 1YQ3C 3AEBC 3D6YA 4H44C 4KHXA 5APXA 1NTME 1SS1A 1Q86Q 4YTPC 1GD2E 1BCCD 4AYCA 1EDLA 3SWKA 3BATA 4H13C 4K3AA 2WITA 2WPRA 2K9JB 5CCHC 2QEXP 4WY4A 4CPGA 3Q2YA 3EFFK 2M5AA 3HD7A 2KUBA 2HFED 1FE6A 1GU5A 1M1KQ 4EYYQ 5AVVB 1OVVA 1SQXJ 3M0AA 3OA7A 2QJKB 4HKZH 3IN6A 3KPEA 2HYNA 5AVRB 1SLQA 1L4AB 1EDJA 1NTKJ 5C39A 5KAFE 3V2QA 2HODB 1VQOP 1GU4A 2HPCA 1KB9I 1LTJA 1XTCC 3AEFC 1A02J 2GA1A 1KTMA 1X22A 3V6IA 3G4SP 3VN0A 3P7KA 1RF0C 2A06G 2W6AA 1LT9B 1JTHA 5APVA 5BU8B 1JY3O 1JCCA 2FYNB 1S1CX 1JEKA 1LP1B 2H8PD 2I8DA 3CLQA 2PRRA 5GTIE 1YJWP 2Y9ZA 2P58A 2IFMA 2YMKA 1U7MA 3L37A 3SWFA 4PD4I 4ZKPA 1LT9C 1RE3A 1Q7YQ 3H32A 1M1JA 1PP9D 2NPSA 1CW5A 1GL2D 1PGOA 2ZYAA 3TGUD 5B5EH 1U7JA 3S1KA 2O3JA 4WY4B 3CWBE 2O1KA 4K35A 1UIIA 2IFNA 3B4SA 2P10A 3BRTB 4YPCA 4NPFX 3D6ZA 1T2KD 2KP8A 2K3RA 2N1TA 3RK3C 3I56P 2Y0EA 2ITAA 3PTZA 2E74B 3KDPB 1JY2O 2FBWC 3L75J 3CCJP 2B87A 2ZT9B 3H1JE 3B5NB 1PP9E 1SQQE 1PPJE 2L5GB 2KSJA 2QRXA 3H1ID 1NAFA 1DD3A 1IFPA 3MUDC 2FYUJ 1JTHB 1Y9BA 1IZNB 2OQQA 3RL0g 1SQXD 3A3YB 3BASA 1CI6A 3AE6C 1J1DB 2C9NY 3AE3C 3H1KD 3CCMP 1P84D 2BCCG 3ITKA 2W6BA 3CCVP 3JSVC 1LTBC 3RK2C 1OWAA 4I7ZB 4DJGA 1FU1A 1KILB 1NTZK 5AVXB 3G6EP 3H1LJ 1RF1A 1LNQA 1T6AA 2JR8A 2M3BA 2C0XA 2E75C 2M5AB 2QM7A 3HD7B 3IAOA 3L36A 1VPCA 2ZYDA 1VDFA 2KNCB 3R2PA 1ZOYC 3L71J 4W80A 3LIDA 1L0NJ 2K9YA 3ABVC 2W90A 1NTMG 5E79H 3Q5RA 2LR2A 1FDIA 1L0LD 1FZCC 5AW3B 3L73D 2IYPA 4L74A 3T97A 3CMEP 2Y0CA 1SFCC 3Q5PA 3FXEA 1ZRTD 1SQBG 1SP4A 2FXPA 4HYTB 1LTJC 1G1JA 2JWDA 3H1HE 1YTZT 3RK3E 2K1AA 4BXLA 1EXIA 3E1IA 2D2CB 4N6JA 3RGUA 3NMDA 4JF7A 3L71D 4WY4D 3N4XA 1RF0A 3S4RA 2LXCB 2YO2A 1X8YA 4EI2A 4MN4C 3H1IJ 5KLVG 1AQ5A 2G3AA 1JY3N 3OAKA 3BRVB 2WT7A 2GUSA 1G1IA 2R3CA 2HODA 2R32A 5KKZC 3CC2P 1LT9A 3GHGC 1EZVE 5KAIH 3WUTA 1JCDA 1EZVG 1KZUB 1L0NE 2KLVA 3AEAC 5KLIC 4D6TG 2OTKE 1S5LE 1USDA 2FYUD 3I5CA 1E5WA 3H1HD 3JCUE 3L72J 2XKMA 3PHLA 4N78E 4OH8B 1S5LX 3RK3D 2XZRA 2XV5A 2H43A 3V2PA 3C9IA 1IK9A 3H1JD 3HD7D 3L74E 3BVHA 2NRGA 2E43A 4LC1A 1L0LJ 1URQB 2K37A 3BCCG 4I2LC 4OGQB 1SQXG 3L74J 5DJTB 5AVTB 2ZFCA 4ASVA 3G71P 2KS1B 4GODA 2A45G 3CMAP 3NTNA 1PGPA 2W83C 1NU1J 2IBZI 2WPSA 1N2DC 2IBZE 2KB7P 1GL2A 1LTSC 3MP7B 2BCCD 1IFJA 3CX5I 2FYUE 3HE5A 4PJ0H 5AVYB 1W2BO 1KN7A 2ZJSE 5KTBA 3A0HH 2Q3IA 1N7SA 5AW9B 2E5YA 5KJ7C 1X0TA 4PV1B 1FC2C 1AQTA 1BSNA 2E75D 3L74D 3RL0C 1NHLA 1OXZA 2N1TD 1JY2P 3W67A 4C7RA 1S2EA 1BGYG 5CJ0A 1LTTC 1L4AC 3M0DC 2E76B 5E79E 2Y9YA 3H1HJ 1NTZJ 1T8ZA 5AVZB 3GF7A 1EZVI 1SQVK 1JB0J 3RBXA 4OGQC 2B9BA 2BCCE 3HUSA 1NTZE 3MIWA 3TSIA 1YJ9P 1HJBA 1SFCD 1ZRTE 1SQPJ 2KSEA 1KYOE 2M0BA 2P7JA 2Z5HA 4JPZB 1LJ2A 3CXHH 3L70J 3P32A 3II6A 2CPSA 4KJMA 4DCKA 1BCCJ 5AW5B 3L71E 1VQ5P 2MKVA 3LW5J 4WY4C 3RL0B 3ZDMA 2V4HA 1NKZB 4A7PA 2FFDA 2A45I 1RE4A 1QL2A 1SQVG 5KLVD 1FZGA 3GG2A 2FYUG 4IL6X 4JQ0D 2ZXXA 5KLVK 1MFTA 4O9BA 1ZLLA 3H32B 1KYOD 1FZAA 1FDOA 2C0WA 1ZP0C 2BCCJ 4N78D 1BDCA 2WSEH 2QSIA 2XNXA 1NU1D 4IL6E 4EOTA 1JY3P 1QEXA 3GHGA 1SQPE 3VYIA 3V5BA 1BGYE 1USEA 1VF5C 1WT6A 2WWWA 3FGAD 3TGUE 3CD6P 1PIXA 1CSBA 2G8YA 4WBAA 1KFNA 1KMIZ 1RH5B 2AXTH 1VF5B 2LKMA 3CXHE 3PRJA 4PV1D 2QE7H 1VQ7P 1L0NG 1NTMJ 3GMAA 1IC2A 4H0LB 1BE3E 1NTKK 1HH0A 2WVRA 2YXRB 4R4LA 3GHGB 1S72P 2RKLA 1N73A 1NU1E 1Q82Q 1IJDB 5KJ7D 1KILC 1SQBJ 4ZKUA 1H0TA 2N1TC 1VQKP 3BCCE 1URQA 1J1DC 2SPZA 3AEGC 4QMAA 3GLMA 1N7SC 3L75D 1NKNA 4L75A 1L4AD 1M1JC 1PZQA 3H1KE 3HE5B 4DZOA 2E74C 2FXOA 2XNDH 1PFIA 4WWIA 1LP1A 2H89C 1URQD 2WSFH 2YIUB 4OGQD 3VMXA 3C8VA 3MUDA 2PP6A 2JKVA 3FWNA 2FYUK 1SQQG 1IO4A 2KIKA 3L72G 1HTLC 3H1KJ 3L72E 3AE4C 1LWUA 2JDIH 1SQVD 2FFDB 2K88A 3HTKA 3UIAA 1ZR4A 1EXJA 1NTMD 2DW3A 4PD4H 5AW1B 1GTWA 1BDDA 1RF1C 1L0LG 2NPSD 2ZAEB 3BCCJ 3MTUE 4C7NB 1R5LA 1QVFO 3JCUH 4I6MC 1HBWA 2OYHA 5CBNA 3B8EB 3H1LD 5B66E 2YKPA 1NU1G 3OJAB 1NWQA 1NAYA 2XDJA 1RE4C 2K9JA 3O6QB 2P67A 3L71G 1L0NK 1PL5A 4I1LA 4U3FG 3KQGA 4WB4A 5AW4B 4DOJA 2BASA 2JP3A 1ZN5A 1R8EA 4HJGH 1KILE 5AW7B 2R44A 5H2FH 1Q81Q 4Y99B 1RQUA 2ZT9D 2O01H 3FXDA 1Y8AA 4HH2A 4PD4E 2IYOA 2I1JA 1GW4A 3B5NC 3R4YA 3L73J 3QH9A 1GW3A 5TISE 3HRNA 1YITP 3CXHD 1K8AQ 1EZVD 1BGYJ 2E76D 1ZW0A 1DIPA 2OYOA 4TT3H 1L0ND 2AEFA 3MGNA 3MZWB 1DH3A 2O01J 3H1HG 2QJKC 4DT0A 2C9LY 2QM8A 4IFMA 4R4MA 4Y99C 3B71A 2OYIC 1M56D 1SQPG 2Q1KA 3AE8C 2YKQA 3G9RA 1KILD 3JC22 3L4FA 5APTA 2M8RA 4JBZA 4PD4D 3VMYA 1BCCG 1CI6B 4B86A 1KORA 1DX7A 3V4QA 2QJPC 4XA4A 1PP9J 2XU6A 1OIPA 3AE7C 3CX5D 1SQXK 2R5DA 1XTGB 2IBZD 1J2JB 4EDFA 4H13D 1BE3G 2E74D 5AW6B 3AEEC 3H1JJ 1AVYA 2YKOA 4GOFA 3L74G 1NTKE 2O1JA 1SQQD 3M9BA 1DEBA 1J1EB 1OFCX 2IPPA 3L72D 3LW5H 1IFIA 1NU1K 3PJSK 5CCHA 2YMYA 1FZCB 2J5UA 2YO3A 1GZLA 2WSFJ 4NPDA 3TDKA 1RY3A 2UWJE 1K9MQ 3A7OA 1FBMA 1OX3A 1RE3C 3L35A 5AVQB 3CCSP 2Z4EA 1JUNA 1S9KD 3QWOC 1FDMA 1P84E 4IL6H 1NYHA 1VQMP 1X79B 4L73A 1OW6A 1IFMA 3D70A 1HVVA 3H6PA 5KKZB 5AW2B 3NFQA 1NVOA 1NTKD 1Q2NA 3RK2B 3USSA 4BRYA 1GL2C 2PGDA 1LTGC 1FOSF 2OYHC
chains in the Genus database with same CATH topology
2FYUG 3L71G 1BE3G 4U3FG 1PPJG 1EZVG 1NTKG 4D6TG 1BGYG 3L75G 3L70G 3L74G 3TGUG 1NTMG 1SQQG 3BCCG 3H1JG 3L72G 1KB9H 1SQXG 3CXHH 1NTZG 3H1HG 1L0NG 1SQBG 3L73G 1P84H 2A06G 4PD4H 3H1IG 1PP9G 1SQPG 1L0LG 3CWBG 2IBZG 3H1KG 3H1LG 3CX5H 1BCCG 1SQVG 2BCCG 1KYOH 5KLVG 1NU1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU G;  3L71 G;  1BE3 G;  4U3F G;  1PPJ G;  1EZV G;  1NTK G;  4D6T G;  1BGY G;  3L75 G;  3L70 G;  3L74 G;  3TGU G;  1NTM G;  1SQQ G;  3BCC G;  3H1J G;  3L72 G;  1KB9 H;  1SQX G;  3CXH H;  1NTZ G;  3H1H G;  1L0N G;  1SQB G;  3L73 G;  1P84 H;  2A06 G;  4PD4 H;  3H1I G;  1PP9 G;  1SQP G;  1L0L G;  3CWB G;  2IBZ G;  3H1K G;  3H1L G;  3CX5 H;  1BCC G;  1SQV G;  2BCC G;  1KYO H;  5KLV G;  1NU1 G; 
#chains in the Genus database with same CATH topology
 1MFZ A;  4RKU J;  2Q3E A;  4RO0 A;  3RL0 D;  3TYY A;  2OTL P;  2H88 C;  1T2K C;  2QG4 A;  1M7L A;  4OWF A;  2WMM A;  1L0L E;  1J1E C;  3L70 E;  4C7N A;  2N9Y B;  5GTI H;  3L70 G;  4AUW A;  3FWL A;  4RJT A;  5AW8 B;  3WMM 0;  2E76 C;  2L91 A;  1L4A A;  2ZXE B;  1M90 Q;  2IZ1 A;  2J58 A;  3T97 B;  2BEZ F;  2P2U A;  2HLO A;  1KQS O;  1DEE G;  2MJZ A;  2Q9I A;  1SQV J;  2WPQ A;  1SQP D;  1YTZ I;  1AJY A;  1LTA C;  4AQR D;  5BU5 A;  2GUV A;  1N73 B;  3N7N A;  3W68 A;  1KB9 D;  1BSH A;  3H1K G;  1MV8 A;  2IBZ G;  3AEC C;  1GK6 A;  4OVN F;  1NOH A;  3CX5 E;  1VL2 A;  3HE4 A;  1FJK A;  1P84 I;  5L8R J;  2AXT E;  1HUC A;  2W6J H;  2YXQ B;  2ZVN B;  4UB8 H;  3SFD C;  2QJP B;  2OYI B;  1H0T B;  3RBZ A;  1LGH B;  4ZMD A;  1BE3 D;  2NPS B;  1WMK A;  1CZQ A;  3RK2 D;  2FYZ A;  1SQB E;  3K5B A;  2Q7C A;  4GT1 A;  1SFC A;  1FAV A;  2JEE A;  2JWA A;  3Q1M A;  1FJP A;  3GW6 A;  2B89 A;  2VRS A;  3MD0 A;  3TNU A;  3VTP C;  1HF9 A;  2WSE J;  1OW8 A;  3AE1 C;  1FZE A;  1KQL A;  3F5H A;  3A0B H;  5KLI B;  2WQY C;  1KQG B;  2B87 B;  2WSC J;  3TGU J;  3L73 G;  5K5G B;  3KZI E;  1FZF A;  4LLH A;  1GL2 B;  1LWU B;  2Q6Q A;  3KXD A;  1SQB D;  1N86 A;  2O01 N;  1FZB A;  4IFF A;  4U3F E;  3EQ2 A;  4H44 B;  2QJY C;  4M3L A;  2I1K A;  1JOC A;  4GDO A;  1D7M A;  1OZH A;  1Y47 A;  1PPJ D;  3H1I E;  1FZC A;  1VQN P;  1KFM A;  4H13 B;  4WVZ A;  4JYB A;  1KYO H;  3AE5 C;  2W27 A;  5APY A;  1OMI A;  4H0L C;  4KT0 J;  5CCG A;  1KIL A;  3A2A A;  3WU2 H;  1JMM A;  1R5S A;  1YYC A;  1ZR2 A;  1SQB K;  2QA4 P;  2LXB A;  1Q90 D;  1RF1 B;  1SQQ J;  1AVO A;  1IK7 A;  1L0L K;  2QIW A;  1H89 A;  2KNC A;  1VQP P;  3CI9 A;  1QVG O;  5CCG D;  1NH4 A;  2NZ2 A;  3WUU A;  2M3E A;  4IFD K;  3HUS B;  1KV4 A;  3CCQ P;  4YXW H;  1PGJ A;  3GF3 A;  1M1J B;  1NO4 A;  1M57 D;  1OVR A;  3H1J G;  3HD7 C;  3A0H E;  3CWB J;  4N3Y B;  3FX0 A;  1YJN P;  1FOS E;  5KJ7 A;  1VQL P;  2YIU C;  1VQ8 P;  1P84 H;  3A5T A;  3CCL P;  2H7H A;  1YIJ P;  5AVU B;  1G2C A;  2QVA A;  2Q5U A;  3M06 A;  2WSC H;  2WSS H;  4XFJ A;  2A06 E;  2A45 H;  2OGU A;  3HE4 B;  4U3F J;  2AEM A;  2OAR A;  2BEQ D;  5TJH A;  1TU3 F;  3S9O A;  2KOG A;  4GIF A;  2N1T B;  3B5N A;  1MUU A;  5AW0 B;  5GTH H;  2RMZ A;  2IZ0 A;  4JYC A;  5APS A;  1BGY D;  2R5B A;  2D2C C;  3C1L A;  3EFG A;  2V7Q J;  2OTJ P;  1PV3 A;  1SQP K;  2J59 M;  4UB6 H;  1KC8 Q;  2OYI A;  1KD1 Q;  3P8M C;  2AXC A;  2YNY A;  4GOE A;  3KHU A;  2A06 D;  1SVF A;  5APW A;  3V2N A;  1L2P A;  1NJI Q;  4IOI H;  1EDK A;  1JM0 A;  1HGV A;  2HG5 D;  1EC5 A;  1N8R Q;  1OW7 A;  1YQ4 C;  1HWT C;  2HPC B;  2POH A;  2Y0D A;  1M8O B;  3TF5 A;  3O6Q A;  1PP9 G;  1X9V A;  4UB8 E;  3CPW O;  2E75 B;  5APQ A;  2FXM A;  2Z5I A;  1K73 Q;  2GM4 A;  1AFO A;  5EFW B;  1K04 A;  3CX5 H;  1BE3 J;  2OYH B;  3CWB D;  4I7Z C;  4H0L D;  1T3J A;  3H25 A;  3OW2 O;  2N9B A;  1EDI A;  1S9K E;  2KZJ A;  3I55 P;  3E7K A;  2WT7 B;  1QX8 A;  1ZV8 A;  2WTY A;  5APU A;  4BRY B;  2W8Z A;  1MZ9 A;  2QJY B;  2IX7 C;  4BWN A;  1QGK B;  1K05 A;  1NTK G;  4HB1 A;  3VP8 A;  2P1J A;  5CCG C;  3U1A A;  5CJ4 A;  1GMJ A;  1LTI C;  1E79 H;  1HGZ A;  2JJL A;  4GKG A;  1WRG A;  3CC4 P;  3SWY A;  1SQV E;  1YBK A;  2V7Q H;  3U1C A;  5B66 H;  3SFE C;  1VF5 D;  3P8C D;  1SQQ K;  1IFD A;  1SQX E;  1KB9 H;  3RK3 B;  1A02 F;  3L70 D;  3KYQ A;  4ZNC A;  2KS1 A;  3IFM A;  1NTZ D;  3H1L E;  4PV1 C;  5CMZ A;  1H88 A;  3CCU P;  3VOP A;  1IFN A;  2KXP B;  3EWK A;  4Z1M H;  1T3U A;  5TIS H;  4UB6 E;  5CHX A;  1JO5 A;  2FYN C;  1RQV A;  3E1R A;  1NTM K;  2R3S A;  1EQ7 A;  4W7Z A;  3CC7 P;  1VQ6 P;  2IDB A;  1LTJ B;  4H44 D;  3TK1 A;  2KYV A;  3IF4 A;  5H2F E;  3P8C E;  2B88 A;  2D2C D;  1AA0 A;  1KB9 E;  1SFC B;  2WPV B;  5KLV E;  3SSU A;  5CCH D;  3M9Q A;  1NGM B;  1KYO I;  5CBO A;  3PP5 A;  1W5C E;  3L73 E;  1N7S D;  1LWU C;  3L75 G;  3NXS A;  5AVS B;  1N73 C;  1G2C B;  1YHQ P;  4D6T E;  5B5E E;  3CXH I;  1VQ9 P;  2JO1 A;  4RES B;  1DD4 A;  1HJ0 A;  1URQ C;  3M91 A;  2E42 A;  4D6T J;  4C46 A;  1OVU A;  5AVW B;  2RN0 A;  3D71 A;  1JMB A;  1N7S B;  1LT1 A;  1MKM A;  1GK4 A;  2KK7 A;  3O8Z A;  3Q5S A;  1ZME C;  1KQF B;  1UIX A;  1FS0 E;  1U57 A;  2HR3 A;  3CWB G;  3H1L G;  1H8A A;  2NPS C;  1PGQ A;  4D6T D;  3CL3 D;  3U59 A;  3VMZ A;  3F89 A;  2FY8 A;  2ZVO B;  3LIE A;  4XE5 B;  3V4W A;  4YXD C;  2RH0 A;  1AV1 A;  2FKW B;  4PJ0 E;  4U3F D;  5KAF H;  3WU2 E;  2E5T A;  2WZ7 A;  3CCE P;  2KZI A;  3PLN A;  1PPJ G;  2ZT9 C;  2CPB A;  1JNM A;  1RHZ B;  3MHV A;  3WUV A;  3IR9 A;  1JY2 N;  3BCC D;  3B5N D;  3HUS C;  3PH0 A;  2AEJ A;  2KLU A;  5BVZ A;  2KI7 B;  3V2R A;  3G3Z A;  2FFD C;  3L75 E;  3TGU G;  1QLE D;  4Y28 J;  1BCC E;  3Q3D A;  1GDT A;  3AE2 C;  4TLF A;  1YI2 P;  3AE9 C;  1ZXG A;  3KZI H;  2PAJ A;  1W2E A;  3VMA A;  5DJU B;  4EIJ A;  4NPE A;  3VP9 A;  1NTZ G;  5GTH E;  2ZYG A;  1S5L H;  3M0D A;  1S3J A;  3A0B E;  3HTK B;  2CK3 H;  2PFX A;  3M9H A;  4L76 A;  4U7J A;  1S4X A;  3H1I G;  5KAI E;  1N7L A;  1Z56 A;  3TNU B;  4ASW A;  5KLV J;  1QL1 A;  3AED C;  3CCR P;  4LGD E;  1VQ4 P;  4W7Y A;  5M1B A;  1YQ3 C;  3AEB C;  3D6Y A;  4H44 C;  4KHX A;  5APX A;  1NTM E;  1SS1 A;  1Q86 Q;  4YTP C;  1GD2 E;  1BCC D;  4AYC A;  1EDL A;  3SWK A;  3BAT A;  4H13 C;  4K3A A;  2WIT A;  2WPR A;  2K9J B;  5CCH C;  2QEX P;  4WY4 A;  4CPG A;  3Q2Y A;  3EFF K;  2M5A A;  3HD7 A;  2KUB A;  2HFE D;  1FE6 A;  1GU5 A;  1M1K Q;  4EYY Q;  5AVV B;  1OVV A;  1SQX J;  3M0A A;  3OA7 A;  2QJK B;  4HKZ H;  3IN6 A;  3KPE A;  2HYN A;  5AVR B;  1SLQ A;  1L4A B;  1EDJ A;  1NTK J;  5C39 A;  5KAF E;  3V2Q A;  2HOD B;  1VQO P;  1GU4 A;  2HPC A;  1KB9 I;  1LTJ A;  1XTC C;  3AEF C;  1A02 J;  2GA1 A;  1KTM A;  1X22 A;  3V6I A;  3G4S P;  3VN0 A;  3P7K A;  1RF0 C;  2A06 G;  2W6A A;  1LT9 B;  1JTH A;  5APV A;  5BU8 B;  1JY3 O;  1JCC A;  2FYN B;  1S1C X;  1JEK A;  1LP1 B;  2H8P D;  2I8D A;  3CLQ A;  2PRR A;  5GTI E;  1YJW P;  2Y9Z A;  2P58 A;  2IFM A;  2YMK A;  1U7M A;  3L37 A;  3SWF A;  4PD4 I;  4ZKP A;  1LT9 C;  1RE3 A;  1Q7Y Q;  3H32 A;  1M1J A;  1PP9 D;  2NPS A;  1CW5 A;  1GL2 D;  1PGO A;  2ZYA A;  3TGU D;  5B5E H;  1U7J A;  3S1K A;  2O3J A;  4WY4 B;  3CWB E;  2O1K A;  4K35 A;  1UII A;  2IFN A;  3B4S A;  2P10 A;  3BRT B;  4YPC A;  4NPF X;  3D6Z A;  1T2K D;  2KP8 A;  2K3R A;  2N1T A;  3RK3 C;  3I56 P;  2Y0E A;  2ITA A;  3PTZ A;  2E74 B;  3KDP B;  1JY2 O;  2FBW C;  3L75 J;  3CCJ P;  2B87 A;  2ZT9 B;  3H1J E;  3B5N B;  1PP9 E;  1SQQ E;  1PPJ E;  2L5G B;  2KSJ A;  2QRX A;  3H1I D;  1NAF A;  1DD3 A;  1IFP A;  3MUD C;  2FYU J;  1JTH B;  1Y9B A;  1IZN B;  2OQQ A;  3RL0 g;  1SQX D;  3A3Y B;  3BAS A;  1CI6 A;  3AE6 C;  1J1D B;  2C9N Y;  3AE3 C;  3H1K D;  3CCM P;  1P84 D;  2BCC G;  3ITK A;  2W6B A;  3CCV P;  3JSV C;  1LTB C;  3RK2 C;  1OWA A;  4I7Z B;  4DJG A;  1FU1 A;  1KIL B;  1NTZ K;  5AVX B;  3G6E P;  3H1L J;  1RF1 A;  1LNQ A;  1T6A A;  2JR8 A;  2M3B A;  2C0X A;  2E75 C;  2M5A B;  2QM7 A;  3HD7 B;  3IAO A;  3L36 A;  1VPC A;  2ZYD A;  1VDF A;  2KNC B;  3R2P A;  1ZOY C;  3L71 J;  4W80 A;  3LID A;  1L0N J;  2K9Y A;  3ABV C;  2W90 A;  1NTM G;  5E79 H;  3Q5R A;  2LR2 A;  1FDI A;  1L0L D;  1FZC C;  5AW3 B;  3L73 D;  2IYP A;  4L74 A;  3T97 A;  3CME P;  2Y0C A;  1SFC C;  3Q5P A;  3FXE A;  1ZRT D;  1SQB G;  1SP4 A;  2FXP A;  4HYT B;  1LTJ C;  1G1J A;  2JWD A;  3H1H E;  1YTZ T;  3RK3 E;  2K1A A;  4BXL A;  1EXI A;  3E1I A;  2D2C B;  4N6J A;  3RGU A;  3NMD A;  4JF7 A;  3L71 D;  4WY4 D;  3N4X A;  1RF0 A;  3S4R A;  2LXC B;  2YO2 A;  1X8Y A;  4EI2 A;  4MN4 C;  3H1I J;  5KLV G;  1AQ5 A;  2G3A A;  1JY3 N;  3OAK A;  3BRV B;  2WT7 A;  2GUS A;  1G1I A;  2R3C A;  2HOD A;  2R32 A;  5KKZ C;  3CC2 P;  1LT9 A;  3GHG C;  1EZV E;  5KAI H;  3WUT A;  1JCD A;  1EZV G;  1KZU B;  1L0N E;  2KLV A;  3AEA C;  5KLI C;  4D6T G;  2OTK E;  1S5L E;  1USD A;  2FYU D;  3I5C A;  1E5W A;  3H1H D;  3JCU E;  3L72 J;  2XKM A;  3PHL A;  4N78 E;  4OH8 B;  1S5L X;  3RK3 D;  2XZR A;  2XV5 A;  2H43 A;  3V2P A;  3C9I A;  1IK9 A;  3H1J D;  3HD7 D;  3L74 E;  3BVH A;  2NRG A;  2E43 A;  4LC1 A;  1L0L J;  1URQ B;  2K37 A;  3BCC G;  4I2L C;  4OGQ B;  1SQX G;  3L74 J;  5DJT B;  5AVT B;  2ZFC A;  4ASV A;  3G71 P;  2KS1 B;  4GOD A;  2A45 G;  3CMA P;  3NTN A;  1PGP A;  2W83 C;  1NU1 J;  2IBZ I;  2WPS A;  1N2D C;  2IBZ E;  2KB7 P;  1GL2 A;  1LTS C;  3MP7 B;  2BCC D;  1IFJ A;  3CX5 I;  2FYU E;  3HE5 A;  4PJ0 H;  5AVY B;  1W2B O;  1KN7 A;  2ZJS E;  5KTB A;  3A0H H;  2Q3I A;  1N7S A;  5AW9 B;  2E5Y A;  5KJ7 C;  1X0T A;  4PV1 B;  1FC2 C;  1AQT A;  1BSN A;  2E75 D;  3L74 D;  3RL0 C;  1NHL A;  1OXZ A;  2N1T D;  1JY2 P;  3W67 A;  4C7R A;  1S2E A;  1BGY G;  5CJ0 A;  1LTT C;  1L4A C;  3M0D C;  2E76 B;  5E79 E;  2Y9Y A;  3H1H J;  1NTZ J;  1T8Z A;  5AVZ B;  3GF7 A;  1EZV I;  1SQV K;  1JB0 J;  3RBX A;  4OGQ C;  2B9B A;  2BCC E;  3HUS A;  1NTZ E;  3MIW A;  3TSI A;  1YJ9 P;  1HJB A;  1SFC D;  1ZRT E;  1SQP J;  2KSE A;  1KYO E;  2M0B A;  2P7J A;  2Z5H A;  4JPZ B;  1LJ2 A;  3CXH H;  3L70 J;  3P32 A;  3II6 A;  2CPS A;  4KJM A;  4DCK A;  1BCC J;  5AW5 B;  3L71 E;  1VQ5 P;  2MKV A;  3LW5 J;  4WY4 C;  3RL0 B;  3ZDM A;  2V4H A;  1NKZ B;  4A7P A;  2FFD A;  2A45 I;  1RE4 A;  1QL2 A;  1SQV G;  5KLV D;  1FZG A;  3GG2 A;  2FYU G;  4IL6 X;  4JQ0 D;  2ZXX A;  5KLV K;  1MFT A;  4O9B A;  1ZLL A;  3H32 B;  1KYO D;  1FZA A;  1FDO A;  2C0W A;  1ZP0 C;  2BCC J;  4N78 D;  1BDC A;  2WSE H;  2QSI A;  2XNX A;  1NU1 D;  4IL6 E;  4EOT A;  1JY3 P;  1QEX A;  3GHG A;  1SQP E;  3VYI A;  3V5B A;  1BGY E;  1USE A;  1VF5 C;  1WT6 A;  2WWW A;  3FGA D;  3TGU E;  3CD6 P;  1PIX A;  1CSB A;  2G8Y A;  4WBA A;  1KFN A;  1KMI Z;  1RH5 B;  2AXT H;  1VF5 B;  2LKM A;  3CXH E;  3PRJ A;  4PV1 D;  2QE7 H;  1VQ7 P;  1L0N G;  1NTM J;  3GMA A;  1IC2 A;  4H0L B;  1BE3 E;  1NTK K;  1HH0 A;  2WVR A;  2YXR B;  4R4L A;  3GHG B;  1S72 P;  2RKL A;  1N73 A;  1NU1 E;  1Q82 Q;  1IJD B;  5KJ7 D;  1KIL C;  1SQB J;  4ZKU A;  1H0T A;  2N1T C;  1VQK P;  3BCC E;  1URQ A;  1J1D C;  2SPZ A;  3AEG C;  4QMA A;  3GLM A;  1N7S C;  3L75 D;  1NKN A;  4L75 A;  1L4A D;  1M1J C;  1PZQ A;  3H1K E;  3HE5 B;  4DZO A;  2E74 C;  2FXO A;  2XND H;  1PFI A;  4WWI A;  1LP1 A;  2H89 C;  1URQ D;  2WSF H;  2YIU B;  4OGQ D;  3VMX A;  3C8V A;  3MUD A;  2PP6 A;  2JKV A;  3FWN A;  2FYU K;  1SQQ G;  1IO4 A;  2KIK A;  3L72 G;  1HTL C;  3H1K J;  3L72 E;  3AE4 C;  1LWU A;  2JDI H;  1SQV D;  2FFD B;  2K88 A;  3HTK A;  3UIA A;  1ZR4 A;  1EXJ A;  1NTM D;  2DW3 A;  4PD4 H;  5AW1 B;  1GTW A;  1BDD A;  1RF1 C;  1L0L G;  2NPS D;  2ZAE B;  3BCC J;  3MTU E;  4C7N B;  1R5L A;  1QVF O;  3JCU H;  4I6M C;  1HBW A;  2OYH A;  5CBN A;  3B8E B;  3H1L D;  5B66 E;  2YKP A;  1NU1 G;  3OJA B;  1NWQ A;  1NAY A;  2XDJ A;  1RE4 C;  2K9J A;  3O6Q B;  2P67 A;  3L71 G;  1L0N K;  1PL5 A;  4I1L A;  4U3F G;  3KQG A;  4WB4 A;  5AW4 B;  4DOJ A;  2BAS A;  2JP3 A;  1ZN5 A;  1R8E A;  4HJG H;  1KIL E;  5AW7 B;  2R44 A;  5H2F H;  1Q81 Q;  4Y99 B;  1RQU A;  2ZT9 D;  2O01 H;  3FXD A;  1Y8A A;  4HH2 A;  4PD4 E;  2IYO A;  2I1J A;  1GW4 A;  3B5N C;  3R4Y A;  3L73 J;  3QH9 A;  1GW3 A;  5TIS E;  3HRN A;  1YIT P;  3CXH D;  1K8A Q;  1EZV D;  1BGY J;  2E76 D;  1ZW0 A;  1DIP A;  2OYO A;  4TT3 H;  1L0N D;  2AEF A;  3MGN A;  3MZW B;  1DH3 A;  2O01 J;  3H1H G;  2QJK C;  4DT0 A;  2C9L Y;  2QM8 A;  4IFM A;  4R4M A;  4Y99 C;  3B71 A;  2OYI C;  1M56 D;  1SQP G;  2Q1K A;  3AE8 C;  2YKQ A;  3G9R A;  1KIL D;  3JC2 2;  3L4F A;  5APT A;  2M8R A;  4JBZ A;  4PD4 D;  3VMY A;  1BCC G;  1CI6 B;  4B86 A;  1KOR A;  1DX7 A;  3V4Q A;  2QJP C;  4XA4 A;  1PP9 J;  2XU6 A;  1OIP A;  3AE7 C;  3CX5 D;  1SQX K;  2R5D A;  1XTG B;  2IBZ D;  1J2J B;  4EDF A;  4H13 D;  1BE3 G;  2E74 D;  5AW6 B;  3AEE C;  3H1J J;  1AVY A;  2YKO A;  4GOF A;  3L74 G;  1NTK E;  2O1J A;  1SQQ D;  3M9B A;  1DEB A;  1J1E B;  1OFC X;  2IPP A;  3L72 D;  3LW5 H;  1IFI A;  1NU1 K;  3PJS K;  5CCH A;  2YMY A;  1FZC B;  2J5U A;  2YO3 A;  1GZL A;  2WSF J;  4NPD A;  3TDK A;  1RY3 A;  2UWJ E;  1K9M Q;  3A7O A;  1FBM A;  1OX3 A;  1RE3 C;  3L35 A;  5AVQ B;  3CCS P;  2Z4E A;  1JUN A;  1S9K D;  3QWO C;  1FDM A;  1P84 E;  4IL6 H;  1NYH A;  1VQM P;  1X79 B;  4L73 A;  1OW6 A;  1IFM A;  3D70 A;  1HVV A;  3H6P A;  5KKZ B;  5AW2 B;  3NFQ A;  1NVO A;  1NTK D;  1Q2N A;  3RK2 B;  3USS A;  4BRY A;  1GL2 C;  2PGD A;  1LTG C;  1FOS F;  2OYH C; 
#chains in the Genus database with same CATH homology
 2FYU G;  3L71 G;  1BE3 G;  4U3F G;  1PPJ G;  1EZV G;  1NTK G;  4D6T G;  1BGY G;  3L75 G;  3L70 G;  3L74 G;  3TGU G;  1NTM G;  1SQQ G;  3BCC G;  3H1J G;  3L72 G;  1KB9 H;  1SQX G;  3CXH H;  1NTZ G;  3H1H G;  1L0N G;  1SQB G;  3L73 G;  1P84 H;  2A06 G;  4PD4 H;  3H1I G;  1PP9 G;  1SQP G;  1L0L G;  3CWB G;  2IBZ G;  3H1K G;  3H1L G;  3CX5 H;  1BCC G;  1SQV G;  2BCC G;  1KYO H;  5KLV G;  1NU1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...