2KUBA

Solution structure of the alpha subdomain of the major non-repeat unit of fap1 fimbriae of streptococcus parasanguis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
81
structure length
81
Chain Sequence
ENLDKMISEAEVLNDMAARKLITLDAEQQLELMKSLVATQSQLEATKNLIGDPNATVADLQIAYTTLGNNTQALGNELIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Fimbriae-associated protein Fap1
publication title Structural insights into serine-rich fimbriae from gram-positive bacteria.
pubmed doi rcsb
source organism Streptococcus parasanguinis
total genus 32
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2010-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2kubA00
2UWJE 2I8DA 4NPDA 1EDJA 4GODA 3MZWB 1JMBA 2KUBA 2K3RA 4K3AA 4NPFX 2RKLA 1BDCA 1U7MA 3S1KA 1Q2NA 2B89A 2KS1B 5EFWB 2WMMA 4ZMDA 2M5AA 4ZNCA 4NPEA 4GOEA 1LP1A 1EC5A 2R44A 1X0TA 1OVRA 1MFTA 2ZAEB 4JBZA 3RGUA 5K5GB 4K35A 4GOFA 2B87A 2HR3A 3FXDA 2M0BA 1EDKA 1ZXGA 4ASVA 2KIKA 4HJGH 2B88A 1U7JA 1S3JA 5DJTB 1H0TA 1Y47A 1EDIA 1JM0A 2KI7B 2SPZA 2JWDA 2KZJA 2QVAA 3MHVA 4CPGA 2LXCB 2M5AB 2LR2A 4ASWA 1LP1B 1SS1A 2QRXA 2P58A 1FC2C 1NVOA 5CBNA 4HB1A 5CBOA 4WWIA 2B87B 4IOIH 4KJMA 2Q1KA 4EYYQ 2OTKE 3QWOC 4HKZH 2KZIA 4MN4C 1OVVA 1ZW0A 5DJUB 1H0TB 3FXEA 1EDLA 1LT1A 3ZDMA 1DEEG 1BDDA 2LXBA 3PH0A 1OVUA 4BXLA 5C39A
chains in the Genus database with same CATH superfamily
3H1LD 4XA4A 4NPDA 5H2FH 4H0LB 4NPFX 5M1BA 5KJ7D 2OYIC 1VQ7P 1L0LJ 3OJAB 1MKMA 1BDCA 1SQXJ 3MTUE 2R44A 1X0TA 2H89C 4I2LC 3Q5SA 3AE3C 2BEQD 2W6AA 5KLVD 1L0NJ 2BCCD 1FBMA 2HR3A 2K9JB 1QVGO 2AXCA 1PIXA 3RK3B 2AEMA 4HH2A 3L74J 2KIKA 1DIPA 4KHXA 3B4SA 3KDPB 1M56D 1ZN5A 1H0TA 2KI7B 2H43A 1BGYJ 1L2PA 1FOSE 1IFMA 3OA7A 1E5WA 1PP9D 2IDBA 1M1KQ 3GMAA 3H1IE 3L37A 2IZ1A 2ZYAA 1NTKG 4R4MA 1SQQG 2I1JA 3GHGB 3VN0A 2LKMA 5B66E 5CBOA 4GT1A 4HYTB 2J59M 1JNMA 3II6A 1HF9A 4A7PA 2ZXXA 2L91A 1S5LX 1SQPG 1N73C 4JPZB 3PHLA 1ZW0A 1YITP 2E75B 2MJZA 5APSA 1OFCX 2KUBA 1P84D 2XV5A 4K3AA 2HLOA 1NOHA 2Q3EA 2JKVA 3PLNA 2RKLA 3B5NA 3Q2YA 2KB7P 3S1KA 2WWWA 4I7ZB 2ZVOB 2Y9YA 3LIDA 4RO0A 4IL6E 2WSFH 3SFEC 5GTHE 3L73J 3N4XA 2QA4P 1L0LE 2FXMA 1BE3G 1SQXE 2ZT9C 4D6TJ 3CXHD 1NWQA 1NTMD 3M0AA 1ZXGA 2C9NY 2GM4A 1GK4A 1YTZT 1IFJA 4O9BA 1L0NE 1EDIA 1FS0E 2KS1A 1X79B 3CCLP 2Y0CA 4ZKUA 1NHLA 5KKZB 3L74E 1SFCB 2WPQA 4WVZA 2RH0A 4U3FG 1CI6A 2OYOA 3VTPC 1KYOI 1K04A 1BGYE 3SSUA 4PD4E 2VRSA 3CC2P 1J2JB 2NPSD 2CK3H 3ABVC 3KYQA 3D71A 3T97A 3M0DC 2FFDA 2O01N 3CX5E 3CWBD 4H0LD 3Q5PA 1M1JA 1QX8A 2UWJE 1VF5C 2YXRB 2QJKB 1LTTC 3NTNA 4GIFA 4PJ0H 2IBZI 2BCCJ 1DH3A 1NTZE 5AW5B 3V2RA 3HE5B 3HD7D 4OGQB 4LGDE 2B89A 1VF5D 3I56P 2Y9ZA 1FZCB 3O6QB 1NU1D 1VQMP 2BASA 4Y99C 3RBZA 2O1KA 3U59A 1HJBA 2M0BA 2ZYDA 1W5CE 3L73E 1RE3A 2R5DA 3A0HH 3VOPA 3JC22 4D6TE 4UB6E 5AVYB 2SPZA 3L71J 1GL2B 1PGOA 5AW7B 1FDOA 1S1CX 2LR2A 2Z5IA 5KTBA 1L0LK 5B5EE 5APWA 1SQXK 3L35A 2P58A 1QLED 3L75J 1G2CA 3KZIH 4IOIH 5CCHA 2WSFJ 3IF4A 4EYYQ 2OTKE 3TGUD 3VMXA 1FZGA 4MN4C 2J58A 1M90Q 4UB8H 1FDIA 1MUUA 3H1HD 1W2EA 1Q82Q 3H32B 3AE7C 3V2PA 3H1IG 4DZOA 4W7ZA 1J1DB 2OTLP 3W68A 1LTAC 1YQ3C 2CPBA 4H13B 1GZLA 4ZKPA 1WRGA 3R2PA 3BASA 1VDFA 2RMZA 2OARA 4YXWH 1YYCA 3IN6A 3I55P 2BCCE 2N1TA 3PJSK 3RK2C 1RE4A 2QSIA 1LTBC 3TYYA 3L72G 2O01H 4IFMA 2KXPB 2E74B 1ZP0C 2FFDC 1S3JA 1LTJB 3A0BE 2PGDA 1M1JC 2WPVB 5KJ7A 1PL5A 1RY3A 2PAJA 2M5AB 2W6JH 1BSNA 1L0LG 3SWFA 3KPEA 1SQXG 3L71E 4YXDC 1BCCD 3NMDA 4DT0A 2A45G 2OYIA 1HUCA 1HWTC 3U1CA 1KYOD 2A06D 1GK6A 1L0NG 1OVVA 2I1KA 3L75E 3HE4B 2CPSA 3P32A 4WY4D 5BU8B 2JDIH 1EQ7A 3L74G 1KILB 1S72P 1OXZA 1LWUA 2OYHA 2XNXA 2YIUB 1EDJA 3MZWB 4OGQD 1YI2P 1RE3C 1BGYG 4N6JA 1R5SA 2P67A 3A2AA 2O1JA 3H1KJ 1N8RQ 3HRNA 2W8ZA 1NGMB 1H8AA 2C0WA 1D7MA 1CZQA 2IBZD 1BSHA 1AJYA 2ZJSE 1AA0A 4AUWA 2AXTH 1IFPA 4PV1B 1KTMA 2BEZF 2OQQA 3GW6A 5CCHC 1JY2O 2QJPC 2V4HA 3FXDA 2GA1A 1NTZG 2AEJA 1KB9E 1KQGB 3HTKB 1ZOYC 3TGUJ 3KHUA 3P8CD 2IPPA 1W2BO 1RF1A 3H1HJ 1KMIZ 2KYVA 1KFNA 2WT7B 3L70J 1NVOA 1Q90D 1N2DC 4WWIA 4B86A 3UIAA 3L73G 3S4RA 1DD4A 4Z1MH 4OH8B 2N1TC 4D6TG 3F5HA 2QM8A 4IL6X 1S4XA 2O01J 1RE4C 2LXBA 5AW6B 3GF3A 5C39A 4H44C 2JEEA 3F89A 3OAKA 3EQ2A 3JSVC 4JYCA 1LT9C 4RJTA 3M9BA 2IFNA 4U7JA 2KLVA 2XNDH 1M8OB 3IFMA 3A0HE 1IK9A 2HPCB 1JMMA 3H1KE 1DEBA 4EOTA 4XFJA 1SQVD 1OVRA 2NPSA 1LTSC 1URQD 1N7SC 1IJDB 3RBXA 2Q9IA 4GOFA 2YMYA 4AYCA 2M8RA 3AEAC 1A02J 4EDFA 2JO1A 4HJGH 2E43A 4YTPC 4W80A 3KZIE 5KAFH 1BCCJ 2AEFA 2N9YB 1NKZB 3H6PA 1N7SD 3M0DA 5AW0B 1AQTA 4UB8E 1LWUC 2OYHC 2DW3A 2P10A 2FYZA 2BCCG 3HD7A 2YO2A 2KSJA 5TISH 4N3YB 3CCSP 2QJYC 2R3CA 1OWAA 3WU2H 2IX7C 2NRGA 2WSCH 1N7LA 1FZFA 2QIWA 3H1HE 3M91A 3QWOC 4R4LA 3V2QA 1KC8Q 2IZ0A 3L70E 3NXSA 1H0TB 1VPCA 2WPSA 3MD0A 4DOJA 1OW6A 1YTZI 5KLIB 2H8PD 1AVYA 1JEKA 2P2UA 3TK1A 1JMBA 1USEA 3H1JD 3L71G 5APUA 2YKOA 1NTKD 1FE6A 1KN7A 1UIIA 1KZUB 2V7QH 1RF1C 4ZNCA 4BRYA 5APQA 2E76D 3L72E 1DD3A 3L75G 3SWKA 1SQPD 1IFDA 5K5GB 1Y9BA 2B87A 1K05A 3CD6P 1T3JA 5DJTB 2FBWC 3AEEC 3B5NB 5KAIH 1QGKB 2W6BA 1P84H 3KQGA 3SFDC 1PGPA 2KOGA 1Q86Q 4L76A 1SQBD 1E79H 1IC2A 1VQ5P 3AE8C 3B71A 2Q6QA 2A06E 5TJHA 2PRRA 1BE3D 2O3JA 2Y0EA 1MFZA 3OW2O 4N78E 3CXHH 1L4AB 1S9KE 1YJNP 2NPSC 2D2CC 3BVHA 3E1RA 3VMYA 3G3ZA 2XDJA 2Q3IA 5APXA 4RKUJ 2G8YA 4H0LC 4OWFA 3H1LJ 2P1JA 1VQ9P 2AXTE 2PFXA 1CI6B 1VQNP 1JCCA 3RL0D 1FZEA 2WZ7A 5APYA 3RK2B 2D2CD 2JR8A 1JTHA 2R5BA 3TNUA 2WTYA 5BVZA 2FXOA 4L74A 3HD7C 1LP1A 3T97B 2FFDB 1RQUA 2WSCJ 1JY3N 1RHZB 1X8YA 1M1JB 5KLVJ 4PD4I 2FYUD 1HH0A 4XE5B 4WY4A 3BRVB 3V4QA 1FU1A 3HE5A 4L75A 1OZHA 1EZVE 5CJ0A 3RK3D 2ZYGA 1PP9J 1QEXA 3H1KG 1PPJE 1NAYA 5AVUB 3AE5C 3D6YA 2V7QJ 1VQ8P 4KJMA 2K88A 3H1JJ 2HFED 4HKZH 5AVWB 2NZ2A 2W90A 1SLQA 2HODA 1LT1A 1ZRTD 3ZDMA 1JY3P 5H2FE 2E75D 3SWYA 3P8MC 3E7KA 1X9VA 2H7HA 3TGUG 1G2CB 3H1HG 3H1LE 5KAFE 2QJPB 1MZ9A 1IZNB 3L70G 4DJGA 3AEBC 1T6AA 1LJ2A 5L8RJ 4IFDK 1R5LA 1JOCA 2R32A 5TISE 4K35A 1SQBJ 1EXJA 5AVZB 1EDKA 3WU2E 3H1ID 4ASVA 5AW4B 1NTMJ 1ZLLA 2P7JA 5KKZC 5KLVE 2JWDA 2E42A 2QVAA 1NYHA 3L36A 1USDA 2N1TB 2QM7A 3Q5RA 2Q7CA 1YJWP 1L4AD 1LT9A 1SFCD 1PP9E 2R3SA 1URQA 2Q1KA 3CPWO 4KT0J 3CCVP 1GU5A 3CLQA 3S9OA 1IFIA 1LTIC 3CWBJ 1VQLP 3H1JE 5BU5A 3K5BA 1JO5A 2I8DA 1N7SA 1BCCG 4IFFA 4WY4C 1QVFO 2JP3A 2A06G 1YBKA 3G6EP 4OGQC 1GD2E 2ZXEB 3CMAP 3GG2A 1SQXD 2FYUJ 2OYIB 1NKNA 2WMMA 3HUSA 3MP7B 5KAIE 1P84E 1NU1J 1VQKP 1KYOH 1L0ND 3TSIA 3EWKA 1AV1A 1LWUB 2OYHB 3PP5A 4JQ0D 2WPRA 1T3UA 1T2KC 1J1EC 1OW8A 1GL2C 3V5BA 1BGYD 3CXHE 4PD4D 3Q1MA 2PP6A 3USSA 1VQOP 1NTME 2Z4EA 4M3LA 3LW5H 3G4SP 2E5TA 1T2KD 4DCKA 2KNCA 3C9IA 3V2NA 5AVTB 1GL2D 3WUUA 4HB1A 1NH4A 4PD4H 2E5YA 3C1LA 2C9LY 3LIEA 5KLVK 1EZVG 4RESB 1N73B 1NTZD 2XZRA 3WMM0 1J1DC 3FGAD 1PGJA 3VMZA 3A3YB 1PPJG 4PJ0E 3H25A 3CWBE 2QEXP 1YIJP 3CCRP 3CCQP 1H89A 5AW9B 1QL2A 2OTJP 1R8EA 5APTA 1KB9I 3FX0A 5EFWB 1NO4A 2L5GB 3M06A 1CSBA 1HGZA 3BCCD 4H13D 3IAOA 1IK7A 5CCGD 3L73D 1JUNA 1ZMEC 3CCUP 2KK7A 2FYUE 4D6TD 3RGUA 1S2EA 1K8AQ 1URQC 2ZT9B 4C7NA 1PV3A 1NU1E 5AW8B 1S5LH 3V6IA 3H1LG 2E74D 4UB6H 1TU3F 4GDOA 2Y0DA 2WQYC 1M7LA 3TDKA 1KV4A 2NPSB 3AE4C 1T8ZA 3CI9A 5CBNA 4Y28J 3CMEP 1Q81Q 3HUSC 3M9HA 1ZRTE 3JCUH 2Q5UA 5KLVG 1FZAA 1SQBK 1EDLA 2YKPA 2IFMA 1KILC 3CC4P 3G9RA 3GF7A 1NTMK 3ITKA 3QH9A 2YIUC 4TT3H 2K9JA 3TGUE 1XTGB 3HD7B 1VF5B 2K3RA 1KILD 1PP9G 3LW5J 1HBWA 1FOSF 3E1IA 3EFFK 4PV1C 2B9BA 3GHGA 4YPCA 5AVSB 2JJLA 2E76C 2WVRA 3H1JG 2ZAEB 4Y99B 1GDTA 1SQQD 2IYPA 2OGUA 3KXDA 4PV1D 5E79H 3L71D 1PFIA 1SVFA 3A0BH 5AW1B 4CPGA 5GTIH 1AFOA 4BRYB 2IYOA 2FYUK 1NTZJ 3L75D 4AQRD 1FC2C 4LC1A 3L4FA 2B87B 1NU1K 2POHA 2KZIA 3W67A 1OMIA 3FXEA 1SQBG 4JYBA 1BCCE 1A02F 1FJPA 1NTMG 3BCCJ 5CHXA 1KYOE 2GUSA 2WSEH 2W27A 4TLFA 3AE2C 5AVRB 2FYNC 1U7MA 3RL0C 1GW4A 2KS1B 1L4AA 1SFCA 4GOEA 2ZT9D 1SQVJ 2K1AA 1KB9D 2A45I 4U3FD 2FXPA 2GUVA 3U1AA 2IBZE 4L73A 3CWBG 3M9QA 1KORA 1Y47A 1JTHB 2ZVNB 1KB9H 3TNUB 1HJ0A 1JB0J 3D70A 1KQFB 3P7KA 1LP1B 3RK3C 5AVVB 2QRXA 2FYUG 1GMJA 1FDMA 2M3BA 3P8CE 5APVA 1NU1G 4WY4B 3CX5I 1FZCA 1RF0A 3O6QA 3GHGC 4I6MC 1KQLA 1N86A 1DEEG 5KLIC 1PZQA 1GU4A 5AVXB 3R4YA 3H1KD 1HTLC 5AW3B 2RN0A 3B8EB 3AEDC 2E75C 3V4WA 1DX7A 1NTKJ 3BCCE 3I5CA 1SQQJ 1Q2NA 1GL2A 3VYIA 1JY3O 1EZVI 1S5LE 1YJ9P 3VP9A 4NPEA 3AEFC 1EC5A 2FY8A 1NAFA 1J1EB 1NJIQ 2HODB 1PGQA 2H88C 3PTZA 4C7RA 1YHQP 1SQPJ 2ZFCA 4I7ZC 2J5UA 5AVQB 4LLHA 3B5NC 1SQVE 2G3AA 3JCUE 1ZR2A 2WSEJ 3AE9C 3H32A 2QG4A 2YNYA 2LXCB 1K9MQ 1L0NK 1LTGC 4ASWA 3MIWA 3MUDA 1KQSO 3B5ND 3AECC 3L70D 2HG5D 1FJKA 1YQ4C 4WB4A 5CCGA 1M57D 3MGNA 3O8ZA 1BE3J 1KFMA 2K37A 1L4AC 4W7YA 2Z5HA 1SFCC 1HVVA 3IR9A 2HYNA 1RQVA 3FWNA 1AVOA 1XTCC 3NFQA 3PRJA 5B66H 1ZR4A 3RL0g 1KILE 2ITAA 1IO4A 1MV8A 4H44B 1CW5A 3CCJP 3GLMA 3L72D 1LTJA 1KD1Q 1LT9B 4U3FJ 2JWAA 1LNQA 2WSSH 1URQB 1RH5B 5CJ4A 3AEGC 1NTZK 5E79E 1HGVA 2M5AA 3RK2D 2YMKA 2QJKC 1VL2A 5CMZA 1NTKE 1WMKA 1SQQE 1WT6A 1JCDA 5GTIE 2QE7H 4QMAA 3CL3D 1L0LD 1N7SB 3CC7P 1FZCC 4C46A 3A5TA 1RF0C 2K9YA 4WBAA 1SQPE 1JY2N 3HE4A 4EI2A 4IL6H 5GTHH 1KILA 3N7NA 1Y8AA 3HUSB 4N78D 1ZV8A 2KLUA 2YXQB 1S9KD 3BATA 2FKWB 3L74D 1OIPA 2A45H 3AE6C 2QJYB 3BRTB 1G1JA 3EFGA 2IBZG 1SQBE 1SQVK 1FAVA 1IFNA 1QL1A 5AW2B 3WUTA 5DJUB 4OVNF 3G71P 1P84I 1EXIA 1LGHB 1Z56A 1BE3E 4BXLA 1G1IA 1GTWA 3CX5D 3VP8A 4GODA 2KNCB 2M3EA 1VQ4P 2KSEA 2E76B 1GW3A 3HTKA 3CX5H 3CXHI 4ZMDA 3MUDC 1JY2P 1N73A 1VQPP 1RF1B 4U3FE 4EIJA 4GKGA 2W83C 4H13C 5CCHD 2WT7A 1MFTA 5CCGC 2WITA 1EZVD 1VQ6P 4JBZA 1K73Q 3C8VA 3CCMP 1X22A 2YKQA 2KP8A 3Q3DA 1PPJD 3H1IJ 2B88A 1U7JA 3A7OA 3BCCG 4I1LA 1JM0A 3AE1C 1AQ5A 2KZJA 3TF5A 3MHVA 1OW7A 1Q7YQ 2E74C 1NTKK 1U57A 3FWLA 1SP4A 1SQQK 4JF7A 3D6ZA 3CCEP 1SS1A 1LTJC 2N9BA 1UIXA 4BWNA 1H88A 3RK3E 1OX3A 3WUVA 2N1TD 2C0XA 4C7NB 1SQVG 3L72J 2HPCA 1SQPK 5KJ7C 4H44D 3VMAA 2XKMA 2YO3A 1FZBA 2MKVA 2FYNB 3PH0A 1BDDA 3RL0B 1OVUA 5B5EH 2XU6A 2D2CB
chains in the Genus database with same CATH topology
2UWJE 2I8DA 4NPDA 1EDJA 4GODA 3MZWB 1JMBA 2KUBA 2K3RA 4K3AA 4NPFX 2RKLA 1BDCA 1U7MA 3S1KA 1Q2NA 2B89A 2KS1B 5EFWB 2WMMA 4ZMDA 2M5AA 4ZNCA 4NPEA 4GOEA 1LP1A 1EC5A 2R44A 1X0TA 1OVRA 1MFTA 2ZAEB 4JBZA 3RGUA 5K5GB 4K35A 4GOFA 2B87A 2HR3A 3FXDA 2M0BA 1EDKA 1ZXGA 4ASVA 2KIKA 4HJGH 2B88A 1U7JA 1S3JA 5DJTB 1H0TA 1Y47A 1EDIA 1JM0A 2KI7B 2SPZA 2JWDA 2KZJA 2QVAA 3MHVA 4CPGA 2LXCB 2M5AB 2LR2A 4ASWA 1LP1B 1SS1A 2QRXA 2P58A 1FC2C 1NVOA 5CBNA 4HB1A 5CBOA 4WWIA 2B87B 4IOIH 4KJMA 2Q1KA 4EYYQ 2OTKE 3QWOC 4HKZH 2KZIA 4MN4C 1OVVA 1ZW0A 5DJUB 1H0TB 3FXEA 1EDLA 1LT1A 3ZDMA 1DEEG 1BDDA 2LXBA 3PH0A 1OVUA 4BXLA 5C39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UWJ E;  2I8D A;  4NPD A;  1EDJ A;  4GOD A;  3MZW B;  1JMB A;  2KUB A;  2K3R A;  4K3A A;  4NPF X;  2RKL A;  1BDC A;  1U7M A;  3S1K A;  1Q2N A;  2B89 A;  2KS1 B;  5EFW B;  2WMM A;  4ZMD A;  2M5A A;  4ZNC A;  4NPE A;  4GOE A;  1LP1 A;  1EC5 A;  2R44 A;  1X0T A;  1OVR A;  1MFT A;  2ZAE B;  4JBZ A;  3RGU A;  5K5G B;  4K35 A;  4GOF A;  2B87 A;  2HR3 A;  3FXD A;  2M0B A;  1EDK A;  1ZXG A;  4ASV A;  2KIK A;  4HJG H;  2B88 A;  1U7J A;  1S3J A;  5DJT B;  1H0T A;  1Y47 A;  1EDI A;  1JM0 A;  2KI7 B;  2SPZ A;  2JWD A;  2KZJ A;  2QVA A;  3MHV A;  4CPG A;  2LXC B;  2M5A B;  2LR2 A;  4ASW A;  1LP1 B;  1SS1 A;  2QRX A;  2P58 A;  1FC2 C;  1NVO A;  5CBN A;  4HB1 A;  5CBO A;  4WWI A;  2B87 B;  4IOI H;  4KJM A;  2Q1K A;  4EYY Q;  2OTK E;  3QWO C;  4HKZ H;  2KZI A;  4MN4 C;  1OVV A;  1ZW0 A;  5DJU B;  1H0T B;  3FXE A;  1EDL A;  1LT1 A;  3ZDM A;  1DEE G;  1BDD A;  2LXB A;  3PH0 A;  1OVU A;  4BXL A;  5C39 A; 
#chains in the Genus database with same CATH topology
 3H1L D;  4XA4 A;  4NPD A;  5H2F H;  4H0L B;  4NPF X;  5M1B A;  5KJ7 D;  2OYI C;  1VQ7 P;  1L0L J;  3OJA B;  1MKM A;  1BDC A;  1SQX J;  3MTU E;  2R44 A;  1X0T A;  2H89 C;  4I2L C;  3Q5S A;  3AE3 C;  2BEQ D;  2W6A A;  5KLV D;  1L0N J;  2BCC D;  1FBM A;  2HR3 A;  2K9J B;  1QVG O;  2AXC A;  1PIX A;  3RK3 B;  2AEM A;  4HH2 A;  3L74 J;  2KIK A;  1DIP A;  4KHX A;  3B4S A;  3KDP B;  1M56 D;  1ZN5 A;  1H0T A;  2KI7 B;  2H43 A;  1BGY J;  1L2P A;  1FOS E;  1IFM A;  3OA7 A;  1E5W A;  1PP9 D;  2IDB A;  1M1K Q;  3GMA A;  3H1I E;  3L37 A;  2IZ1 A;  2ZYA A;  1NTK G;  4R4M A;  1SQQ G;  2I1J A;  3GHG B;  3VN0 A;  2LKM A;  5B66 E;  5CBO A;  4GT1 A;  4HYT B;  2J59 M;  1JNM A;  3II6 A;  1HF9 A;  4A7P A;  2ZXX A;  2L91 A;  1S5L X;  1SQP G;  1N73 C;  4JPZ B;  3PHL A;  1ZW0 A;  1YIT P;  2E75 B;  2MJZ A;  5APS A;  1OFC X;  2KUB A;  1P84 D;  2XV5 A;  4K3A A;  2HLO A;  1NOH A;  2Q3E A;  2JKV A;  3PLN A;  2RKL A;  3B5N A;  3Q2Y A;  2KB7 P;  3S1K A;  2WWW A;  4I7Z B;  2ZVO B;  2Y9Y A;  3LID A;  4RO0 A;  4IL6 E;  2WSF H;  3SFE C;  5GTH E;  3L73 J;  3N4X A;  2QA4 P;  1L0L E;  2FXM A;  1BE3 G;  1SQX E;  2ZT9 C;  4D6T J;  3CXH D;  1NWQ A;  1NTM D;  3M0A A;  1ZXG A;  2C9N Y;  2GM4 A;  1GK4 A;  1YTZ T;  1IFJ A;  4O9B A;  1L0N E;  1EDI A;  1FS0 E;  2KS1 A;  1X79 B;  3CCL P;  2Y0C A;  4ZKU A;  1NHL A;  5KKZ B;  3L74 E;  1SFC B;  2WPQ A;  4WVZ A;  2RH0 A;  4U3F G;  1CI6 A;  2OYO A;  3VTP C;  1KYO I;  1K04 A;  1BGY E;  3SSU A;  4PD4 E;  2VRS A;  3CC2 P;  1J2J B;  2NPS D;  2CK3 H;  3ABV C;  3KYQ A;  3D71 A;  3T97 A;  3M0D C;  2FFD A;  2O01 N;  3CX5 E;  3CWB D;  4H0L D;  3Q5P A;  1M1J A;  1QX8 A;  2UWJ E;  1VF5 C;  2YXR B;  2QJK B;  1LTT C;  3NTN A;  4GIF A;  4PJ0 H;  2IBZ I;  2BCC J;  1DH3 A;  1NTZ E;  5AW5 B;  3V2R A;  3HE5 B;  3HD7 D;  4OGQ B;  4LGD E;  2B89 A;  1VF5 D;  3I56 P;  2Y9Z A;  1FZC B;  3O6Q B;  1NU1 D;  1VQM P;  2BAS A;  4Y99 C;  3RBZ A;  2O1K A;  3U59 A;  1HJB A;  2M0B A;  2ZYD A;  1W5C E;  3L73 E;  1RE3 A;  2R5D A;  3A0H H;  3VOP A;  3JC2 2;  4D6T E;  4UB6 E;  5AVY B;  2SPZ A;  3L71 J;  1GL2 B;  1PGO A;  5AW7 B;  1FDO A;  1S1C X;  2LR2 A;  2Z5I A;  5KTB A;  1L0L K;  5B5E E;  5APW A;  1SQX K;  3L35 A;  2P58 A;  1QLE D;  3L75 J;  1G2C A;  3KZI H;  4IOI H;  5CCH A;  2WSF J;  3IF4 A;  4EYY Q;  2OTK E;  3TGU D;  3VMX A;  1FZG A;  4MN4 C;  2J58 A;  1M90 Q;  4UB8 H;  1FDI A;  1MUU A;  3H1H D;  1W2E A;  1Q82 Q;  3H32 B;  3AE7 C;  3V2P A;  3H1I G;  4DZO A;  4W7Z A;  1J1D B;  2OTL P;  3W68 A;  1LTA C;  1YQ3 C;  2CPB A;  4H13 B;  1GZL A;  4ZKP A;  1WRG A;  3R2P A;  3BAS A;  1VDF A;  2RMZ A;  2OAR A;  4YXW H;  1YYC A;  3IN6 A;  3I55 P;  2BCC E;  2N1T A;  3PJS K;  3RK2 C;  1RE4 A;  2QSI A;  1LTB C;  3TYY A;  3L72 G;  2O01 H;  4IFM A;  2KXP B;  2E74 B;  1ZP0 C;  2FFD C;  1S3J A;  1LTJ B;  3A0B E;  2PGD A;  1M1J C;  2WPV B;  5KJ7 A;  1PL5 A;  1RY3 A;  2PAJ A;  2M5A B;  2W6J H;  1BSN A;  1L0L G;  3SWF A;  3KPE A;  1SQX G;  3L71 E;  4YXD C;  1BCC D;  3NMD A;  4DT0 A;  2A45 G;  2OYI A;  1HUC A;  1HWT C;  3U1C A;  1KYO D;  2A06 D;  1GK6 A;  1L0N G;  1OVV A;  2I1K A;  3L75 E;  3HE4 B;  2CPS A;  3P32 A;  4WY4 D;  5BU8 B;  2JDI H;  1EQ7 A;  3L74 G;  1KIL B;  1S72 P;  1OXZ A;  1LWU A;  2OYH A;  2XNX A;  2YIU B;  1EDJ A;  3MZW B;  4OGQ D;  1YI2 P;  1RE3 C;  1BGY G;  4N6J A;  1R5S A;  2P67 A;  3A2A A;  2O1J A;  3H1K J;  1N8R Q;  3HRN A;  2W8Z A;  1NGM B;  1H8A A;  2C0W A;  1D7M A;  1CZQ A;  2IBZ D;  1BSH A;  1AJY A;  2ZJS E;  1AA0 A;  4AUW A;  2AXT H;  1IFP A;  4PV1 B;  1KTM A;  2BEZ F;  2OQQ A;  3GW6 A;  5CCH C;  1JY2 O;  2QJP C;  2V4H A;  3FXD A;  2GA1 A;  1NTZ G;  2AEJ A;  1KB9 E;  1KQG B;  3HTK B;  1ZOY C;  3TGU J;  3KHU A;  3P8C D;  2IPP A;  1W2B O;  1RF1 A;  3H1H J;  1KMI Z;  2KYV A;  1KFN A;  2WT7 B;  3L70 J;  1NVO A;  1Q90 D;  1N2D C;  4WWI A;  4B86 A;  3UIA A;  3L73 G;  3S4R A;  1DD4 A;  4Z1M H;  4OH8 B;  2N1T C;  4D6T G;  3F5H A;  2QM8 A;  4IL6 X;  1S4X A;  2O01 J;  1RE4 C;  2LXB A;  5AW6 B;  3GF3 A;  5C39 A;  4H44 C;  2JEE A;  3F89 A;  3OAK A;  3EQ2 A;  3JSV C;  4JYC A;  1LT9 C;  4RJT A;  3M9B A;  2IFN A;  4U7J A;  2KLV A;  2XND H;  1M8O B;  3IFM A;  3A0H E;  1IK9 A;  2HPC B;  1JMM A;  3H1K E;  1DEB A;  4EOT A;  4XFJ A;  1SQV D;  1OVR A;  2NPS A;  1LTS C;  1URQ D;  1N7S C;  1IJD B;  3RBX A;  2Q9I A;  4GOF A;  2YMY A;  4AYC A;  2M8R A;  3AEA C;  1A02 J;  4EDF A;  2JO1 A;  4HJG H;  2E43 A;  4YTP C;  4W80 A;  3KZI E;  5KAF H;  1BCC J;  2AEF A;  2N9Y B;  1NKZ B;  3H6P A;  1N7S D;  3M0D A;  5AW0 B;  1AQT A;  4UB8 E;  1LWU C;  2OYH C;  2DW3 A;  2P10 A;  2FYZ A;  2BCC G;  3HD7 A;  2YO2 A;  2KSJ A;  5TIS H;  4N3Y B;  3CCS P;  2QJY C;  2R3C A;  1OWA A;  3WU2 H;  2IX7 C;  2NRG A;  2WSC H;  1N7L A;  1FZF A;  2QIW A;  3H1H E;  3M91 A;  3QWO C;  4R4L A;  3V2Q A;  1KC8 Q;  2IZ0 A;  3L70 E;  3NXS A;  1H0T B;  1VPC A;  2WPS A;  3MD0 A;  4DOJ A;  1OW6 A;  1YTZ I;  5KLI B;  2H8P D;  1AVY A;  1JEK A;  2P2U A;  3TK1 A;  1JMB A;  1USE A;  3H1J D;  3L71 G;  5APU A;  2YKO A;  1NTK D;  1FE6 A;  1KN7 A;  1UII A;  1KZU B;  2V7Q H;  1RF1 C;  4ZNC A;  4BRY A;  5APQ A;  2E76 D;  3L72 E;  1DD3 A;  3L75 G;  3SWK A;  1SQP D;  1IFD A;  5K5G B;  1Y9B A;  2B87 A;  1K05 A;  3CD6 P;  1T3J A;  5DJT B;  2FBW C;  3AEE C;  3B5N B;  5KAI H;  1QGK B;  2W6B A;  1P84 H;  3KQG A;  3SFD C;  1PGP A;  2KOG A;  1Q86 Q;  4L76 A;  1SQB D;  1E79 H;  1IC2 A;  1VQ5 P;  3AE8 C;  3B71 A;  2Q6Q A;  2A06 E;  5TJH A;  2PRR A;  1BE3 D;  2O3J A;  2Y0E A;  1MFZ A;  3OW2 O;  4N78 E;  3CXH H;  1L4A B;  1S9K E;  1YJN P;  2NPS C;  2D2C C;  3BVH A;  3E1R A;  3VMY A;  3G3Z A;  2XDJ A;  2Q3I A;  5APX A;  4RKU J;  2G8Y A;  4H0L C;  4OWF A;  3H1L J;  2P1J A;  1VQ9 P;  2AXT E;  2PFX A;  1CI6 B;  1VQN P;  1JCC A;  3RL0 D;  1FZE A;  2WZ7 A;  5APY A;  3RK2 B;  2D2C D;  2JR8 A;  1JTH A;  2R5B A;  3TNU A;  2WTY A;  5BVZ A;  2FXO A;  4L74 A;  3HD7 C;  1LP1 A;  3T97 B;  2FFD B;  1RQU A;  2WSC J;  1JY3 N;  1RHZ B;  1X8Y A;  1M1J B;  5KLV J;  4PD4 I;  2FYU D;  1HH0 A;  4XE5 B;  4WY4 A;  3BRV B;  3V4Q A;  1FU1 A;  3HE5 A;  4L75 A;  1OZH A;  1EZV E;  5CJ0 A;  3RK3 D;  2ZYG A;  1PP9 J;  1QEX A;  3H1K G;  1PPJ E;  1NAY A;  5AVU B;  3AE5 C;  3D6Y A;  2V7Q J;  1VQ8 P;  4KJM A;  2K88 A;  3H1J J;  2HFE D;  4HKZ H;  5AVW B;  2NZ2 A;  2W90 A;  1SLQ A;  2HOD A;  1LT1 A;  1ZRT D;  3ZDM A;  1JY3 P;  5H2F E;  2E75 D;  3SWY A;  3P8M C;  3E7K A;  1X9V A;  2H7H A;  3TGU G;  1G2C B;  3H1H G;  3H1L E;  5KAF E;  2QJP B;  1MZ9 A;  1IZN B;  3L70 G;  4DJG A;  3AEB C;  1T6A A;  1LJ2 A;  5L8R J;  4IFD K;  1R5L A;  1JOC A;  2R32 A;  5TIS E;  4K35 A;  1SQB J;  1EXJ A;  5AVZ B;  1EDK A;  3WU2 E;  3H1I D;  4ASV A;  5AW4 B;  1NTM J;  1ZLL A;  2P7J A;  5KKZ C;  5KLV E;  2JWD A;  2E42 A;  2QVA A;  1NYH A;  3L36 A;  1USD A;  2N1T B;  2QM7 A;  3Q5R A;  2Q7C A;  1YJW P;  1L4A D;  1LT9 A;  1SFC D;  1PP9 E;  2R3S A;  1URQ A;  2Q1K A;  3CPW O;  4KT0 J;  3CCV P;  1GU5 A;  3CLQ A;  3S9O A;  1IFI A;  1LTI C;  3CWB J;  1VQL P;  3H1J E;  5BU5 A;  3K5B A;  1JO5 A;  2I8D A;  1N7S A;  1BCC G;  4IFF A;  4WY4 C;  1QVF O;  2JP3 A;  2A06 G;  1YBK A;  3G6E P;  4OGQ C;  1GD2 E;  2ZXE B;  3CMA P;  3GG2 A;  1SQX D;  2FYU J;  2OYI B;  1NKN A;  2WMM A;  3HUS A;  3MP7 B;  5KAI E;  1P84 E;  1NU1 J;  1VQK P;  1KYO H;  1L0N D;  3TSI A;  3EWK A;  1AV1 A;  1LWU B;  2OYH B;  3PP5 A;  4JQ0 D;  2WPR A;  1T3U A;  1T2K C;  1J1E C;  1OW8 A;  1GL2 C;  3V5B A;  1BGY D;  3CXH E;  4PD4 D;  3Q1M A;  2PP6 A;  3USS A;  1VQO P;  1NTM E;  2Z4E A;  4M3L A;  3LW5 H;  3G4S P;  2E5T A;  1T2K D;  4DCK A;  2KNC A;  3C9I A;  3V2N A;  5AVT B;  1GL2 D;  3WUU A;  4HB1 A;  1NH4 A;  4PD4 H;  2E5Y A;  3C1L A;  2C9L Y;  3LIE A;  5KLV K;  1EZV G;  4RES B;  1N73 B;  1NTZ D;  2XZR A;  3WMM 0;  1J1D C;  3FGA D;  1PGJ A;  3VMZ A;  3A3Y B;  1PPJ G;  4PJ0 E;  3H25 A;  3CWB E;  2QEX P;  1YIJ P;  3CCR P;  3CCQ P;  1H89 A;  5AW9 B;  1QL2 A;  2OTJ P;  1R8E A;  5APT A;  1KB9 I;  3FX0 A;  5EFW B;  1NO4 A;  2L5G B;  3M06 A;  1CSB A;  1HGZ A;  3BCC D;  4H13 D;  3IAO A;  1IK7 A;  5CCG D;  3L73 D;  1JUN A;  1ZME C;  3CCU P;  2KK7 A;  2FYU E;  4D6T D;  3RGU A;  1S2E A;  1K8A Q;  1URQ C;  2ZT9 B;  4C7N A;  1PV3 A;  1NU1 E;  5AW8 B;  1S5L H;  3V6I A;  3H1L G;  2E74 D;  4UB6 H;  1TU3 F;  4GDO A;  2Y0D A;  2WQY C;  1M7L A;  3TDK A;  1KV4 A;  2NPS B;  3AE4 C;  1T8Z A;  3CI9 A;  5CBN A;  4Y28 J;  3CME P;  1Q81 Q;  3HUS C;  3M9H A;  1ZRT E;  3JCU H;  2Q5U A;  5KLV G;  1FZA A;  1SQB K;  1EDL A;  2YKP A;  2IFM A;  1KIL C;  3CC4 P;  3G9R A;  3GF7 A;  1NTM K;  3ITK A;  3QH9 A;  2YIU C;  4TT3 H;  2K9J A;  3TGU E;  1XTG B;  3HD7 B;  1VF5 B;  2K3R A;  1KIL D;  1PP9 G;  3LW5 J;  1HBW A;  1FOS F;  3E1I A;  3EFF K;  4PV1 C;  2B9B A;  3GHG A;  4YPC A;  5AVS B;  2JJL A;  2E76 C;  2WVR A;  3H1J G;  2ZAE B;  4Y99 B;  1GDT A;  1SQQ D;  2IYP A;  2OGU A;  3KXD A;  4PV1 D;  5E79 H;  3L71 D;  1PFI A;  1SVF A;  3A0B H;  5AW1 B;  4CPG A;  5GTI H;  1AFO A;  4BRY B;  2IYO A;  2FYU K;  1NTZ J;  3L75 D;  4AQR D;  1FC2 C;  4LC1 A;  3L4F A;  2B87 B;  1NU1 K;  2POH A;  2KZI A;  3W67 A;  1OMI A;  3FXE A;  1SQB G;  4JYB A;  1BCC E;  1A02 F;  1FJP A;  1NTM G;  3BCC J;  5CHX A;  1KYO E;  2GUS A;  2WSE H;  2W27 A;  4TLF A;  3AE2 C;  5AVR B;  2FYN C;  1U7M A;  3RL0 C;  1GW4 A;  2KS1 B;  1L4A A;  1SFC A;  4GOE A;  2ZT9 D;  1SQV J;  2K1A A;  1KB9 D;  2A45 I;  4U3F D;  2FXP A;  2GUV A;  3U1A A;  2IBZ E;  4L73 A;  3CWB G;  3M9Q A;  1KOR A;  1Y47 A;  1JTH B;  2ZVN B;  1KB9 H;  3TNU B;  1HJ0 A;  1JB0 J;  3D70 A;  1KQF B;  3P7K A;  1LP1 B;  3RK3 C;  5AVV B;  2QRX A;  2FYU G;  1GMJ A;  1FDM A;  2M3B A;  3P8C E;  5APV A;  1NU1 G;  4WY4 B;  3CX5 I;  1FZC A;  1RF0 A;  3O6Q A;  3GHG C;  4I6M C;  1KQL A;  1N86 A;  1DEE G;  5KLI C;  1PZQ A;  1GU4 A;  5AVX B;  3R4Y A;  3H1K D;  1HTL C;  5AW3 B;  2RN0 A;  3B8E B;  3AED C;  2E75 C;  3V4W A;  1DX7 A;  1NTK J;  3BCC E;  3I5C A;  1SQQ J;  1Q2N A;  1GL2 A;  3VYI A;  1JY3 O;  1EZV I;  1S5L E;  1YJ9 P;  3VP9 A;  4NPE A;  3AEF C;  1EC5 A;  2FY8 A;  1NAF A;  1J1E B;  1NJI Q;  2HOD B;  1PGQ A;  2H88 C;  3PTZ A;  4C7R A;  1YHQ P;  1SQP J;  2ZFC A;  4I7Z C;  2J5U A;  5AVQ B;  4LLH A;  3B5N C;  1SQV E;  2G3A A;  3JCU E;  1ZR2 A;  2WSE J;  3AE9 C;  3H32 A;  2QG4 A;  2YNY A;  2LXC B;  1K9M Q;  1L0N K;  1LTG C;  4ASW A;  3MIW A;  3MUD A;  1KQS O;  3B5N D;  3AEC C;  3L70 D;  2HG5 D;  1FJK A;  1YQ4 C;  4WB4 A;  5CCG A;  1M57 D;  3MGN A;  3O8Z A;  1BE3 J;  1KFM A;  2K37 A;  1L4A C;  4W7Y A;  2Z5H A;  1SFC C;  1HVV A;  3IR9 A;  2HYN A;  1RQV A;  3FWN A;  1AVO A;  1XTC C;  3NFQ A;  3PRJ A;  5B66 H;  1ZR4 A;  3RL0 g;  1KIL E;  2ITA A;  1IO4 A;  1MV8 A;  4H44 B;  1CW5 A;  3CCJ P;  3GLM A;  3L72 D;  1LTJ A;  1KD1 Q;  1LT9 B;  4U3F J;  2JWA A;  1LNQ A;  2WSS H;  1URQ B;  1RH5 B;  5CJ4 A;  3AEG C;  1NTZ K;  5E79 E;  1HGV A;  2M5A A;  3RK2 D;  2YMK A;  2QJK C;  1VL2 A;  5CMZ A;  1NTK E;  1WMK A;  1SQQ E;  1WT6 A;  1JCD A;  5GTI E;  2QE7 H;  4QMA A;  3CL3 D;  1L0L D;  1N7S B;  3CC7 P;  1FZC C;  4C46 A;  3A5T A;  1RF0 C;  2K9Y A;  4WBA A;  1SQP E;  1JY2 N;  3HE4 A;  4EI2 A;  4IL6 H;  5GTH H;  1KIL A;  3N7N A;  1Y8A A;  3HUS B;  4N78 D;  1ZV8 A;  2KLU A;  2YXQ B;  1S9K D;  3BAT A;  2FKW B;  3L74 D;  1OIP A;  2A45 H;  3AE6 C;  2QJY B;  3BRT B;  1G1J A;  3EFG A;  2IBZ G;  1SQB E;  1SQV K;  1FAV A;  1IFN A;  1QL1 A;  5AW2 B;  3WUT A;  5DJU B;  4OVN F;  3G71 P;  1P84 I;  1EXI A;  1LGH B;  1Z56 A;  1BE3 E;  4BXL A;  1G1I A;  1GTW A;  3CX5 D;  3VP8 A;  4GOD A;  2KNC B;  2M3E A;  1VQ4 P;  2KSE A;  2E76 B;  1GW3 A;  3HTK A;  3CX5 H;  3CXH I;  4ZMD A;  3MUD C;  1JY2 P;  1N73 A;  1VQP P;  1RF1 B;  4U3F E;  4EIJ A;  4GKG A;  2W83 C;  4H13 C;  5CCH D;  2WT7 A;  1MFT A;  5CCG C;  2WIT A;  1EZV D;  1VQ6 P;  4JBZ A;  1K73 Q;  3C8V A;  3CCM P;  1X22 A;  2YKQ A;  2KP8 A;  3Q3D A;  1PPJ D;  3H1I J;  2B88 A;  1U7J A;  3A7O A;  3BCC G;  4I1L A;  1JM0 A;  3AE1 C;  1AQ5 A;  2KZJ A;  3TF5 A;  3MHV A;  1OW7 A;  1Q7Y Q;  2E74 C;  1NTK K;  1U57 A;  3FWL A;  1SP4 A;  1SQQ K;  4JF7 A;  3D6Z A;  3CCE P;  1SS1 A;  1LTJ C;  2N9B A;  1UIX A;  4BWN A;  1H88 A;  3RK3 E;  1OX3 A;  3WUV A;  2N1T D;  2C0X A;  4C7N B;  1SQV G;  3L72 J;  2HPC A;  1SQP K;  5KJ7 C;  4H44 D;  3VMA A;  2XKM A;  2YO3 A;  1FZB A;  2MKV A;  2FYN B;  3PH0 A;  1BDD A;  3RL0 B;  1OVU A;  5B5E H;  2XU6 A;  2D2C B; 
#chains in the Genus database with same CATH homology
 2UWJ E;  2I8D A;  4NPD A;  1EDJ A;  4GOD A;  3MZW B;  1JMB A;  2KUB A;  2K3R A;  4K3A A;  4NPF X;  2RKL A;  1BDC A;  1U7M A;  3S1K A;  1Q2N A;  2B89 A;  2KS1 B;  5EFW B;  2WMM A;  4ZMD A;  2M5A A;  4ZNC A;  4NPE A;  4GOE A;  1LP1 A;  1EC5 A;  2R44 A;  1X0T A;  1OVR A;  1MFT A;  2ZAE B;  4JBZ A;  3RGU A;  5K5G B;  4K35 A;  4GOF A;  2B87 A;  2HR3 A;  3FXD A;  2M0B A;  1EDK A;  1ZXG A;  4ASV A;  2KIK A;  4HJG H;  2B88 A;  1U7J A;  1S3J A;  5DJT B;  1H0T A;  1Y47 A;  1EDI A;  1JM0 A;  2KI7 B;  2SPZ A;  2JWD A;  2KZJ A;  2QVA A;  3MHV A;  4CPG A;  2LXC B;  2M5A B;  2LR2 A;  4ASW A;  1LP1 B;  1SS1 A;  2QRX A;  2P58 A;  1FC2 C;  1NVO A;  5CBN A;  4HB1 A;  5CBO A;  4WWI A;  2B87 B;  4IOI H;  4KJM A;  2Q1K A;  4EYY Q;  2OTK E;  3QWO C;  4HKZ H;  2KZI A;  4MN4 C;  1OVV A;  1ZW0 A;  5DJU B;  1H0T B;  3FXE A;  1EDL A;  1LT1 A;  3ZDM A;  1DEE G;  1BDD A;  2LXB A;  3PH0 A;  1OVU A;  4BXL A;  5C39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...