2KUBA

Solution structure of the alpha subdomain of the major non-repeat unit of fap1 fimbriae of streptococcus parasanguis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
81
structure length
81
Chain Sequence
ENLDKMISEAEVLNDMAARKLITLDAEQQLELMKSLVATQSQLEATKNLIGDPNATVADLQIAYTTLGNNTQALGNELIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into serine-rich fimbriae from gram-positive bacteria.
pubmed doi rcsb
source organism Streptococcus parasanguinis
molecule tags Structural protein
molecule keywords Fimbriae-associated protein Fap1
total genus 32
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2010-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2kubA00
4ZNCA 2SPZA 4ASWA 4NPEA 3QWOC 5DJUB 4MN4C 1OVUA 5EFWB 2R44A 5C39A 4HJGH 1X0TA 2QVAA 1MFTA 4EYYQ 1DEEG 1Q2NA 1U7MA 4GODA 2KI7B 1JM0A 5DJTB 4ZMDA 2KUBA 2B87A 1EDIA 4GOEA 2KIKA 2KZJA 1ZW0A 3S1KA 1OVRA 2KS1B 2P58A 4HB1A 3FXDA 4WWIA 3RGUA 1LP1B 4ASVA 4K35A 4HKZH 2LXBA 4JBZA 1EDKA 3MZWB 4KJMA 4CPGA 1H0TA 2KZIA 1ZXGA 2K3RA 1EC5A 5CBNA 2I8DA 1FC2C 4IOIH 3MHVA 2LR2A 3ZDMA 4BXLA 2RKLA 1S3JA 4NPDA 2JWDA 5CBOA 1OVVA 1U7JA 2QRXA 1NVOA 2M5AB 1JMBA 1BDDA 4GOFA 3PH0A 2B88A 4K3AA 2B87B 1BDCA 2Q1KA 1H0TB 2UWJE 1LT1A 2WMMA 2HR3A 2OTKE 1EDLA 4NPFX 2LXCB 3FXEA 2ZAEB 2B89A 1LP1A 1Y47A 5K5GB 1SS1A 2M0BA 2M5AA 1EDJA
chains in the Genus database with same CATH superfamily
1RF0A 2QJKB 1L0NE 2YIUB 2E76C 3PRJA 4ASWA 1UIXA 2JR8A 1FS0E 1S2EA 4PD4D 1X9VA 1SQQG 1T2KD 2N1TB 2I1JA 2E75D 3SFEC 3HUSB 1SFCD 1NTKG 3Q5PA 1NTKK 2FYUE 4W7ZA 3CXHD 2M3EA 1GMJA 3HE4B 4WY4D 1MKMA 3RL0B 1T2KC 4AUWA 2OTLP 1FZCA 3RK3D 1OFCX 1K8AQ 2BEZF 1OIPA 2JKVA 2W6AA 1WMKA 4H44D 4OGQC 3HD7C 1XTCC 2K9JA 4YPCA 1QL1A 2E74D 2N1TD 2P2UA 2WITA 4M3LA 3TGUG 4EYYQ 2E75B 3HUSC 1DEEG 1KQSO 5CCHA 2WT7B 3UIAA 3I5CA 2N1TC 1G1JA 1D7MA 3IAOA 4OGQD 1NYHA 2O3JA 1G2CB 1L0LK 5AW1B 3SWYA 4H0LD 2P7JA 4N78D 2E76B 3H1JD 3B5NC 1YJNP 3WU2H 1EQ7A 1KILA 3H1JE 3SFDC 2QM8A 1A02F 1ZV8A 1FDOA 1IZNB 2VRSA 1IK9A 4IL6E 2HODB 1EDIA 2IFMA 3L73E 3M9BA 1JY3O 3TGUE 4ZKPA 1LTGC 1SQPD 3TF5A 1NTKD 1NTZE 2QM7A 1U57A 3ABVC 3HTKB 5KLIB 1S9KE 4QMAA 4W7YA 1VQKP 1N7SD 2KSEA 3JC22 2J59M 2FFDC 2BCCD 3S1KA 3EFFK 2QIWA 3CMEP 1S1CX 1VL2A 3MUDC 5APYA 2GA1A 3FXDA 1IC2A 1L0NJ 1JEKA 1NTZG 3CX5I 1FZCB 2B9BA 3B4SA 3MIWA 3B71A 3LIEA 3L75G 4YXDC 3PTZA 1M1KQ 3U59A 2LKMA 3FGAD 3K5BA 3CX5H 2LXBA 3H1KG 3HE5B 4JQ0D 2AEMA 4C7NA 2R3SA 5KLVE 1W2EA 1H0TA 3MGNA 4IFFA 3WUTA 1ZXGA 3P32A 2HG5D 3D70A 2ZVNB 3NFQA 2WPSA 5CBNA 1BCCJ 1ZRTE 2I8DA 5APXA 3CC2P 3C1LA 1YITP 3VTPC 3Q1MA 1PP9E 1HVVA 3H1KE 1SQXE 4PJ0H 3ZDMA 3VMZA 1KTMA 2FYZA 2K37A 2W27A 4N3YB 3RK2B 5KAIH 2OYIC 2IBZI 1BCCG 1NHLA 2W83C 3AE7C 5H2FE 3O6QB 1GTWA 2Y9ZA 4NPDA 3B5ND 1LWUC 2JWDA 3H1LD 3AEEC 2XDJA 3RK3E 1QLED 3D71A 3NMDA 3H1JJ 3L70D 3IR9A 5GTIE 1SFCB 3U1CA 3CCUP 2Q5UA 1RH5B 1FOSE 3PLNA 1EZVD 2XNDH 3A0BH 3VMXA 4GOFA 2YMYA 1FU1A 1N2DC 2ZYAA 5AVWB 1BE3D 1SQVG 2KB7P 2Q3EA 5TISH 3E7KA 4LC1A 1KFMA 2WWWA 3B5NB 3CL3D 2G8YA 1LJ2A 2B88A 3G3ZA 2B87B 4PV1D 4TT3H 5H2FH 5CCGC 2KLUA 1IFJA 3GMAA 1FOSF 2XV5A 1GW4A 1P84I 5CJ4A 1LT1A 2N9BA 2WZ7A 2E75C 1L0LG 1URQB 2WMMA 1Q7YQ 1SQQD 3HD7B 1USDA 3A0HH 3Q3DA 1L0NG 3CWBG 2IBZG 2WSCJ 2W6BA 2WSFJ 3FXEA 3OJAB 2MKVA 2ZXXA 2NRGA 1IO4A 5AVUB 1Y47A 1L0LD 1SS1A 1L0LJ 1PPJE 2WVRA 2KLVA 1LTBC 5AW4B 5AW3B 1NOHA 3VOPA 2ZJSE 3I55P 4UB6E 3CX5E 3OA7A 3PJSK 1PL5A 3GF3A 4XFJA 5KJ7C 2YXRB 1H88A 4WY4A 4UB8H 4N6JA 2PFXA 5APQA 4ZNCA 3HUSA 1LT9C 3BRVB 3A7OA 2RH0A 2OYHB 1QVFO 1EZVI 2BCCG 2O1KA 4NPEA 4R4MA 2QJYC 3SWFA 1RY3A 2Z4EA 2A06G 1VF5B 2J5UA 1FJPA 3M91A 1KILC 1OWAA 2W90A 3QWOC 1LTJA 3AE5C 2D2CD 3H32B 4U3FJ 2FYNC 5AW9B 3B8EB 3L70G 2YO3A 4MN4C 1VQPP 1BE3J 3L73D 4DZOA 5EFWB 3FWNA 2R44A 3H1LE 2AXCA 3KHUA 2IBZD 3L72J 3VMAA 4PD4E 1AFOA 1OMIA 1X0TA 1SQQE 3V2NA 2A06E 4XA4A 1N8RQ 2NPSA 1LGHB 2XZRA 1KILE 2R32A 1IK7A 3W68A 5KAFE 4C46A 1Q2NA 1KILB 3GF7A 1VF5C 4AYCA 1NU1D 2QJYB 1JTHA 3H1LG 1N7SA 1ZR2A 1BGYE 4IL6X 3IF4A 3D6ZA 2NZ2A 1FZGA 1JM0A 1AV1A 5DJTB 3V6IA 1DH3A 2KUBA 2FXMA 1EZVG 1WRGA 3BCCG 2H89C 4Y99B 5APSA 1NU1G 5TJHA 3P8CE 1N7SC 3SSUA 3R2PA 1QX8A 4DCKA 2OYHA 3CC4P 3R4YA 3TYYA 2KYVA 3AE1C 1NTMK 1CI6B 1DD3A 1FZFA 1GDTA 2XKMA 1NH4A 4RJTA 2NPSC 1NGMB 3CCQP 2W8ZA 2R3CA 1L4AA 1IFMA 2Q3IA 2HLOA 3AE9C 2V4HA 3BCCE 3O6QA 1JCDA 2CPSA 1NU1E 4LLHA 4WWIA 3WUVA 1Q82Q 1LP1B 3CCVP 4D6TJ 1SVFA 1T8ZA 2AXTH 2KS1A 1OW6A 3KZIE 3M0DA 1YQ3C 4OVNF 2V7QH 4HKZH 3L37A 5AW5B 1YJ9P 4JBZA 3HD7D 4HH2A 3RK3B 1BSNA 5KLVD 1NWQA 4Y28J 5APWA 3CI9A 2JEEA 3RBZA 1CW5A 4PJ0E 2HODA 1JOCA 2QSIA 3RK3C 3B5NA 1EC5A 5BVZA 4YTPC 5AVZB 1SQPJ 4C7NB 3AE4C 3JCUE 1VQLP 3L71G 3L75E 1JO5A 1KB9I 1S72P 1H8AA 1HTLC 1FAVA 1LNQA 3MHVA 2FYUK 3VYIA 3A5TA 2C9NY 2KNCA 1GD2E 3L74E 3TDKA 4PV1C 3H1IE 3CCLP 1BE3G 1SFCA 3KPEA 1S3JA 3L71J 1KYOH 5CBOA 4IFMA 4EI2A 1SP4A 2P67A 2KSJA 1RE3A 1U7JA 1SLQA 3CX5D 1NVOA 5AVQB 1KYOI 1SQXG 1N7SB 3EFGA 1FDIA 2Y0CA 3KDPB 1L0LE 3BRTB 1L0NK 4Y99C 2KXPB 1IJDB 1BDDA 1PZQA 1SQVD 2WPVB 1RE4C 2Z5HA 3F89A 3H1IG 3PH0A 4L73A 3D6YA 1BGYD 1PGJA 2IBZE 1MFZA 1VQNP 2NPSD 1T3JA 3O8ZA 1IFIA 2RN0A 3H1KD 3II6A 1QL2A 3OAKA 3CWBJ 4HYTB 5B5EH 2WTYA 3IFMA 3CD6P 1KILD 5AW8B 1FZCC 1CI6A 3Q5SA 1IFNA 1ZRTD 2RMZA 1M57D 3LW5J 3CCMP 4H13B 5TISE 2JP3A 3AEDC 1OW8A 2OTKE 3VMYA 4R4LA 2BEQD 2ZAEB 1FDMA 1AVOA 1FE6A 1SQVK 2JJLA 4PD4H 5AW7B 2OYOA 2WSSH 1HGZA 1LP1A 5KJ7D 2O1JA 4I6MC 4B86A 1R5LA 2JDIH 1BSHA 5KLIC 1AVYA 2M0BA 1SQQJ 2FYNB 4GIFA 3VP8A 1J2JB 1JY2N 1L2PA 1NTZJ 1SQBD 1NTMG 2K9YA 2XNXA 3L70E 3MP7B 4I7ZC 4H13D 4U3FG 3RL0D 3CCRP 1T3UA 3AEAC 1WT6A 1USEA 1YBKA 2P10A 2SPZA 2IX7C 3MD0A 1LT9B 4RO0A 1VQ7P 2FKWB 3CXHI 5E79E 3CCSP 1KORA 2YKPA 1OZHA 5AVRB 3V4WA 1N86A 1SQBG 3L74J 4N78E 1AA0A 1M90Q 1J1EB 1KQGB 1SQXD 5AW0B 2WQYC 1S9KD 3F5HA 3HRNA 1A02J 1SQPK 5AVVB 4EDFA 2O01J 1SQPG 4KHXA 2POHA 4OGQB 3WU2E 4YXWH 2Q9IA 1OVUA 4H0LB 3BCCD 2BCCJ 1BGYG 3AEGC 1GL2A 2FYUJ 3PHLA 5KKZB 1KV4A 2C0WA 5KKZC 3H1JG 3CC7P 3KYQA 2QVAA 1NTKJ 1SQBE 1YIJP 1MFTA 1XTGB 1EZVE 3FWLA 3W67A 3H6PA 1NTZK 1H89A 3ITKA 1J1EC 3BCCJ 4WB4A 3VP9A 2E42A 1NU1J 3AECC 1FZBA 1OX3A 1RHZB 3JSVC 2E74C 5AVSB 1AQ5A 4Z1MH 1RF1B 4A7PA 1SQXJ 3P7KA 3S4RA 2HPCA 3GW6A 1NJIQ 1BCCD 1K05A 1LTJC 1JY3P 2QJKC 3L74D 5B5EE 4I7ZB 1EXJA 3VN0A 5CJ0A 2E5TA 1RF0C 2O01N 2ZT9D 3LIDA 3RBXA 1VPCA 2JO1A 1PP9D 1AJYA 1LTSC 4GOEA 3L73J 1HH0A 4U7JA 3CCEP 2K88A 3EWKA 1Y9BA 2FXPA 5KTBA 1ZW0A 2A45H 2KK7A 2A06D 1OVRA 2Y9YA 1CSBA 3HD7A 3L75J 2ZVOB 4JF7A 5B66E 2KS1B 5KLVG 2YKQA 1JUNA 1X79B 4H13C 4HB1A 2OYIB 1X8YA 3L73G 1HJBA 3RGUA 2ZT9B 1KB9H 3A0BE 1JCCA 1GL2B 3AE6C 2QJPC 2H43A 4IL6H 1L4AB 1MUUA 3L71E 2H88C 1AQTA 1IFPA 4K35A 2R5BA 1EDKA 3GHGC 3MZWB 4KJMA 3L74G 5E79H 4W80A 2E43A 3CWBD 3M9QA 2KZIA 1BCCE 2AEJA 1HBWA 3GHGB 1PGQA 3AEFC 5AVXB 3U1AA 5APUA 1FZEA 1ZOYC 4GDOA 2D2CC 3CXHE 3L75D 1KYOE 1M1JA 3H1KJ 5APTA 5CCGA 2HPCB 1HWTC 1PPJD 3H1HG 3V4QA 1L4AC 2V7QJ 4IOIH 5APVA 2LR2A 2QE7H 1QVGO 2ZT9C 3Q5RA 2IPPA 4BXLA 1PP9J 3HTKA 5CCHD 4OWFA 2HFED 3TGUJ 2RKLA 2ZYDA 5AVTB 4WVZA 1S4XA 3PP5A 2FFDA 1FJKA 1OVVA 1ZLLA 1Y8AA 1PGOA 4EIJA 1KB9D 2IZ1A 1JY3N 1PP9G 1RQVA 1P84D 2DW3A 2M5AB 3L71D 1G2CA 3V5BA 4AQRD 1YYCA 2OYIA 1URQD 1HJ0A 1JTHB 1LTTC 2IFNA 2YKOA 3EQ2A 1JMBA 3OW2O 1ZR4A 1BE3E 2YNYA 3H1LJ 1LTJB 3H32A 5GTHE 2W6JH 2N9YB 4TLFA 3GLMA 4H44B 1NKZB 4OH8B 4WY4C 3T97A 3N7NA 2E74B 5KJ7A 1RF1C 1BDCA 2FYUD 2Q1KA 1H0TB 2UWJE 1PGPA 1PPJG 3H1HD 3CPWO 3S9OA 2O01H 1N73C 1LWUA 5B66H 5L8RJ 5CCGD 5KLVJ 1VQ5P 1RQUA 2KNCB 4JYCA 3M0AA 3HE4A 1YHQP 4DJGA 1M1JB 1OXZA 3G6EP 3CXHH 1EDLA 2LXCB 2JWAA 1LTAC 5BU5A 2B89A 2H7HA 2BCCE 1NU1K 5K5GB 1NO4A 4H0LC 3RL0C 3USSA 3TNUB 2GM4A 3V2RA 5KAIE 3Q2YA 5CHXA 1PFIA 1DD4A 1G1IA 1NTKE 1GZLA 1NTZD 1PV3A 1SQBJ 1EDJA 4I2LC 2ZFCA 3HE5A 1M8OB 4KT0J 2AXTE 3KZIH 1Q86Q 3GG2A 1M7LA 1GU5A 2YO2A 1K73Q 2IYPA 3L4FA 2YIUC 1MZ9A 1GK6A 2WPRA 4JYBA 3H1HJ 2Q7CA 4BRYB 1KD1Q 1GL2D 3A2AA 1KZUB 1P84E 2OGUA 5DJUB 1NTME 1X22A 2OQQA 3WMM0 1SQXK 4U3FE 3E1IA 3MUDA 3AEBC 2HYNA 3NXSA 1VDFA 1J1DB 1MV8A 4I1LA 1HGVA 5C39A 1DIPA 1HF9A 4HJGH 4IFDK 2GUVA 1GU4A 2P1JA 2WT7A 3L36A 3G4SP 5GTIH 2OTJP 1E5WA 3SWKA 3M06A 1QEXA 1VF5D 2WSEH 3L72D 4C7RA 1VQ8P 3A0HE 1ZN5A 2M8RA 1BGYJ 1SQPE 1U7MA 2FYUG 2KOGA 2I1KA 2L5GB 2PGDA 3NTNA 4GODA 1SQVJ 3E1RA 3TK1A 1DX7A 1OW7A 2OYHC 2QG4A 1VQ9P 2KI7B 3RK2D 3M0DC 2BASA 1W5CE 1SQQK 4ZMDA 3H1IJ 1KMIZ 2B87A 1K9MQ 2N1TA 4U3FD 2A45G 2Z5IA 4GT1A 1YJWP 1E79H 2FXOA 1JNMA 1KB9E 5BU8B 1KN7A 2KIKA 2KZJA 3LW5H 4RESB 1S5LH 2Q6QA 5KAFH 1Z56A 5KLVK 4L76A 4BWNA 1M1JC 2WSCH 2WSFH 1K04A 1URQC 2P58A 4PV1B 2WPQA 3CLQA 3KQGA 2M3BA 2AEFA 3MTUE 2YMKA 4JPZB 3TNUA 3H25A 2PP6A 4ASVA 1YTZI 1N73B 3I56P 4L75A 2GUSA 2XU6A 1KQFB 5M1BA 5CMZA 2CK3H 3H1HE 1VQMP 4H44C 3L72E 1UIIA 4WY4B 3RL0g 3TSIA 1RF1A 2C9LY 4D6TD 1PIXA 2ZXEB 1VQ4P 1NAFA 4CPGA 3FX0A 4PD4I 1RE3C 1NKNA 3BVHA 3H1ID 3WUUA 4BRYA 2K3RA 1HUCA 1NTMD 3T97B 1EXIA 1FC2C 1RE4A 1SFCC 2PRRA 2E5YA 2PAJA 1FZAA 1YQ4C 3L72G 1LWUB 3BASA 2FBWC 1JY2P 4L74A 5AVYB 1URQA 1NAYA 1KFNA 2E76D 1DEBA 1JB0J 3L70J 2OARA 4WBAA 3A3YB 3RK2C 1GW3A 1YTZT 1SQVE 2NPSB 3G9RA 1SQBK 1TU3F 2K9JB 4O9BA 2IDBA 3AE8C 1QGKB 2WSEJ 1LTIC 1M56D 2D2CB 3AE2C 2YXQB 3C8VA 2QRXA 3KXDA 5AW2B 1LT9A 3CMAP 1VQOP 3CCJP 2C0XA 1IFDA 4GKGA 4EOTA 1R8EA 1GK4A 1Q81Q 2R5DA 2L91A 2ZYGA 1FBMA 4UB8E 1VQ6P 3CWBE 3L35A 3V2QA 3C9IA 2IZ0A 3GHGA 3M9HA 3P8MC 4K3AA 4D6TE 4RKUJ 5CCHC 2K1AA 1Q90D 2CPBA 4DOJA 2QEXP 1S5LE 1L4AD 1JY2O 1KYOD 1N7LA 2QJPB 1GL2C 2IYOA 5AW6B 4DT0A 4ZKUA 3TGUD 1KQLA 2QA4P 3G71P 2ITAA 3P8CD 5GTHH 1ZMEC 3IN6A 1YI2P 2HR3A 3BATA 3AE3C 3JCUH 2MJZA 1NTMJ 3N4XA 4NPFX 1R5SA 2Y0EA 1L0ND 3QH9A 4UB6H 4D6TG 2FFDB 1J1DC 1N73A 1CZQA 3V2PA 1W2BO 2G3AA 1T6AA 4XE5B 2A45I 1S5LX 2Y0DA 2M5AA 4LGDE 2KP8A 2H8PD 2FY8A 1P84H 2J58A 1ZP0C 1KC8Q 1JMMA
chains in the Genus database with same CATH topology
4ZNCA 2SPZA 4ASWA 4NPEA 3QWOC 5DJUB 4MN4C 1OVUA 5EFWB 2R44A 5C39A 4HJGH 1X0TA 2QVAA 1MFTA 4EYYQ 1DEEG 1Q2NA 1U7MA 4GODA 2KI7B 1JM0A 5DJTB 4ZMDA 2KUBA 2B87A 1EDIA 4GOEA 2KIKA 2KZJA 1ZW0A 3S1KA 1OVRA 2KS1B 2P58A 4HB1A 3FXDA 4WWIA 3RGUA 1LP1B 4ASVA 4K35A 4HKZH 2LXBA 4JBZA 1EDKA 3MZWB 4KJMA 4CPGA 1H0TA 2KZIA 1ZXGA 2K3RA 1EC5A 5CBNA 2I8DA 1FC2C 4IOIH 3MHVA 2LR2A 3ZDMA 4BXLA 2RKLA 1S3JA 4NPDA 2JWDA 5CBOA 1OVVA 1U7JA 2QRXA 1NVOA 2M5AB 1JMBA 1BDDA 4GOFA 3PH0A 2B88A 4K3AA 2B87B 1BDCA 2Q1KA 1H0TB 2UWJE 1LT1A 2WMMA 2HR3A 2OTKE 1EDLA 4NPFX 2LXCB 3FXEA 2ZAEB 2B89A 1LP1A 1Y47A 5K5GB 1SS1A 2M0BA 2M5AA 1EDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZNC A;  2SPZ A;  4ASW A;  4NPE A;  3QWO C;  5DJU B;  4MN4 C;  1OVU A;  5EFW B;  2R44 A;  5C39 A;  4HJG H;  1X0T A;  2QVA A;  1MFT A;  4EYY Q;  1DEE G;  1Q2N A;  1U7M A;  4GOD A;  2KI7 B;  1JM0 A;  5DJT B;  4ZMD A;  2KUB A;  2B87 A;  1EDI A;  4GOE A;  2KIK A;  2KZJ A;  1ZW0 A;  3S1K A;  1OVR A;  2KS1 B;  2P58 A;  4HB1 A;  3FXD A;  4WWI A;  3RGU A;  1LP1 B;  4ASV A;  4K35 A;  4HKZ H;  2LXB A;  4JBZ A;  1EDK A;  3MZW B;  4KJM A;  4CPG A;  1H0T A;  2KZI A;  1ZXG A;  2K3R A;  1EC5 A;  5CBN A;  2I8D A;  1FC2 C;  4IOI H;  3MHV A;  2LR2 A;  3ZDM A;  4BXL A;  2RKL A;  1S3J A;  4NPD A;  2JWD A;  5CBO A;  1OVV A;  1U7J A;  2QRX A;  1NVO A;  2M5A B;  1JMB A;  1BDD A;  4GOF A;  3PH0 A;  2B88 A;  4K3A A;  2B87 B;  1BDC A;  2Q1K A;  1H0T B;  2UWJ E;  1LT1 A;  2WMM A;  2HR3 A;  2OTK E;  1EDL A;  4NPF X;  2LXC B;  3FXE A;  2ZAE B;  2B89 A;  1LP1 A;  1Y47 A;  5K5G B;  1SS1 A;  2M0B A;  2M5A A;  1EDJ A; 
#chains in the Genus database with same CATH topology
 1RF0 A;  2QJK B;  1L0N E;  2YIU B;  2E76 C;  3PRJ A;  4ASW A;  1UIX A;  2JR8 A;  1FS0 E;  1S2E A;  4PD4 D;  1X9V A;  1SQQ G;  1T2K D;  2N1T B;  2I1J A;  2E75 D;  3SFE C;  3HUS B;  1SFC D;  1NTK G;  3Q5P A;  1NTK K;  2FYU E;  4W7Z A;  3CXH D;  2M3E A;  1GMJ A;  3HE4 B;  4WY4 D;  1MKM A;  3RL0 B;  1T2K C;  4AUW A;  2OTL P;  1FZC A;  3RK3 D;  1OFC X;  1K8A Q;  2BEZ F;  1OIP A;  2JKV A;  2W6A A;  1WMK A;  4H44 D;  4OGQ C;  3HD7 C;  1XTC C;  2K9J A;  4YPC A;  1QL1 A;  2E74 D;  2N1T D;  2P2U A;  2WIT A;  4M3L A;  3TGU G;  4EYY Q;  2E75 B;  3HUS C;  1DEE G;  1KQS O;  5CCH A;  2WT7 B;  3UIA A;  3I5C A;  2N1T C;  1G1J A;  1D7M A;  3IAO A;  4OGQ D;  1NYH A;  2O3J A;  1G2C B;  1L0L K;  5AW1 B;  3SWY A;  4H0L D;  2P7J A;  4N78 D;  2E76 B;  3H1J D;  3B5N C;  1YJN P;  3WU2 H;  1EQ7 A;  1KIL A;  3H1J E;  3SFD C;  2QM8 A;  1A02 F;  1ZV8 A;  1FDO A;  1IZN B;  2VRS A;  1IK9 A;  4IL6 E;  2HOD B;  1EDI A;  2IFM A;  3L73 E;  3M9B A;  1JY3 O;  3TGU E;  4ZKP A;  1LTG C;  1SQP D;  3TF5 A;  1NTK D;  1NTZ E;  2QM7 A;  1U57 A;  3ABV C;  3HTK B;  5KLI B;  1S9K E;  4QMA A;  4W7Y A;  1VQK P;  1N7S D;  2KSE A;  3JC2 2;  2J59 M;  2FFD C;  2BCC D;  3S1K A;  3EFF K;  2QIW A;  3CME P;  1S1C X;  1VL2 A;  3MUD C;  5APY A;  2GA1 A;  3FXD A;  1IC2 A;  1L0N J;  1JEK A;  1NTZ G;  3CX5 I;  1FZC B;  2B9B A;  3B4S A;  3MIW A;  3B71 A;  3LIE A;  3L75 G;  4YXD C;  3PTZ A;  1M1K Q;  3U59 A;  2LKM A;  3FGA D;  3K5B A;  3CX5 H;  2LXB A;  3H1K G;  3HE5 B;  4JQ0 D;  2AEM A;  4C7N A;  2R3S A;  5KLV E;  1W2E A;  1H0T A;  3MGN A;  4IFF A;  3WUT A;  1ZXG A;  3P32 A;  2HG5 D;  3D70 A;  2ZVN B;  3NFQ A;  2WPS A;  5CBN A;  1BCC J;  1ZRT E;  2I8D A;  5APX A;  3CC2 P;  3C1L A;  1YIT P;  3VTP C;  3Q1M A;  1PP9 E;  1HVV A;  3H1K E;  1SQX E;  4PJ0 H;  3ZDM A;  3VMZ A;  1KTM A;  2FYZ A;  2K37 A;  2W27 A;  4N3Y B;  3RK2 B;  5KAI H;  2OYI C;  2IBZ I;  1BCC G;  1NHL A;  2W83 C;  3AE7 C;  5H2F E;  3O6Q B;  1GTW A;  2Y9Z A;  4NPD A;  3B5N D;  1LWU C;  2JWD A;  3H1L D;  3AEE C;  2XDJ A;  3RK3 E;  1QLE D;  3D71 A;  3NMD A;  3H1J J;  3L70 D;  3IR9 A;  5GTI E;  1SFC B;  3U1C A;  3CCU P;  2Q5U A;  1RH5 B;  1FOS E;  3PLN A;  1EZV D;  2XND H;  3A0B H;  3VMX A;  4GOF A;  2YMY A;  1FU1 A;  1N2D C;  2ZYA A;  5AVW B;  1BE3 D;  1SQV G;  2KB7 P;  2Q3E A;  5TIS H;  3E7K A;  4LC1 A;  1KFM A;  2WWW A;  3B5N B;  3CL3 D;  2G8Y A;  1LJ2 A;  2B88 A;  3G3Z A;  2B87 B;  4PV1 D;  4TT3 H;  5H2F H;  5CCG C;  2KLU A;  1IFJ A;  3GMA A;  1FOS F;  2XV5 A;  1GW4 A;  1P84 I;  5CJ4 A;  1LT1 A;  2N9B A;  2WZ7 A;  2E75 C;  1L0L G;  1URQ B;  2WMM A;  1Q7Y Q;  1SQQ D;  3HD7 B;  1USD A;  3A0H H;  3Q3D A;  1L0N G;  3CWB G;  2IBZ G;  2WSC J;  2W6B A;  2WSF J;  3FXE A;  3OJA B;  2MKV A;  2ZXX A;  2NRG A;  1IO4 A;  5AVU B;  1Y47 A;  1L0L D;  1SS1 A;  1L0L J;  1PPJ E;  2WVR A;  2KLV A;  1LTB C;  5AW4 B;  5AW3 B;  1NOH A;  3VOP A;  2ZJS E;  3I55 P;  4UB6 E;  3CX5 E;  3OA7 A;  3PJS K;  1PL5 A;  3GF3 A;  4XFJ A;  5KJ7 C;  2YXR B;  1H88 A;  4WY4 A;  4UB8 H;  4N6J A;  2PFX A;  5APQ A;  4ZNC A;  3HUS A;  1LT9 C;  3BRV B;  3A7O A;  2RH0 A;  2OYH B;  1QVF O;  1EZV I;  2BCC G;  2O1K A;  4NPE A;  4R4M A;  2QJY C;  3SWF A;  1RY3 A;  2Z4E A;  2A06 G;  1VF5 B;  2J5U A;  1FJP A;  3M91 A;  1KIL C;  1OWA A;  2W90 A;  3QWO C;  1LTJ A;  3AE5 C;  2D2C D;  3H32 B;  4U3F J;  2FYN C;  5AW9 B;  3B8E B;  3L70 G;  2YO3 A;  4MN4 C;  1VQP P;  1BE3 J;  3L73 D;  4DZO A;  5EFW B;  3FWN A;  2R44 A;  3H1L E;  2AXC A;  3KHU A;  2IBZ D;  3L72 J;  3VMA A;  4PD4 E;  1AFO A;  1OMI A;  1X0T A;  1SQQ E;  3V2N A;  2A06 E;  4XA4 A;  1N8R Q;  2NPS A;  1LGH B;  2XZR A;  1KIL E;  2R32 A;  1IK7 A;  3W68 A;  5KAF E;  4C46 A;  1Q2N A;  1KIL B;  3GF7 A;  1VF5 C;  4AYC A;  1NU1 D;  2QJY B;  1JTH A;  3H1L G;  1N7S A;  1ZR2 A;  1BGY E;  4IL6 X;  3IF4 A;  3D6Z A;  2NZ2 A;  1FZG A;  1JM0 A;  1AV1 A;  5DJT B;  3V6I A;  1DH3 A;  2KUB A;  2FXM A;  1EZV G;  1WRG A;  3BCC G;  2H89 C;  4Y99 B;  5APS A;  1NU1 G;  5TJH A;  3P8C E;  1N7S C;  3SSU A;  3R2P A;  1QX8 A;  4DCK A;  2OYH A;  3CC4 P;  3R4Y A;  3TYY A;  2KYV A;  3AE1 C;  1NTM K;  1CI6 B;  1DD3 A;  1FZF A;  1GDT A;  2XKM A;  1NH4 A;  4RJT A;  2NPS C;  1NGM B;  3CCQ P;  2W8Z A;  2R3C A;  1L4A A;  1IFM A;  2Q3I A;  2HLO A;  3AE9 C;  2V4H A;  3BCC E;  3O6Q A;  1JCD A;  2CPS A;  1NU1 E;  4LLH A;  4WWI A;  3WUV A;  1Q82 Q;  1LP1 B;  3CCV P;  4D6T J;  1SVF A;  1T8Z A;  2AXT H;  2KS1 A;  1OW6 A;  3KZI E;  3M0D A;  1YQ3 C;  4OVN F;  2V7Q H;  4HKZ H;  3L37 A;  5AW5 B;  1YJ9 P;  4JBZ A;  3HD7 D;  4HH2 A;  3RK3 B;  1BSN A;  5KLV D;  1NWQ A;  4Y28 J;  5APW A;  3CI9 A;  2JEE A;  3RBZ A;  1CW5 A;  4PJ0 E;  2HOD A;  1JOC A;  2QSI A;  3RK3 C;  3B5N A;  1EC5 A;  5BVZ A;  4YTP C;  5AVZ B;  1SQP J;  4C7N B;  3AE4 C;  3JCU E;  1VQL P;  3L71 G;  3L75 E;  1JO5 A;  1KB9 I;  1S72 P;  1H8A A;  1HTL C;  1FAV A;  1LNQ A;  3MHV A;  2FYU K;  3VYI A;  3A5T A;  2C9N Y;  2KNC A;  1GD2 E;  3L74 E;  3TDK A;  4PV1 C;  3H1I E;  3CCL P;  1BE3 G;  1SFC A;  3KPE A;  1S3J A;  3L71 J;  1KYO H;  5CBO A;  4IFM A;  4EI2 A;  1SP4 A;  2P67 A;  2KSJ A;  1RE3 A;  1U7J A;  1SLQ A;  3CX5 D;  1NVO A;  5AVQ B;  1KYO I;  1SQX G;  1N7S B;  3EFG A;  1FDI A;  2Y0C A;  3KDP B;  1L0L E;  3BRT B;  1L0N K;  4Y99 C;  2KXP B;  1IJD B;  1BDD A;  1PZQ A;  1SQV D;  2WPV B;  1RE4 C;  2Z5H A;  3F89 A;  3H1I G;  3PH0 A;  4L73 A;  3D6Y A;  1BGY D;  1PGJ A;  2IBZ E;  1MFZ A;  1VQN P;  2NPS D;  1T3J A;  3O8Z A;  1IFI A;  2RN0 A;  3H1K D;  3II6 A;  1QL2 A;  3OAK A;  3CWB J;  4HYT B;  5B5E H;  2WTY A;  3IFM A;  3CD6 P;  1KIL D;  5AW8 B;  1FZC C;  1CI6 A;  3Q5S A;  1IFN A;  1ZRT D;  2RMZ A;  1M57 D;  3LW5 J;  3CCM P;  4H13 B;  5TIS E;  2JP3 A;  3AED C;  1OW8 A;  2OTK E;  3VMY A;  4R4L A;  2BEQ D;  2ZAE B;  1FDM A;  1AVO A;  1FE6 A;  1SQV K;  2JJL A;  4PD4 H;  5AW7 B;  2OYO A;  2WSS H;  1HGZ A;  1LP1 A;  5KJ7 D;  2O1J A;  4I6M C;  4B86 A;  1R5L A;  2JDI H;  1BSH A;  5KLI C;  1AVY A;  2M0B A;  1SQQ J;  2FYN B;  4GIF A;  3VP8 A;  1J2J B;  1JY2 N;  1L2P A;  1NTZ J;  1SQB D;  1NTM G;  2K9Y A;  2XNX A;  3L70 E;  3MP7 B;  4I7Z C;  4H13 D;  4U3F G;  3RL0 D;  3CCR P;  1T3U A;  3AEA C;  1WT6 A;  1USE A;  1YBK A;  2P10 A;  2SPZ A;  2IX7 C;  3MD0 A;  1LT9 B;  4RO0 A;  1VQ7 P;  2FKW B;  3CXH I;  5E79 E;  3CCS P;  1KOR A;  2YKP A;  1OZH A;  5AVR B;  3V4W A;  1N86 A;  1SQB G;  3L74 J;  4N78 E;  1AA0 A;  1M90 Q;  1J1E B;  1KQG B;  1SQX D;  5AW0 B;  2WQY C;  1S9K D;  3F5H A;  3HRN A;  1A02 J;  1SQP K;  5AVV B;  4EDF A;  2O01 J;  1SQP G;  4KHX A;  2POH A;  4OGQ B;  3WU2 E;  4YXW H;  2Q9I A;  1OVU A;  4H0L B;  3BCC D;  2BCC J;  1BGY G;  3AEG C;  1GL2 A;  2FYU J;  3PHL A;  5KKZ B;  1KV4 A;  2C0W A;  5KKZ C;  3H1J G;  3CC7 P;  3KYQ A;  2QVA A;  1NTK J;  1SQB E;  1YIJ P;  1MFT A;  1XTG B;  1EZV E;  3FWL A;  3W67 A;  3H6P A;  1NTZ K;  1H89 A;  3ITK A;  1J1E C;  3BCC J;  4WB4 A;  3VP9 A;  2E42 A;  1NU1 J;  3AEC C;  1FZB A;  1OX3 A;  1RHZ B;  3JSV C;  2E74 C;  5AVS B;  1AQ5 A;  4Z1M H;  1RF1 B;  4A7P A;  1SQX J;  3P7K A;  3S4R A;  2HPC A;  3GW6 A;  1NJI Q;  1BCC D;  1K05 A;  1LTJ C;  1JY3 P;  2QJK C;  3L74 D;  5B5E E;  4I7Z B;  1EXJ A;  3VN0 A;  5CJ0 A;  2E5T A;  1RF0 C;  2O01 N;  2ZT9 D;  3LID A;  3RBX A;  1VPC A;  2JO1 A;  1PP9 D;  1AJY A;  1LTS C;  4GOE A;  3L73 J;  1HH0 A;  4U7J A;  3CCE P;  2K88 A;  3EWK A;  1Y9B A;  2FXP A;  5KTB A;  1ZW0 A;  2A45 H;  2KK7 A;  2A06 D;  1OVR A;  2Y9Y A;  1CSB A;  3HD7 A;  3L75 J;  2ZVO B;  4JF7 A;  5B66 E;  2KS1 B;  5KLV G;  2YKQ A;  1JUN A;  1X79 B;  4H13 C;  4HB1 A;  2OYI B;  1X8Y A;  3L73 G;  1HJB A;  3RGU A;  2ZT9 B;  1KB9 H;  3A0B E;  1JCC A;  1GL2 B;  3AE6 C;  2QJP C;  2H43 A;  4IL6 H;  1L4A B;  1MUU A;  3L71 E;  2H88 C;  1AQT A;  1IFP A;  4K35 A;  2R5B A;  1EDK A;  3GHG C;  3MZW B;  4KJM A;  3L74 G;  5E79 H;  4W80 A;  2E43 A;  3CWB D;  3M9Q A;  2KZI A;  1BCC E;  2AEJ A;  1HBW A;  3GHG B;  1PGQ A;  3AEF C;  5AVX B;  3U1A A;  5APU A;  1FZE A;  1ZOY C;  4GDO A;  2D2C C;  3CXH E;  3L75 D;  1KYO E;  1M1J A;  3H1K J;  5APT A;  5CCG A;  2HPC B;  1HWT C;  1PPJ D;  3H1H G;  3V4Q A;  1L4A C;  2V7Q J;  4IOI H;  5APV A;  2LR2 A;  2QE7 H;  1QVG O;  2ZT9 C;  3Q5R A;  2IPP A;  4BXL A;  1PP9 J;  3HTK A;  5CCH D;  4OWF A;  2HFE D;  3TGU J;  2RKL A;  2ZYD A;  5AVT B;  4WVZ A;  1S4X A;  3PP5 A;  2FFD A;  1FJK A;  1OVV A;  1ZLL A;  1Y8A A;  1PGO A;  4EIJ A;  1KB9 D;  2IZ1 A;  1JY3 N;  1PP9 G;  1RQV A;  1P84 D;  2DW3 A;  2M5A B;  3L71 D;  1G2C A;  3V5B A;  4AQR D;  1YYC A;  2OYI A;  1URQ D;  1HJ0 A;  1JTH B;  1LTT C;  2IFN A;  2YKO A;  3EQ2 A;  1JMB A;  3OW2 O;  1ZR4 A;  1BE3 E;  2YNY A;  3H1L J;  1LTJ B;  3H32 A;  5GTH E;  2W6J H;  2N9Y B;  4TLF A;  3GLM A;  4H44 B;  1NKZ B;  4OH8 B;  4WY4 C;  3T97 A;  3N7N A;  2E74 B;  5KJ7 A;  1RF1 C;  1BDC A;  2FYU D;  2Q1K A;  1H0T B;  2UWJ E;  1PGP A;  1PPJ G;  3H1H D;  3CPW O;  3S9O A;  2O01 H;  1N73 C;  1LWU A;  5B66 H;  5L8R J;  5CCG D;  5KLV J;  1VQ5 P;  1RQU A;  2KNC B;  4JYC A;  3M0A A;  3HE4 A;  1YHQ P;  4DJG A;  1M1J B;  1OXZ A;  3G6E P;  3CXH H;  1EDL A;  2LXC B;  2JWA A;  1LTA C;  5BU5 A;  2B89 A;  2H7H A;  2BCC E;  1NU1 K;  5K5G B;  1NO4 A;  4H0L C;  3RL0 C;  3USS A;  3TNU B;  2GM4 A;  3V2R A;  5KAI E;  3Q2Y A;  5CHX A;  1PFI A;  1DD4 A;  1G1I A;  1NTK E;  1GZL A;  1NTZ D;  1PV3 A;  1SQB J;  1EDJ A;  4I2L C;  2ZFC A;  3HE5 A;  1M8O B;  4KT0 J;  2AXT E;  3KZI H;  1Q86 Q;  3GG2 A;  1M7L A;  1GU5 A;  2YO2 A;  1K73 Q;  2IYP A;  3L4F A;  2YIU C;  1MZ9 A;  1GK6 A;  2WPR A;  4JYB A;  3H1H J;  2Q7C A;  4BRY B;  1KD1 Q;  1GL2 D;  3A2A A;  1KZU B;  1P84 E;  2OGU A;  5DJU B;  1NTM E;  1X22 A;  2OQQ A;  3WMM 0;  1SQX K;  4U3F E;  3E1I A;  3MUD A;  3AEB C;  2HYN A;  3NXS A;  1VDF A;  1J1D B;  1MV8 A;  4I1L A;  1HGV A;  5C39 A;  1DIP A;  1HF9 A;  4HJG H;  4IFD K;  2GUV A;  1GU4 A;  2P1J A;  2WT7 A;  3L36 A;  3G4S P;  5GTI H;  2OTJ P;  1E5W A;  3SWK A;  3M06 A;  1QEX A;  1VF5 D;  2WSE H;  3L72 D;  4C7R A;  1VQ8 P;  3A0H E;  1ZN5 A;  2M8R A;  1BGY J;  1SQP E;  1U7M A;  2FYU G;  2KOG A;  2I1K A;  2L5G B;  2PGD A;  3NTN A;  4GOD A;  1SQV J;  3E1R A;  3TK1 A;  1DX7 A;  1OW7 A;  2OYH C;  2QG4 A;  1VQ9 P;  2KI7 B;  3RK2 D;  3M0D C;  2BAS A;  1W5C E;  1SQQ K;  4ZMD A;  3H1I J;  1KMI Z;  2B87 A;  1K9M Q;  2N1T A;  4U3F D;  2A45 G;  2Z5I A;  4GT1 A;  1YJW P;  1E79 H;  2FXO A;  1JNM A;  1KB9 E;  5BU8 B;  1KN7 A;  2KIK A;  2KZJ A;  3LW5 H;  4RES B;  1S5L H;  2Q6Q A;  5KAF H;  1Z56 A;  5KLV K;  4L76 A;  4BWN A;  1M1J C;  2WSC H;  2WSF H;  1K04 A;  1URQ C;  2P58 A;  4PV1 B;  2WPQ A;  3CLQ A;  3KQG A;  2M3B A;  2AEF A;  3MTU E;  2YMK A;  4JPZ B;  3TNU A;  3H25 A;  2PP6 A;  4ASV A;  1YTZ I;  1N73 B;  3I56 P;  4L75 A;  2GUS A;  2XU6 A;  1KQF B;  5M1B A;  5CMZ A;  2CK3 H;  3H1H E;  1VQM P;  4H44 C;  3L72 E;  1UII A;  4WY4 B;  3RL0 g;  3TSI A;  1RF1 A;  2C9L Y;  4D6T D;  1PIX A;  2ZXE B;  1VQ4 P;  1NAF A;  4CPG A;  3FX0 A;  4PD4 I;  1RE3 C;  1NKN A;  3BVH A;  3H1I D;  3WUU A;  4BRY A;  2K3R A;  1HUC A;  1NTM D;  3T97 B;  1EXI A;  1FC2 C;  1RE4 A;  1SFC C;  2PRR A;  2E5Y A;  2PAJ A;  1FZA A;  1YQ4 C;  3L72 G;  1LWU B;  3BAS A;  2FBW C;  1JY2 P;  4L74 A;  5AVY B;  1URQ A;  1NAY A;  1KFN A;  2E76 D;  1DEB A;  1JB0 J;  3L70 J;  2OAR A;  4WBA A;  3A3Y B;  3RK2 C;  1GW3 A;  1YTZ T;  1SQV E;  2NPS B;  3G9R A;  1SQB K;  1TU3 F;  2K9J B;  4O9B A;  2IDB A;  3AE8 C;  1QGK B;  2WSE J;  1LTI C;  1M56 D;  2D2C B;  3AE2 C;  2YXQ B;  3C8V A;  2QRX A;  3KXD A;  5AW2 B;  1LT9 A;  3CMA P;  1VQO P;  3CCJ P;  2C0X A;  1IFD A;  4GKG A;  4EOT A;  1R8E A;  1GK4 A;  1Q81 Q;  2R5D A;  2L91 A;  2ZYG A;  1FBM A;  4UB8 E;  1VQ6 P;  3CWB E;  3L35 A;  3V2Q A;  3C9I A;  2IZ0 A;  3GHG A;  3M9H A;  3P8M C;  4K3A A;  4D6T E;  4RKU J;  5CCH C;  2K1A A;  1Q90 D;  2CPB A;  4DOJ A;  2QEX P;  1S5L E;  1L4A D;  1JY2 O;  1KYO D;  1N7L A;  2QJP B;  1GL2 C;  2IYO A;  5AW6 B;  4DT0 A;  4ZKU A;  3TGU D;  1KQL A;  2QA4 P;  3G71 P;  2ITA A;  3P8C D;  5GTH H;  1ZME C;  3IN6 A;  1YI2 P;  2HR3 A;  3BAT A;  3AE3 C;  3JCU H;  2MJZ A;  1NTM J;  3N4X A;  4NPF X;  1R5S A;  2Y0E A;  1L0N D;  3QH9 A;  4UB6 H;  4D6T G;  2FFD B;  1J1D C;  1N73 A;  1CZQ A;  3V2P A;  1W2B O;  2G3A A;  1T6A A;  4XE5 B;  2A45 I;  1S5L X;  2Y0D A;  2M5A A;  4LGD E;  2KP8 A;  2H8P D;  2FY8 A;  1P84 H;  2J58 A;  1ZP0 C;  1KC8 Q;  1JMM A; 
#chains in the Genus database with same CATH homology
 4ZNC A;  2SPZ A;  4ASW A;  4NPE A;  3QWO C;  5DJU B;  4MN4 C;  1OVU A;  5EFW B;  2R44 A;  5C39 A;  4HJG H;  1X0T A;  2QVA A;  1MFT A;  4EYY Q;  1DEE G;  1Q2N A;  1U7M A;  4GOD A;  2KI7 B;  1JM0 A;  5DJT B;  4ZMD A;  2KUB A;  2B87 A;  1EDI A;  4GOE A;  2KIK A;  2KZJ A;  1ZW0 A;  3S1K A;  1OVR A;  2KS1 B;  2P58 A;  4HB1 A;  3FXD A;  4WWI A;  3RGU A;  1LP1 B;  4ASV A;  4K35 A;  4HKZ H;  2LXB A;  4JBZ A;  1EDK A;  3MZW B;  4KJM A;  4CPG A;  1H0T A;  2KZI A;  1ZXG A;  2K3R A;  1EC5 A;  5CBN A;  2I8D A;  1FC2 C;  4IOI H;  3MHV A;  2LR2 A;  3ZDM A;  4BXL A;  2RKL A;  1S3J A;  4NPD A;  2JWD A;  5CBO A;  1OVV A;  1U7J A;  2QRX A;  1NVO A;  2M5A B;  1JMB A;  1BDD A;  4GOF A;  3PH0 A;  2B88 A;  4K3A A;  2B87 B;  1BDC A;  2Q1K A;  1H0T B;  2UWJ E;  1LT1 A;  2WMM A;  2HR3 A;  2OTK E;  1EDL A;  4NPF X;  2LXC B;  3FXE A;  2ZAE B;  2B89 A;  1LP1 A;  1Y47 A;  5K5G B;  1SS1 A;  2M0B A;  2M5A A;  1EDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...