2KUBA

Solution structure of the alpha subdomain of the major non-repeat unit of fap1 fimbriae of streptococcus parasanguis
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
81
structure length
81
Chain Sequence
ENLDKMISEAEVLNDMAARKLITLDAEQQLELMKSLVATQSQLEATKNLIGDPNATVADLQIAYTTLGNNTQALGNELIKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fimbriae-associated protein Fap1
publication title Structural insights into serine-rich fimbriae from gram-positive bacteria.
pubmed doi rcsb
source organism Streptococcus parasanguinis
molecule tags Structural protein
total genus 32
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2010-02-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 2kubA00
1DEEG 3FXEA 1EDIA 2B88A 4HB1A 1LT1A 2HR3A 3QWOC 1H0TB 1OVUA 1LP1B 1LP1A 2B87A 2B87B 1EDKA 2JWDA 4CPGA 4JBZA 4ZNCA 1FC2C 3PH0A 2OTKE 2WMMA 4ASWA 2SPZA 1OVVA 2B89A 2KUBA 2R44A 5CBNA 3S1KA 3MZWB 4ASVA 2P58A 1NVOA 5C39A 4K3AA 4NPFX 1BDDA 1Q2NA 4HJGH 2KIKA 1EDLA 1OVRA 4GODA 1JM0A 2M5AB 4IOIH 2M5AA 2I8DA 2LXCB 1U7MA 2LXBA 3RGUA 4GOEA 1Y47A 4NPEA 1JMBA 4K35A 4HKZH 4GOFA 5CBOA 1X0TA 1EC5A 1ZXGA 2KZJA 2KZIA 2KI7B 1SS1A 5DJUB 2KS1B 2QVAA 2UWJE 2Q1KA 1U7JA 4EYYQ 4MN4C 2ZAEB 3ZDMA 2LR2A 3FXDA 4KJMA 1S3JA 5DJTB 5EFWB 2M0BA 2QRXA 2RKLA 4ZMDA 1H0TA 4BXLA 2K3RA 1ZW0A 3MHVA 1MFTA 1EDJA 4WWIA 4NPDA 1BDCA 5K5GB
chains in the Genus database with same CATH superfamily
4HB1A 1RE3C 1KYOE 4D6TG 4Z1MH 2QJPC 1H0TB 2E42A 2JEEA 2QJKB 3L74J 3WU2H 2DW3A 1PGOA 1FDIA 4XA4A 1SQVE 3IFMA 2W6JH 3O6QB 3JSVC 3VTPC 1NTMJ 2WSEH 3BCCE 1GW4A 3HE4B 5C39A 4NPFX 3WMM0 4JYBA 3LW5H 3MIWA 3H1HD 5H2FE 1JM0A 1FOSF 5APVA 4L76A 1U7MA 2R5BA 1T2KC 3RGUA 3RBZA 1JMBA 1PP9J 2Q7CA 4N78D 1K8AQ 1USEA 1OXZA 3CPWO 1RF1A 1VQKP 2D2CC 4LC1A 1RF0C 1N7SA 5CCGD 1N73C 1JOCA 2AEMA 2KB7P 2IBZD 2Y9ZA 3ZDMA 1HWTC 1LTAC 2RKLA 4IFDK 2WPSA 4BXLA 1ZW0A 3CD6P 3W67A 2AEFA 1MFTA 1BDCA 3EFGA 3L37A 2ZYDA 3S4RA 1AVOA 4N6JA 1VQ7P 2WPQA 1EZVG 2Y0EA 4TT3H 3LIDA 3T97B 1VL2A 2POHA 3HUSB 1LP1B 1OVUA 2C0XA 1RQVA 5AW1B 3OA7A 3WUVA 3CWBJ 2YO2A 1OW7A 1IO4A 4UB8E 1S72P 1NHLA 3O6QA 1WT6A 1CI6B 1S9KE 2QEXP 1HH0A 1L0NG 1PP9E 5KJ7A 3SWFA 3L71J 1GK6A 1JCDA 1GK4A 1BGYE 2PRRA 1KILD 3I5CA 5TISE 3H1JG 3AE2C 2M8RA 3AE9C 1LWUC 3WUTA 1JTHA 3RK2D 4I7ZC 1JCCA 2J58A 2WTYA 4PD4I 3OJAB 3L72G 5GTHE 4MN4C 5AW5B 1L4AB 1P84E 2FYUG 3E1RA 2KK7A 3BRVB 1DD4A 1EZVD 3E1IA 2K1AA 4DT0A 2XZRA 1LGHB 4I1LA 1Q90D 2WVRA 4YPCA 1PGPA 4ZKUA 3T97A 2Y9YA 3JCUH 1NTKG 1LP1A 4CPGA 1L2PA 1VF5D 3H1LD 1L0ND 3II6A 1NTZK 2HLOA 1L0LJ 1GU5A 1RF1C 3NMDA 1CI6A 5APWA 1DD3A 1N7SC 2YIUC 1HGVA 2IX7C 1VDFA 3H1JD 4UB6H 1SQXG 2IYOA 2K37A 2L5GB 1JY2O 1YITP 1X22A 2QIWA 2BEQD 1L0LK 2W83C 3VYIA 1HBWA 3P8CD 4K35A 1JY3O 2ZXXA 3L72D 3L74G 4OVNF 1M8OB 3GLMA 1ZRTE 2GM4A 3WUUA 1SP4A 3AE6C 1U7JA 1NTZE 4EYYQ 4HH2A 5AVQB 2N1TD 2FXOA 2QJKC 1L4AA 2Q5UA 3H32B 3CCRP 1NU1G 1MFZA 2KLUA 3KDPB 1EDJA 2R5DA 5KJ7C 1G1IA 3TF5A 1NTKD 1S5LE 2C9LY 1FDMA 2E75B 5AW8B 1L0LE 3B5ND 2ZYAA 3EWKA 3G9RA 5KKZB 2JWDA 2ZT9D 4JBZA 3Q3DA 1MV8A 3LIEA 4GKGA 1KB9E 4U3FG 3KZIE 1MKMA 3S1KA 3MZWB 1JB0J 2OTLP 2E43A 2PAJA 3G6EP 3CMAP 2OYHB 2E74D 1YJWP 1OVRA 2G8YA 2M5AB 1GD2E 3L75G 3UIAA 1D7MA 1QX8A 4C7NA 2OGUA 1PL5A 3R2PA 1FE6A 3CCJP 4HKZH 4I6MC 3G3ZA 1IFDA 4GIFA 2M3EA 4D6TE 1LT9A 3HD7D 1XTCC 4YXDC 1KB9I 3HUSC 4M3LA 5AW4B 1NU1D 3FX0A 1BE3G 3H1IG 1IK7A 5BU5A 1NWQA 3S9OA 1KQLA 3H32A 2IYPA 2NZ2A 1JMMA 3TNUB 3M91A 1PGQA 4WY4D 1ZP0C 4XFJA 2FXMA 1JY2P 1VQLP 2IBZI 5AVWB 1RY3A 3EFFK 4OWFA 2FFDC 4U3FD 1QVFO 3H1LJ 4GT1A 3QWOC 1L0NJ 2KSEA 1JY3P 3L70G 2WMMA 2B89A 3CCSP 1RE4A 2E76D 2N9BA 1M1KQ 1ZOYC 3SSUA 2WSCH 5B66E 1YQ4C 2FKWB 1ZV8A 3H1JJ 3PP5A 3L75D 2WPRA 2MKVA 2OYHA 1K04A 2KIKA 2FYNB 1EDLA 3VMXA 4GODA 5KLIB 1L4AC 2M5AA 2AEJA 1FAVA 2Q9IA 1PZQA 2HYNA 3H1KG 2WSEJ 3L72J 3O8ZA 3LW5J 2HG5D 1USDA 3MUDC 2FYUJ 3GF3A 3H1ID 1BE3D 5TJHA 2AXTH 2A45H 2GA1A 1OFCX 2QVAA 3H1HG 1Y9BA 4W80A 5DJTB 1SQBK 2N9YB 2QRXA 1T8ZA 1M1JA 3A5TA 1LJ2A 3KPEA 3MHVA 1NTKJ 2FYUK 1DX7A 4PJ0H 3TNUA 3RK2B 4H13D 3F5HA 1CSBA 1SQQK 2B88A 5GTIH 1YQ3C 3L70D 3H1JE 2P67A 2Z4EA 3V2PA 4OH8B 5CCGA 3N4XA 1IFNA 1T2KD 1EZVI 5CBNA 1U57A 1FBMA 1SLQA 2BASA 1SQBE 3RBXA 2D2CD 2WT7B 3H1KD 2QG4A 4IOIH 2FYUE 2I8DA 1SQXK 4O9BA 4PV1B 4AUWA 4GOEA 1PFIA 2HPCA 1SQQE 1VQMP 1VF5B 2XKMA 2KZIA 2E75C 3CCLP 1IFPA 1YTZT 1QVGO 4L75A 1AFOA 1R5LA 1NU1J 2K9JB 2P2UA 3CL3D 1VQPP 1IC2A 5KKZC 2ZAEB 5CJ0A 2BEZF 2KSJA 3U1CA 1NTMK 1JTHB 1RE4C 1KV4A 1EXJA 3RL0D 1KILA 1GDTA 1ZR4A 2NRGA 2FY8A 3MP7B 4AQRD 5APSA 1SQXE 1N8RQ 5AVRB 2OYHC 2W27A 1KMIZ 4U3FJ 4H44C 1ZN5A 3IAOA 2BCCG 2A45G 5KAIH 3AEEC 2N1TB 1A02F 3L74E 4HYTB 2YXQB 2O01N 1AQ5A 3L75J 4Y99C 4YTPC 1LTTC 2AXCA 3V2NA 2CPSA 1NTME 4OGQD 3K5BA 4GDOA 1URQD 2WT7A 3L35A 5KLVG 2CK3H 1YJ9P 4PD4E 3V2QA 3L73G 3TYYA 3USSA 1VQ4P 1AVYA 3V2RA 3H1LG 2ZT9B 4N3YB 5CJ4A 1BCCG 3MGNA 1LTBC 3H1IJ 1BE3J 3AE3C 1W5CE 2KI7B 1G2CB 2K9JA 3RK3D 2E74B 4U3FE 1DH3A 1GZLA 1GL2A 4ZMDA 2PFXA 1FZAA 1K05A 1IZNB 5AVZB 2JWAA 3TSIA 2BCCD 3L70J 3FWNA 5AVTB 1NH4A 2Y0CA 3CC2P 2FYNC 3A0BE 3FXEA 2OYIA 1VQNP 1LT1A 2QA4P 1YBKA 5KLIC 3HD7B 4BRYA 2J5UA 3JCUE 5AW9B 1NYHA 2XV5A 2N1TA 3P7KA 4DCKA 3CWBE 4R4LA 3Q5RA 5KLVD 1OZHA 4KT0J 3AE4C 3H1KJ 5CHXA 1FZFA 3L73D 1BDDA 1Q2NA 2K88A 1BE3E 3L71E 4UB6E 3AE8C 2NPSA 3B5NA 4W7ZA 1BCCD 1NAFA 4U7JA 2O1JA 2LXBA 1Y47A 4NPEA 3AECC 1X9VA 2R3SA 3H1HJ 2WSSH 3ITKA 1SQPG 3PLNA 3RK2C 1ZXGA 2KZJA 1GL2D 5DJUB 2E5TA 1G2CA 3M9HA 2KS1B 2ZXEB 4LGDE 4C7NB 3L70E 1OX3A 2W90A 1BSNA 2H88C 4RJTA 3D70A 3D6YA 3CX5D 2YXRB 1LT9B 2ITAA 2JDIH 3CI9A 1OMIA 4WWIA 2WITA 3Q5PA 4TLFA 2H43A 3HD7A 1PV3A 1KYOD 2FXPA 3VMYA 1WMKA 3CCMP 3H1KE 2YMKA 4PV1C 2QM8A 1DEBA 1Q7YQ 4L73A 1YJNP 1DIPA 5CMZA 3NXSA 1SQVD 3PJSK 2P58A 5APTA 4R4MA 1R8EA 2NPSD 4EI2A 4Y28J 4HJGH 3H1HE 1NKZB 1GMJA 1SFCD 2YKPA 4WY4A 1R5SA 4H13B 2PP6A 2I1KA 2MJZA 3RL0g 3AE1C 2WSCJ 4W7YA 1SQPD 2IFMA 4N78E 1CW5A 1BGYG 3NTNA 1OW6A 3TGUG 5CCHD 2W6AA 2H7HA 1X79B 2KS1A 2IBZE 3CCEP 1S5LH 1QL2A 3CC7P 3V4QA 2Q1KA 3FXDA 1S3JA 4RKUJ 3G4SP 2YKQA 3GMAA 5BU8B 2P10A 3Q5SA 3GHGB 1Q81Q 1A02J 2BCCJ 4DOJA 3GG2A 3KZIH 1FZGA 3HE5A 4RESB 2GUSA 3PRJA 1VQ5P 2YKOA 3MTUE 2VRSA 4IL6H 3M9BA 2RH0A 1M1JB 1EDKA 3PTZA 1RE3A 1FOSE 2OTKE 3C1LA 2ZT9C 5KLVJ 4YXWH 2Q3IA 4EOTA 3VOPA 3RL0B 3L73J 1OWAA 1S9KD 3D71A 3N7NA 3CLQA 2E5YA 2V4HA 1BCCJ 1W2EA 4LLHA 3RK3E 1KILE 1T3JA 1BGYD 2CPBA 5KLVK 1JY3N 4H0LD 3TGUD 1N2DC 3P32A 1QLED 4DJGA 1FS0E 4IL6X 1VQOP 1FZEA 1L0NK 1BSHA 3VP9A 3NFQA 2A06G 3HD7C 5B5EE 4OGQB 3H6PA 5AW2B 3AEGC 5AVVB 2Z5HA 1RF0A 4XE5B 5L8RJ 2HPCB 3L4FA 3F89A 1URQB 3FGAD 5EFWB 1N73A 1S2EA 1P84D 3GHGA 2KNCA 1EZVE 1NTZG 1KQSO 1JUNA 2WZ7A 2ZYGA 5KLVE 2OYOA 5K5GB 1NAYA 1EDIA 5GTIE 2OQQA 3AE5C 3H1LE 1LTGC 3CXHH 3RK3B 1KILB 3CCVP 1L0NE 4C7RA 3AE7C 1SQVJ 2KLVA 2IPPA 2R3CA 3GF7A 2A45I 1CZQA 2O01H 1HF9A 4BWNA 2E75D 1IFJA 3QH9A 3MD0A 1NGMB 2GUVA 1KTMA 3M9QA 1SQPJ 1NTKK 3WU2E 2P1JA 5E79H 2LXCB 1VQ6P 2QSIA 3P8CE 5KAFH 1LT9C 1QL1A 2V7QJ 2A06D 3L72E 3CCUP 5AW3B 1IFIA 1EC5A 3G71P 2QJYB 1LWUA 1PIXA 5AW7B 1ZRTD 1SQPK 1FJPA 3B71A 4H44D 3C8VA 2HFED 1RH5B 1NTZD 1URQA 3A0HH 3CX5H 1IJDB 3SFEC 3D6ZA 2IFNA 3OAKA 1PPJG 3I56P 1NTKE 3TK1A 2G3AA 3IF4A 1E79H 5M1BA 2QM7A 1KYOH 4H13C 1KFMA 2PGDA 1L0LD 1GL2B 2HR3A 2OARA 1H8AA 3C9IA 1AQTA 3CX5I 1RQUA 5KAIE 1ZR2A 4ZKPA 1OIPA 1SQPE 3EQ2A 1KB9D 1NU1K 2XDJA 2OYIB 3AEAC 5AVUB 4BRYB 1KYOI 2WSFH 3CMEP 5APQA 1BGYJ 5H2FH 3M0AA 3TGUJ 5KTBA 1HUCA 2Y0DA 3GHGC 3KYQA 3R4YA 2V7QH 3SWKA 3V5BA 2KP8A 2H89C 4D6TD 1SS1A 3E7KA 3JC22 4JQ0D 2NPSB 3B5NB 2RMZA 2ZVNB 3ABVC 4IFFA 2LKMA 1NU1E 1VQ8P 1PPJD 1M1JC 1LNQA 1SFCB 1H0TA 1Q86Q 2Z5IA 1HJ0A 3A7OA 1M56D 3RL0C 1J1DB 4JPZB 2L91A 5CCGC 2KXPB 1T3UA 3HE4A 2WWWA 3P8MC 1FZCB 4DZOA 1GU4A 4ZNCA 4PD4H 2FFDB 1Z56A 2JKVA 3TDKA 5APYA 1NKNA 2KUBA 4UB8H 1AJYA 3TGUE 1N7SD 4ASVA 3L75E 3CC4P 4WBAA 1J1EB 1KFNA 4OGQC 1UIXA 3U59A 3CXHD 1URQC 1SQBG 3M06A 5TISH 1WRGA 2OTJP 2JR8A 3B8EB 4GOFA 3M0DA 1SQVG 3H1IE 1IK9A 4WY4B 1SQQG 1NO4A 1K73Q 1NTZJ 3BCCG 5GTHH 1HTLC 3A0BH 2UWJE 1LTIC 3B4SA 4EDFA 3RK3C 1KILC 2YNYA 2JO1A 1SFCA 4PV1D 5AVSB 2XNXA 2M0BA 1P84H 4JF7A 3HUSA 2IZ1A 2E76B 1Q82Q 5KJ7D 2YO3A 4H0LB 5AVXB 5BVZA 4NPDA 3VN0A 3W68A 2B9BA 1HVVA 1Y8AA 1VQ9P 1YIJP 3KQGA 1MUUA 1LTJB 5CCHA 1FZCA 2IDBA 2WQYC 1P84I 3HRNA 2FFDA 1FC2C 2R32A 2JJLA 2SPZA 3GW6A 1IFMA 3HE5B 2R44A 1FJKA 2W6BA 2RN0A 4JYCA 2A06E 3U1AA 2QJYC 2ZVOB 1KC8Q 2ZFCA 5AW0B 1SQBD 1XTGB 1M90Q 2QJPB 2I1JA 1VF5C 2FYUD 5APUA 1NTMG 1TU3F 2IZ0A 1J2JB 5APXA 1SQQD 4EIJA 1N7LA 3BCCD 4D6TJ 5AVYB 3OW2O 5AW6B 1AV1A 1HGZA 1H88A 1YHQP 4QMAA 3BATA 1GL2C 3MUDA 1PP9G 3SFDC 3IR9A 1PGJA 4RO0A 2H8PD 1AA0A 2OYIC 1YI2P 1M7LA 3SWYA 1ZMEC 2C0WA 1SQXD 2D2CB 3HTKB 1JNMA 1KD1Q 3V6IA 1FU1A 3A2AA 4IL6E 1LTJA 1N73B 2N1TC 3H25A 2B87B 4H44B 2KNCB 2FBWC 1KQFB 1EQ7A 1KB9H 4ASWA 1OVVA 1GTWA 3AEFC 2XU6A 2M3BA 3BASA 3L74D 3M0DC 4KHXA 2WPVB 4K3AA 2QE7H 2NPSC 3B5NC 1NTMD 3CWBG 4Y99B 1L4AD 2HODB 3VMZA 3L36A 1QGKB 2O1KA 1SFCC 1RHZB 4PD4D 1PPJE 3AEDC 4L74A 1S5LX 1M57D 2O01J 3L71G 1J1DC 1JEKA 1E5WA 1NOHA 4WVZA 1GW3A 1PP9D 1X0TA 3IN6A 3AEBC 1JY2N 2E74C 5CCHC 4A7PA 1KZUB 1FZCC 1VPCA 2LR2A 1OW8A 3KXDA 1LWUB 1T6AA 2BCCE 3VP8A 4I7ZB 2ZJSE 2AXTE 1J1EC 3FWLA 1DEEG 1KN7A 1S1CX 3HTKA 3PHLA 3A3YB 1X8YA 1KORA 1H89A 2B87A 1HJBA 3CXHE 1K9MQ 2KOGA 3PH0A 2KYVA 3KHUA 1S4XA 1FDOA 2J59M 2FYZA 4PJ0E 3V4WA 3CWBD 1EXIA 5B66H 3I55P 1SQBJ 1NVOA 4WY4C 1JO5A 4B86A 3Q1MA 3L73E 4I2LC 2P7JA 4WB4A 2HODA 4IFMA 1BCCE 3L71D 2C9NY 1L0LG 2Q3EA 5E79E 5B5EH 3BVHA 1SQQJ 1G1JA 1ZLLA 2E76C 3BCCJ 5KAFE 2Q6QA 4H0LC 2WSFJ 5CBOA 3Q2YA 2K9YA 1RF1B 2W8ZA 1MZ9A 3CCQP 1N7SB 1YYCA 2YIUB 3CXHI 1LTJC 1SQVK 1QEXA 1LTSC 3BRTB 2JP3A 4KJMA 3VMAA 3A0HE 3CX5E 2K3RA 2YMYA 2IBZG 1UIIA 4AYCA 1SQXJ 1N86A 1FZBA 1KQGB 2O3JA 1SVFA 4C46A 1NJIQ 1W2BO 2XNDH 1YTZI
chains in the Genus database with same CATH topology
1DEEG 3FXEA 1EDIA 2B88A 4HB1A 1LT1A 2HR3A 3QWOC 1H0TB 1OVUA 1LP1B 1LP1A 2B87A 2B87B 1EDKA 2JWDA 4CPGA 4JBZA 4ZNCA 1FC2C 3PH0A 2OTKE 2WMMA 4ASWA 2SPZA 1OVVA 2B89A 2KUBA 2R44A 5CBNA 3S1KA 3MZWB 4ASVA 2P58A 1NVOA 5C39A 4K3AA 4NPFX 1BDDA 1Q2NA 4HJGH 2KIKA 1EDLA 1OVRA 4GODA 1JM0A 2M5AB 4IOIH 2M5AA 2I8DA 2LXCB 1U7MA 2LXBA 3RGUA 4GOEA 1Y47A 4NPEA 1JMBA 4K35A 4HKZH 4GOFA 5CBOA 1X0TA 1EC5A 1ZXGA 2KZJA 2KZIA 2KI7B 1SS1A 5DJUB 2KS1B 2QVAA 2UWJE 2Q1KA 1U7JA 4EYYQ 4MN4C 2ZAEB 3ZDMA 2LR2A 3FXDA 4KJMA 1S3JA 5DJTB 5EFWB 2M0BA 2QRXA 2RKLA 4ZMDA 1H0TA 4BXLA 2K3RA 1ZW0A 3MHVA 1MFTA 1EDJA 4WWIA 4NPDA 1BDCA 5K5GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DEE G;  3FXE A;  1EDI A;  2B88 A;  4HB1 A;  1LT1 A;  2HR3 A;  3QWO C;  1H0T B;  1OVU A;  1LP1 B;  1LP1 A;  2B87 A;  2B87 B;  1EDK A;  2JWD A;  4CPG A;  4JBZ A;  4ZNC A;  1FC2 C;  3PH0 A;  2OTK E;  2WMM A;  4ASW A;  2SPZ A;  1OVV A;  2B89 A;  2KUB A;  2R44 A;  5CBN A;  3S1K A;  3MZW B;  4ASV A;  2P58 A;  1NVO A;  5C39 A;  4K3A A;  4NPF X;  1BDD A;  1Q2N A;  4HJG H;  2KIK A;  1EDL A;  1OVR A;  4GOD A;  1JM0 A;  2M5A B;  4IOI H;  2M5A A;  2I8D A;  2LXC B;  1U7M A;  2LXB A;  3RGU A;  4GOE A;  1Y47 A;  4NPE A;  1JMB A;  4K35 A;  4HKZ H;  4GOF A;  5CBO A;  1X0T A;  1EC5 A;  1ZXG A;  2KZJ A;  2KZI A;  2KI7 B;  1SS1 A;  5DJU B;  2KS1 B;  2QVA A;  2UWJ E;  2Q1K A;  1U7J A;  4EYY Q;  4MN4 C;  2ZAE B;  3ZDM A;  2LR2 A;  3FXD A;  4KJM A;  1S3J A;  5DJT B;  5EFW B;  2M0B A;  2QRX A;  2RKL A;  4ZMD A;  1H0T A;  4BXL A;  2K3R A;  1ZW0 A;  3MHV A;  1MFT A;  1EDJ A;  4WWI A;  4NPD A;  1BDC A;  5K5G B; 
#chains in the Genus database with same CATH topology
 4HB1 A;  1RE3 C;  1KYO E;  4D6T G;  4Z1M H;  2QJP C;  1H0T B;  2E42 A;  2JEE A;  2QJK B;  3L74 J;  3WU2 H;  2DW3 A;  1PGO A;  1FDI A;  4XA4 A;  1SQV E;  3IFM A;  2W6J H;  3O6Q B;  3JSV C;  3VTP C;  1NTM J;  2WSE H;  3BCC E;  1GW4 A;  3HE4 B;  5C39 A;  4NPF X;  3WMM 0;  4JYB A;  3LW5 H;  3MIW A;  3H1H D;  5H2F E;  1JM0 A;  1FOS F;  5APV A;  4L76 A;  1U7M A;  2R5B A;  1T2K C;  3RGU A;  3RBZ A;  1JMB A;  1PP9 J;  2Q7C A;  4N78 D;  1K8A Q;  1USE A;  1OXZ A;  3CPW O;  1RF1 A;  1VQK P;  2D2C C;  4LC1 A;  1RF0 C;  1N7S A;  5CCG D;  1N73 C;  1JOC A;  2AEM A;  2KB7 P;  2IBZ D;  2Y9Z A;  3ZDM A;  1HWT C;  1LTA C;  2RKL A;  4IFD K;  2WPS A;  4BXL A;  1ZW0 A;  3CD6 P;  3W67 A;  2AEF A;  1MFT A;  1BDC A;  3EFG A;  3L37 A;  2ZYD A;  3S4R A;  1AVO A;  4N6J A;  1VQ7 P;  2WPQ A;  1EZV G;  2Y0E A;  4TT3 H;  3LID A;  3T97 B;  1VL2 A;  2POH A;  3HUS B;  1LP1 B;  1OVU A;  2C0X A;  1RQV A;  5AW1 B;  3OA7 A;  3WUV A;  3CWB J;  2YO2 A;  1OW7 A;  1IO4 A;  4UB8 E;  1S72 P;  1NHL A;  3O6Q A;  1WT6 A;  1CI6 B;  1S9K E;  2QEX P;  1HH0 A;  1L0N G;  1PP9 E;  5KJ7 A;  3SWF A;  3L71 J;  1GK6 A;  1JCD A;  1GK4 A;  1BGY E;  2PRR A;  1KIL D;  3I5C A;  5TIS E;  3H1J G;  3AE2 C;  2M8R A;  3AE9 C;  1LWU C;  3WUT A;  1JTH A;  3RK2 D;  4I7Z C;  1JCC A;  2J58 A;  2WTY A;  4PD4 I;  3OJA B;  3L72 G;  5GTH E;  4MN4 C;  5AW5 B;  1L4A B;  1P84 E;  2FYU G;  3E1R A;  2KK7 A;  3BRV B;  1DD4 A;  1EZV D;  3E1I A;  2K1A A;  4DT0 A;  2XZR A;  1LGH B;  4I1L A;  1Q90 D;  2WVR A;  4YPC A;  1PGP A;  4ZKU A;  3T97 A;  2Y9Y A;  3JCU H;  1NTK G;  1LP1 A;  4CPG A;  1L2P A;  1VF5 D;  3H1L D;  1L0N D;  3II6 A;  1NTZ K;  2HLO A;  1L0L J;  1GU5 A;  1RF1 C;  3NMD A;  1CI6 A;  5APW A;  1DD3 A;  1N7S C;  2YIU C;  1HGV A;  2IX7 C;  1VDF A;  3H1J D;  4UB6 H;  1SQX G;  2IYO A;  2K37 A;  2L5G B;  1JY2 O;  1YIT P;  1X22 A;  2QIW A;  2BEQ D;  1L0L K;  2W83 C;  3VYI A;  1HBW A;  3P8C D;  4K35 A;  1JY3 O;  2ZXX A;  3L72 D;  3L74 G;  4OVN F;  1M8O B;  3GLM A;  1ZRT E;  2GM4 A;  3WUU A;  1SP4 A;  3AE6 C;  1U7J A;  1NTZ E;  4EYY Q;  4HH2 A;  5AVQ B;  2N1T D;  2FXO A;  2QJK C;  1L4A A;  2Q5U A;  3H32 B;  3CCR P;  1NU1 G;  1MFZ A;  2KLU A;  3KDP B;  1EDJ A;  2R5D A;  5KJ7 C;  1G1I A;  3TF5 A;  1NTK D;  1S5L E;  2C9L Y;  1FDM A;  2E75 B;  5AW8 B;  1L0L E;  3B5N D;  2ZYA A;  3EWK A;  3G9R A;  5KKZ B;  2JWD A;  2ZT9 D;  4JBZ A;  3Q3D A;  1MV8 A;  3LIE A;  4GKG A;  1KB9 E;  4U3F G;  3KZI E;  1MKM A;  3S1K A;  3MZW B;  1JB0 J;  2OTL P;  2E43 A;  2PAJ A;  3G6E P;  3CMA P;  2OYH B;  2E74 D;  1YJW P;  1OVR A;  2G8Y A;  2M5A B;  1GD2 E;  3L75 G;  3UIA A;  1D7M A;  1QX8 A;  4C7N A;  2OGU A;  1PL5 A;  3R2P A;  1FE6 A;  3CCJ P;  4HKZ H;  4I6M C;  3G3Z A;  1IFD A;  4GIF A;  2M3E A;  4D6T E;  1LT9 A;  3HD7 D;  1XTC C;  4YXD C;  1KB9 I;  3HUS C;  4M3L A;  5AW4 B;  1NU1 D;  3FX0 A;  1BE3 G;  3H1I G;  1IK7 A;  5BU5 A;  1NWQ A;  3S9O A;  1KQL A;  3H32 A;  2IYP A;  2NZ2 A;  1JMM A;  3TNU B;  3M91 A;  1PGQ A;  4WY4 D;  1ZP0 C;  4XFJ A;  2FXM A;  1JY2 P;  1VQL P;  2IBZ I;  5AVW B;  1RY3 A;  3EFF K;  4OWF A;  2FFD C;  4U3F D;  1QVF O;  3H1L J;  4GT1 A;  3QWO C;  1L0N J;  2KSE A;  1JY3 P;  3L70 G;  2WMM A;  2B89 A;  3CCS P;  1RE4 A;  2E76 D;  2N9B A;  1M1K Q;  1ZOY C;  3SSU A;  2WSC H;  5B66 E;  1YQ4 C;  2FKW B;  1ZV8 A;  3H1J J;  3PP5 A;  3L75 D;  2WPR A;  2MKV A;  2OYH A;  1K04 A;  2KIK A;  2FYN B;  1EDL A;  3VMX A;  4GOD A;  5KLI B;  1L4A C;  2M5A A;  2AEJ A;  1FAV A;  2Q9I A;  1PZQ A;  2HYN A;  3H1K G;  2WSE J;  3L72 J;  3O8Z A;  3LW5 J;  2HG5 D;  1USD A;  3MUD C;  2FYU J;  3GF3 A;  3H1I D;  1BE3 D;  5TJH A;  2AXT H;  2A45 H;  2GA1 A;  1OFC X;  2QVA A;  3H1H G;  1Y9B A;  4W80 A;  5DJT B;  1SQB K;  2N9Y B;  2QRX A;  1T8Z A;  1M1J A;  3A5T A;  1LJ2 A;  3KPE A;  3MHV A;  1NTK J;  2FYU K;  1DX7 A;  4PJ0 H;  3TNU A;  3RK2 B;  4H13 D;  3F5H A;  1CSB A;  1SQQ K;  2B88 A;  5GTI H;  1YQ3 C;  3L70 D;  3H1J E;  2P67 A;  2Z4E A;  3V2P A;  4OH8 B;  5CCG A;  3N4X A;  1IFN A;  1T2K D;  1EZV I;  5CBN A;  1U57 A;  1FBM A;  1SLQ A;  2BAS A;  1SQB E;  3RBX A;  2D2C D;  2WT7 B;  3H1K D;  2QG4 A;  4IOI H;  2FYU E;  2I8D A;  1SQX K;  4O9B A;  4PV1 B;  4AUW A;  4GOE A;  1PFI A;  2HPC A;  1SQQ E;  1VQM P;  1VF5 B;  2XKM A;  2KZI A;  2E75 C;  3CCL P;  1IFP A;  1YTZ T;  1QVG O;  4L75 A;  1AFO A;  1R5L A;  1NU1 J;  2K9J B;  2P2U A;  3CL3 D;  1VQP P;  1IC2 A;  5KKZ C;  2ZAE B;  5CJ0 A;  2BEZ F;  2KSJ A;  3U1C A;  1NTM K;  1JTH B;  1RE4 C;  1KV4 A;  1EXJ A;  3RL0 D;  1KIL A;  1GDT A;  1ZR4 A;  2NRG A;  2FY8 A;  3MP7 B;  4AQR D;  5APS A;  1SQX E;  1N8R Q;  5AVR B;  2OYH C;  2W27 A;  1KMI Z;  4U3F J;  4H44 C;  1ZN5 A;  3IAO A;  2BCC G;  2A45 G;  5KAI H;  3AEE C;  2N1T B;  1A02 F;  3L74 E;  4HYT B;  2YXQ B;  2O01 N;  1AQ5 A;  3L75 J;  4Y99 C;  4YTP C;  1LTT C;  2AXC A;  3V2N A;  2CPS A;  1NTM E;  4OGQ D;  3K5B A;  4GDO A;  1URQ D;  2WT7 A;  3L35 A;  5KLV G;  2CK3 H;  1YJ9 P;  4PD4 E;  3V2Q A;  3L73 G;  3TYY A;  3USS A;  1VQ4 P;  1AVY A;  3V2R A;  3H1L G;  2ZT9 B;  4N3Y B;  5CJ4 A;  1BCC G;  3MGN A;  1LTB C;  3H1I J;  1BE3 J;  3AE3 C;  1W5C E;  2KI7 B;  1G2C B;  2K9J A;  3RK3 D;  2E74 B;  4U3F E;  1DH3 A;  1GZL A;  1GL2 A;  4ZMD A;  2PFX A;  1FZA A;  1K05 A;  1IZN B;  5AVZ B;  2JWA A;  3TSI A;  2BCC D;  3L70 J;  3FWN A;  5AVT B;  1NH4 A;  2Y0C A;  3CC2 P;  2FYN C;  3A0B E;  3FXE A;  2OYI A;  1VQN P;  1LT1 A;  2QA4 P;  1YBK A;  5KLI C;  3HD7 B;  4BRY A;  2J5U A;  3JCU E;  5AW9 B;  1NYH A;  2XV5 A;  2N1T A;  3P7K A;  4DCK A;  3CWB E;  4R4L A;  3Q5R A;  5KLV D;  1OZH A;  4KT0 J;  3AE4 C;  3H1K J;  5CHX A;  1FZF A;  3L73 D;  1BDD A;  1Q2N A;  2K88 A;  1BE3 E;  3L71 E;  4UB6 E;  3AE8 C;  2NPS A;  3B5N A;  4W7Z A;  1BCC D;  1NAF A;  4U7J A;  2O1J A;  2LXB A;  1Y47 A;  4NPE A;  3AEC C;  1X9V A;  2R3S A;  3H1H J;  2WSS H;  3ITK A;  1SQP G;  3PLN A;  3RK2 C;  1ZXG A;  2KZJ A;  1GL2 D;  5DJU B;  2E5T A;  1G2C A;  3M9H A;  2KS1 B;  2ZXE B;  4LGD E;  4C7N B;  3L70 E;  1OX3 A;  2W90 A;  1BSN A;  2H88 C;  4RJT A;  3D70 A;  3D6Y A;  3CX5 D;  2YXR B;  1LT9 B;  2ITA A;  2JDI H;  3CI9 A;  1OMI A;  4WWI A;  2WIT A;  3Q5P A;  4TLF A;  2H43 A;  3HD7 A;  1PV3 A;  1KYO D;  2FXP A;  3VMY A;  1WMK A;  3CCM P;  3H1K E;  2YMK A;  4PV1 C;  2QM8 A;  1DEB A;  1Q7Y Q;  4L73 A;  1YJN P;  1DIP A;  5CMZ A;  3NXS A;  1SQV D;  3PJS K;  2P58 A;  5APT A;  4R4M A;  1R8E A;  2NPS D;  4EI2 A;  4Y28 J;  4HJG H;  3H1H E;  1NKZ B;  1GMJ A;  1SFC D;  2YKP A;  4WY4 A;  1R5S A;  4H13 B;  2PP6 A;  2I1K A;  2MJZ A;  3RL0 g;  3AE1 C;  2WSC J;  4W7Y A;  1SQP D;  2IFM A;  4N78 E;  1CW5 A;  1BGY G;  3NTN A;  1OW6 A;  3TGU G;  5CCH D;  2W6A A;  2H7H A;  1X79 B;  2KS1 A;  2IBZ E;  3CCE P;  1S5L H;  1QL2 A;  3CC7 P;  3V4Q A;  2Q1K A;  3FXD A;  1S3J A;  4RKU J;  3G4S P;  2YKQ A;  3GMA A;  5BU8 B;  2P10 A;  3Q5S A;  3GHG B;  1Q81 Q;  1A02 J;  2BCC J;  4DOJ A;  3GG2 A;  3KZI H;  1FZG A;  3HE5 A;  4RES B;  2GUS A;  3PRJ A;  1VQ5 P;  2YKO A;  3MTU E;  2VRS A;  4IL6 H;  3M9B A;  2RH0 A;  1M1J B;  1EDK A;  3PTZ A;  1RE3 A;  1FOS E;  2OTK E;  3C1L A;  2ZT9 C;  5KLV J;  4YXW H;  2Q3I A;  4EOT A;  3VOP A;  3RL0 B;  3L73 J;  1OWA A;  1S9K D;  3D71 A;  3N7N A;  3CLQ A;  2E5Y A;  2V4H A;  1BCC J;  1W2E A;  4LLH A;  3RK3 E;  1KIL E;  1T3J A;  1BGY D;  2CPB A;  5KLV K;  1JY3 N;  4H0L D;  3TGU D;  1N2D C;  3P32 A;  1QLE D;  4DJG A;  1FS0 E;  4IL6 X;  1VQO P;  1FZE A;  1L0N K;  1BSH A;  3VP9 A;  3NFQ A;  2A06 G;  3HD7 C;  5B5E E;  4OGQ B;  3H6P A;  5AW2 B;  3AEG C;  5AVV B;  2Z5H A;  1RF0 A;  4XE5 B;  5L8R J;  2HPC B;  3L4F A;  3F89 A;  1URQ B;  3FGA D;  5EFW B;  1N73 A;  1S2E A;  1P84 D;  3GHG A;  2KNC A;  1EZV E;  1NTZ G;  1KQS O;  1JUN A;  2WZ7 A;  2ZYG A;  5KLV E;  2OYO A;  5K5G B;  1NAY A;  1EDI A;  5GTI E;  2OQQ A;  3AE5 C;  3H1L E;  1LTG C;  3CXH H;  3RK3 B;  1KIL B;  3CCV P;  1L0N E;  4C7R A;  3AE7 C;  1SQV J;  2KLV A;  2IPP A;  2R3C A;  3GF7 A;  2A45 I;  1CZQ A;  2O01 H;  1HF9 A;  4BWN A;  2E75 D;  1IFJ A;  3QH9 A;  3MD0 A;  1NGM B;  2GUV A;  1KTM A;  3M9Q A;  1SQP J;  1NTK K;  3WU2 E;  2P1J A;  5E79 H;  2LXC B;  1VQ6 P;  2QSI A;  3P8C E;  5KAF H;  1LT9 C;  1QL1 A;  2V7Q J;  2A06 D;  3L72 E;  3CCU P;  5AW3 B;  1IFI A;  1EC5 A;  3G71 P;  2QJY B;  1LWU A;  1PIX A;  5AW7 B;  1ZRT D;  1SQP K;  1FJP A;  3B71 A;  4H44 D;  3C8V A;  2HFE D;  1RH5 B;  1NTZ D;  1URQ A;  3A0H H;  3CX5 H;  1IJD B;  3SFE C;  3D6Z A;  2IFN A;  3OAK A;  1PPJ G;  3I56 P;  1NTK E;  3TK1 A;  2G3A A;  3IF4 A;  1E79 H;  5M1B A;  2QM7 A;  1KYO H;  4H13 C;  1KFM A;  2PGD A;  1L0L D;  1GL2 B;  2HR3 A;  2OAR A;  1H8A A;  3C9I A;  1AQT A;  3CX5 I;  1RQU A;  5KAI E;  1ZR2 A;  4ZKP A;  1OIP A;  1SQP E;  3EQ2 A;  1KB9 D;  1NU1 K;  2XDJ A;  2OYI B;  3AEA C;  5AVU B;  4BRY B;  1KYO I;  2WSF H;  3CME P;  5APQ A;  1BGY J;  5H2F H;  3M0A A;  3TGU J;  5KTB A;  1HUC A;  2Y0D A;  3GHG C;  3KYQ A;  3R4Y A;  2V7Q H;  3SWK A;  3V5B A;  2KP8 A;  2H89 C;  4D6T D;  1SS1 A;  3E7K A;  3JC2 2;  4JQ0 D;  2NPS B;  3B5N B;  2RMZ A;  2ZVN B;  3ABV C;  4IFF A;  2LKM A;  1NU1 E;  1VQ8 P;  1PPJ D;  1M1J C;  1LNQ A;  1SFC B;  1H0T A;  1Q86 Q;  2Z5I A;  1HJ0 A;  3A7O A;  1M56 D;  3RL0 C;  1J1D B;  4JPZ B;  2L91 A;  5CCG C;  2KXP B;  1T3U A;  3HE4 A;  2WWW A;  3P8M C;  1FZC B;  4DZO A;  1GU4 A;  4ZNC A;  4PD4 H;  2FFD B;  1Z56 A;  2JKV A;  3TDK A;  5APY A;  1NKN A;  2KUB A;  4UB8 H;  1AJY A;  3TGU E;  1N7S D;  4ASV A;  3L75 E;  3CC4 P;  4WBA A;  1J1E B;  1KFN A;  4OGQ C;  1UIX A;  3U59 A;  3CXH D;  1URQ C;  1SQB G;  3M06 A;  5TIS H;  1WRG A;  2OTJ P;  2JR8 A;  3B8E B;  4GOF A;  3M0D A;  1SQV G;  3H1I E;  1IK9 A;  4WY4 B;  1SQQ G;  1NO4 A;  1K73 Q;  1NTZ J;  3BCC G;  5GTH H;  1HTL C;  3A0B H;  2UWJ E;  1LTI C;  3B4S A;  4EDF A;  3RK3 C;  1KIL C;  2YNY A;  2JO1 A;  1SFC A;  4PV1 D;  5AVS B;  2XNX A;  2M0B A;  1P84 H;  4JF7 A;  3HUS A;  2IZ1 A;  2E76 B;  1Q82 Q;  5KJ7 D;  2YO3 A;  4H0L B;  5AVX B;  5BVZ A;  4NPD A;  3VN0 A;  3W68 A;  2B9B A;  1HVV A;  1Y8A A;  1VQ9 P;  1YIJ P;  3KQG A;  1MUU A;  1LTJ B;  5CCH A;  1FZC A;  2IDB A;  2WQY C;  1P84 I;  3HRN A;  2FFD A;  1FC2 C;  2R32 A;  2JJL A;  2SPZ A;  3GW6 A;  1IFM A;  3HE5 B;  2R44 A;  1FJK A;  2W6B A;  2RN0 A;  4JYC A;  2A06 E;  3U1A A;  2QJY C;  2ZVO B;  1KC8 Q;  2ZFC A;  5AW0 B;  1SQB D;  1XTG B;  1M90 Q;  2QJP B;  2I1J A;  1VF5 C;  2FYU D;  5APU A;  1NTM G;  1TU3 F;  2IZ0 A;  1J2J B;  5APX A;  1SQQ D;  4EIJ A;  1N7L A;  3BCC D;  4D6T J;  5AVY B;  3OW2 O;  5AW6 B;  1AV1 A;  1HGZ A;  1H88 A;  1YHQ P;  4QMA A;  3BAT A;  1GL2 C;  3MUD A;  1PP9 G;  3SFD C;  3IR9 A;  1PGJ A;  4RO0 A;  2H8P D;  1AA0 A;  2OYI C;  1YI2 P;  1M7L A;  3SWY A;  1ZME C;  2C0W A;  1SQX D;  2D2C B;  3HTK B;  1JNM A;  1KD1 Q;  3V6I A;  1FU1 A;  3A2A A;  4IL6 E;  1LTJ A;  1N73 B;  2N1T C;  3H25 A;  2B87 B;  4H44 B;  2KNC B;  2FBW C;  1KQF B;  1EQ7 A;  1KB9 H;  4ASW A;  1OVV A;  1GTW A;  3AEF C;  2XU6 A;  2M3B A;  3BAS A;  3L74 D;  3M0D C;  4KHX A;  2WPV B;  4K3A A;  2QE7 H;  2NPS C;  3B5N C;  1NTM D;  3CWB G;  4Y99 B;  1L4A D;  2HOD B;  3VMZ A;  3L36 A;  1QGK B;  2O1K A;  1SFC C;  1RHZ B;  4PD4 D;  1PPJ E;  3AED C;  4L74 A;  1S5L X;  1M57 D;  2O01 J;  3L71 G;  1J1D C;  1JEK A;  1E5W A;  1NOH A;  4WVZ A;  1GW3 A;  1PP9 D;  1X0T A;  3IN6 A;  3AEB C;  1JY2 N;  2E74 C;  5CCH C;  4A7P A;  1KZU B;  1FZC C;  1VPC A;  2LR2 A;  1OW8 A;  3KXD A;  1LWU B;  1T6A A;  2BCC E;  3VP8 A;  4I7Z B;  2ZJS E;  2AXT E;  1J1E C;  3FWL A;  1DEE G;  1KN7 A;  1S1C X;  3HTK A;  3PHL A;  3A3Y B;  1X8Y A;  1KOR A;  1H89 A;  2B87 A;  1HJB A;  3CXH E;  1K9M Q;  2KOG A;  3PH0 A;  2KYV A;  3KHU A;  1S4X A;  1FDO A;  2J59 M;  2FYZ A;  4PJ0 E;  3V4W A;  3CWB D;  1EXI A;  5B66 H;  3I55 P;  1SQB J;  1NVO A;  4WY4 C;  1JO5 A;  4B86 A;  3Q1M A;  3L73 E;  4I2L C;  2P7J A;  4WB4 A;  2HOD A;  4IFM A;  1BCC E;  3L71 D;  2C9N Y;  1L0L G;  2Q3E A;  5E79 E;  5B5E H;  3BVH A;  1SQQ J;  1G1J A;  1ZLL A;  2E76 C;  3BCC J;  5KAF E;  2Q6Q A;  4H0L C;  2WSF J;  5CBO A;  3Q2Y A;  2K9Y A;  1RF1 B;  2W8Z A;  1MZ9 A;  3CCQ P;  1N7S B;  1YYC A;  2YIU B;  3CXH I;  1LTJ C;  1SQV K;  1QEX A;  1LTS C;  3BRT B;  2JP3 A;  4KJM A;  3VMA A;  3A0H E;  3CX5 E;  2K3R A;  2YMY A;  2IBZ G;  1UII A;  4AYC A;  1SQX J;  1N86 A;  1FZB A;  1KQG B;  2O3J A;  1SVF A;  4C46 A;  1NJI Q;  1W2B O;  2XND H;  1YTZ I; 
#chains in the Genus database with same CATH homology
 1DEE G;  3FXE A;  1EDI A;  2B88 A;  4HB1 A;  1LT1 A;  2HR3 A;  3QWO C;  1H0T B;  1OVU A;  1LP1 B;  1LP1 A;  2B87 A;  2B87 B;  1EDK A;  2JWD A;  4CPG A;  4JBZ A;  4ZNC A;  1FC2 C;  3PH0 A;  2OTK E;  2WMM A;  4ASW A;  2SPZ A;  1OVV A;  2B89 A;  2KUB A;  2R44 A;  5CBN A;  3S1K A;  3MZW B;  4ASV A;  2P58 A;  1NVO A;  5C39 A;  4K3A A;  4NPF X;  1BDD A;  1Q2N A;  4HJG H;  2KIK A;  1EDL A;  1OVR A;  4GOD A;  1JM0 A;  2M5A B;  4IOI H;  2M5A A;  2I8D A;  2LXC B;  1U7M A;  2LXB A;  3RGU A;  4GOE A;  1Y47 A;  4NPE A;  1JMB A;  4K35 A;  4HKZ H;  4GOF A;  5CBO A;  1X0T A;  1EC5 A;  1ZXG A;  2KZJ A;  2KZI A;  2KI7 B;  1SS1 A;  5DJU B;  2KS1 B;  2QVA A;  2UWJ E;  2Q1K A;  1U7J A;  4EYY Q;  4MN4 C;  2ZAE B;  3ZDM A;  2LR2 A;  3FXD A;  4KJM A;  1S3J A;  5DJT B;  5EFW B;  2M0B A;  2QRX A;  2RKL A;  4ZMD A;  1H0T A;  4BXL A;  2K3R A;  1ZW0 A;  3MHV A;  1MFT A;  1EDJ A;  4WWI A;  4NPD A;  1BDC A;  5K5G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...