1KQFB

Formate dehydrogenase n from e. coli
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
289
structure length
289
Chain Sequence
AMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPADLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELAEQRVAKLKARGYEHAGVYNPEGVGGTHVMYVLHHADQPELYHGLPKDPKIDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIGPNKEVDDDEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
publication title Molecular basis of proton motive force generation: structure of formate dehydrogenase-N.
pubmed doi rcsb
total genus 87
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2002-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF09163 Form-deh_trans Formate dehydrogenase N, transmembrane
B PF12838 Fer4_7 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.480 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1kqfB03
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqfB01
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqfB02
4L6V3 2VPWB 4YDDB 4XDDA 1G6BA 1Y5IB 7FD1A 2C3YA 2FJDB 4AYBD 2FJBB 2C3MA 5BYSA 3EXYA 1HFEL 2Y0SD 1B0VA 3MM6B 1C4AA 2XSJB 1BQXA 1FEHA 1FRXA 3MM9B 2GMHA 4ID8A 1JB0C 1PC4A 1KEKA 1FXDA 2O01C 1Y4ZB 1FDDA 2WSCC 3MM9A 1B0PA 3MMBA 3IR7B 1R27B 1FRLA 1WTFA 3GYXB 2C42A 3MM8A 7FDRA 1FERA 1SIWB 1H98A 3C8YA 2WSEC 1FXRA 1GAOA 1H7WA 1K0TA 3MM7A 2FJAB 2C3UA 2VPYB 2FJEB 1SJ1A 5FD1A 1FTCA 3OR1B 1BD6A 1B0TA 1BLUA 3MMBB 2PDAA 5BYQA 2C3PA 3LW5C 1BC6A 3HKZD 1A6LA 1FRJA 3OR1A 1IR0A 3MM8B 1FD2A 2C3OA 1C4CA 3MMAA 1FDNA 1JNRB 1XERA 5L8RC 2IVFB 3OR2A 1GT8A 1Y5LB 3IR5B 3MM7B 1KQGB 5E7OB 1Y5NB 1D3WA 1H0HB 3EGWB 1FCAA 1KQFB 6FD1A 2FD2A 1ROFA 1BWEA 1FRHA 4OV1A 1F2GA 1H7XA 2VKRA 1FRKA 1SIZA 2WAQD 1GTHA 3MMAB 4RKUC 5BYRA 1FRIA 1AXQA 1FF2A 2V4JA 1DURA 3EUNA 3OR2B 4Y28C 2PMZD 1JNZB 5CH7B 2WSFC 2ZVSA 3PNIA 1Q16B 4KT0C 1GTEA 2GMJA 3MMCA 6FDRA 4XK8C 1VJWA 1F5CA 1RGVA 1FDAA 2UZAA 2FGOA 5CHCB 1IQZA 2WB1D 2Z8QA 1DFDA 3MM5B 1FDBA 3IR6B 4OMFG 4XDCA 1CLFA 2PA8D 1PC5A 4DHVA 2V4JB 2VPXB 2VPZB 3MM6A 2V2KA 3MM5A 1F5BA 3MMCB 1G3OA 2XSJA 1FRMA 4CI0B 2FDNA 1DAXA
chains in the Genus database with same CATH superfamily
2WQYC 2XTJP 4ZPWR 3ZC4A 3H1JG 1PYSB 1EZVI 2BMBA 4CCHA 4NYPA 2V2ZA 1M1GA 3FCVA 3EICA 4LFAJ 4KGMA 4DQPA 3P3DA 5GTHE 5AXKA 4EIJA 4M95A 3MFHA 2G9OA 1VBKA 4JI2J 1H72C 3UO0A 5A76A 2J0QD 2R7XA 2W4PA 2UXDF 4ED5A 1FJPA 1VQ9P 1XTGB 1WTBA 4ILLA 4XA4A 5K14B 2MQNA 1RQVA 4B9VA 3JXOA 1KQLA 4PJ0H 4QIWD 4P75A 2A45H 1KWMA 1RTZA 1Z56A 3GFXA 4B3SF 3M2UB 2YX4A 3KK1A 4WXOA 2BM1A 1YYCA 1Y5NB 1VC6A 4F3QA 5L46A 3GYGA 1VBXA 4X66J 1SQPE 3RYLA 2W8LA 2CQBA 1EZVD 1RH5B 4OYMA 1YK9A 5B0DA 1X7VA 5AJ3F 5HVHA 1WOSA 4Z2XA 2QA2A 3IRXA 4CNZA 1YJUA 1Q7YT 4H0LD 3KLIA 4LF1A 1FNXH 1WSVA 3K8WA 1VQ4P 5KAFE 3DOMB 3JQMA 2O1KA 3POTA 5F3TA 1ZMEC 1N48A 4CT8A 2M3BA 2WW4A 2ZC3A 5G0RA 1X60A 4B3MF 2O1PA 3Q86A 1RT7A 1G1IA 4AUKA 3TAQA 2C1EB 2IPPA 2O67A 5KFUA 2XU6A 3OTDA 4F2SA 2DO4A 3H1HG 4QIVA 1QX8A 2DR7A 1TK8A 3LH2S 2V8PA 2YQ0A 3CI9A 2HAIA 3TGUE 3QIDA 4NZ0A 1HGVA 1RT1A 2CPHA 4F3OA 3MD0A 1BLUA 2EI5A 1ITPA 2BANB 1MV8A 2HNYB 3MM8B 1UETA 2QJYB 3RJMB 2CQ0A 4F3MA 3NBPB 3VV2B 2V68A 3M32B 1OJ4A 2LCWA 4ES3A 3OW2R 2FYNC 1UKUA 4H4OA 2H7HA 2ZXXA 2BE7D 1H7XA 3RB0A 2IX7C 1J1EB 2L9NA 3CCSS 4CO1A 3O1LA 1GK4A 4YPCA 2AJ1A 3H1IG 1KORA 1OY8A 5ETSA 4J9OA 4CTAB 3Q8PB 3H7HB 3DI6A 3DN9A 3A0BH 4BWNA 3JYTB 4JI4J 4RBTA 4MKYA 4H0LB 4KFBB 4C7NA 1SQGA 2KZJA 2AYEA 2WTFA 2FJBB 2LDIA 1CC7A 1HR0F 4CNYA 5BXIA 2RF2B 2LXIA 1C4AA 4WFZA 4ELVA 1MU2A 2KDOA 3AE5C 2UUCF 5AW0B 3I5AA 1FESA 3L71J 1X8YA 2QX0A 1QUPA 1SQQG 2FLOA 5I4MA 3TYTA 4AL5A 4XO0A 5HN0A 4U7UD 2P1JA 3MUDC 2RHSB 3VQTA 3KJVB 1SVFA 3CCWA 4JV5F 2ZWPA 2VQFJ 2LQJA 1H2UX 2J9EA 1UW9A 1BCCD 5AXMA 1IBKF 2JJLA 4IO1A 1QM9A 1S1WB 2B5JA 3A7OA 3KZIH 4C8MA 2W6JH 1RT6B 4NLRA 4ZLNA 1Q78A 3MMCA 2GHWA 1IUJA 3D0IE 4IOCQ 2WT7B 3M8QB 1KLNA 5A0YB 4IH7A 4MAKA 5IV3A 1UA0A 1SBRA 3ONQA 3VMAA 5J2QB 3CX5I 4B9TA 3CMAS 1SQXG 1USEA 2XLKA 1IR1A 3MTUE 3J7Z5 1AA1B 2EBEA 2E1CA 2ZJQQ 3NS6A 2J0SD 5IT9U 4Y65A 2RSQA 1OPZA 4RW7B 3HFKA 3MCOA 5CHXA 2HQGA 3SCJE 3AH6A 3EDRB 5H9FJ 3B4DA 1L3SA 4C4WA 3C6TB 3DU5A 3G9RA 5DRKA 4PD4H 1NTMD 4B3TJ 1T8EA 2UP1A 2EFQA 2HQFA 4CWBA 1Q86Q 1N32F 1WC1A 2J7WA 5EX0A 4AQYF 2J6TA 1CJVB 3H1LD 3Q22A 2BE2A 1V3SA 3KDPB 2A1BA 1AFJA 3WIVA 2GO9A 3K58A 3ZDMA 2QSIA 1U25A 2CQGA 2O66A 1LWFB 1PPJG 1P6TA 4DX5A 3IRWP 2F8EX 2HNZA 4RBUA 3MEGA 3UCZP 4GVBB 3CCJS 1SQPJ 3DRPA 2HVIA 5J2PA 5GMEA 1UTAA 4IFYA 5HP1A 3PR4A 3FFIB 2CJYB 2VC0A 3J81j 3G71P 3T6JA 3O8WA 1T9WA 4K3AA 2HKEA 2R7SA 1JMTA 2OYOA 1E79H 5K8MA 4RR5A 1MFTA 2DR5A 2O3JA 4C2MA 3TZZA 1X9MA 2H5JB 1N88A 5F8NA 2K9JA 4I7ZB 2BOAA 4A8FA 5KG4A 3A0HH 3E7KA 4LF6J 5LT5A 1UVLA 2IZ1A 3TGUJ 3KHHA 3PW4A 1KHWA 4Y00A 5EGYA 3PFEA 4PV1C 3PJSK 4WBFA 4KE5A 5LSLA 1DARA 2OEJA 2HFVA 2D7SA 3QIPA 4QR1A 3TO8A 3J7A1 4HYKA 5KLIB 2Q43A 3QT8A 2CAJA 2KVQE 1JCCA 1WHWA 4LF2A 4R5PB 3W9IA 1GX6A 1PJ5A 4OZ5A 4J9UE 3MD3A 4X4PA 2ZD1B 3OFFA 1G2EA 2CPBA 3EZ5A 1L0NE 1BWEA 4USVA 2H51B 2B3TB 4MYTA 1WKLA 3MXHP 2PE8A 1GTHA 4KJIA 1SUQB 1SQVK 5CH7B 2XNRA 1WOPA 3L95X 3I87A 3D1HA 4CRJA 2UWJE 3M8SA 1SQBG 4DFJA 4K4UA 1HJBA 1S57A 1R43A 1Q81T 1Q5YA 3BH6B 5BR8F 1VFJA 3H2UB 2QA4G 5E79E 4DPWA 3Q5PA 2KRRA 1ZETA 1YSJA 2LU2A 3Q3DA 4G1IA 3BQ0A 1R7IA 3CL3D 3M7VA 3FDSA 1NTKE 3L74G 2L3MA 2P10A 1AFIA 4UOFA 3W2VB 3KJQB 2PIIA 1UCNA 2OTLP 3PIOQ 1T94A 3OL9A 1RCXB 2VG5B 1KLMB 2V8VA 3MMBA 4WK1A 3SQOP 1X9VA 1JLAA 2WMMA 4GC7A 4I2PA 2N1TD 4X4OA 1YRXA 1S1VA 4FF4A 1RF0C 1JLGB 2HWIA 5AT1B 4NLUA 3CCLP 3VTIA 3HUSB 1VQ4S 3CXHE 4LBPA 4ZVSB 3DMJA 1FFSB 3DDKA 1LWEA 1LKZA 2RQKA 4DCPB 5B0BA 1UIXA 2QV6A 2HMIB 3OTOJ 4NMLA 4HLBA 4IFVB 1ZOYC 2E42A 2MDAA 4DZDA 2KYXA 2OELA 4RW4A 2E75B 3LALA 2NPIA 4N76A 2GMLA 2WSCJ 3GIKA 1DD4A 5CZVA 3K5OA 5HATA 3HMJG 3LO3A 5HROA 4PQUB 1NU4A 4PCQA 1AQ5A 1J2VA 3RG6A 1O5JA 3GR0A 3IWXA 2R7OA 1S72P 2HHVA 2RILA 3SSUA 1KILE 1AJYA 4FPRA 2V50A 3H59A 2P5VA 3M9OB 2YKMB 4OZ2A 1OVRA 1JOCA 1N73C 1LXNA 4PABA 5D4OA 2M8RA 1SV5B 1FXDA 1MROA 2V34A 3CC4P 4QWEA 2IHR1 1XTZA 3FK4A 4A7PA 1IC2A 4DMZA 1NKEA 4F4XA 3MCMA 4DFMA 1KBRA 4ZVOB 2K37A 2N1TB 4DV0F 1EB0A 2DTJA 5H2FH 2CPXA 2UUAJ 3A8IA 5EUHA 2OMOA 2QIFA 1S9FA 1FZCB 5APWA 1S97A 3BVHA 4A4JA 3FGVA 4ZVQB 3V6IA 3OTEA 1TMJA 3P8CD 3JSMA 3TNUB 1QL1A 4XK8C 3RK2D 1BGYD 4LRCA 3CJQA 3T5JA 2P6TA 4LF8J 3AEGC 2VIHA 3GLJA 4RNNA 1EDIA 2B4UA 3UVJB 4N47A 2DGVA 2K7KA 3MPVA 4ELUA 1WKJA 4QIEA 4TU9A 3H5UA 2BACA 3KNAA 2VRSA 2QG9B 3CLQA 5J2MA 2HODB 2OGUA 3AXKA 2GMHA 3E1IA 1HWLA 3GFZA 3LGNA 1QEXA 2P58A 1UJ6A 4NPEA 1R31A 5B66H 2B6AA 3HJFA 5F3ZA 1T3JA 2UVVA 1RT4B 2NYIA 2XCAA 1FERA 9ATCB 4QYZJ 3ISZA 1HIYA 1JLFA 2QZ8A 1R0BG 5KAIE 2QO3A 4ID5A 1NSQA 1S5ZA 1S9EB 3CCVP 1NJXA 3UD4P 3W5ZA 5KAKA 3QJLA 3G4SS 2XMUA 3OR2A 3AD9C 3CX5H 1J1DC 5F0WA 4YUDA 5I42A 1TV6B 2B7CB 5C2CA 3WIUA 3NXZA 2ZH5A 1S9KD 3NOGA 3VQSA 5A2QY 5E3PA 2Z58B 4U9RA 1QTMA 4YB5A 1OX3A 3D68A 2WVRA 2KIKA 2W9BA 3DC2A 4WBAA 5BVZA 4HACB 5HVGA 2MKCA 3QATA 3O44A 2B4OA 4NWBA 2R8IA 3ENQA 4LSLB 2FHMA 1VQ7S 1HYSB 3H1JD 1X5SA 2R7VA 4KQZA 2ROPA 1ZM3A 3L35A 1W2IA 2NPSD 3ILLA 1RA6A 3MHVA 1N73A 3CXCR 4X84A 3FEZA 4C9DA 1NTKJ 3IM9A 3KLVA 4K7QA 2R8HA 4J9NA 1DJ0A 2XV5A 1KFDA 2RD5C 3IAM9 1X4FA 3AFGA 3V81A 2OD6A 2F63A 3MGJA 2ASLA 5RUBA 1ZLLA 3TK1A 1MWYA 3VAIA 3G71S 2UU9F 4X4UA 4RNHA 5AVVB 4HHHA 4IG0B 3KG1A 2UUBF 3U27A 3MM7A 1EETA 2MSTA 1ZV8A 3OSPA 1IBLF 4ZMMA 2BJ3A 2ZHBA 5I3UA 1T3UA 2B87A 4BLGA 4KAIA 1IKVB 1GK8A 4M94A 3GIJA 3C15B 2HFNA 1JMMA 4DJGA 4A47A 5J1NA 3MEDB 3MWBA 2G8YA 2DKOB 1MN7A 2G3AA 2BUNA 4ED6A 3SZ2A 1O51A 1OWXA 4PPDA 2YWEA 3L75E 1N33F 1RSCA 1NDKA 2NS1B 3G6XA 2Q6CA 1SH3A 2WVCA 2K1RA 1F5CA 4OZ0A 1L2PA 3GHGB 1XR5A 3TQEA 5IC4B 3RRHA 1FE0A 1C1CA 2RQCA 3H4BA 4DUZF 1FJGJ 2V69A 3CJSA 4DBQA 4DCJB 3FVYA 3NXSA 4MFBB 1WNEA 3KLHB 5HVFA 1NTZK 4FZVA 3PVXA 1LWCB 4AE5A 3EFGA 1QAIA 2M3EA 3L71G 1M1KQ 4UY85 1S76D 1N0UA 3PHTA 3FMBA 1FK9B 2GGPB 1V5VA 3M9QA 1LP1A 1S1XA 1W25A 2AHOB 3OJUA 4ECZA 4NXMF 4LSNB 1PCAA 3ITHA 2OO4A 3THTA 1S99A 5TISE 1HMVB 2CJBA 2JZ5A 2R7WA 5KFMA 3H4DA 2A2DA 4M5NA 3R9LA 3O2IA 3L36A 4CLPA 1YQ3C 3EQ2A 1YZ6A 3HVAA 5E5NA 1WUUA 5KG1A 2O3DA 3NGKA 4ZPVR 4DQQA 4OZ3A 4OYWA 4LBHA 3FRYA 3IAOA 3DDNA 2R3SA 4WY4B 1CQMA 1O8BA 2MB0B 1W7WA 2HPCB 2W1BA 2OTLS 2RU3A 1Z1ZA 2OTKE 1H0TB 1E6VA 1VQNP 3H1ID 5DLGA 2DNHA 1FDAA 2KL8A 1M7LA 3VAMA 1RTDB 2J58A 3RB4A 3T1YF 5CD4H 4G1QA 4GRSA 1RK8A 3O6QB 4OHZA 5ETKA 1FHTA 1S6PB 2MQ8A 2LR2A 1FS0E 1VQ5P 2RN0A 3J81U 2C3YA 2QJPB 2D9PA 1HARA 4DR2F 1G2CB 3T97B 3BJYA 3PFOA 1C0TB 3TRGA 4DG1B 1N7SA 2KT2A 3PEHA 1SQQD 4PAAA 1VQMS 2E9RX 5ETLA 2IFXA 3D9BA 2XY6A 1CJTB 2OYIB 1X8DA 3C8YA 4ED7A 1LT1A 1LTIC 4HH2A 1H8AA 4OYIA 3KUGA 5E33A 1N6QA 1HHTP 5BJRA 2QTWA 4N3YB 1JLQB 1KYOD 1M57D 4JQ0D 2ALYB 1XMOJ 1NCLA 3SDEA 5DDRC 3JCUE 1B4SA 2KI7B 5KG7A 4TNOA 4W80A 1SQPG 1YJVA 5HQLA 2MJUA 2QMWA 2B88A 1Q95G 3MURP 5B5EE 2ASYA 1IBMJ 4DCKA 3CC4S 1X9WA 2WOMA 3T5HA 1SXLA 3Q83A 2NSCA 1L4AD 2D3OR 2GA7A 2VDHA 4GKJJ 2BJDA 1SQXD 2AIRB 4TY8B 1TAQA 3QLHB 2QA1A 3T41A 3NGSA 2EPIA 4IL6H 3M91A 1WC4A 4M63A 2HQ3A 3MI7X 4I69A 2FVCA 3D6TB 4ETZA 2RJZA 5KOWA 1NJWA 3W8PA 5IT9Y 2PRRA 3CULA 3TGUG 2FHJA 4E0DA 3SMZA 1NHKL 2DXDA 3Q5RA 2ZE2B 2QJYC 2XO6A 2HWHA 4CYUB 3TX0A 4N6JA 1HBMB 1TZ0A 4BS2A 4UT4A 3MR5A 2CNKB 2B8QA 4OJ3A 1N5VA 2H3EB 2QN6B 2K2PA 2W9CB 3HKZD 3WDOA 3AAWB 3DOKA 1XMQJ 3CPWR 1R8AA 4HVZA 3PV8A 1PPJD 4UUXA 2GUSA 1KONA 4USKA 2I5JA 3IR5B 2CRLA 2CNLB 1NU1K 2VUGA 5ETRA 2K06A 1JK9B 5HQMA 1CI6B 2E44A 2VHGA 1HNVB 2LXBA 2HURA 4TY9A 3RL0g 4HDGA 2AXTE 3L75J 4H0LC 3MIWA 5KT5A 1GX5A 1HI8A 3KDNA 1T9TA 3D5MA 1REVB 2R5BA 2J8AA 2QM8A 4PRFA 4Q0BA 3HK2A 1FKPB 2BEQD 2BCCE 2R7RA 2K9YA 4LQ3A 4BWMA 5KFHA 1R6VA 3CCVS 5ETOA 5ITHA 3TVZA 4K4SA 4OYBA 4PKDB 1L4AB 3L72E 1RLCL 4KV8B 4HJGH 2R8GA 3OUYB 4FVMA 5K14A 1S12A 2NZ2A 3ILOA 5LOQA 2GFFA 2NPFA 1F60B 2ATCB 5K8PA 3BSNA 3R4YA 3MM9A 2KB7P 1GMVA 1OYDA 3V6JA 4Q45A 3M2UA 2H89C 1U57A 1GAOA 1U1OA 1UVNA 5FD1A 2HYNA 1KN6A 2E43A 4DV3F 3GMAA 1NB2A 3AE9C 3OXFA 3CPWO 1NOHA 1DLOB 4ZIWA 3HX9A 4LF9J 2PA3A 1JWWA 1GMWD 4CLFA 3JSBA 4X62F 2QLXA 2XNDH 1RCOB 3MPUB 2NUHA 2DITA 1UVIA 2FZCB 1BDDA 4ZVUB 1YI2P 6AT1B 1HQEB 3DOMA 4PZVA 1NEEA 2HHPA 5K8OA 1SQBD 3QRQA 2M8DB 1SQVE 4LFBF 1T2KD 4JI1J 1IFPA 1X9SA 4ZVPB 2YMYA 1R8PA 1MW7A 3CJ5A 4IO9Q 3PX6A 3L74D 2OJ3A 1TQLA 5AE3A 2ZVIA 1IM4A 4L73A 2X1FA 4Y2IA 2R44A 2DGWA 4O4GB 3KK2B 4B3OB 1SI9A 4WIQA 2N7CA 1SS1A 1MUUA 3QPIA 1WEZA 4E8UA 4ES1A 2QRXA 3NRBA 5HK4A 3MM8A 3OBIA 1RE3A 2EKYA 2E76D 2O01N 2MHEA 1Z4UA 1VIOA 3R6GB 1EIYB 3NBPA 4N77A 2W2OP 5LMNF 1U8WA 3M32A 3W61A 4DWIA 1M1JC 1RWOB 4RL1A 2PDAA 2GNKA 1HBUB 3GV8B 4ANDA 1PGQA 2NRGA 2DHXA 2ZVNB 3EWGA 1UEKA 2W2QP 4LF7J 2ZM6J 3LPYA 2YKOA 4PUOA 3RRGA 2YH1A 3TJ9A 4CTAA 1EDLA 5M2RA 5DETA 2VKZG 5DZ7A 3FSYA 1Q1KA 3ZZYA 2BX6A 1J5OA 5KG2A 1J27A 5APSA 1N36F 4DSFA 4KFBA 4ZDNA 2D41A 1GW3A 2YWGA 3HHDA 3MOZA 5LJ3Y 5JMNA 4A8XA 4DS5A 4I7ZC 2DJWA 1T03B 3B5ND 2CA9A 3AXMA 1EQ7A 3ELHA 3R5GA 2XY5A 2FYUJ 2QIWA 1Y9OA 4EYYQ 1Y3JA 2ZHAA 4OV6A 2WSCH 2JP3A 2YNGB 2HRTA 4QW9A 4OJGA 1OW8A 7AT1B 3AOBA 1L5UA 1D1UA 3OJSA 4HR2A 1FJEB 2XMTA 3KJVA 1B70B 1WHXA 1HQ2A 1GU5A 5KLIC 3TR5A 4DX6A 4ECQA 2F4VJ 1Q8LA 1X79B 1SJFA 4MK8A 1KOHA 4DR5F 4YXDC 1P84D 1HPZA 1RE1B 3CMES 2YNIB 4DJBA 4B3SJ 2JHEA 5H9EK 3UN2A 1HUCA 1VK3A 1S1WA 2E76B 2Z5IA 1S9GB 1FDOA 4ZVEA 4OHWA 4YEAA 4AYCA 1D9AA 3FQKA 1D0EA 2C2DA 1VQ5S 1L0NG 2HNDB 2DYAA 4H4KC 1OVVA 1T9UA 4N7TA 4HT5A 2GQQA 3IR9A 2WT7A 1RE4A 2J7KA 3IS9A 5A0YA 1R0AB 1LNQA 5HJXA 2ZH7A 4RJVA 2GVZB 5ETTA 5J2QA 2XS5A 2GA1A 2KS1A 3ENAA 5CXTA 2HHHJ 4MN4C 5IFMA 5TJHA 3S1TA 3M30B 2HVZA 1B3TA 4W7ZA 3C46A 4PG7A 2HZCA 3MM5B 5L39A 2BCCJ 1GDTA 2OD4A 2DCLA 2V8HA 3NCQA 2YX1A 3CWBE 4TKTA 4JI3J 2VV5A 3SI8A 2W6AA 2VPWB 3QFWA 4B3MJ 5GAEI 1NTKG 1NYHA 2APOA 2CJQA 3B5NB 3L72J 4H44B 1WD6A 5K5MA 3C6TA 2XDJA 1JJCB 5CYJA 3CB4A 5KOXA 5APTA 1P8GA 2G4BA 2HHWA 3HUSC 5CA5A 3Q8SB 5F8GA 5H1SV 4ZS6A 1ZYQA 1CJVA 3W64A 1OMSA 3M05A 3TVYA 3WU2E 3W63A 3CIZA 3KHGA 4ICLA 2DNOA 4P52A 2J5UA 3M1VA 1B99A 1LWFA 3GG0A 2RH0A 4J9RA 4A46A 1YVFA 2F5GA 1ZRTE 4GVBA 1MLAA 1VC5A 2E75C 4O23A 3S8SA 3ZTQA 8ATCB 3USSA 3GCXP 2HS0A 1NK9A 3FFIA 2BW2A 1KQGB 1WT6A 2D2CB 2BABA 1FCAA 4GC6A 3CDAA 5KLVK 3DXSX 5JUMA 2V2VA 1ULRA 3CJ2A 3IRXB 3G8TA 2KSJA 3SCIE 1S5LE 2M5AB 1MWQA 3KLIB 1F9HA 4PJ0E 2JWNA 3CCMP 3EVMA 3ZNUA 2WB1D 1CJKB 2LYVA 2GIFA 2DNQA 3POTB 5DGBA 1YTZI 3FBFA 1GL2D 1SL2A 2K3IA 2AGQA 3R7SB 4JPZB 1HR0J 1G7CB 4JI0F 1RT7B 1XIQA 3VYIA 2EFNA 3FNNA 3EXYA 1X0FA 2DH7A 2UUCJ 1NHVA 2GHPA 2N82B 2X3GA 2D74B 3PX4A 1NH8A 5KFJA 4ID8A 2YXLA 2N1TC 4NCAA 5JXSA 4OGQD 1X5PA 3AOCA 1CQNA 5APQA 5CMZA 4JI8F 3T6BA 4R5PA 3GPAA 4OI2A 1H7WA 2FVSA 3CD0A 4ZVTB 1UVMA 5DS7A 4RWXA 1FZCC 2C0WA 1RBLA 3C19A 4K4ZA 3S1KA 2ZD1A 3G6YA 1NUEA 2NSBA 3H98A 4IG3B 2IVFB 1SUQA 1K1QA 3R27A 4MKAA 1D8YA 3DGPA 1VDHA 2MZJA 2DO0A 2OEKA 4IFDK 4K4TA 4H4KA 2HBZB 3N4WA 5F0UA 3D1OA 4F7VA 2JVRA 5F8MA 1T05B 2JLEA 2IJFA 1TP7A 2M8HA 1U09A 4J9SA 3KJNB 4FP9A 3WBZA 5K5GB 3K0JA 1V3ZA 3AJDA 4ZNCA 4LGDE 4DU8A 1K47A 1EDKA 3U1CA 1Y7PA 3KJFB 4BDPA 4P9SA 3I55P 1FZAA 2FC9A 1NK5A 3W2VA 3TNVA 3H2VE 3OVAA 2DPJA 5CCMA 3NGUA 2VG5A 1KLMA 4ZCMA 3L71D 3ILIA 4R4MA 1AQTA 5IV4A 2HPUA 3BBBA 4CLYA 1NTZE 3EPGA 1BQXA 4Q8FA 1KC8T 3S6EA 2DEIA 4YY3F 3GF3A 1YI2S 2OMLA 3HUSA 1MMLA 2AF6A 1QSYA 1N32J 1RDRA 3A0BE 4AQYJ 1YHQS 4OGQB 3B8HA 3BATA 1IK7A 2HMIA 3CE8A 2WVEA 4NLDA 4IFVA 4NYOA 1E6YB 1RQUA 2R8JA 1FZEA 3P45B 3PP5A 2V63A 4IOIH 4JUZA 2VQEF 2KXPB 1R0CB 5E3QA 2FD2A 2B9WA 1U1RA 4PQUA 3AE1C 2Q6BA 3MAAA 2JDJA 1FI4A 5I3PA 4K35A 3A8KA 1GMJA 3AEDC 2HHQA 2RRBA 2X1AA 4J90A 3S01A 2WSFH 3IFMA 4TT3H 2AWZA 1JUNA 4MJKA 1BXNA 2BJ1A 2V7QJ 3MP7B 1TU0B 2UUWA 2ZBPA 3M6VA 3KDOA 1EXJA 5GMKa 1LTSC 5A8KB 1K05A 2DY9A 1SV5A 2ZH9A 4Q44A 3SV4A 2L41A 3H1HE 3AHPA 5IT0A 3RK3B 3ZXWA 4IRCA 5BYSA 4OX9J 1TTHB 3KZIE 2KKHA 5A6WA 1W5CE 3J81Y 2MKJA 2B4VA 4DL4A 3LGHA 3BSAA 2M88A 2HW3A 2VONA 1MG7A 4GODA 1L0LK 5KFGA 4YHHJ 5C25A 2N1TA 4UOHA 3CUNA 3T9NA 1HLWA 3CGIA 2X1GA 4F0MA 1SB6A 1X5OA 2CNNB 1A7GE 4NLTA 4HL9A 1IFIA 4RZRA 2WSEH 1SFCD 2ZUGA 2PO4A 1FZCA 2XGPA 4DV2J 1X4AA 3SCKE 4FS1A 1JY2N 1OIAA 4URSA 1SQPD 1ZXGA 4I2LC 1H2VZ 3DRPB 1LTTC 2JFKA 3L75G 2G2ZA 4IFYB 5HP1B 3HULA 1XN9A 4R8UB 2E5IA 4MK7A 1JX4A 4OYPA 4QR0A 3C6UB 3TA0A 1FF2A 5GVQA 2XHCA 4LIRA 4PD4E 1FA0A 1VK8A 3UVJA 3AEEC 6FDRA 1YITS 3NAIA 1T3OA 5LSRA 4LIWA 2ZH6A 1X0TA 1S1UB 1HQUB 3NY0A 2V9WA 4QW8A 5CD4A 5KFTA 4O3NA 1U1LA 4ANEA 2HODA 2VG7A 3M9MB 3LANA 4LSZB 1AUDA 3ZTOA 1YIJP 5AVWB 1HFEL 2DB1A 2Y9ZA 1KMIZ 1RP5A 3GE9A 1P9QC 3CCUP 2XZTB 4EI2A 3TGUD 2R3CA 2MQPA 1GXUA 2KB2A 4LF5J 3FX0A 1XWLA 1D9DA 4F4YA 3ILJA 3TI0A 2H4WB 2HSEB 1TV6A 4WY4C 2MHNA 1PG5B 1VQ6P 4J9VA 2PP6A 3CIMA 4CLWA 2RE1A 3PW5A 1VBZA 4I68A 2KI2A 5KFCA 4D3GA 3HT3A 3N7NA 1IKWB 1LK5A 4DOJA 3A0HE 4LSLA 2W8KA 3WZ0A 1NDPA 1NU1E 2YNHB 3VCDA 4YR3A 4FKYA 5LXYA 1VISA 4FYVB 4L3KA 4P7TA 2QL5B 2KH9A 1QLED 3BCCJ 2NXEA 2QJPC 5KJ7C 2FGOA 1I5OB 1I94J 4U6PA 2OPPA 2OPRB 2J9DE 3Q8VA 1FWKA 5DG9A 1EQ0A 5HLFB 3MOJB 2E9TA 4DF8A 2OYIC 1SVDA 3AE7C 2A06E 1DHMA 1NTZJ 2JWDA 2E74D 4IG0A 5LMUJ 2LXUA 4JI6F 2ZZNA 2P2UA 4X4NA 4D6TE 3IGVA 2ATLA 2VF3A 1IKVA 4KPCA 1R5SA 4C8YA 3HSJA 4UY8T 3CCMS 3ZFVA 2LDYA 3HE5B 3KHRA 4DV0J 5KG6A 1OS5A 2B89A 2ZT9C 4WYWA 4BBYA 1M90T 3UN3A 2DD8S 4LC1A 3VGTA 4P72A 1VRTA 2PEHA 3EVOA 2MPUA 4M5HA 2HFED 5IT4A 2UV8A 1ZR4A 4DR6F 1UWAA 2PGDA 3GHGA 1F2GA 2DR8A 4DR1J 5DQIA 1R8HA 4K0KF 1OFCX 2B7BB 3JAMU 4MFBA 3KLHA 1HTLC 3L70E 2DW3A 4CH0S 2V67A 1LWCA 5HL7Q 4DT0A 2BKOA 1N5QA 1A02F 3LP0B 1JQGA 4XPEA 2NPSA 1FK9A 2GGPA 3R7NB 2ZFHA 1URNA 2AX0A 3L9ZA 2PEBA 1J5EF 3TZXA 4LSNA 1Q4RA 1NK6A 3MTKA 5KG0A 2MKYA 1PGJA 2MQLA 3NGTA 3PYFA 1U2FA 4FXVA 3WC0A 1Y0HA 1WC5A 1R27B 3AQPA 5CCGD 2E74B 3TA2A 2OP5A 3NKYA 1M5SA 1LGHB 3PKYA 1K1SA 4MK9A 1QVGR 2PI4A 1NK8A 2JX2A 3OD2A 2W2PP 1QY7A 3HM9A 3JSVC 3LW5C 3PW7A 3N0VA 2CPYA 2W7OA 2JOQA 3Q0AA 2LQ9A 1H0TA 1XNRJ 3CCTA 4IH6A 3EZOA 1KB9I 4P74A 4NCBA 1IKYB 2FVPA 2YO3A 2ASDA 4NCGB 3GILA 2IRXA 2QEXP 1L4AC 3O6QA 2Y8WA 2BCCG 1S6PA 1WF2A 4OI3A 3RAQA 1RHRB 2VPXB 5H2FE 1G2CA 3T97A 4GKKF 2PGCA 2RKLA 1C0TA 3L72G 4DG1A 2CJKA 3TX8A 1GW4A 1JNMA 3HKWA 1KNZA 5AW1B 2WK4A 2FYZA 1CJTA 2OYIA 3TW0A 1IJFB 1UVJA 3DLEB 2RT3A 3KLFB 1FEHA 4OJ1A 2FC8A 4QIGA 3PZPA 3AD7C 5L9XA 4YOEA 2Z4PA 4S0MA 3TZYA 2O01H 1JLQA 2F8HA 4OI1A 2XWXA 2L48A 2EXUA 1RT3B 3RUBL 4PG4A 2JWAA 1I51B 3DYAB 2MY7A 1L0ND 2V8DA 1JNRB 3N4XA 3BGRA 3MEEA 1PGPA 1S49A 1TFYA 2M0BA 4DQIA 4G1PA 1D3WA 1H0HB 2BR0A 2ZZMA 4RUCA 1QE1B 3UNGC 5K8NA 2W9BB 1YDLA 1U45A 4O3OA 1FJKA 4OHVA 3W62A 2NXCA 3DDIA 2KU7A 1CEZA 3EWKA 2HBYB 4TY8A 2F40A 2C28A 3U7JA 3QYYA 3PM9A 2FFDB 3QLHA 2FXOA 1S1CX 3QSYB 2VBYA 2IVMA 2UXCJ 4QYZK 2IC3B 1NTKD 1FRMA 2AMCB 3L4FA 3CX5E 2YTCA 1S6QB 1FX2A 3BPDA 4OL8A 1N54B 3PRDA 4GOEA 2ZE2A 1Y47A 3RAXA 1HBMA 3V81B 4RW9B 1NM2A 5ETQA 3JQKA 3SFEC 1L3KA 3IO1A 1DX7A 4C3MA 3R5CA 2I0XA 3VMZA 2W9CA 3VAJA 3OXLA 3CXHD 3P49B 5LM7E 3A3NB 3GU0A 1ZH5A 3W8GA 1R8EA 3WUUA 4JBZA 2BQ3A 1CI6A 3LUYA 1VQLP 5IS2A 1HNVA 1DTQB 5ETMA 2VBXA 1U1KA 1YIJS 2WBMA 1K44A 2Q6QA 3PJ9A 2HIQA 2LXFA 4QJVA 3TA1A 1WORA 1OQ6A 3CCUS 2K1RB 1HGZA 1Q16B 5HO4A 5KLVE 1C1CB 1URQD 1L4AA 3L70J 2QE5A 2KZZA 1CW5A 1KILD 2UXBJ 1IQTA 5DQGA 1AVYA 3T1YJ 2RQ4A 3IR6B 1QDUB 3OUYA 3H5SA 1CC8A 3WHIA 3TJ8A 2G0JA 1N5SA 2CQ2A 1VQ6S 4YP3A 4X66F 4DR2J 2WPSA 2AYGA 3LP1B 2EVZA 4IL6X 4EU0A 5HMWA 4DCOB 2D3ZA 2IYIA 4JYBA 5DDQC 3I6PA 2E76C 5CCHD 4DL5A 3BBFA 4UOCA 4KKOA 2IRUA 2F3JA 4X4SA 3ITKA 4H13D 1DLOA 1PO6A 3OL6A 3L7OA 4IDKB 1XK8A 1DEBA 1CBKA 1JJ2R 1U1QA 1VF5B 4DX7A 1WG1A 1B64A 4V1Ak 4PG8A 4HB1A 3N6MA 1T0TV 1HQEA 3U02A 2J8SA 3ICLA 1S48A 1FOSF 4KSEB 5GTIE 4OX8A 4B3RJ 4WIIA 4N56A 3W1YC 2D3UA 2G1HA 1FRKA 1E6VB 1PILA 1RKIA 1UP1A 2PT0A 5KTQA 2WSFC 4O3SA 1UAWA 4NA3A 1FC2C 1LT9B 4CO4A 3QRPA 3B5NC 4H44C 2ACMA 4HKZH 4OJHA 3BR9A 2RVJA 4F0KA 4G1QB 1NPKA 3LGMA 4ILMA 2PA8D 1YQHA 5ADZA 4AL7A 2KN4A 4O4GA 3KK2A 2LA6A 4B3OA 2CUYA 1KILB 3PXGa 3UCUP 1NAFA 1XC9A 2YKNB 1I1GA 3PTWA 2HVEA 2LLZA 1VRUB 4DPTA 1N7SB 3W60A 5ETNA 1UEUA 3D71A 1KTVA 5KFYA 2ZDOA 4C0BA 3AE8C 2B43A 4NLGA 4XTTA 2IDEA 4KHRA 4ZIVA 1HBUA 1L3TA 1KRPA 1RT5B 1OPIA 2QJ3A 1F3VA 2WSEC 2D2CC 3H42A 4FXDA 2V4RA 2IDLA 1FNOA 5AVZB 1A6LA 2DXEA 4FYDA 1BQMB 3S9OA 1Y5LB 2LFVA 3NWRA 3BB5A 2V8GA 3OTBA 3E01B 3O5TB 1DEEG 1NDCA 4JI7J 3F41A 3EGZA 1T02A 1DQ9A 3QGHA 1FRIA 4OYZA 1T03A 4NRTA 2IVYA 2VQFF 2A45G 2YQ3A 2RH3A 2GVDB 1NKBA 3P4UB 5DQHA 4F36A 5GADI 1M5OC 2NQPA 3EPIA 5AE1A 1W2BO 2YNGA 3GLMA 4WP8A 2DCUB 2PMWA 2QA4S 2HHTA 2ILZA 2FVQA 2HWTA 3LAMA 1EQMA 3DRSB 2XEXA 2ZOGA 2EBGA 2DBBA 4ZHRB 5D4NA 3QT5A 3MR2A 1JB0C 3HHLD 2YNIA 2Z30B 2HVDA 2ZC4A 4ECRA 1S9GA 1KB9H 3ENWA 1HBWA 2RDIA 3A3OB 1P9YA 3PYDA 3BZQA 4I6YA 5JVHQ 1L0LE 2HNDA 5B0FA 1GD2E 2F8MA 1SH0A 2SPZA 1NKCA 2GVZA 4IL6E 5KFEA 4X62J 3PRJA 3L75D 2FJVA 4U67Q 2JVOA 1QAXA 4DXLA 3WMM0 4LT6A 3KHLA 4B3TF 3HFZB 3TUJC 1VDFA 4Q0BB 1EAYC 5KLVJ 2Z2LA 4LFBJ 3C8VA 4KBIA 3B5NA 2KXFA 3ZZUA 4X64J 1KQKA 1KFNA 1YJWP 4RNFA 2DNRA 2OSRA 2WWWA 4F02A 1U6FA 3JTNA 1SJQA 3MZIA 4Q2LA 3F89A 2XMVA 3OJAB 1NTZG 3NWGA 2W2NP 3X3UA 1EKRA 3BN4A 1PAEX 4W4MA 1X4DA 3OL7A 1HNZF 2DNZA 2HGLA 4OGQC 3MM9B 3QFHA 4F0HA 1NK7A 2BA9A 1K73T 1U2CA 1FDDA 1KC8Q 2CIMA 4NE9C 4I64A 3SFDC 2VDIA 3HHLB 5LMNJ 3GJTB 3THVA 1RTIA 3ZZ0A 4ELTA 5KT3A 3W67A 1NO8A 2W01A 2K88A 4N78E 1B0TA 5AVXB 4ZVHA 2E5GA 3SEOA 1OW6A 3TF5A 2YIUB 4LF6F 4LFCF 2PMHA 1JY3N 1U1PA 3WUTA 2M5AA 4TLRA 2K1AA 4G6VB 5GADU 3M4XA 1AA0A 3EGWB 1BE3E 5BU8B 1RQ0A 4OV1A 3AA9A 5FDLA 2DNLA 4C8KA 1CJKA 3G2XA 4Q7AA 1ZM4A 1TKDA 2MZQA 1N36J 1FJCA 2M70A 3AY0A 4JI5F 1R8CA 5IZHA 1R8BA 1K9MT 2AJ4A 1WHYA 2AEMA 3RK3C 5J2NB 1PSDA 2FXPA 4B02A 4UF4A 1IN0A 2OAUA 4OMFG 3SWYA 3MTJA 1V5IB 1N8RT 1VQKS 3KLGB 5FJ4A 3IP0A 1VQLS 3N01A 2P9GA 3JQJA 2BJ9A 2DNNA 3J7YU 1R5LA 1N5TA 1HWTC 2V4HA 1EARA 3GTYX 3QH9A 2Q9IA 3GIRA 1JLEA 1TL3B 1IWAA 1S7IA 3OAKA 1HBOB 1SJ4P 4LQ9A 4A8QA 4BC9A 2ZYAA 2XCPA 2YQ1A 3TDKA 3FZ2A 4U95A 2Y1LB 1NKNA 2E1RA 1N34J 5AW4B 2KXNB 3CWJA 2JSXA 2IBZE 3H8YA 4IG3A 4DV1J 4DPYA 2MKSA 1OW7A 1T05A 3R1HA 5L8RC 3T5LA 1RWWB 1P1LA 5C2GA 1FT8A 4PUOB 2XSFA 1VMBA 1NJZA 5D4LA 3RBDA 2Y0DA 1J5OB 1P27B 1ZTWA 2ZNZA 2LQ8A 1WF0A 2LA4A 2VG6B 3ZZZA 1PIEA 3W9JA 3ZZTA 4NZ7A 3CJ8A 4OZLA 1DH3A 1H88A 1VRQC 5JJBA 2MQMA 3JAMY 1HJ0A 2V4JB 1GL2A 1VQOP 3N6NA 2VODA 4E98A 1WF1A 4TXSA 5HJYA 4DFKA 1OSCA 1TU3F 4KGXB 5DG8A 3LTOA 1BQNA 2A3JA 2FYNB 4ED1A 1AZSB 2KSEA 4K5SA 4BRYB 2O01C 4OLOA 3Q8YA 3L7PA 2FZKB 2GQCA 4FNIA 1E6YA 1TL5A 4OZ1A 1YBKA 1HPZB 2DXFA 7FDRA 1UPMB 2MLZA 3T1AA 3OW2O 1DIPA 2XMMA 4LLHA 2DNGA 2W90A 2WW8A 3UFCX 4NI2A 1L0LJ 1MMDA 4ZITA 1ZOTA 1HF9A 1XR6A 2ERRA 1EX8A 1Y10A 4J9KA 3G9CA 2ZJPQ 3N5FA 2C2NA 2JJ4D 2FYUK 2YNYA 2A18A 3IS9B 4DL2A 3GV5B 3S7RA 1NU1G 4EZ9A 3VZHA 2KS1B 4WJBA 1ZA2B 4RWWA 2BCCD 1PP9E 3IWLA 1PL5A 2DGSA 1NAQA 4WK3A 5A8KA 2AJ0A 4X4TA 2AU0A 1FBMA 1XQIA 1VQSA 3I56P 4LJMA 4FPIA 4V19X 3L72D 1X4BA 3PHLA 1GXTA 5T41A 2XMJA 1JIHA 3MR6A 3CVKA 1BWVA 2CVEA 1GQEA 2F4FA 2A06G 3RTVA 1S0MA 3MDFA 1DTTB 1KV4A 5IWAJ 5U47A 1NJYA 4D6TG 2L9DA 1V6HA 4ZKPA 1JMBA 2HS3A 1AROP 2JRSA 2RU9A 4JI8J 4ICLB 3THPA 2UVRA 3M1VB 4EBDA 4C0OC 1F1BB 2C2KB 1KFSA 1Q79A 1U0SA 2XGQA 1K0TA 4HI2A 3UR0A 5C24B 1G1JA 5T7LA 3BV8A 2VA3A 3V5RA 3DKDA 3BQ2A 4R8UA 4DR3J 1GK6A 2FGCA 3HSZA 4ZVFA 2RAQA 3C6UA 1M90Q 3VOPA 1GXLA 2WBRA 1BE3J 2K3KA 4QWDA 3EDQB 2W25A 3LQVA 1F2HA 1S1UA 1WMKA 1HQUA 4O44B 3TUIC 3E3XA 5BYRA 3IWNC 2Q79A 4RU2A 4LR9A 1FXLA 3L70G 4PV1D 1SQVD 2QL9B 1JXLA 3C1LA 5KT2A 3GFYA 4L3NA 3VWSA 2RNEA 3NS7B 4RW8B 1K04A 4OWFA 1PC5A 1YRTA 2EEYA 2XG8A 1PYOB 1T11A 4NLYA 3MR7A 2CJ9A 4J5OA 4CIOA 4DEZA 1NXIA 2DHHA 2G13A 3MPWA 2E74C 3M6UA 4UTGA 1JJ4A 2DHGA 2XSJB 5B0EA 5EX3A 1U7JA 4Y99B 1ZAXA 4YQWA 2MSSA 5GAHI 3QO9A 2C2MB 4NXNJ 2XNQA 3C14B 4WP3A 4ER8A 5CYQB 1RZMA 4LRBA 1OQ3A 2OTJP 3JSRA 2RQMA 3D54A 1IKWA 2DRDA 1YJWS 4USJC 1RWUA 1QVFR 4ASWA 3DGPB 1U1NA 1VQ9S 4DR7J 4Y3CA 2YNHA 1UFKA 1RAGB 2GC8A 1VC0A 1RHUB 3UWTA 4O0NA 2MXYA 4OYXA 1IO4A 3RBEA 1OIPA 3R3TA 3G6VA 2ZVSA 1RWPB 2XHWA 5LJ5Y 4CLKA 4ZJLA 2OPRA 3M8PB 2N4DA 2YVSA 3J80U 1KQSR 3HD7D 4IRKA 5HLFA 3AE4C 4NA2A 4PV1B 2F65A 4KGKA 5AW6B 4HHUA 3NMAA 5C42B 4TN2A 1F5BA 1YZ7A 2ZDPA 4RLEA 2FDNA 4IFFA 4F2RA 2V94A 5D0EA 2C2ZB 3PG9A 1TUWA 3M6XA 2DHAA 3JC22 3V6DB 1S4EA 1M1HA 2OUGA 3I96A 3FRZA 5CCGC 2QFJA 2KYVA 3HE5A 4HKQA 1FTRA 3N5BA 2XZWA 1FJGF 4PXDA 2M0GB 3MAQA 2HQDA 4NLSA 1QD1A 2IIHA 2JLGA 4TVAB 1U1MA 3H1KE 3DRRA 3HCXA 3V2RA 3OT9A 3WX4A 4TLQA 3RGUA 1U49A 3VAFA 2KOGA 1Z2ZA 5B5EH 2GCFA 3BQ1A 2WPRA 4H4MB 3TAMA 2IY5B 4P10A 1RHZB 2JDIH 1SQQJ 2FFDC 5A8WB 1HBNB 3MAAB 3GW6A 2PSZA 1RU2A 1Q7LB 1OO0B 3ETOA 5D78A 3GF7A 3C16B 4Y28C 3DHWC 4DLGA 1NB7A 1PP9J 3LP0A 3CWBD 2N7YA 4LVNP 4YR2A 3EJMA 4EOTA 1H2TZ 1NNDA 4XDCA 2OKQA 2VPZB 1BMQB 5HAOA 2JKVA 3Q1MA 2ASJA 3HD7B 2HHSA 3LW5J 4CI0B 5GAHU 4QQBA 2Y8YA 5APYA 3EFFK 2H8PD 2VB6A 5IM0B 4CP5A 1NPPA 4AYBD 3UDLA 2C22A 2R4FA 5HBMA 2CG8A 3I9ZA 2Y9HA 2XI2A 3U1NA 3CO0P 4P7VA 5C25B 1XJWB 3R1LA 3D66A 3TVKA 3D6YA 5A6PA 1FE6A 2HZVA 1XR7A 1KTMA 1ZRTD 1SQXJ 1LK7A 1YBAA 4PEOA 1WC0A 3AODA 4A8MP 1VQOS 2HYIB 2GV1A 2C3PA 2YH0A 1IKYA 4RUBA 1HNXJ 4DL7A 4NCGA 4WKYA 1HNWJ 4WFAQ 3VHQA 3A2AA 1Y11A 4FVCA 2AXCA 2XMKA 3H20A 5KLVG 2FLPA 4OX6A 4K59A 2PAJA 3K57A 4JV0A 2YPYA 2AZ1A 4ZLPA 5MAOA 5MLCV 1S1TB 1PZQA 1RKJA 2POHA 3OVSA 1XMOF 1FDBA 5F9LA 2Z57B 4UZCA 4QR2A 2VG7B 3CJKB 1X5TA 2GO8A 3DLEA 3SCLE 4NOHA 3KLFA 2CQPA 1SQFA 2LQ5A 1H73A 4DDFA 3VTPC 1IBMF 4WF9Q 4PR6A 1QAYA 4I67A 4JI6J 2M7SA 1NSPA 5KFSA 2JC1A 1RT3A 1X4GA 1TL1A 5IQ6A 5CCGA 3CT9A 1VF5C 4Z7YA 4NEYA 4GKJF 3SFGA 3M6WA 2MZSA 4TQRA 3DYAA 3OHBA 2QLJB 1S0VA 2C3UA 1QGKB 4FYWB 5HMZA 5A8RB 1YBUA 3I56S 3HP6A 3H5YA 3T3FA 1QE1A 1SC4B 1PJ7A 3OR1A 1MKMA 4BC7A 3PH0A 1DRZA 3GG2A 4QZVB 1TK0A 4A8OA 3DOLA 4OLPA 1LT9C 4NRUA 2XM3A 4C7RA 1UEVA 4YS2A 4KTQA 3QAUA 2YX7A 2KHCA 5B0AA 2FFDA 3RK2B 1SL1A 1RT2B 2YXQB 4IYQA 2V9KA 3FSXA 3R2PA 5KFOA 2XZRA 4TQSA 2IC3A 1GTEA 3UQSA 4MIBA 3MAHA 1QTNB 5DDPC 4NLVA 1S6QA 1XMQF 2VBZA 4ZCLA 2NCKL 1X4EA 1N7SC 1D09B 4FXWA 2OPPB 4WU2A 2OPSB 4DUYF 2MJNA 4RW9A 1NTZD 1J5EJ 5APXA 2PN6A 4PPZA 1FU1A 3RBXA 4J9MA 3SBMA 2OSQA 2HS4A 3MM6B 1YTZT 5DG7A 2ADBA 2FHOB 3L09A 3P5BP 3JSYA 1MN9A 4XE5B 4HH1A 4J9PA 5ETVA 1SQBJ 3V4IB 2R8KA 1CULB 1B0PA 1HW9A 2LEAA 1IFMA 5M2PA 2QJKB 1DTQA 4V19J 3OVBA 2HFSA 2KM8B 3H1KJ 1VRTB 3L74J 2FQQB 2CQDA 2BW7A 2EG2A 2M2BA 5DZ6A 3SQGB 1T8ZA 4DQSA 4KHPJ 2FHJD 4NZ6A 2F9JA 2O1JA 3IA0A 3SWKA 4ZN1A 2EFGA 3GQCA 1TAUA 3K5MA 3CMAP 3FBEA 2AZ3A 1OWAA 2GAHC 1K0VA 4MT1A 3HZGA 4Z1MH 4O3PA 2LXCB 2BEZF 3TP2A 4GKKJ 2VJUA 3LP1A 4LF9F 1V9OA 3H1HD 2NPSB 4RX6A 3V2PA 4PWDB 3NCPA 4DU7A 3FGAD 3SXLA 1G3OA 5EWGA 1KN7A 1S4XA 1J2JB 4YR0A 2R2RA 4DV4F 3PW0A 4GDOA 2VOPA 5AW2B 4CLUA 2WZ1A 2OI2A 2RKIB 3CCRP 4IDKA 1Y4ZB 2CKWA 3BGFA 3T1HJ 2WSFJ 1WACA 3MECB 3A13A 4JI1F 1L0LG 3RK3E 2Z4EA 4CT9A 1WG5A 5CYMB 1CJUB 2J5AA 2LEBA 3W9HA 3QNWB 2WPVB 1S77D 4P71A 1O0PA 4O3QA 1WJ9A 4U3FE 3K5NA 1I3OB 1CS4B 1KYOI 3WUVA 8RUCA 1KD1Q 3HF5A 4NASA 2HG5D 3I0RA 4PD4D 1LT9A 1IFNA 1WRGA 5KFXA 4YB1P 4MMOA 1SIZA 1M56D 2MZ1A 3CCLS 4W7YA 2PC6A 5AW5B 1DURA 1QAJA 4QPXA 4WZQA 4KYZA 3IAS9 3OA7A 1KILA 4CH1A 4C48A 2IFMA 5A2QU 4C8LA 2YKNA 2WSEJ 4FS2A 2LECA 2Q3PA 1VRUA 4OYOA 4Y2MA 4B9NA 4OI4A 2MJZA 4ZK7M 3A8EA 1KOOA 5IC6B 3HLUA 2ZM6F 2ZZTA 2IM3A 2RUSA 3FXEA 2RDDA 4GMKA 4ZPCA 2U2FA 5C39A 1QL2A 2WPQA 3QMQA 4NLPA 1RT5A 3TUPA 2AYMA 2BM0A 1NDLA 2E9ZA 1OVUA 2DVIA 5BU5A 3OL8A 3FWLA 1YJ7A 5CCHA 3MGNA 4Q8EA 1S72S 4BHQA 4ECYA 1IWGA 4U7CA 4RW6B 3VGSA 1K73Q 2YIUC 1BQMA 1WC6A 4CLZA 4EFAC 4UB6H 1X4CA 2QRRA 1LXJA 2R2UA 5KG3A 2FJEB 3IBFB 2A0FB 3E01A 2XC9A 5L1JA 3BGRB 4ZPTR 3G86A 3MEEB 5THWA 1B7YB 2MY8A 1BSHA 2IYPA 2CFXA 2ZVOB 1BE3G 1U7MA 3QGIA 3S4RA 1NU1D 3DLLQ 4WTOB 1S5LH 1LWUA 2GVDA 3KQGA 2L08A 4K4XA 2FPHX 2F4VF 3GJQB 1Q7YQ 3FCWA 4C6AA 2FYUE 4F26A 1Z2LA 1JB0J 2MKVA 3PJXA 4WPAA 1X22A 3MUMP 3US5A 1ZN5A 3CD7A 8AT1B 1UZDA 2G0CA 3D4JA 3HRNA 1K9MQ 5APVA 3I0SA 3FZBA 3KFWX 3DRSA 4HH0A 1Y00A 2FUG9 3KPEA 4GO5X 4AQRD 1KDNA 3BKTA 4ZHRA 2B9YA 1EZZB 2A06D 3QZ7A 3L73E 3AQOA 1RE3C 2KXHA 1N8RQ 1Y5IB 4DR4F 3PYEA 4Q5VA 2N9YB 2IBOA 3PHEA 4D6TD 2J76E 2HHHF 4C11B 2EW9A 3HJVA 3I32A 2E5LJ 2IBZG 1FDIA 1J1EC 2QMUB 3A1YG 1NMEB 3D6MB 4JI3F 1JLBB 3B78A 4JV2A 1H98A 4IUFA 3DLHA 2I1JA 1NPRA 2GAGC 2W9AA 4NA1A 2ZKTA 1T3NA 2DHSA 2FBWC 1HD0A 3W7BA 1AT1B 1JLCA 3CD6P 2C3OA 2RDJA 3OFHA 3EX7B 3LIDA 4CLSA 2OYHB 4HTIA 1PJ6A 1XNQJ 3L70D 3EGNA 2W83C 3K8VA 3MCSA 1T9XA 4N5SA 2ZOFA 3PX0A 3CNQP 4K8RA 1NHLA 1U6BA 1VJWA 2P8IA 2WCXA 1RGVA 3MEKA 3UIAA 1RF1A 1RISA 1FWPA 4AD6A 4XIUA 4M8LA 4KGZB 1U48A 3HZEA 3N9UC 1JJHA 1X4HA 4U96A 1YJ9P 2Z2ZA 2Z2YB 2NREA 1C1BB 3HHLA 4X65J 2D1CA 1PGOA 1DY3A 1NLKL 4KKOB 2NXUA 3GIIA 2YKQA 5KFPA 2E29A 1AW0A 4A48A 3NAHA 4HEA9 2E1AA 4DV7J 4QMAA 4KIAA 3A12A 3CO9A 1WTFA 3G82B 1RE4C 4QCLA 2SXLA 5F8LA 5KFAA 4ZP7A 2DISA 1WOOA 2WRMA 3DRXA 3CTRA 5AVYB 2ABYA 1R3NA 1WDDA 4ECTA 4U3FJ 4ED4A 1VI7A 1IR0A 4I0WA 1UJ5A 2C0XA 4RNOA 1SC3B 2UVUA 2C2OB 4OH8B 2DEJA 3P32A 5J2NA 4USUA 3CDBA 1PP9G 3MMAB 4M5JA 3AJ2A 3BREA 3RL0D 2GHVC 3KLGA 3GIMA 1O6XA 3BEGB 3UN5A 4QPTA 4HT7A 2XLJA 2ITAA 2VFRA 4KH1B 3DLKB 1W2EA 2CPFA 2B9XA 1CLFA 3VAGA 2XZDB 1F9EB 1Q2NA 1TL3A 3KK3B 3RR8A 3J80Y 2ZH3A 3QSIA 1HBOA 1UZHA 1S4FA 2FTRA 5AE2A 2R2TA 3Q2SC 5L8RJ 3D6FB 1Y9BA 2Z0GA 3BRVB 1LW2A 1M8OB 5DM7Q 2EFVA 2CDQA 2DNMA 4DN0A 4ZJQA 2P9EA 4UB8H 2KVIA 1TVRB 1S6OA 4BWJA 2H88C 3G4SP 2I1KA 3QWOC 5EDWA 1CG2A 4U7UK 4R4LA 2HEKA 2WONB 1P84I 4I2QB 1SKWA 4A8YA 3ABVC 4URGA 1FRJA 4J91A 4X2BA 3BPSP 2W7PA 4M5MA 3MCNA 2VG6A 2JEGA 2GJIA 1SJRA 3BKFA 1NGMB 4LBIA 3VP9A 3RRKA 1VQ7P 4OX7A 3CCRS 1QSSA 4B86A 2WAQD 1IZNB 2V4JA 3EUNA 5D3GB 1JY2O 2O01J 4C3KA 4R25A 2GMJA 3CDUA 2FLLA 5F41A 1SH2A 3M8RA 3RL0B 3CX5D 1S59A 1TKTB 3BYRA 5C5JA 1M1JB 2UXDJ 1GZLA 1AZSA 1RHQB 4Y99C 3BGUA 2KZIA 4YXWH 2EFPA 1DAXA 3JB9k 4BRYA 3CCZA 3L73J 2R9LA 2IPOB 1VQNS 4HI1A 1HNZJ 4QWAA 4CH7A 2GJ2A 2XKMA 1MFZA 2KK7A 2FIUA 3BN7A 4JB8B 3GMGA 3PJWA 1S6UA 3GJSB 1KYOH 3RB6A 1FEEA 5ETPA 3PIPQ 3DLBA 1U0HB 3KLEB 5D8HB 2Q3EA 3M9HA 2F1FA 3UDVA 5F8HA 2ZBQA 3LW5H 2IDBA 4RBVA 3GYXB 3D70A 3LOUA 5AW3B 3ZO7A 1NTMK 2ZNYA 2CJAA 3HTKB 4W98A 5FLXU 5F8JA 3AE3C 3OLAA 1N0VC 4OX9F 3G87A 5AJ3J 1FX4A 5JVGQ 4LFCJ 2QSWA 2CNOB 2XYPB 1RWKB 1RYSA 3UR3C 2VD3A 2ZH8A 2RRAA 4YHHF 4QU7A 5DJBA 3M8ZA 2U1AA 2HAFA 1JXEA 4RUHA 2HLTA 2OFGX 1NJIT 1C0UB 4JI5J 3MUDA 5KLVD 4Q43A 5HI7A 3AE6C 4YB7A 3K5BA 2MQOA 1Q81Q 2ILYA 2ZITA 4RKUC 4WCEQ 1KB9E 1S0OA 4KT0C 4DV2F 1HA1A 1OY9A 2H1YA 3RW7A 4O9BA 5DDOC 2E75D 4EBCA 1SC6A 1FZBA 3RZAA 4DV5F 3Q8UA 2LU1A 1DTTA 2CG4A 1TKZB 4M5GA 4WFYA 1RYRA 2BV3A 2NYHA 2XB2D 3IG1B 1HHSA 3BSOA 4H54A 3DFEA 2GS8A 4ILRA 4USMA 1HNIB 4MTPA 1DBDA 2VBWA 4RUAA 4M3LA 3UW1A 2UVWA 1NKZB 1KFMA 1UIIA 4BXLA 2E5TA 4K2XA 1FRXA 4J37A 5C24A 5DGAA 1YJRA 1KEKA 2DR9A 4AL6A 4UQGA 2J9CA 2YWWA 3C9IA 1ZAWA 1RTIB 3QT6A 2EFOA 4MKVA 1HWJA 2R7UA 3H1KG 3PTZA 2JC0A 4OHYA 3B4SA 2QC3A 4IKAA 2Q3IA 4EYIB 2N3LA 1ICEB 5KT4A 2W8ZA 2K8GA 1FKOB 4O44A 2ZAEB 1LTAC 5FDLB 4LF5F 3BS9A 1JY2P 1LW0B 3H0PA 4RW8A 3K59A 2DGQA 2IBKA 4YMEA 4JYCA 4N8NA 3HD7C 4C8NA 3PNIA 2V2QA 4OZNA 4MIAA 2LQBA 4I6AA 3FUYA 1NSKL 2Z8QA 3CD5A 3Q8RB 4I6MC 3IFEA 2H5IB 4DLEA 1VBYA 2MLYA 1VQMP 2XSJA 3IMQJ 1NRKA 3AB2B 1G6BA 1JLEB 3CD6S 2AD9A 1YRUA 3C14A 4JV5J 3SYZA 1KZUB 3CCQP 1WI8A 2Y0SD 5CYQA 4B9SA 4UOGA 3P5TL 3BO3A 2ZBCA 2R32A 2BDPA 4KO0B 3D28A 4F4AA 3R5AA 1I94F 1IBKJ 1TFWA 3GCWP 4USIA 4CM2A 3FEXB 4LR7A 2PI5A 2F7VA 3AD8C 5D0GA 4K50A 3H40A 2KO1A 4ZKAA 4ZPDA 2AEJA 2Q1KA 4YB6A 4QWBA 4Q2MA 2CPDA 3W66A 4OI6A 3IF4A 1FTCA 2JEEA 2I9SA 2ALZA 1LFPA 3SWFA 3HVTB 2B51A 1VIXA 2CWKA 2XQCA 2KZMA 2MKKA 1UPPA 5LMUF 2CJXB 3BCCE 3AOAA 5KFBA 2VOOA 2R7TA 3M8YA 2AQ4A 3QWUA 2V0NA 5T14A 3HHEA 3W5XA 4YN3B 1YJ9S 1FDMA 2AGOA 2DGOA 3M8PA 3Q23A 3KXDA 3UCGA 1XBWA 3BGOP 2HZAA 2R3VA 2IJNA 2ZKUA 4ED2A 2ADCA 1JNZB 3VALA 2E1PA 5C42A 4URQU 3L3CA 1GL2B 3WX8A 2AP6A 4ALZA 4C8ZA 1FNMA 2BRLA 2L9WA 3SSSA 2ROGA 3PKMA 3OHAA 2V2KA 3V6DA 4ZLJA 3M06A 1TUGB 3KUHA 2CQHA 3N6LA 1BQNB 1D8ZA 3EVWA 3HHKA 3H32B 3DM2A 2KRBA 3ZZPA 4DR1F 4ANCA 3SV3A 1F0XA 4MH8A 4WP9A 5HANA 3C66A 4ECUA 2HVHA 3A5TA 3HPOA 4WZMA 1QLNA 3N28A 1UA1A 2RHQB 1U4BA 4G65A 1TUVA 3TJAA 2GM4A 4Y28J 2XMWA 1L0LD 3KYLA 4HDHA 4IQMA 4NI2B 2QLBB 2YNFB 3BF4A 3BKUA 2RIJA 3BASA 2G2YA 2VL1A 4EEYA 2PFFB 4H4MA 2XNXA 4WE1B 4IRDA 3RK2C 5A8WA 1HBNA 2CADA 2I38A 1FD2A 1XERA 3C16A 4I1TA 1LTJB 3HXMA 2HHXA 3NMRA 4WWSA 2CQ1A 4C3LA 2LKZA 3UI3A 1ROFA 2PFDA 2XLIA 3GSIA 1UL3A 4LUBA 4F8RA 1RF0A 3K89A 4YTPC 3HD7A 3W2WA 1HL6A 3Q89A 4NLOA 5J1PA 4YFUA 5IM0A 1YQ4C 3CEDA 1DZ5A 1SQEA 1ZPWX 1L0NJ 1WDTA 1XNRF 2H5EA 3ZNJ1 3FWNA 2JEIA 5AXNA 2PFXA 3BR8A 3NGRA 1P84H 2QJKC 4A8WA 3IGNA 4USTA 3TSIA 4L76A 1GU4A 3B54A 4MYUA 2KM8C 1GMUA 1JXVA 2AJ2A 2KP8A 4F67A 3D2WA 4GOFA 1JO5A 3VGUA 4N78D 4EK2A 5T7LB 3DXBA 3ISND 2XI3A 3GHGC 2M9KA 2YY3A 1GNKA 1Q8BA 3LAKA 3RU0A 3MUVP 1BD6A 2N4CA 5L9NA 2IBZI 1BE3D 2HR3A 3LIEA 2M4MA 3O3LA 4DL0C 1LQ9A 4JYAF 5BR8J 3R7BB 1TK5A 2CZ4A 1HI1A 1Q8KA 3M9NB 1M0SA 2DNKA 2GIQA 4CO0A 1S1TA 4X4RA 1EJ7L 4ZP8A 3NNHA 3MD1A 1PV3A 3V4QA 2NPSC 3GV7B 3TEGA 3CJKA 5AVSB 4WY4D 2BBEA 1TELA 1KSPA 3KOAA 3CC7P 1QJHA 2X7IA 2NLWA 3JTPA 2KTQA 1EHWA 3EGVA 3V5BA 4ED0A 2VH7A 2KJWA 3U1MA 2FJDB 4MKBA 4DL6A 3ZTPA 2O5DA 3GSDA 2W7AA 4ZOSA 2KG1A 2Q7CA 2OLWA 3QO9B 2IBZD 4L72B 5KJ7D 3OFEA 5D15A 2BKNA 5A8RA 2QGFB 2UXCF 4R0EA 4M5DB 1SFCB 3P8MC 3DRYA 3TWZA 2MGZB 3G96A 1H89A 3CF5Q 3SIPB 2J0WA 4U3FG 1WHVA 4KH0B 1M5HA 3PW2A 2ZBRA 5GTIH 1A0OB 1ELOA 2IMWP 1RT2A 1YJNP 2VFSA 3NP5A 1HW8A 2HBQB 5SUHA 3C3LA 5DM6Q 3KKFA 2HG4A 2RS8A 5APUA 2YWFA 3EMTA 2PMZD 3T5KA 1RWMB 1YG0A 2OPSA 1RACB 4AUWA 3AEFC 4ZP9A 5CABA 2ZT9D 1T9VA 4ZPAA 1EZVE 1IJEB 5AW7B 4CDIA 3W65A 2H65B 2B9EA 4B9MA 3MM6A 2E7VA 4USHA 2HRYA 2OPQA 4NL5A 2W6BA 5KFDA 3IM8A 1SC1B 1S10A 3V4IA 2WVFA 1MSWD 1CULA 1URRA 1WWHA 4ES2A 1VR6A 2DIVA 3ET6B 3CMEP 2BJ7A 1XTCC 3UNYA 1PC4A 2UXBF 1EC5A 3NS5A 3D67A 1SKUB 2Z2MA 3U1AA 3IR7B 1CSJA 1P1TA 4AXJA 4ZMDA 3GJRB 2KT3A 1ZR2A 2OEMA 5L1KA 3DRRB 3SQGA 3V6KA 5LSOA 3QT7A 1U02A 1M5KC 1K8AT 1L3VA 1F9FA 4J7CA 3DGVA 3F5HA 2H54B 4JBCA 1H3DA 3TAMB 1LTBC 3ENVA 1N2DC 4WWIA 3DU6A 3HSDA 1KVKA 5CQGA 5L38A 2JH3A 5E7OB 2FYUG 5AVTB 3PYGA 3CCQS 1PP9D 1FRHA 3UD5A 2XBPA 5KFVA 5KFNA 4FF3A 4ZPBA 1KVIA 3KNGA 1JTHB 4PWDA 4DUTA 1AV1A 2CPJA 1IXKA 1DFDA 4JOUA 2QSFA 4LRDA 2EC2A 5AXLA 4LRAA 3L73G 2ZT9B 1RJJA 2RKIA 2QM7A 3B8EB 2LVWA 3IBWA 4B3RF 3HI9A 3AJ1A 3MF5A 5HBMB 4XDDA 1RTHB 2VC1A 5B08A 3LP2B 3EM1A 2DT9A 3MECA 3FCHA 1SKRA 1HKAA 3R97A 5J1EB 2XS7A 2ZJRQ 2HBRB 5CYMA 1CJUA 4ATNA 3I55S 3CW2C 1SQQK 2AYBA 2E7XA 2B8PA 4NYZA 2AJFE 3QBCA 3I4HX 4LMZA 1CS4A 1YTYA 1VHIA 2JLFA 3G6EP 2OYHC 4DV6F 3TARA 1DQAA 4NX9A 3B4MA 1IKXA 5KKZB 1VL2A 2JO1A 1VHFA 4KRWA 3MR3A 3TAPA 2WVBA 3JS9A 4ZLLA 3RGIA 2ZH2A 2ZJSE 1FE4A 3NG8A 2I6WA 2WITA 2BRKA 4M5LA 1LJ2A 1BCCE 1YX2A 3QJPA 3M2RB 2X3DA 2W2MP 1TKXB 2Y1RI 5GTHH 3Q2YA 3VR1A 1RAHB 3KMQA 5D77A 2CZ9A 1HH0A 3GWCA 3KYQA 1LEOA 3WQPA 1QSLA 4ITSA 3M2VB 2OH2A 2VZ9A 4DUYJ 1FFGB 5CBOA 1SQXK 3KWMA 3Q8QB 5E0OA 1TR0A 3A8JA 3F73A 2UU9J 2VA2A 4JI7F 2UUBJ 5HQ8A 3DLGB 4M1KA 3QWPA 4RW6A 1IBLJ 4PXCA 1QVGO 1TL1B 5EWFA 2JR8A 3NFQA 2BVZA 5GAGI 4P6QA 4DPXA 3T19A 4TU8A 2OIHA 3D0HE 2ZH1A 2NR0A 4ETXA 2WTYA 2MMYA 4EWTA 5AVQB 2KNCB 4X4VA 3MMJA 1WEYA 1JCDA 2IJRA 3CXHI 5KFWA 2FLNA 2W24A 1N33J 3PR5B 5B66E 3OR1B 4RPFA 2E5YA 4I4BA 5KFFA 2DGUA 4B17A 1NTME 5CJ4A 3DOLB 5FLXY 5KAFH 1VQ8P 4FN5A 1NK0A 4TYBA 4DUZJ 1U8SA 4IR1A 3K7RA 3H1LE 2CXEA 2VASA 4Z7CA 4L75A 4KHMA 4CPGA 1IBCB 4UUWA 1F5AA 3CDWA 2DK2A 1H38A 2KG0A 3NL0A 2QVAA 4LF4F 2HLUA 2P2CB 1JY3O 2OHDA 4XFJA 1S79A 4ZP6A 2YKAA 4JF7A 2YMKA 1TL7B 1JEKA 3E8OA 2DH9A 2FVRA 4P2XA 4NXMJ 1NK4A 2IAJB 4DPOA 4C11A 1ZW0A 2XO7A 1BC6A 3BO2A 3WC2A 4DV4J 5M2UA 1VCTA 1EXIA 4QU6A 1BE4A 3B82A 2EWHA 1WKKA 1EP4B 1JLBA 1FJ7A 1YHQP 4LFAF 2KFYA 2GQ2A 1ZA1B 2NXNA 3RAMA 1RWVB 4X64F 2ZHOA 1A9NB 2KLVA 1JKHB 3KG0A 5E41A 3E51A 2ZBIA 4KY3A 4JI2F 4J9QA 1GEHA 3H1KD 1AVOA 2BJ8A 3CC7S 4KB7A 4M5KA 4B08A 3OQ2A 3CJ0A 2OYHA 1RU1A 1BGXT 1RY3A 4GT1A 2Q66A 5K9FA 2V6AA 2RMLA 2HQCA 1UWBB 2BANA 1T2KC 2HNYA 4FBUA 3BDEA 2ZWOA 3IN5A 3KHUA 1XMBA 1S5LX 4UQTA 3RL0C 1N52B 4ZKUA 3RB3A 4CLTA 3AE2C 4ENOA 2J59M 1SQBK 4OVNF 2J9DA 2YBVA 4Y0FA 5CHCB 1XEZA 3F44A 1YKWA 4Y6IA 1DQ8A 5GAGU 1C1BA 1UMJA 2QYCA 1TL4A 1UJ4A 1YJNS 3JYTA 4RNMA 1PIXA 4I7FB 4KJMA 4QIFA 3JTOA 3I4PA 3G82A 4K4WA 1REGX 1Q53A 2RF2A 4H44D 1RA7A 3V2NA 4FF1A 3KUEA 3I9V9 2Y0BB 3TANA 2HRUA 1RTJB 3ADAC 2HQIA 5LXRA 3BO4A 2C9NY 2E5JA 4AFFA 3H90A 2FB0A 3T9ZA 1VQYA 1IM6A 5FIIA 2AT1B 3J7ZT 3CC2P 4TLFA 3MMAA 1YITP 3I0RB 1BSNA 3GONA 1T95A 3HT0A 1N34F 2CWXA 4C8OA 1BCCJ 3UE2A 1RHJB 3DLKA 1URQB 4DV1F 1JY3P 4YDXA 3PDNA 2D2CD 1NJIQ 3KK3A 2IA6A 1RT6A 4DOZA 3MUTP 1N5YB 4KR0B 2HFOA 3HE4B 4NPFX 2KFZA 3M0DC 2A10A 3VAKA 2QG4A 5F9NA 3M8QA 1ZZNA 1G1XA 4AT1B 5D0HA 1RI7A 2F9DA 3NCRA 2HFZA 4DR4J 1WSRA 2G0IA 1YGYA 4PG6A 4JI4F 5KFQA 1TVRA 2I8DA 1RHKB 2RUGA 1RBAA 1NH7A 3Q5SA 3RBZA 4KC5A 1AUSL 4RW7A 4H13B 3L37A 3GR1A 2I8EA 2WONA 4K4VA 2Y3YA 4I2QA 4GO7X 5C7PA 1GMWA 2BE9B 4IOBA 2C42A 1N4LA 2VJVA 1UVKA 2R7QA 1GTWA 4ECWA 4UW2A 2XYHB 3B6BA 2MZRA 1NTMJ 1Q90D 2IM2A 3K17A 1LWUB 5D3GA 5L1IA 4M5IA 3H2LA 1Y8AA 3H1LJ 1RWXB 1U6ZA 2I1RA 2IRYA 1TKTA 5LL6d 4DFPA 3KK1B 3QJJA 1M1JA 1VJQA 1Q82T 4UB6E 3I0SB 4WYLA 5KTBA 3HVWA 2CZVC 4EZ6A 4Y2CA 4WB4A 3U59A 1IJDB 3G6ES 2QE7H 3P8CE 1NBEB 1BGYE 2BOPA 4U8YA 3J7YI 1VLYA 3AA8A 2LKMA 2H9ZA 1U0HA 2V5HG 3KLEA 2QEXS 5G4DA 4C97A 3NGDA 3RW6A 2BEFA 4DV3J 2GIRA 5DO2A 2VFUA 4FYXB 2Y9YA 1SQVJ 5CBNA 4USWA 4I56A 1RWNB 3HTKA 2LMIA 3PRVA 5KG5A 2DY1A 3R6LB 4RKUJ 4QWCA 3D1QA 5G0RB 5B0GA 1RADB 2IMOA 3J7AN 4DX8H 4KT0J 1HWIA 2NZCA 4WVZA 2XS2A 4DN9A 3ZZRA 2WSSH 4IFMA 3F56A 5E3AA 2P7JA 1RAFB 4LRFA 3DCAA 1JLCB 2P67A 5IWAF 3EE3A 2EC0A 1H6KX 3BCCG 1C0UA 5E79H 3QZ8A 1C4CA 4IR9A 2Y0CA 2ACYA 3VZIA 1RT1B 1VOMA 1IR2A 1GL2C 2JL9A 2E7WA 3OFGA 6FD1A 4ZVRB 4ECVA 4AXIA 2ROEA 3N79A 1TKZA 2NUUG 2BJEA 2W27A 1RABB 1S9KE 1ZBTA 1B7FA 1KTQA 1SL0A 3IG1A 1RF1B 3I82A 2JEFA 4DR3F 3BDPA 3I5CA 4H4OB 1HNIA 3P96A 2B9BA 3B71A 3M0DA 2QYGA 2QFIA 4Z37A 4HTJA 4WFNQ 3BRTB 3CXHH 5GAEU 1VQ8S 3LWLA 3KMSA 4TYAA 3DI6B 3H1JE 3VF0B 1HWUA 4XPCA 3EYZA 2HIYA 3RK3D 3K5LA 1AFOA 4C7NB 4FF2A 4ZCIA 3KG4A 4EUVA 3MZWB 4ED8A 4F50A 1LTJC 2QT7A 2IM0A 4XAKA 1FKOA 2W4CA 4U3FD 1MU2B 2YPZA 4IQXA 2FJAB 2Y1JA 2FYXA 3GFHA 2CPZA 2IM1A 1LW0A 4PYDA 4HYTB 1JLGA 1KP6A 3U1LA 3C2PA 1BY9A 3MFIA 3V2UC 4NXNF 3DHXA 2P6SA 1EDJA 2KFNA 2CQIA 1NZ8A 2MZTA 4DS4A 1E5WA 2KLUA 2D69A 2XY7A 4ZJOA 5KFZA 1ZM9A 4BCAA 4B9UA 3H6PA 2B5JB 3OV7A 1IQZA 2FHKA 1M5VC 4DR7F 4JP8A 2CVIA 3BYPA 4ZA1A 4ECSA 4I1LA 3P7KA 5AW8B 2GJFA 3MMCB 2AJQA 1EKSA 1LOUA 3AECC 4KO0A 3CCEP 1LW2B 2MKHA 2ZXEB 4P2FA 4DR5J 2CPIA 1FKAF 2YKMA 2N3OA 3VMYA 3VAHA 3HDSA 4DF4A 3CWBJ 1AYEA 4PWUA 3HVTA 3P6YC 2C2RA 2IYOA 2CDRB 1FO1A 4F4KA 3G3ZA 1IFJA 4JV1A 2C9LY 4PXBA 3OXGA 3AEBC 2KHDA 3K5PA 2JNJA 4LREA 1FAVA 3ZTSA 3CJ3A 2E66A 2IYGA 5KFKA 5B7WA 3HSGA 5D4PA 5L1LA 2FYUD 3BH7B 2Q1LA 4EYHB 2N9BA 1FWLA 1MWZA 2IA0A 2A2CA 4UB8E 2Q5UA 2BE2B 3OTOF 3IXQA 4NLQA 1RLDA 3D7SB 5M1BA 3ZZOA 2DGTA 4DV5J 3UDCA 4A8KA 2HNZB 1TMMA 3MEGB 3H32A 3TNUA 3L73D 4CO2A 2COLA 5J2PB 3H1IE 3IC1A 2LP4A 3D6HB 2WHOA 4B9LA 3EZUA 5KAIH 1FFWB 1BGYJ 2I2YA 1FVSA 3CC2S 4DSKA 1SFCC 1T6AA 4GVLA 5H9FK 4O0IA 2HK3A 1HHQA 1S2EA 1KKHA 2WB4A 2YNFA 1RUSA 1U2RA 3AB4B 3SSQA 4WE1A 2ZUAA 1N7LA 3ISNC 1LTGC 2AV5A 3TZWA 2ZH4A 4FNHA 3M8WA 2K9JB 5EHHA 4W92B 5IXUA 1X31C 1SQQE 1LTJA 1UFWA 5EWEA 1RT4A 2VPYB 5E3CA 1NO4A 2M5YA 1RB0A 1T9YA 3A3PB 4CLLA 2VU5A 1S9EA 1MMNA 1FDNA 4OFZA 1SQPK 4WFBQ 1LFWA 2UUAF 1W26A 2OARA 3AT1B 1LWXA 1KYOE 3ULHA 3QIPB 2NXJA 1RAIB 3L7UA 4JI0J 3M9BA 4WKRA 4ECXA 3P8BB 3DNCA 3PO4A 1EZVG 4P2MA 3FJ2A 2M52A 2R42A 1D9FA 4CZCA 1ACMB 3I5BA 1HNXF 4HACA 2X51A 1VQPP 2K7JA 2HLOA 1HNWF 1ZAVA 2HGNA 3D0GE 2G2OA 4LF8F 3K2YA 4F4ZA 4YDDB 2RS2A 3NTNA 1HYSA 2YKPA 1YLXA 1SQXE 4IH5A 2GW8A 4NMXA 1RAAB 3H1JJ 1B0VA 3R8YA 1CVJA 2W4DA 1RBOB 1KHVA 3CMQA 2Y0EA 1IFDA 1FRLA 1HD1A 2FXMA 4GKGA 1NH4A 5B09A 1JM0A 1Q86T 2L5GB 1AB8A 4D3HA 1RAJA 1S7HA 1Q8IA 1SJ1A 2JEJA 2XMAA 5KFRA 3MMBB 1WI6A 1KVJA 1HWKA 2OQQA 1JLAB 4I2PB 1K8AQ 4RESB 3MPDA 1GT8A 1QUVA 1KR4A 4NEZA 3C15A 1HI0P 1S1VB 1SPBP 2H4YB 4DI6A 3MEDA 1KQFB 2DGXA 3V4MA 1PPJE 3DMJB 2VKRA 5HMXA 1LWEB 3TYYA 2GUVA 4O3RA 2R2SA 2YXRB 5KFIA 3FEYB 2CQ3A 3VGVA 2QLWA 2DH8A 2WZ7A 2KYZA 4YY3J 4RW4B 3VVTA 3R2DJ 4L74A 4Y2KA 3BGLA 2ZFCA 2EK1A 4QOTA 4ZCKA 1ZS6A 5TISH 3MHYA 3UPFA 5HROB 1PKUA 1MNEA 2AGPA 4M5DA 1F3FA 3SFUA 1SFCA 4ERDA 3FQLA 2MGZA 3MPYA 4ZVGA 1KS2A 4OIXA 3NEKA 5KKZC 2OFHX 2VQEJ 2MQQA 2WSCC 2RMZA 2D9OA 2IZ0A 5IQQA 3II6A 2XULA 3D6ZA 3LPEA 3H1HJ 1ZZFA 4NLWA 4C98A 1NSAA 4OI0A 2D3O1 2EG1A 3D3BJ 4WFXA 1MROB 2DIUA 4W90B 3VMXA 1HMVA 2DPIA 3GG1A 3NNCA 1BCCG 2ZEJA 3EXCX 2IFNA 1OYEA 2CQ4A 4C46A 3NNAA 2DR6A 4P73A 5IOLA 1ZTTA 4F25A 2QA4P 1D7MA 3OPKA 4WY4A 3GYNA 2VICA 2HPCA 1FD8A 2H48B 3AEAC 4PYAA 4EGLA 3A3YB 2X1BA 1RAEB 2CYYA 4PG5A 4Y34A 3FMWA 2AX1A 4KHPF 3H1IJ 3ET6A 1SQBE 2HHUA 2AW0A 3DM2B 1RTDA 4HHJA 2ZYDA 3JSMB 4A8SA 5SZTA 1SLQA 2BYCA 2CQCA 4DPUA 4TU7A 1X0PA 3KTQA 1PYTA 2MYFA 3JCUH 2GZOA 5KJ7A 3NMDA 1U24A 1VS3A 3L74E 1QVFO 1ZP0C 4FBTA 3X1LB 4EO8A 3LF0A 3FXDA 5J2MB 5D6GA 3NOCA 3BM7A 4U7JA 2Z5HA 1Q0NA 1NTMG 4KPYA 2B6AB 1CSBA 4C7QA 4JYAJ 1S0NA 4J9LA 2RRNA 3PY8A 3G8SA 2MKIA 2V4QA 1OMIA 3H1LG 3GB0A 3CCES 1KQSO 1JTHA 2EKNA 1JLFB 9RUBA 4K2JA 1KB9D 3T1HF 4ID5B 3V6HA 3GZ7A 3VP8A 3W2WB 1AXQA 3OR2B 2AEFA 2A45I 5I42B 1VPCA 3H5XA 1R89A 5EFWB 1RTHA 1ZPVA 4EO6A 3LP2A 4FKXA 4DHVA 5J1EA 3FSIA 3VN0A 4WXWA 4DZOA 2EK6A 1NU1J 3CJRA 2C3MA 1SQVG 3HVRA 4QYRA 4N8OA 2BZ2A 4RU9A 2BQUA 4WU3A 2J6SA 1N73B 2AXTH 3OTCA 3R5JB 2E1MC 4IOAQ 1Y3KA 4CQ1A 3LWMA 2J0XA 1M5PC 4CYUA 1R6YA 2B56A 1GFWB 3FBBA 3M2RA 4D6TJ 4EDFA 1L0NK 1TKXA 1P84E 1H74A 3GP9A 4U8VA 2FY1A 4PXEA 1L3UA 3PLNA 3MM7B 3RR7A 3TQ1A 1EETB 4DSLA 2E5HA 2VFTA 3H25A 1VF5D 2R5DA 1NZAA 1U26A 5I3UB 3F0NA 2B87B 3CJ4A 3M2VA 1VQKP 2HFUA 3CJTA 2XWYA 2MEWA 2M3DA 1SCJB 2CK3H 3FKBA 1CZQA 3W5YA 5CAAA 3DLGA 4OHXA 1REVA 4C0HA 5DJTB 1FKPA 2AKWB 1NTKK 2J7UA 5B0CA 4L6V3 2LEPA 2B0GA 7FD1A 1U47A 2G1DA 2KNCA 1UFLA 3W3SA 2ZYGA 4OYAA 1U7LA 2NZ4A 4Y2AA 3CSKA 4KV8A 4RO0A 1NVOA 2MTLA 4CM0A 1V3RA 1N7SD 3CCSP 1VGYA 2DNPA 2KUBA 1YBTA 3OSNA 4DR6J 1SKSA 4R0JA 2JFDA 2L91A 1FZFA 3QAEA 2J6UA 3TEHB 3SSRA 4K0KJ 1IK9A 1SJ3P 1ZM2A 2BASA 1LP1B 1S1XB 5D0RA 3BCCD 1VYAA 3CDEA 5EN1A 4FYYB 1VQPS 3UD3P 1URQC 2DRBA 5CZXA 1NHUA 3HD2A 1KILC 2KT5A 2RB7A 5KT7A 3ITHB 2GX8A 3Q2TC 2E5LF 1T7PA 3PO5A 4GIFA 3HD1A 4NLXA 2A6MA 3A4TA 4K4YA 1A02J 4KHXA 3PACA 4UZBA 3IBCB 2FJWA 2Y1IA 1TL7A 1WC3A 1YJTA 3E2EA 1N86A 3E1RA 2IAJA 2B4PA 1OZHA 1PBUA 5I3QA 1J1DB 4O4RA 2CPEA 2UZAA 2WVDA 3OLBA 5CCHC 3FBCA 2OPQB 3PEJA 1C2PA 2FZGB 1EP4A 2A6OA 3I31A 3G8QA 2KJVA 1UW4A 1BUXA 4H13C 5HMYA 1F6TA 1BDCA 2BXJA 4I6WA 2MLXA 1XNQF 4PQAA 4QBUA 4KGVB 1G4CA 1JKHA 4OQJA 3QRRA 3CWBG 3HO1A 1W2BR 4P2SA 4RJTA 2BKPA 1Q5VA 5AW9B 1PBAA 3QGPA 4N41A 3QQCD 1FOSE 1PGZA 1WELA 1YWXA 4PWWA 4DV6J 1LWUC 5CJ0A 1SIWB 2QMXA 4F04B 1PAUB 1UWBA 1I6JA 3HFVA 1BHNA 2DRAA 3V2QA 4DSEA 4X65F 4MIWA 1PFIA 5KT6A 4CO5A 1DD3A 2BQRA 4OZJA 3IN6A 2VFVA 2YWHA 4DL3A 3LA0A 4DV7F 2YO2A 2FJXA 2OTJS 4X4QA 4ED3A 2POKA 1NWQA 3R5DA 4PD4I 1N6QB 4G3IA 2XYGB 5CCLA 3UDEA 3SDEB 1CPZA 2C2EA 4CO3A 2FY8A 2CPSA 5E2QA 1RXOB 1Q82Q 5DJUB 1RAOA 5KFLA 5H9EJ 1BGYG 1FZGA 5HSPA 4I7FA 2PD1A 2WOMB 4DQRA 1FVQA 1NAYA 4E2FB 2FKWB 4EBEA 1M1KT 1OXZA 1LV5A