1KQFB

Formate dehydrogenase n from e. coli
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
289
structure length
289
Chain Sequence
AMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPADLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELAEQRVAKLKARGYEHAGVYNPEGVGGTHVMYVLHHADQPELYHGLPKDPKIDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIGPNKEVDDDEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of proton motive force generation: structure of formate dehydrogenase-N.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
total genus 87
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2002-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF09163 Form-deh_trans Formate dehydrogenase N, transmembrane
B PF12838 Fer4_7 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.480 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1kqfB03
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqfB01
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqfB02
3OR1B 1H98A 1KQGB 1ROFA 2VPXB 2WSCC 4OV1A 3IR7B 1GTEA 2WSEC 3EUNA 1FEHA 4Y28C 2XSJA 1FRHA 1PC4A 1FRJA 3HKZD 2VKRA 3MM5A 5L8RC 3MM6B 1GAOA 1AXQA 1FERA 2PDAA 4XDDA 1Q16B 1FRMA 2V2KA 2VPYB 4KT0C 4YDDB 1IR0A 2V4JB 3MM8A 1C4CA 2PMZD 3MMBB 4RKUC 3IR6B 1K0TA 2WSFC 1G3OA 1Y5LB 3EGWB 3MM7A 2FJBB 3MM7B 4XDCA 5BYSA 1Y4ZB 1FDBA 1B0PA 2GMJA 4XK8C 1BD6A 2FGOA 2XSJB 5FD1A 1VJWA 1DURA 1F5CA 1FXDA 3MMAA 1GT8A 2C42A 2C3YA 3IR5B 4CI0B 1GTHA 2WB1D 4AYBD 1F2GA 3C8YA 1SIZA 7FD1A 1D3WA 1Y5NB 3MMCA 3MM8B 1HFEL 1SJ1A 2ZVSA 4L6V3 2V4JA 2Y0SD 1FXRA 1B0TA 3OR2B 3MMCB 1FRLA 2VPWB 2VPZB 1SIWB 2FJDB 1B0VA 2C3OA 1H0HB 3OR1A 1JNZB 2UZAA 4DHVA 7FDRA 1KQFB 1IQZA 4ID8A 1BWEA 2FJEB 5E7OB 1H7XA 1R27B 1FRXA 5CH7B 1FDNA 1FTCA 2GMHA 1PC5A 1Y5IB 2FJAB 2O01C 1FRKA 3GYXB 3LW5C 1FDDA 3MM9B 5BYQA 1FD2A 2C3UA 3MMBA 1FCAA 2PA8D 4OMFG 1FDAA 2WAQD 1G6BA 2FDNA 1H7WA 1DAXA 2Z8QA 3MM5B 1RGVA 1WTFA 1FF2A 3MM6A 2C3MA 3EXYA 6FDRA 3MMAB 5CHCB 1JB0C 1BQXA 1KEKA 1DFDA 2IVFB 1A6LA 1BLUA 3PNIA 1C4AA 3MM9A 1JNRB 2C3PA 3OR2A 5BYRA 1CLFA 1XERA 1FRIA 2FD2A 1F5BA 1BC6A 6FD1A
chains in the Genus database with same CATH superfamily
4R5PA 3VVUA 1FO1A 2VPXB 4KB7A 2ZYAA 1CQMA 2YH1A 3A5TA 1KORA 2XWYA 1NKNA 3QGPA 3DOLA 1L0NJ 4YDDB 1JY3P 3UI3A 1W2BO 3W2VA 3BVHA 2R42A 2WB4A 4DLEA 1FKOA 1ZW0A 3CDAA 1U1OA 3IAOA 4DV5J 3NP5A 1WI8A 5HJXA 4B86A 2DK2A 3KLHB 3B4DA 1SJ1A 3MCMA 1VRTB 3N79A 4PG6A 2L9WA 3BN7A 1Z2ZA 2KFNA 5AXMA 2R7UA 1TUWA 3DLEA 2CKWA 1HHSA 2VOOA 1Y5IB 3K8VA 5J1EB 3B5ND 2BCCD 3CCMS 4P75A 5APYA 3H1KJ 3THPA 3MXHP 1JIHA 5B66H 2WW4A 1N33J 1VQOS 1YJNS 1XMQJ 3US5A 4NA1A 1P1TA 2ZH4A 3LIDA 2XMTA 1U48A 4WP8A 4FYXB 4J9NA 3QO9A 3R1HA 4J5OA 4CDIA 3PFOA 1Y7PA 4YPCA 2RS2A 1U47A 1JJHA 4F4ZA 4N7TA 3MPYA 2ZM6F 2XGPA 2Q3EA 5DETA 1KFDA 2V2KA 3D1HA 4B9NA 4HL9A 1G2CB 3MCSA 2DJWA 4Y2CA 4CLKA 3HHEA 2FJBB 3CF5Q 5A8WA 2Q3PA 1CI6A 1KRPA 5F9LA 1HBMA 3TYYA 2E75B 3GJTB 2LU1A 3MIWA 1O0PA 3H5XA 3BGOP 2BE7D 3MWBA 1NU1K 1Q86T 1FZFA 3VR1A 1FRLA 2CUYA 4JP8A 4V1Ak 4XPEA 3J80Y 4WXWA 3SDEA 3RK2B 2QEXP 1K73Q 1WC5A 3ETOA 2QGFB 4R0EA 2HG4A 3QFWA 4CIOA 1WF2A 4A8MP 3GYXB 4DPYA 5AW3B 2WOMA 1M1HA 1SQEA 3D9BA 3JTOA 1Q5VA 1SQGA 2EWHA 1QL1A 2NR0A 5CHXA 5AVQB 4C7NB 3W9JA 4WKRA 2P2CB 3CW2C 1DZ5A 1L4AC 3H1LG 1S9KD 1VPCA 1YKWA 1C4AA 1YBKA 1N32F 1YRXA 1HR0F 3HSDA 3ETMA 2DXDA 4WE1A 4IDKB 3FJ2A 1VQ4S 5MLCV 1CJTA 1LT9C 3SFDC 3V2PA 1H0TA 5BVZA 3FXDA 2VPYB 4H0LB 2KTQA 2AJFE 4NCBA 5IQQA 1S4EA 4W98A 3BPDA 3L75G 2AXCA 5M2PA 4CO5A 3CJ8A 1BGXT 5KAKA 1YTZT 4KAIA 3SSQA 3VWSA 2MQLA 2QA4G 1GQEA 3W8PA 3AQPA 5CYMA 5C5JA 4MAKA 2V4JA 4BBYA 5D4OA 2MJZA 3AE5C 3BRVB 1HMVB 2YWFA 3TYTA 1FOSF 1VC6A 2WPSA 1XTZA 2BABA 2XC9A 4LC1A 1TVRA 1A0OB 3C19A 1TVRB 3T5HA 1HBWA 4ZOSA 2J6TA 2JWDA 4ANDA 1ZRTE 1SH0A 4OYWA 2ZXXA 3E3XA 2IVFB 4DDFA 2DNMA 3BJYA 1PILA 4WYLA 4YHHF 5BU5A 4CNYA 3W8GA 1PJ5A 2AXTH 1N73A 3FWLA 1Q4RA 1FJEB 4MYTA 4OYBA 3JSRA 4Q5VA 5IWAJ 3OFFA 4TN2A 4ZIVA 2ZZMA 1P1LA 3P96A 3MZWB 2RUGA 4N5SA 2Q6BA 1IFMA 1N7SD 2Y9YA 3GHGC 1UA0A 3PEHA 4ZITA 4N3YB 1U6BA 2QZ8A 1OVRA 3CC4P 1FK9A 4R4MA 3AE2C 2WW8A 2R2UA 2AV5A 3K2YA 3CTRA 1VLOA 1ZAVA 1SIWB 5E33A 2KH9A 2KRBA 4L3KA 5CMZA 3Q23A 3USSA 3SV3A 2AF6A 2NXCA 1KHVA 2Q66A 4OGQC 4OJHA 5KG7A 3RBEA 1EKRA 2XSFA 3FEXB 3L35A 3TAMB 3D1QA 3M8QA 3DFEA 4P2SA 1YIJP 1WKJA 1X5TA 3E01A 3DRSB 4NLPA 4XE5B 1H2UX 5APQA 2MQOA 4PWUA 1HNWJ 4WTOB 3UDVA 3OW2O 1VF5B 4EGLA 3CMAS 1LXJA 4WU2A 2MKYA 2V68A 3N28A 1TKTA 2J0XA 1C0TB 4J90A 4NCGA 1T9YA 4DCJB 4TY8A 4LF2A 5HVHA 4LF5F 4DPXA 1FZCB 2IHR1 4AXJA 2NXUA 3CX5I 3HJFA 1K04A 2N1TA 3HE4A 3VMYA 5BR8J 3OFEA 2C0XA 3JCUH 3OJAB 1REVA 4EMDA 2UXBF 4U8VA 1RQUA 1GK4A 1X31C 5CXTA 4F4KA 1OSDA 1PBAA 2D2CC 4AQRD 5L8RJ 2WVRA 2OYIA 2IPPA 1QEXA 1UVJA 4JQ0D 1X4HA 3EDRB 3MUDA 1KZUB 2BACA 2ZWOA 1VQKS 2B9EA 4IKAA 1DQAA 1NTMD 3O8ZA 2VG7A 5AW4B 1NTME 4PD4E 1RWNB 1CJUB 3A8EA 3IS9A 2KL8A 1SJ4P 3I5AA 2YIUC 1FDDA 4NRTA 2OMLA 2DCLA 2HPCB 1RWWB 4M5IA 3PM9A 4M5NA 3IR9A 5JJBA 4DFPA 2ADCA 3PTWA 2FY8A 4K5RA 3K17A 3OAKA 5IC4B 4RW6B 2IRXA 2ZC3A 2X1GA 5K14A 1KILE 3KJQB 2RF2B 2Y1IA 2RRNA 1RWKB 1U1LA 2X51A 1S9KE 1QY7A 5F8HA 1UJ5A 3DCAA 2ACMA 1KDNA 4PWDA 2QL5B 1NAQA 3GJSB 5CD4A 1VS3A 3CMAP 1H88A 2SXLA 1TL3A 4DZOA 1GMUA 5K9FA 1EZVI 3NS6A 4I7FB 1JOCA 1XMOJ 2HWHA 3V81A 3I55P 5D0GA 4CZCA 4DV1F 4GODA 3UQSA 4DF4A 5DDQC 4C8NA 2R7WA 3BRTB 2DO4A 5GMEA 1KSPA 2FHJA 2MHNA 2NPSC 2DXEA 5J2QB 2DGQA 4DPTA 1QJHA 4DXLA 4CT9A 2ZVSA 1D9DA 2A1BA 3W2WA 2NRGA 4YFUA 2GM4A 1ZETA 2YTCA 4C8MA 3L7OA 4F50A 3R5AA 2VICA 4GO5X 4ICLB 2K9JA 2HRTA 4DL3A 3Q8YA 4FNHA 2CJKA 2R8HA 3CCVS 3GJRB 4DQIA 3UW1A 4LF5J 1S0NA 3VF0B 1VLYA 1SC3B 1R5SA 4C46A 3Q8VA 3IS9B 4IOAQ 4ILRA 1VQ6S 1NK5A 3TARA 3VTPC 2LXFA 3C46A 3R6GB 1N34J 3E2EA 4FNIA 2JOQA 4GKKJ 4YY3J 3H1KG 2KLVA 2QG4A 3F44A 2BCCE 2RSQA 2R3SA 2BW7A 2RRAA 4I2PA 2CG4A 1ZZNA 1SQXK 1FKOB 4EEYA 3DMJA 4LVOP 3HUSC 4LMZA 4MH8A 5HVFA 2IVMA 2WSSH 4S0MA 5GADI 4OJ1A 2V2QA 4CH0S 2KZIA 1UPMB 4DUZJ 1A7GE 3T9NA 1VDFA 5FJ4A 3BSAA 3J81U 4J9KA 4MTPA 5KG4A 1N0VC 2OQQA 3ZZUA 2RB7A 1NOHA 1ITPA 2C0WA 2W6BA 4G1QB 4QPXA 3CJ4A 4AT1B 2JRSA 2WT7A 1FK9B 1I3OB 1OYEA 2L3MA 3VALA 3MECA 2OTLS 1FD2A 2OUGA 2HZVA 3MECB 1IJEB 4ED3A 3U1MA 2FY1A 3QRQA 2FDNA 3AJ2A 4ZJLA 1WTFA 2F4VF 1SQPD 2Y0BB 2M2BA 1FZCC 2Z0GA 1URNA 1MMDA 5K5GB 1YBUA 1HR0J 4NRUA 4DR3F 4ICLA 1JJ2R 1TKXA 5BJRA 2CQ4A 4O44B 1HHTP 3DRRB 1RYRA 4RR5A 4Y2IA 2YX4A 2HS3A 1N86A 1BQNB 3PW4A 5DG8A 1F9EB 1GX5A 4UY8T 3H40A 3L70E 1VQMS 3D0GE 3L71E 5D78A 2GMJA 1U57A 2DBBA 4JI0F 2E7VA 3K57A 3M9HA 2M3BA 3AB4B 3MMCA 1HFEL 2KT5A 4ES1A 1AVOA 2WZ7A 2F65A 5HBMB 1RWMB 5KFPA 4ED4A 3HX9A 5KFZA 3CCVP 1OVUA 3B78A 5JXSA 3RJMB 2IFMA 4IH6A 4QWDA 1ZH5A 4OGQB 2YNIB 3W68A 4Y2KA 4ILMA 1T7PA 5A8KB 3VTIA 2K7KA 2J9DE 1KONA 2J0WA 4BLGA 1L2PA 3H1IE 1M0SA 4USUA 3DLHA 2G4BA 3CC2P 4F4YA 4K59A 3BCCE 2LU2A 4B3RF 4G1IA 1VQ9P 2UUAJ 2LXUA 1MN9A 3RL0C 3OHAA 5ETOA 2VC1A 3MEGB 2DGUA 4ED7A 4NLDA 2PN6A 2XKMA 3G3ZA 1FEHA 1HNIB 5KFAA 4NXMF 3FMWA 2H8PD 2RH0A 1AV1A 3RK2C 2ZYGA 2GQCA 2NPSB 1YBAA 3HD7D 1ZV8A 5EN1A 3T5KA 1LP1A 1OW6A 4PWDB 4QMAA 3EVMA 1GFWB 1VQMP 2WSEJ 3HVTB 1W26A 4JI7J 3R9LA 3N01A 3U1NA 2ZH6A 1HBUB 1LV5A 4NLSA 3MEDB 2AQ4A 3CJQA 1IBMJ 3I32A 4QIGA 1YG0A 1JMMA 2PI5A 2VUGA 2FZCB 4DV2F 1EKSA 2CJXB 1EC5A 2EFOA 5F8LA 3PKYA 1TKZA 3VP8A 1S1XA 4DR3J 2OYOA 4NI2B 2M8RA 4K4TA 2F3JA 2QMUB 4C3LA 4G1PA 1UAWA 1RT2A 2CG8A 1UL3A 3OUYB 4XIUA 4NEZA 3W67A 2XEXA 3RGIA 2RUSA 1GX6A 2JC1A 4TY9A 3HUSA 1HNXJ 3JAMY 3V6DA 2VQFJ 2QG9B 3M0DC 2HVHA 2IPOB 2APOA 4B3TJ 2VKRA 2OEJA 2FYNB 4LRBA 3FCVA 3TUZC 4USIA 2DPJA 1FEEA 1S1UA 1F0XA 4WXOA 1HQ2A 1IBCB 1J5EJ 2HWIA 1OXZA 2HPUA 3H2VE 2XDJA 4LSLA 3C2PA 1BD6A 1U2FA 4ZJQA 3M9NB 4WKYA 5C25B 2C42A 2Q5UA 1GL2D 2CPJA 3NMAA 4CI0B 3KK3B 4A47A 1XIQA 1AA0A 4KV8A 1LWFA 2OPRB 1HWIA 3PO4A 1XBWA 1T3NA 5KLVJ 5KFLA 3UDEA 3OXFA 3G8SA 1NTMK 1QLED 2V5HG 3N6LA 1ZMEC 4EZ9A 2EI5A 3KLHA 5KOWA 1PJ7A 3BGRB 4JV1A 3L7PA 4U96A 2R2TA 5KFMA 1OY9A 5LMNF 2XMKA 5JVHQ 4LQ3A 1E5WA 3AB2B 1B7YB 4TXSA 2IMOA 1UVMA 2MY8A 3CCUS 2H4YB 3A13A 3BBFA 1JMTA 1A6LA 2ZFHA 1IR2A 2RQ4A 3AEAC 2WSCJ 3CWJA 3HE5A 5GVQA 3RGUA 1RWPB 3JSVC 1N5YB 4AL5A 1SI9A 5KFTA 3RBDA 2AXTE 1J2VA 4FYWB 1RQVA 3QZ8A 4LFAF 1N54B 5EGYA 2FLNA 1VJQA 4E8UA 1VQ8S 1FX4A 1WHYA 1LW0B 1KOHA 3F89A 1VF5C 1DURA 3M2UB 5AT1B 4E2FB 2LKZA 4UUWA 4QJVA 4AYBD 1U49A 3KJNB 4DR7F 2P7JA 1BQNA 5HLFA 2K37A 1AZSB 2IJNA 1L0NE 2M0BA 1TAQA 4ECYA 3Q5RA 4RUHA 1IFIA 1GMVA 1SC6A 3NY0A 4QWCA 1RHJB 2ZNYA 1WD6A 2UU9F 3CJKA 3EMTA 2JWAA 2YY3A 3U59A 4P2MA 4DZ6A 3LOUA 2WONB 1RCOB 4CM2A 2PGCA 5E3QA 3PYDA 4NLYA 2YPYA 2QYGA 2E76B 2DNLA 2QJYC 2DNHA 5HROA 5L1LA 4ED6A 1WNEA 4DSKA 1EIYB 4DUZF 1Y11A 2YWGA 3CCWA 1S59A 1URQA 5E3RA 4QWBA 2GVZB 2IX7C 4Q44A 1PP9D 4QBUA 4DQRA 5L38A 1OIAA 5IV4A 1TMJA 1CG2A 3I55S 4NMLA 4WY4B 2BV3A 4EYYQ 1QTMA 5DO2A 4NOHA 3H1HE 2NCKL 4ZP7A 3RBXA 1IKVA 4UT4A 4CO2A 3KTQA 4NPOA 1L3SA 1ZM2A 4ZVPB 1LTJB 4F0HA 4J7CA 1IFJA 5L8RC 4C0OC 2FC8A 4HLBA 3MZIA 2HQIA 5B09A 2B6AB 2ZH7A 2MTLA 1S49A 1O6XA 1KBRA 2FYUK 1M90Q 3OT9A 1WHXA 2YIUB 4FS2A 4DX8H 4OVNF 2AD9A 5DJTB 1XTCC 3ILIA 4DL0C 4OZNA 2LEPA 3DLJA 2U1AA 2RD5C 5L9NA 4EO6A 4BHQA 3T3FA 5H9FJ 1R0AA 2BASA 2M8DB 3RB6A 3SQOP 1F60B 4DR4F 3N5FA 4JB8B 5KG1A 4LBHA 1WTBA 3LP1A 2IJRA 3LP1B 3QSYB 3BQ1A 5CJ0A 4CLFA 3DRPB 4PXDA 3E51A 4ANCA 3I56S 4NLUA 2BJDA 1NDPA 3QT5A 4B3SJ 3IG1B 1HNVA 4PG8A 1CJKB 5DGBA 2OFHX 1LWEA 4DV4J 4DFKA 4XTTA 3G87A 7AT1B 3H59A 3AY0A 2IBZD 2E5JA 2YKMA 1UTAA 4F04B 3CX5D 3AOBA 2FD2A 2QTWA 5KT6A 4F0KA 2KLUA 3GHGB 1AYEA 2IC3A 2G0CA 3GSIA 2BOPA 4JI3J 4GKJJ 3Q3DA 1PC4A 2W2MP 1A02J 4NL5A 4F4XA 1RAJA 2UVUA 3D6MB 1S76D 1QAYA 4A8YA 1LTSC 3NMRA 4AD6A 1UA1A 1D8ZA 3TRGA 1G3OA 5AJ3J 2IRUA 1L4AD 1IBMF 2DR7A 3H32B 3ENAA 2RH3A 3TVKA 1VR6A 1S72S 4PWWA 5L1KA 3CPWO 1ZP0C 2C3YA 2LQ5A 1NK0A 5RUBA 2UVWA 1QAIA 3L72J 1S1UB 4I2LC 2OPRA 4U9RA 4YR2A 1YITP 2GW8A 5F8NA 2HRYA 3GJQB 2FJDB 3L37A 1H0HB 2BE2B 3B4MA 7FDRA 1S57A 3FCWA 1LTIC 3HD1A 4DV0J 3A0BE 2E1RA 4OI6A 3Q22A 1X9MA 1K8AT 1X4FA 5C25A 4I6YA 3W5ZA 1L0ND 1I1GA 1VK8A 3UR3C 3L7UA 1UVNA 2CVIA 5A76A 1N5QA 4CWBA 4U3FD 4DV6F 4A8FA 3NCQA 5BXIA 2HHSA 4LBPA 2AYEA 1PGOA 2DNRA 2RDDA 5APWA 1WDTA 2HBYB 3WIVA 3T97A 5APUA 3OR2A 3Q86A 1BMQB 3M32B 3RK3D 1FKPA 4B3OB 1Q78A 1RJJA 1WC0A 3CCRS 2ZOMA 2VC0A 1MLAA 1VQNS 2BKOA 1J5OA 4LF4F 4MK9A 4O0IA 3QFHA 3V6HA 3BATA 2PMZD 3R2DJ 1RISA 1XNQJ 4KIAA 1K0TA 4LJMA 4DN9A 1CJVA 3VAMA 1JLCA 9ATCB 3IRXB 1GEHA 4OHWA 4BC9A 2IDLA 2Y8WA 1R6YA 1ZA2B 3LO3A 3GLJA 1MNEA 3A1YG 1NMEB 2R4FA 4MK8A 4UB6E 2NUUG 2VQEJ 3TA0A 2F40A 3MPUB 3DMJB 2E74D 1QAXA 2C2NA 1SQXD 4I67A 5A2QY 3O5TB 2ZKUA 4GKKF 2D2CD 2KB7P 1VC0A 2DGXA 2LXIA 2RIJA 1GXTA 2DW3A 3KNGA 3VV2B 2QN6B 2YKAA 1WUUA 4DG1A 2BBEA 3GFYA 1U4BA 5B0CA 4DU8A 3FGAD 5KG0A 2QFJA 3TF5A 3ULHA 4L74A 3TVZA 1AT1B 1S6PB 1L4AB 5JUMA 3CD6P 2HHWA 4DV5F 3HFZB 2XNXA 4PG4A 3IA0A 1VIXA 1N73C 3EZUA 2VQFF 5D3GB 3WBZA 2L9NA 3POTB 4WVZA 4V19J 1LTJA 2CPIA 3P7KA 3RL0D 2YX7A 4ECUA 2N3LA 2ASYA 2J76E 4DX5A 2NXNA 2MQQA 1L0NG 3MPVA 3CJTA 2BR0A 3VN0A 2KS1A 2QYCA 3HJVA 3LP0B 3NBPB 1LP1B 3T97B 4RX6A 3SCIE 1PYTA 3LP0A 2B89A 5DGAA 2JFKA 5A2QU 4ZN3A 2MY7A 3KLIA 3OW2R 2RHQB 4TU8A 5G4DA 1FNMA 5D0EA 3ITHA 4ED0A 2PI4A 1QM9A 2VPWB 3EYZA 3WIUA 1NLKL 4FYVB 3I0SB 3L09A 3MI7X 1YSJA 1P84H 1NTZG 4NCGB 1GZLA 3T1HJ 3MTUE 4O23A 1JLAB 3LGNA 4B9MA 1KLMB 3KHHA 5C24A 1CS4B 4YTPC 2OI2A 3B5NC 3BBBA 5SUHA 2YNHB 3W5XA 3V6KA 2RJZA 4ED1A 3R1LA 1WSRA 2JO1A 1FE4A 5AVTB 1LK7A 5LXRA 2YO3A 2B4UA 2YNIA 3FKBA 4URSA 3TUPA 2D3UA 2CJQA 1NKZB 1ZLLA 1PJ6A 1SQQJ 4ZVFA 4OI1A 1NBEB 2V7QH 4LF9F 2XMMA 4F25A 2EEYA 3R7BB 2DY9A 4KC5A 1NHVA 2ZM6J 1NCLA 2XS7A 2BANA 3D68A 2UUCF 3KPEA 3WX8A 3N9UC 3CCES 3MEGA 4C4WA 2GUSA 5HQ8A 1G1IA 2HW3A 2QL9B 3M0DA 1Q7LB 1U6FA 3EDQB 4JI1J 1RTHA 2IM1A 4EBCA 1CPZA 1D7MA 2HFUA 4C8KA 4DL2A 1DD4A 3N6MA 3ET6B 2HGLA 2RF2A 2U2FA 3R6LB 2HHHJ 3KZIH 2F9DA 2DTJA 2K88A 5CBNA 1J2JB 3M8RA 2E76D 1B99A 2BM0A 2Y0EA 2MYFA 4FS1A 2AJQA 4PQUA 1X9VA 3TGUD 4Y34A 5CCHC 3PW0A 1PGPA 3CIMA 4QYRA 4ZLPA 2FYUD 3I5BA 4RL1A 1CEZA 3M30B 3M6VA 3M30A 4JV5J 2M5AB 3SFEC 1SQXE 1G6BA 5AW7B 3GW6A 2HVEA 2L41A 3PX6A 5ETTA 1UVLA 4RBUA 5CHCB 2C22A 1ZM4A 2B88A 2WT7B 3QATA 4DOZA 3H1LJ 2GFFA 1CBKA 3AD7C 1E6YA 2JEGA 4X4UA 1PFIA 4WP3A 1U25A 2CPXA 2BJEA 1QX8A 4IQXA 2HODB 2WSEC 3EUNA 2AKWB 3PEJA 3R4YA 3GMAA 3FBEA 2ZH1A 4PQAA 2FVRA 4KGMA 4UQGA 3DM2B 2AT1B 2KZMA 2OH2A 2OSQA 2SPZA 5DQGA 3P5BP 2GHWA 4U3FJ 4DFMA 1RU2A 3DU6A 4JYAF 1OMSA 1AQTA 2KDOA 1PZQA 4YB5A 1V5VA 1TQLA 3C8YA 1TU3F 5E79H 1AZSA 4ELUA 2J9EA 3UNGC 1Q8LA 4KT0J 2VFVA 1X5PA 3P8CD 4B3TF 3CCRP 3CJKB 4U3FE 3J80U 4RPFA 1RF1B 1RWXB 1LW0A 3VGVA 5IWAF 1NM2A 4P6QA 3IN6A 4NYOA 2NZ4A 3T41A 3KKFA 2QA2A 1RT4B 1VBZA 5KOXA 3LW5J 1LWFB 1JMBA 3HVWA 4U95A 1YJTA 3L71D 2KSJA 1VIOA 1NAYA 5I3QA 1NUEA 1WC1A 1U45A 2CQ0A 1VQ6P 3D6HB 1BGYJ 5ETSA 4PV1D 2VBWA 3G9CA 3SDEB 2NZCA 1RUSA 4MN4C 4LQ9A 2HFZA 3DDKA 1Y0HA 3KK1A 3KHGA 2VONA 2ZD1A 4YY3F 2EXUA 2LQ8A 2GC8A 4I69A 4TQSA 4KE5A 5IV3A 4OGQD 3MP7B 3NGUA 3NBPA 2HPCA 3W66A 2NYIA 2GIFA 5GAGI 3J7YU 4RESB 3KQGA 3HD7A 1RK8A 3JSBA 1YI2P 4A7PA 3L73D 1W2EA 1VJWA 5HI7A 2AJ1A 3U1CA 1X5SA 4DV0F 2MQPA 3GIKA 5KFOA 3WHIA 1B0TA 3B5NB 3J7AN 2CPFA 4U67Q 1YGYA 3BCCJ 1PYOB 1R0BG 4N56A 1JLCB 1WORA 3DRRA 3JQJA 4Y99C 4HJGH 4IYQA 1PC5A 4MFBB 3FRZA 4PPZA 5C24B 2H9ZA 4MT1A 4LRAA 2ZITA 1RTJA 3M9BA 3LP2B 2MZTA 5APXA 4TLFA 2GAHC 3OTBA 1XN9A 5ETNA 1KB9E 1SB6A 4PJ0H 3CCJP 5KFGA 3T1AA 1SUQA 2KM8B 2CQGA 2WHOA 3FNNA 3CGIA 1ELOA 3IP0A 2H5IB 3CCUP 2E5TA 3IM8A 3D67A 3M06A 3EGZA 2E5HA 4KRWA 2I1RA 2CADA 5B0BA 1NHUA 4CO1A 1T3OA 3D54A 3CX5E 1S6UA 1DRZA 1X0PA 4K2XA 3K5BA 2NQPA 2HS0A 5AVYB 2FZGB 2HMIA 5DG9A 4D6TG 2X3GA 4ZCLA 3L72E 1TTHB 1HYSB 3MM7B 3GHGA 4DUYF 2DKOB 3MGNA 2N4DA 3KK1B 3HCXA 5C39A 2Z2ZA 2C9LY 3QBCA 5KFUA 3M8PA 1RF0C 1NSKL 2XLIA 4KGZB 1DLOB 2DGVA 3IN5A 1NTKK 1S6QB 3H32A 2VZ9A 3SWKA 2NPSD 1JKHA 3BYRA 3KLIB 1PG5B 1IK9A 3QJPA 3MMJA 2OO4A 4MMOA 3C9IA 2EC2A 5E5NA 5KFIA 3AFGA 3UFCX 2QV6A 2E1CA 5GADU 4JV2A 3TUIC 3CD5A 1G7CB 1BY9A 4WBFA 2VBZA 3HVAA 3MCNA 2K06A 1M5OC 1TL1B 3O6QA 2ZHAA 1K9MQ 2CZ9A 1Q86Q 3UN5A 2QSWA 3DYAB 1RT1B 3AA8A 2DNKA 2Z58B 3QT6A 3BSCA 3I6PA 3H98A 4I6MC 3NGSA 2GX8A 1S4XA 3ZTQA 2W83C 1IR0A 3R97A 2Y9ZA 4KPYA 1ZM9A 4ZPCA 1F9HA 4PPDA 4X4SA 2HLOA 3R5GA 1T05A 2OPQB 5KT2A 2P9GA 3TZWA 3NS7B 3FUYA 1AROP 1S1TB 3TX8A 2DH9A 3EFFK 3MFHA 5AVUB 1SFCC 4RU2A 2YKNB 4FPRA 3CCZA 2W1BA 2FC9A 4DUYJ 2IM3A 3G6YA 3M6WA 2QJYB 4OHZA 2E5YA 4W80A 4GO7X 5GAEU 3ITKA 2ZYDA 1FNXH 1WELA 5GMKa 4DR4J 4M94A 2GJIA 2ZUAA 2V9KA 4RW8B 5GTIH 1SL0A 3P8BB 3W65A 1M8OB 4JI4J 3OA7A 2B8PA 3DGPB 3ZTOA 2E7WA 3MAAA 4HT5A 5J2NA 4K4WA 1B3TA 3VMAA 5CCHD 3ZO7A 3LAMA 1ICEB 1YIJS 4ZCMA 2BJ8A 2KHDA 2EK6A 2BA9A 1JY2O 1SQQK 4I0WA 3A8KA 3HO1A 2WVBA 4PUOA 1UIIA 4HDHA 2C3PA 4JBZA 4K8RA 4K4ZA 2RKIA 1UJ4A 4KSEB 4PXBA 3GU0A 4JV5F 4TLQA 2PDAA 1S6PA 2X7IA 5A8KA 1K1QA 3PW2A 2XI2A 1L3UA 3UPFA 2OHDA 4K4YA 1UEUA 4TT3H 2DGSA 2ACYA 4A8QA 1MN7A 1X0TA 3DLEB 2PFDA 5CCGA 3CJSA 4GC7A 3X3UA 1RDRA 4C2MA 1XNRF 1J1DB 1F5AA 5LJ5Y 3TGUG 4HHJA 4X4TA 2J9CA 4OWFA 3AE7C 5IQ6A 3C15A 3RW6A 2OPSA 3H4DA 2FHKA 5M1BA 5LM7E 2C28A 2R5DA 3I9ZA 4IO9Q 1WG5A 1JY2N 1WG4A 1OS5A 1OW8A 2ROPA 1JM0A 2MB0B 2N1TB 3THTA 5AE1A 1YI2S 3WC0A 4QWAA 1FBMA 2V69A 3LP2A 4O3SA 5GAHU 2X1AA 5CABA 3LPEA 1JLAA 1R8BA 2JL9A 5KFJA 4ECRA 5J2QA 1TK8A 3L72D 1S77D 3KLFB 2VG5B 1SQBE 4DLGA 2FXPA 1Q95G 4X4OA 4EWTA 5KAIE 3QPIA 3VAIA 3G6EP 1FJPA 5TISH 4L76A 4HB1A 3P6YC 4NI2A 4LREA 5DZ6A 2IFXA 5L1IA 3R5DA 3M2RB 1RT5A 2J59M 3CVKA 4OYIA 1IKVB 1S9GB 1Z4UA 1HWTC 1XR6A 2LCWA 5CCGC 2DCUB 3H8YA 3NWRA 3W5YA 4RWWA 1FZGA 2LP4A 1RE4C 3DLBA 5FLXY 1RCXB 2HS4A 5KFBA 1JNZB 2POKA 1KQFB 2YKPA 2A0FB 3M6XA 4WIQA 4NLGA 4JI0J 3I31A 1BCCD 2E75C 2WBRA 3BKUA 4ECQA 4LR8A 3JQKA 1B64A 2BKPA 4ZPVR 4OI3A 3CD7A 4K50A 2PA8D 4KFBB 1SQPJ 3V4MA 2GV1A 3MPWA 2MPUA 3QIDA 2IM2A 2CK3H 2H4WB 2HNZB 3FQKA 2BXJA 2KZZA 2VL1A 3PJWA 2DVIA 3SFGA 3UCGA 2E43A 4LLHA 3IG1A 3RAQA 2HAIA 5DJBA 2W24A 3SI8A 1GTEA 3DI6A 4C7QA 3IRWP 3E1IA 5T7LB 1N5SA 3HPOA 4USWA 4CCHA 3PFEA 4CO4A 2K8GA 1IWGA 2QM8A 4Y0FA 1HNZJ 2GO8A 4PXCA 1CJKA 1OZHA 2HBZB 1QUVA 5IT9U 2MJUA 2KT3A 5KFKA 3V2NA 1PP9E 3WU2E 3EICA 1JLFB 1TFYA 2JEFA 3NXSA 3M2VB 3LWLA 1U1KA 1S79A 2HNDA 3K58A 4O3NA 1SQVJ 2PFXA 3RB3A 2B4VA 3A3NB 3TEHB 2K9YA 2FXOA 2VKZG 1KQLA 1S6OA 1FZEA 4EUVA 4TKTA 4D3HA 3H1ID 1N73B 2WPRA 1QL2A 1YJ9P 3NS5A 3GILA 3CI9A 2W9BA 2V67A 2DGWA 4N41A 3HT0A 4QYZK 2NLWA 3BGUA 1XR7A 5A8WB 3UCUP 1FNOA 1RT7B 5DM6Q 3AHPA 2XQCA 3HZGA 2F4FA 1HQEA 1JY2P 3PHTA 5K5MA 3NAIA 4QR1A 4D3GA 1HBOA 5H9EJ 2WSFJ 3JAMU 1G2CA 2AJ2A 3F56A 3B8HA 1SQVE 4HTJA 2GVDB 3CB4A 1NTZJ 3MCOA 1JLBA 1U6ZA 2XMVA 4F02A 2CNNB 4ENOA 2HKEA 3ZTRA 3A0HE 3NOGA 4WYWA 3TEGA 2QE7H 1PL5A 1AB8A 2GIQA 5K8OA 3VMXA 2HEKA 5EX3A 1JWWA 5EWFA 1U24A 2POHA 1KB9I 2DISA 2HQCA 1JLGA 1AA1B 4ANEA 1RT1A 1APSA 1C2PA 1FWPA 1J5EF 2XS2A 3EQ2A 3C6TA 1C1BB 4H0LD 3NNHA 1OJ4A 2GHPA 4LT6A 1NTMJ 2Y0SD 5CZXA 5HP1A 2R2SA 9RUBA 4NWBA 3OR1A 3H25A 4PXEA 5GTHE 5HK4A 1FJGJ 2G8YA 1T03A 3SQGB 5AVRB 1S1TA 3IAS9 3Q8UA 4X2BA 5CH7B 5J1PA 2XTJP 4O3PA 1FE0A 4J9QA 1VYAA 3IRXA 4B9TA 5BYQA 4EU0A 4K3AA 2HZAA 2I9SA 3VYIA 2HVIA 2B7BB 4W92B 4KO0A 3ZTPA 2I2YA 1RLDA 2Q43A 5B0DA 3EZ5A 2HFNA 3P8MC 5CA5A 1VBXA 3HLUA 3A8IA 3MEDA 3MF5A 5B5EH 1K05A 1SVDA 3L74D 4JI6F 1UEKA 2EFNA 2ABYA 2PAJA 5KLIC 3PDNA 2X1FA 2COLA 1YHQP 2IYIA 2YWHA 1QE1A 2Z2MA 2V2ZA 1AXQA 4K4VA 3FZBA 5B0FA 1HGVA 1G2EA 4YN3B 2B9YA 1FC2C 1HI1A 3HSGA 1MSWD 2AGQA 2PMWA 2KNCA 3HHKA 3CE8A 3KHLA 4HKQA 3CD0A 4IRCA 2ALZA 4NZ6A 5K14B 5HMZA 1VQLP 3RRKA 1B0VA 1VC5A 2UZAA 4LUBA 4QYZJ 2B9BA 3A3PB 5E7OB 3IWLA 1RAOA 3OVBA 3VGTA 1EJ7L 5KLIB 3HDSA 8ATCB 2UU9J 4OYOA 3EVOA 1SQXJ 3RTVA 4WFBQ 4U3FG 3SIPB 1IN0A 2B9WA 3KG1A 3MM5B 3C3LA 4C8YA 3EXYA 2KIKA 3L71G 2HHUA 3HHNB 4LSZB 3AD8C 1KFMA 1EDJA 3HHLB 3P3DA 3E7KA 1F5BA 1YDLA 2ZFCA 2GAGC 4H4KC 4JBCA 4FBUA 2K1RA 2R8GA 4Z7YA 2QX0A 4JYBA 3QWPA 3MM6B 1U8WA 4IFVB 4LRDA 4RNMA 3KLEB 2J8AA 4URGA 1LT1A 2ZH5A 1EDLA 4NA2A 5KFQA 1Y5LB 4ATNA 2Z4EA 3QSIA 1L0LE 2ZOGA 2W4DA 1ZBTA 5T7LA 4YR3A 4B9VA 2VASA 1IBKJ 1X4AA 2AWZA 3RB4A 4G6VB 2ZJQQ 1SJFA 2WSEH 2QJ3A 2C1EB 1DARA 4B17A 4UUXA 5CCHA 3DRSA 2XYHB 5JVGQ 5AVXB 3ZXWA 3M9MB 1JLEB 4ECVA 1FOSE 1KYOE 4M5KA 2CPSA 5CYQB 2B43A 5IT9Y 4C0BA 3ZNJ1 4RKUJ 2DR6A 1T8ZA 1YRUA 1JQGA 5AJ3F 1EXJA 2XM3A 2NZ2A 1FDAA 3SEOA 2ZVOB 2QLFB 4HTIA 1PAEX 1RHZB 1S97A 2XB2D 2HAFA 4F8RA 4A8KA 2O3JA 1LWCB 3A8JA 1KFNA 4NLXA 3CCJS 1M5SA 3SCJE 5KFHA 4LR7A 1TFWA 2OIHA 5I4MA 5E41A 2OYHB 3VCDA 4K35A 2BE2A 3MAQA 1QDUB 1RTIB 2HHQA 1HUCA 2IYOA 4DOJA 1U1RA 5A6PA 2PSZA 1BE3E 2UUCJ 3PG9A 1HQUA 3KHUA 3CDUA 2XY6A 4BWJA 2CQ3A 5ETQA 3A3YB 4I6WA 2Z5IA 3CWBG 3O2IA 2Q3IA 4N78E 3F0NA 3L72G 4DCKA 3CJ5A 4K2JA 4O3QA 3G82A 4ZMDA 1NTKD 4OL8A 1KR4A 2W25A 3OR2B 2XLJA 3CXHH 2I8EA 2IBOA 1HW9A 2F5GA 1GL2B 5D15A 3SCKE 4ZVRB 1TL5A 1ZOTA 2FLOA 1RHQB 3M2VA 1U1PA 2ZT9C 4A4JA 1RBOB 4Y65A 3PJSK 3G6XA 1VGYA 1YBTA 3MMBA 1H3DA 4B3MJ 2G2ZA 1C1CB 1EP4A 2LVWA 1X4EA 3TX0A 4ZCIA 3DKDA 1X22A 2Q79A 4ZN1A 3D7SB 4I6AA 1R8HA 1TK5A 2G13A 5K8MA 3MHYA 2R8IA 5DRKA 4ZMMA 2H3EB 2W9BB 3G2XA 1KYOH 3DOKB 1HW8A 2YQ1A 1T2KC 4ZKPA 5HBMA 3NWGA 1VCTA 4CTAB 1HA1A 4TNOA 4ELVA 3MHVA 1NSAA 1IKWB 3CUNA 1FRMA 2M52A 4DCOB 4H4OB 4J9SA 2V4JB 4DJGA 1C4CA 3TR5A 3P8CE 1IC2A 1R0CB 3GTYX 5B0GA 5B08A 3OBIA 2PA3A 1RT2B 3HFKA 3NAHA 3W9HA 5KT3A 1RTIA 4OYMA 1S7IA 2RKLA 4ASVA 1P9QC 1FJCA 3IR5B 2KJVA 3GSDA 3RK3E 1SIZA 4XAKA 1RT3A 4YB7A 1SVFA 2KO1A 3WUVA 2ZBIA 5D77A 2IIHA 4QIFA 1RYSA 2H5JB 1N36J 2KUBA 4WZMA 3LANA 4TQRA 1MMNA 1RLCL 1WRGA 1WHVA 2BANB 2R7QA 3MUVP 2LECA 1HLWA 4PCQA 2WMMA 3QLHB 3KJVA 2WPQA 3C1LA 3KJVB 1SQVG 1S5ZA 4OI4A 5C7PA 4DN0A 1IK7A 1H0TB 1GU4A 2H89C 4N77A 1VMBA 2P9EA 4RJTA 2NSCA 3CWBE 1PP9J 2E1PA 4I68A 4AXIA 2A45I 2V8DA 1UKUA 1PGZA 1R89A 1FRHA 3OVSA 1NDCA 2XYGB 3TW0A 1SFCA 4NLQA 2R3CA 2Z5HA 2GMLA 4UB8E 4D6TD 2RU3A 3FEZA 1EETA 3TA2A 5K20B 4R8UB 4QCLA 4JI6J 3OHBA 3PW7A 1E79H 1HMVA 4OZ0A 3BPSP 2RU9A 4HEA9 1UWAA 2R9LA 2K1RB 1W5CE 2XSJB 3PRBA 4NASA 2W7AA 1N48A 1UVKA 3CCSS 1YK9A 3L9ZA 5FIIA 3EPIA 3FBFA 2W7OA 1F3FA 3WQPA 2VB6A 2XHWA 3QZ7A 3DHXA 1R6VA 1SS1A 5MAOA 1IQZA 4J9RA 2DRAA 1VRUA 4RBTA 1Q5YA 4ZVGA 3EZOA 5DJUB 2MKJA 3K89A 3O1LA 1FTCA 3AE6C 3VOPA 3U02A 2BW2A 5J2PB 4DMZA 1TK0A 1PSDA 3THVA 3BREA 4LF6J 1B7FA 3GF7A 2WVCA 4CLZA 4JI3F 3C6UB 1Q82T 2CXEA 4ZDNA 1UWBB 3M8ZA 3HULA 3BO3A 3V6JA 3HVRA 3ET6A 4I2QB 3GIIA 1L0LK 4OYAA 2F7VA 1LWCA 1SQQG 4CPGA 2YQ3A 4LF1A 3TWZA 3IR7B 4HACB 3CJ0A 4DL7A 5KJ7C 1RHKB 4NX9A 3K5OA 2VJUA 2FFDB 2MKVA 3KUHA 4QR0A 2IYPA 3VAGA 1H2TZ 3GYGA 1HBOB 2MZRA 3IAM9 3VP9A 1RWOB 4DV7J 2ZBQA 5DDOC 2CPHA 3G6ES 3CWBD 2CJAA 3L73E 2P58A 3AEBC 2D9OA 2HQ3A 1SQBD 4XDCA 4K0KJ 2B56A 4KPCA 3C14B 3OTOJ 4JI5J 1EZVG 1PCAA 5HMXA 2HYNA 3N7NA 4H44D 1EHWA 1RQ0A 1KTMA 1S9EB 4LVNP 2Z2YB 2HODA 2RN0A 2LDYA 3WUTA 2H48B 2J6SA 3J81Y 1EQ7A 1XMQF 1OO0B 1L0LG 2ZAEB 1HD1A 2WWWA 3G86A 2H65B 2DB1A 2XGQA 2WZ1A 3R5JB 2CYYA 4LSNB 1RF1C 3Q8QB 5C2GA 4Q2MA 4ED2A 3ENWA 2ASLA 5IXUA 2HIQA 4X62F 2A06D 3D71A 2LXBA 1XJWB 2AU0A 2ILYA 1YQ3C 2VFTA 2XNRA 3D0IE 1KQGB 4OV1A 1IZNB 3R7SB 1VBYA 1KLMA 2FVPA 4N6JA 4KYZA 3FFIA 3CPWR 3UD4P 4WCEQ 4DR1F 5F8GA 4O4GB 2UUTA 3NGTA 3IMQJ 1GDTA 3OUYA 2GS8A 4LF8J 3ZZYA 4C11A 2KT2A 1FJKA 1GT8A 3IC1A 5KLVD 1U7JA 2FXMA 7FD1A 4WFNQ 1HNWF 4FXVA 2UUBJ 4IFMA 3BH7B 1RE1B 3L73J 2DXFA 4YDXA 1YJVA 1YJWS 1UVIA 1VRQC 5D3GA 1LT9B 2KYZA 1KLNA 4OX9J 3NTNA 1NDKA 1ZTTA 1AW0A 1C1BA 2JEIA 3FGVA 3EWGA 1YZ6A 4WWIA 2RILA 4HI2A 4J9MA 4I1LA 3TZZA 2MXYA 3TJ8A 4I64A 1S5LE 2FVCA 2CJBA 2BCCG 2O66A 3C16A 2OGUA 5LSLA 3MMAB 4I7FA 1XMBA 3P49B 4I2PB 1VISA 4KV8B 5KTQA 1S0MA 4KHRA 3BSOA 4HDGA 2QA1A 2ZC4A 4WE1B 4Z2XA 2W4CA 3RK3C 2DHSA 1DEEG 2CNLB 3A2AA 3UNYA 3OTDA 3Q2SC 3OJSA 1RTDA 1Q90D 3JB9k 1KC8Q 3FK4A 2ZH8A 4IG3A 4R8UA 2XZTB 3BDEA 3CCLP 2WQYC 1JJ4A 3H1JG 4EK2A 1Y47A 2DEJA 3GG2A 2FHMA 2RMLA 2HQGA 1NJYA 2AGPA 2JLFA 3GV7B 3EVWA 3ABVC 2J7WA 2V94A 1TL1A 5LMUJ 2MKKA 2JFDA 3RW7A 1VDHA 5B7WA 3R2CJ 1HD0A 3KK2A 5KFSA 1QSLA 1VQ8P 1Q7YT 2HNDB 2UV8G 4C11B 1M56D 1KTQA 3NGKA 1XMOF 4DZDA 1KB9H 1QVFO 2FFDC 1LWUA 2BJ9A 3MD1A 4JI8J 1TL4A 3CWBJ 2ALYB 2YNGA 1K44A 2NUHA 1NB7A 5SZTA 1KNZA 2Z8QA 4P74A 1JLEA 1W2BR 2XU6A 5J1NA 2JSXA 4ED8A 2KYVA 1RAHB 3KG4A 4ZKAA 3DGVA 2HK3A 1LFPA 2JEEA 4ZHRA 2E1MC 1N7SA 3GLMA 1ZOYC 3QRPA 2YX1A 4P10A 2G0IA 2BE9B 5IOLA 2W7PA 4EO8A 2DHAA 4PEOA 3ILJA 3M7VA 4I2QA 2JJLA 4NMXA 4HH0A 1XWLA 1ZXGA 4KFBA 4IRKA 2FQQB 1RE4A 4ECSA 3CCLS 1IUJA 1Q2NA 1CJUA 5B66E 3SSRA 3U7JA 3OVAA 4HVZA 2IM0A 1GTWA 4PD4I 1U0SA 1NU1J 1VRTA 2XNDH 3BQ2A 2FB0A 1AFJA 4USHA 2FYXA 4AL7A 2W9AA 1GD2E 4G1QA 5LMNJ 4DSFA 3TOQA 3H4BA 2M0GB 3DLGA 2KRRA 3G9RA 4H54A 2ZJRQ 4X4NA 4BRYA 3BASA 2O01C 2JLEA 1F9FA 1LTJC 1UFWA 1M1JB 3HM9A 1FAVA 3OD2A 3TJ9A 1N56A 4LSNA 5KFCA 1MW7A 5I42A 1N5YA 3L70J 2QO3A 4GOFA 2HHXA 1AJYA 5F9NA 1L3KA 1PV3A 1EXIA 1KMIZ 3ICLA 3I56P 2EG2A 4CTAA 2HK2A 4DV7F 1NK4A 4FDFA 3H1IG 2ZT9B 2MQNA 2J7UA 2C2MB 2CQHA 4L3NA 2HVZA 3OTOF 4JI5F 1IVZA 4U7JA 3FVYA 4H4MA 1SQXG 2VG6A 4ITSA 5T41A 1ZS6A 2R7XA 5EDWA 1R7IA 2V8PA 4RKUC 1ZPWX 1RADB 4IR1A 4U7CA 3K0JA 2XMAA 2IAJA 1PGQA 2Y0CA 3I87A 4O9BA 1M1GA 5F0UA 1VOMA 2N82B 2RDIA 2V6AA 2ILZA 1Y9OA 3CCQP 2EFPA 2PO4A 1RAGB 2C2OB 3PTZA 1NSQA 1VQ5P 4JI8F 3MUMP 3T1YF 5GTIE 4FKYA 5AW2B 2P5VA 4U6PA 3G6VA 2W6JH 1IKXB 4OH8B 5CYJA 2FJXA 1URQB 2O1PA 2I8DA 1TR0A 2ROGA 2AYBA 2PGDA 2VG7B 3AOAA 4P71A 1UJ6A 5KFVA 2JEJA 1YZ7A 3OPKA 8RUCA 2WOMB 3JTNA 3H2LA 4WFAQ 1HYSA 2WPVB 3PX0A 2FJVA 3IFMA 1DAXA 3W9IA 2ZBPA 4WK1A 4NLRA 3CEDA 2F1FA 3L36A 2A3JA 1EARA 3FCHA 4RNFA 2A45H 2K2PA 1H89A 1T6AA 4QZVB 1XNRJ 3JS9A 1HKAA 2B87B 2V4QA 5H9FK 3DC2A 1OFCX 3N6NA 5IM0A 1BCCG 1M5KC 1ROFA 3T6JA 3FDSA 4IFFA 3IWNC 4K4XA 5FLXU 1JUNA 2QVAA 1MMLA 3ENQA 4LFCF 2WRMA 5FDLA 4RUBA 4NCAA 2H43A 4IG3B 2E7XA 3HD7C 1IFPA 2YNHA 5L46A 3O3LA 2KG0A 3MGJA 3CXCR 3HXMA 3TZYA 3DI6B 1HWJA 4RW4A 1NDLA 3KOAA 2RHSB 3RL0g 3O6QB 1V5IB 4C7RA 1T9VA 2MJNA 5D4PA 4H4OA 1SBRA 3GIRA 2C3OA 2UP1A 3NRBA 1LTAC 4CM0A 2ZBCA 3V5RA 4ZVSB 1Y00A 3HKWA 1NWQA 1VHFA 2YKMB 3D6TB 2K9JB 4KKOA 3MTKA 4ID5A 5DQIA 4QW9A 2R2RA 3D4JA 2OPQA 3PYFA 4KGVB 1RT6B 1S4FA 4F26A 4TY8B 3ELHA 1SQPG 3U1AA 2J0SD 4YEAA 1Q8KA 1ZRTD 3P45B 2FZKB 3AEDC 1AQ5A 5IZHA 4ZS6A 2KN4A 4KJIA 2AX1A 4ZPTR 1N36F 5KT7A 1S6QA 2ZH2A 1HQEB 2A2CA 3MTJA 3RRHA 3CO9A 1DIPA 4G65A 2IDBA 2J6UA 4U7UD 2YKOA 2FUG9 3PIOQ 4BC7A 2C9NY 4MIBA 2PFFB 1SQQE 1O5JA 2IJFA 5KJ7A 1NU1D 1A02F 1N5VA 2FVSA 4RBVA 4EBEA 4OZ2A 4YR0A 3UN2A 1NK9A 4ZVHA 3SZ2A 5CBOA 3U27A 4XFJA 4EYHB 2JDJA 4M63A 2LR2A 4Y6IA 4UOHA 4OZ1A 4DL6A 2W2PP 1SFCD 4DU7A 2FJEB 1BGYG 4RU9A 3V2UC 1BSHA 1S10A 1X8YA 4Y99B 3H1KD 4ZIWA 5IC6B 3G96A 3B6BA 3RZAA 2JZ5A 4CO3A 2DH8A 4A8XA 5CD4H 1L0LD 3MURP 1OW7A 4OMFG 3H5YA 1RKJA 2FBWC 2K7JA 4V19X 1S0VA 1RBLA 1TUVA 2CWXA 5KLVE 1T03B 2ZT9D 2VFRA 3DLGB 2DY1A 3LAKA 2XHCA 1SJRA 4F3MA 4CLSA 3NG8A 3JCUE 3SMZA 4ERDA 1R43A 4WK3A 3M9OB 1YJNP 1C0TA 3MD3A 3LPYA 1OWXA 4IFDK 1LEOA 3H1JE 3I4HX 4CNZA 3TI0A 1FDOA 1Q16B 2OJ3A 3TVYA 1VHIA 3QO9B 2HFVA 2I6WA 2Y1RI 2D69A 2D3ZA 4C97A 4B9SA 4K4SA 1R8PA 1AVYA 1FDBA 1SH3A 4K7QA 2J5UA 5B5EE 2NYHA 5LSRA 2FGOA 2E74C 2DH7A 2KXNB 3SSUA 1FS0E 2Z30B 3IWXA 1SQBJ 1UW9A 1HWKA 1FWKA 4M5DB 3OXGA 3CJ2A 1PP9G 3DN9A 4CLYA 4CLPA 3M6UA 1XNQF 2OYHA 1NTMG 1N33F 2AX0A 1ACMB 3AOCA 3SBMA 2QL7B 1KILD 2DYAA 2GVZA 3V2RA 3LUYA 2R7SA 3Q83A 4IRDA 4NPEA 1PPJD 3D28A 3FSXA 1KTVA 3BO4A 2KZJA 4LIRA 1URQD 2MKIA 4KBIA 1Z2LA 3IFEA 4X65J 5KFDA 4ES3A 1BE4A 2LQBA 3HK2A 2B87A 5ETPA 2OD6A 4NZ7A 3PACA 5F41A 4C3KA 5J2MB 1KYOD 3BQ0A 3HD7B 2W8KA 1FJGF 1WI6A 2GJFA 2BRLA 3DLKB 2E76C 1TKDA 1F6TA 3RK2D 2FTRA 5I42B 3KK3A 1N52B 4W90B 1Y8AA 3V81B 2HGMA 1BXNA 2JX2A 4CT8A 5AW5B 1CSJA 4DL5A 4CLTA 2BDPA 4NLTA 3EGWB 3A3OB 4DT0A 3BB5A 3TNVA 4KTQA 3T1HF 1MFTA 2Z57B 2DHGA 1TKTB 1SKWA 1OIPA 4R0JA 4PG7A 3KZIE 5ITHA 1FDIA 1CS4A 1GTHA 4X62J 3BKFA 5L1JA 4AE5A 2CZ4A 4ER8A 3RK3B 1U7LA 2LA4A 5ETRA 4F4WA 3BGFA 4MYUA 4DPOA 3EXCX 1R0AB 1GMWD 2I0XA 1Z56A 4ID8A 2O5DA 2GGPB 4HI1A 3RB0A 4FBTA 2PT0A 3KMSA 2ZJPQ 3UDCA 2Z2LA 1WOPA 1WF0A 4CYUA 4QR2A 3VMZA 1HI8A 3V4WA 4RW9A 4LBIA 1HNXF 2W8LA 3KUEA 1PAUB 3MR3A 1IR1A 3HUSB 2K3RA 4M5GA 1OVVA 1KFSA 4MKAA 4GRSA 1O8BA 2HFED 4EOTA 3UN3A 2OYHC 4OX7A 4UTGA 3KYQA 4ZP6A 3D6YA 4Y28C 1N8RQ 3MR2A 2XZRA 1YJ7A 2DNOA 1J27A 1NJZA 5CJ4A 3BEGB 2GJ2A 2VODA 5J2NB 4J9OA 2B0GA 6AT1B 4XK8C 1A9NB 4NZ0A 3T1YJ 2BMBA 3BGRA 4IH5A 3OLBA 2MHEA 1DEBA 1MWQA 4FF1A 3EPGA 2W6AA 5DS7A 4ZVEA 3KDOA 4OYZA 1YJWP 1S7HA 1ZA1B 4X65F 4USJC 5DLGA 2JP3A 3I0RA 2EFGA 3IF4A 1SKSA 1PBUA 2E5LF 2KKHA 3GE9A 3JC22 1USEA 3JSMB 4N8OA 1RB0A 3D6FB 1DQ8A 1D9FA 3ISND 1OSCA 4USKA 4H13B 1JB0C 1IBLJ 5LMUF 3L73G 3LQVA 5AE2A 5ETMA 3AQOA 2C2EA 1HL6A 4AQYF 3J7ZT 2WTFA 1AUSL 3TGUJ 3HMJG 3F41A 4X64J 2KXPB 1JCCA 3M8YA 2CQDA 1OX3A 3LIEA 5G0RA 3AE8C 1LKZA 5B0AA 4YS2A 3HE4B 1TL7B 2BCCJ 1VQSA 2XO7A 2AMCB 3TDKA 3LALA 1Q7YQ 1WJ9A 1RWUA 2FYUE 3PHEA 4P72A 3HTKB 4DR6J 3DLLQ 2VOPA 2IRYA 3M91A 2RQKA 1T8EA 2CVEA 1RHUB 3B4SA 1NRKA 2UXDJ 2EW9A 4QU6A 3CIZA 4YMEA 4IL6H 5KFWA 1JXEA 1XC9A 2WONA 3CSKA 1NTKG 2WSFH 1AUDA 2HNYB 2P1JA 3LW5C 3GQCA 4DV3F 1N7LA 1WDDA 5H2FH 5CCMA 3HD2A 2ADBA 2DNNA 3AJDA 1NK8A 1RKIA 3C6TB 2FYZA 4MKVA 3SWYA 3H6PA 1DFDA 2Q7CA 2A6OA 3CCSP 4FF2A 5J2MA 4ZK7M 1XERA 4O3OA 3UDLA 2YMYA 2Y9HA 3WUUA 3T9ZA 1VQPP 1CULB 4NA3A 2RRBA 4WBAA 2C2KB 4RJVA 2XV5A 3NCRA 2XMJA 2Q9IA 3ZC4A 4OHVA 4YQWA 3A0HH 4JPZB 2CPBA 3H1HD 2FYUJ 3MM8A 5APSA 1QVGO 4PRFA 1IFNA 2NSBA 2YXQB 2V4HA 2VFUA 3BGLA 1U1QA 1HGZA 4P52A 2IYGA 4PD4D 3MD0A 3GFZA 1SQFA 1SPBP 1FXRA 3ITHB 1LW2B 3AA9A 2KSEA 3A4TA 1HBNB 1HWLA 2BQRA 2W90A 1G1JA 2VV5A 2E66A 4NXNJ 2BZ2A 2DNGA 2M88A 2W2NP 3GR1A 1ZAXA 3PVXA 4C9DA 1N7SC 4Q0BA 2M9KA 3MR5A 3P5TL 2JVRA 4OLOA 1ZYQA 2DO0A 3MUTP 1T9XA 4J37A 2QLWA 4DPWA 2NXEA 1S1VB 4CO0A 3AD9C 1HI0P 2QJKC 3VZIA 3V6DB 5AXLA 1NU1G 3M1VA 2QM7A 3AXKA 2MGZA 1SQBK 1S0OA 3BCCD 3M2UA 1G4CA 1UWBA 4C7NA 1L0NK 1FD8A 1YRTA 5IFMA 1WF1A 4ZPBA 1KHWA 1FJ7A 1R3NA 4DR1J 2OELA 1YLXA 2OTJS 3IGNA 2VJVA 1R5LA 2CA9A 2BYCA 1QUPA 3S1KA 1RSCA 4OV6A 3K5LA 5DDRC 3UVJA 1BHNA 3PYEA 4RW8A 3GG0A 1TL3B 2AJ4A 2ZH3A 2K3KA 2CQPA 3HT3A 5EFWB 4DV3J 3RR8A 3FSYA 2ZKTA 3GB0A 4P7VA 2XWXA 3J7A1 4PKDB 3C14A 1O51A 3DRYA 4C6AA 5THWA 2N9YB 1PPJE 2ZZTA 2WSCH 2CQBA 3OL7A 4H13C 4PUOB 4K5SA 1FFSB 1FDMA 2HQDA 1T02A 5KFXA 3OFGA 1EETB 4ALZA 5BR8F 2YBVA 1U0HA 1DTTA 1FT8A 1M90T 1SQBG 3GMGA 3K5NA 1JLFA 5IT4A 5AVSB 2WVFA 2AZ3A 5HATA 2J5AA 2HYIB 4BRYB 4M5MA 2EFVA 4OHYA 1RP5A 3CC4S 4P2FA 3TZXA 3L75E 3HSJA 4RW9B 3SV4A 3Q8RB 3F5HA 2FYNC 3BH6B 3HSZA 3HFVA 2NREA 5EHHA 2J8SA 4YUDA 4FYYB 3KWMA 2C2DA 2HFOA 5G0RB 4DFJA 2Q1KA 4ZLLA 1SXLA 2R44A 2ZDOA 4BDPA 2QRRA 3K59A 3G71S 2N1TD 3S01A 2BUNA 2IZ0A 3ZZRA 1GXLA 4DPUA 4MIWA 3PO5A 1HNZF 1SJQA 2H1YA 5M2UA 4DSIA 4NPDA 4KY3A 1LWEB 1ZM3A 2QLBB 1BCCJ 3MMCB 4GVLA 4FKXA 3OXLA 5LXYA 2N1TC 4RUCA 4F2SA 5BU8B 3T6BA 2CQIA 1JLQB 1REVB 3Q5PA 1BWEA 1ZR4A 1L4AA 3B71A 5D8HB 4C8OA 5T14A 2HIYA 1NYHA 1RT4A 2BJ7A 2WAQD 2E74B 3M2RA 3PRJA 1S9GA 3J7YI 2I1KA 3L74J 3O44A 3MEKA 2LXCB 5DQHA 5I3UA 2QJKB 3UD3P 2VU5A 3TAMA 3HHLC 2HSEB 3S7RA 1U09A 4CLUA 3OR1B 3QMQA 1HNIA 2XMUA 4O0NA 2LFVA 2MKHA 3QT7A 4ZVQB 3Q2YA 1M5HA 2YNYA 4E0DA 5HN0A 2OP5A 3I9V9 2OEMA 1RE3C 2VF3A 4QU7A 1JCDA 1HF9A 3QLHA 2QJPB 3MMBB 1EP4B 4KH1B 1JXVA 1B4SA 1SQVD 3R8YA 5BYSA 3TQEA 1SQPK 3WDOA 4ECXA 3KDNA 2WTYA 3CCMP 1IM4A 1EDKA 2XZWA 1RTDB 2FHJD 1D3WA 3T5LA 3PH0A 2YWEA 4YXWH 3AXMA 3UD5A 3UWTA 2VPZB 2HWTA 1DH3A 3P4UB 5CCGD 2N4CA 4HH2A 2JC0A 2HQFA 4IFVA 4GDOA 3DXBA 4RW4B 3VZHA 2ASJA 2VBYA 4PABA 4F0MA 3M32A 1OMIA 2GHVC 3M8SA 1JO5A 3RR7A 2Y0DA 3QIPB 4Q8EA 4C0HA 5AXKA 2OPPA 1KQKA 2GGPA 4RNHA 1H2VZ 1EB0A 3J81j 3S9OA 2JDIH 3H5SA 4FXWA 2ASDA 2V2VA 5D4LA 2QSIA 4J91A 1S1XB 3DDIA 3LF0A 5ADZA 1IJFB 4B3MF 1LT9A 4BWMA 2YNGB 1YYCA 1VQOP 2CJ9A 3CCTA 1GW4A 3AE9C 5KFYA 1P27B 5I3UB 5EUHA 3IR6B 3KUGA 2D41A 3DNCA 5HMYA 4X4QA 2E9TA 5IM0B 1KVKA 2O67A 5APVA 1JEKA 2XG8A 4DR2J 2MLYA 3A7OA 4DR5F 4QWEA 1SP4A 4C48A 3GIJA 4HHHA 2WB1D 1VQ5S 2YKQA 3RYLA 2AYMA 4KHXA 2UUBF 2VDHA 4DSJA 1GMJA 3RRGA 2PEHA 4PQUB 2D9PA 3CJ3A 3BS9A 3KLVA 3WMM0 5HSPA 2DHXA 4FP9A 4KHMA 1HQUB 5C2CA 4H4KA 3U1LA 3G4SP 3VAHA 1M1JC 1PPJG 4Q8FA 1GW3A 1FCAA 2NXJA 2YPZA 4YHHJ 2QEXS 2YXLA 5KFFA 4N76A 4J9VA 4FPIA 1KKHA 5D6GA 5EWGA 4TLRA 1VI7A 4NE9C 2LEAA 2V34A 4RLEA 3A0BH 1LOUA 2RT3A 3GZ7A 2HURA 4X4RA 1Y10A 3PRDA 1KN6A 2QLXA 4LR9A 2XO6A 1S12A 1V9OA 5KFEA 3L75D 1HHQA 1T3JA 3FC9A 3B54A 2I1JA 3BM7A 2WSFC 5KFRA 1RY3A 3FRYA 5KFNA 3AECC 1RF0A 5A8RB 5HO4A 1RAEB 1F5CA 1P6TA 1VQ7S 2VRSA 4MKBA 1PKUA 2O3DA 1N4LA 2RMZA 1RAIB 4NLVA 3Q24A 3RAXA 4IO1A 4F3QA 1CC8A 3ZDMA 1J1EB 3VAFA 4KO0B 3SFUA 2A6MA 3JYTB 3L3CA 1JB0J 1NK6A 4UOGA 3GWCA 1FFWB 1H7XA 4OHXA 3JYTA 2H5EA 4OYXA 3CLQA 2VH7A 1U7MA 4QOTA 2GMHA 1NKCA 2FJAB 1S48A 1KILA 3FMBA 3ZZZA 3GV5B 3BSNA 3KXDA 2GVDA 1D1UA 3CMES 1S72P 2H54B 4CH1A 4WB4A 1OWAA 1MU2A 3V4QA 1K1SA 4NPFX 2RS8A 1WT6A 1X4GA 2DRDA 2M3DA 3R27A 2HMIB 1CW5A 3L70G 1EAYC 4CLLA 5KG3A 4WPAA 4DEZA 2GNKA 3BDPA 2PD1A 1DTTB 2YXRB 3IBWA 1S99A 2R8JA 4Y2AA 3ZTSA 3MDFA 2NPSA 3EWKA 4XDDA 2B6AA 1NJWA 2KYXA 2E1AA 2QMXA 2WITA 1T9WA 3GIMA 3CDWA 4RNNA 4ZP9A 4OLPA 2KU7A 1BE3J 1VQYA 2V50A 3IO1A 2KXFA 4O44A 1MWYA 1TZ0A 4MFBA 2F8HA 4PR6A 1F2GA 3G4SS 1WG1A 2CAJA 1RWVB 1SV5A 4OX6A 2XS5A 3GYNA 1LWXA 1UFKA 2V8GA 5AVZB 2W2QP 1RTZA 1R27B 1RHMB 1KVJA 3CDEA 5K8PA 2LMIA 2GA1A 5LJ3Y 2MKCA 5A0YB 2DHHA 2X1BA 4H4MB 2O01H 1T9TA 5A0YA 2LYVA 2JH3A 2HBRB 3GFXA 1S1CX 3JTPA 2ZOFA 4HYKA 5L9XA 4OI2A 1BQXA 2JHEA 4GMKA 4UW2A 1HNVB 3PNIA 3RU0A 1S2EA 1X9WA 2KP8A 3UR0A 2CZVC 3B8EB 2V4RA 1NHKL 2QA4P 3OL8A 1T94A 2RE1A 3H1IJ 1FE6A 5C42B 2HFSA 5LL6d 1HIYA 3RAMA 2XY7A 3W7BA 1RABB 3NOCA 2VBXA 2ZEJA 2X3DA 4OFZA 5HJYA 5CZVA 4GVBA 1S3JA 1WKKA 1HTLC 2AHOB 1NKEA 3DLKA 1HVVA 4XPCA 2DD8S 3MMAA 3RG6A 2C2RA 3CL3D 2AEFA 1EZVD 2G2OA 2W9CB 2ROEA 3PY8A 4I56A 3RBZA 3TNUA 2DEIA 3GCXP 4XO0A 1G1XA 1BUXA 4FYDA 2OTJP 3AE3C 4LFCJ 3NKYA 2EKNA 2R8KA 1KS2A 1FXLA 2O01N 1M57D 4F67A 2CWKA 4LRCA 2YO2A 1XQIA 2M5AA 1N5TA 3AEFC 3KG0A 1OY6A 1NH7A 4JYAJ 1VK3A 1RGVA 4IG0A 3MM6A 3IM9A 1BGYE 2JLGA 4KH0B 1U26A 3MR7A 1F3VA 2AYGA 1JNRB 2AZ1A 2OLWA 3V5BA 1SJ3P 1TKZB 5ETVA 3E01B 4IQMA 1RZMA 3JSMA 4WIIA 2YH0A 1YQHA 3OL6A 4DWIA 1JJCB 2IVYA 5H9EK 1S1VA 2PP6A 1TELA 5GAEI 3PRVA 3Q0AA 4WJBA 2UV8A 4ES2A 1IBKF 1T05B 1F2HA 3EGNA 1M1KQ 1QGKB 1CJVB 1U8SA 1UIXA 4P9SA 4ZCKA 4DS5A 4RO0A 3WZ0A 3DU5A 2ZXEB 4M1KA 3S8SA 2DITA 1RAAB 4JV0A 4FVMA 4OZ3A 1EQ0A 2ZZNA 5HL7Q 1FA0A 2NS1B 5M2RA 2E5LJ 2OAUA 8AT1B 4YP3A 1X8DA 2KB2A 2ZVIA 1FRXA 2BX6A 4Z37A 4LSLB 1FZCA 3R5CA 3OV7A 2EVZA 3CCEP 3HP6A 3HTKA 4F3OA 2D7SA 1KC8T 4C8ZA 4Z7CA 2AGOA 4GOEA 5E79E 1DQ9A 2QRXA 2QC3A 4AQYJ 1NZ8A 3QGGA 4WF9Q 2E44A 4UZCA 4DBQA 1NO4A 4K0KF 2VIHA 2OYIB 3BKTA 3OL9A 3V6IA 3H1LD 3VVTA 2BEFA 3EJMA 1REGX 4Z1MH 4CH7A 1IQTA 5HQMA 1MU2B 2IBZE 3LW5H 5IS2A 3BCCG 2R7TA 3CXHE 2ZD1B 1U02A 3AE1C 1T2KD 3QAEA 1GL2C 3VQTA 5KG6A 1BQMB 2G1HA 2YWWA 2GIRA 2ZHOA 4DR2F 3D3BJ 1K8AQ 1Q1KA 3TAPA 2P10A 1QLNA 3QT8A 1W2IA 1QSSA 1XK8A 3MM8B 4WU3A 4ETZA 3KFWX 3LH2S 1JXLA 3V4IB 1V3SA 3D1OA 2HG5D 2E5IA 2PC6A 1KP6A 1NTKJ 5A8RA 2QJPC 4X66F 3KNAA 3TSIA 3E8OA 1SLQA 1FDNA 3W1YC 4AUKA 4ZKUA 1X79B 3H1JD 2W27A 4F2RA 1NGMB 3DYAA 4GIFA 1LTTC 3W64A 2H51B 3W63A 1RTJB 2VA3A 3CDBA 3S4RA 2DGTA 1CI6B 2JKVA 3ISZA 2HLTA 2HRUA 4L72B 2IMWP 4KGKA 3NCPA 5ETKA 1T11A 4DUTA 1LJ2A 2HNYA 3L70D 4C98A 1R8CA 2A06G 1V3ZA 3N5BA 1WOSA 1KOOA 3BR9A 1BGYD 5E3PA 3VHQA 3Q8SB 1YTZI 3FXEA 1FRJA 1K9MT 1RAFB 1LQ9A 5E2QA 2FJWA 1P84I 4TU9A 2A2DA 2YVSA 2FYUG 4UOFA 4IOIH 1LXNA 4LF9J 3M0AA 2M70A 3FZ2A 5KJ7D 4JI2F 1K0VA 1VRUB 4USMA 3PX4A 1RI7A 2G0JA 5HAOA 2MEWA 2J7KA 1Q8BA 4L75A 2DIUA 4W7ZA 1JK9B 3M05A 3MEEA 2UXDF 2AIRB 1EDIA 1MROA 2DR9A 4R5PB 1NO8A 1KN7A 3C16B 1D0EA 1CZQA 3K5MA 1TU0B 1CJTB 3TGUE 4D6TJ 1NJIQ 1UCNA 3HRNA 1NZAA 3CX5H 2V8HA 4X4VA 2MMYA 1I6JA 2ZE2A 5U47A 2FKWB 2ZE2B 2HNZA 4B08A 2HGNA 4IOCQ 3PZPA 3DRPA 1U1MA 4DX6A 2B8QA 2ITAA 2YNFA 4E98A 2RQCA 3AEGC 4LF6F 1VQPS 4NYZA 2UXBJ 4W4MA 2WSCC 4JI1F 4ZPDA 3BF4A 1RH5B 4DF8A 4KQZA 1YITS 2GZOA 4U7UK 1UFLA 5J1EA 4BCAA 4UB6H 1KQSO 4LGDE 1EX8A 1E6YB 3VAJA 3GF3A 4ECZA 3PW5A 1WC3A 3NNCA 2MGZB 3I96A 3NNAA 4QIWD 5F3TA 5KLVK 2Y3YA 4P2XA 5LSOA 1YTYA 1L3VA 2DIVA 1TAUA 4CLWA 4URQU 1B70B 2AP6A 4QW8A 4MK7A 2BOAA 4WP9A 3JSYA 3OJUA 2FVQA 1TKXB 5CAAA 2QE5A 4ZP8A 1X7VA 2OEKA 1OPZA 1TV6B 2QIFA 1C0UB 2UUAF 3N0VA 4IFYB 1EQMA 3Q5SA 3DGPA 1VQ7P 5B0EA 2KHCA 1Q81T 2DR8A 2G9OA 3DOLB 1XR5A 3H42A 1J1EC 1MFZA 1NTKE 3W2VB 3CD6S 4DG1B 3VQSA 3EFGA 4BS2A 3KDPB 2XBPA 3CXHI 4N78D 4JYCA 2MDAA 2NPIA 4K4UA 1JY3N 1K73T 1IO4A 2CJYB 4WY4D 4NLOA 1RU1A 4DR7J 4TU7A 4JI7F 1NJIT 1JLGB 1FVQA 4A8OA 1XTGB 3L75J 1WC4A 2QLJB 3D6ZA 5ETLA 1Q82Q 3POTA 5D0RA 4B3OA 2LQJA 4DSLA 4NLWA 3WC2A 1RA7A 5E3CA 1GK6A 4IL6X 2CDRB 2BJ3A 2Z4PA 5EX0A 3N4XA 1C1CA 4RZRA 5GAHI 1TUGB 3CJRA 1H73A 2BRKA 3HHLD 1VFJA 4FXDA 4Y2MA 3VAKA 1YQ4C 4H44B 3HVTA 5KT4A 1FRKA 1Y3JA 3HHLA 1NAFA 1NVOA 4I7ZB 2GQQA 4DQPA 1P84E 1Q8IA 5F8IA 1P84D 1LFWA 3PJ9A 2QA4S 4B3RJ 4H0LC 4OX9F 1HBNA 3TK1A 1MWZA 3AT1B 1LTBC 3DOMB 3QNWB 4DX7A 3OFHA 3M8WA 4B3SF 3FEYB 4G3IA 1FRIA 3ADAC 4ECTA 2JJ4D 5AW6B 4LIWA 2DR5A 4Q2LA 3C66A 4UOCA 2KI2A 4KT0C 2L48A 4EFAC 1YJ9S 4WFYA 1RT5B 2JNJA 1IKXA 2B5JA 1Y4ZB 2WCXA 2CQ2A 4M5HA 5GAGU 1OY8A 4PV1B 2OSRA 3ZZOA 2OMOA 1L5UA 1R8AA 3S6EA 3MUDC 2RNEA 2IBZG 3QWOC 2F8MA 1D9AA 1SCJB 1MROB 2Q1LA 2OFGX 3FX0A 3W61A 1Y3KA 1TP7A 4YXDC 2MZSA 4ZA1A 3P32A 2P6TA 3AE4C 2HHVA 4WFXA 1CVJA 1FVSA 3PR4A 2BEQD 1LK5A 5CQGA 3L95X 2DGOA 3QGIA 1X9SA 2WVDA 1VL2A 1EZZB 1HARA 4IR9A 2IA6A 4IG0B 3NGRA 2FFDA 2C3MA 1T3UA 4LFBF 1DTQA 2KOGA 1GU5A 3BBCA 3T5JA 2N7YA 3FSIA 4TVAB 1S5LH 5CYMB 1DTQB 1NEEA 4LFAJ 2O01J 1NTZE 1RXOB 4F36A 3KHRA 1HJ0A 3H1KE 4HH1A 1HJBA 4P73A 2XLKA 2OPPB 3FWNA 1RACB 1V3RA 1QTNB 2F4VJ 4IH7A 2VG5A 2VQEF 4ECWA 1NXIA 2IBZI 3N4WA 2GA7A 3IBCB 4OZ5A 1SC1B 4A8WA 3MR6A 5KKZB 2QT7A 5F8JA 3W60A 4JOUA 1SC4B 1KD1T 3FQLA 1J5OB 2ZJSE 4YOEA 1S1WB 2Y8YA 3CC7S 1M1JA 3HZEA 2Q6CA 3ZFVA 2D3O1 2E75D 4ZVUB 2LDIA 2F63A 2CPDA 3CT9A 2MSSA 2YKNA 4IFYA 1ULRA 2B4OA 1ZTWA 4JI2J 3M8PB 5DDPC 2AW0A 2B7CB 2BQ3A 2PEBA 3TUJC 3W3SA 3D5MA 4HACA 1IM6A 1BE3G 3I5CA 4AYCA 2CPEA 1HPZA 3X1LB 3WU2H 3NXZA 4Q45A 2DT9A 5HLFB 5KG2A 4EBDA 1JNMA 4Y28J 2EG1A 1SQVK 1R8EA 2XYPB 4USTA 1T9UA 2RDJA 2EK1A 2OTLP 4KHPJ 1UZDA 4FF4A 3DHWC 1W7WA 2MLXA 1BQMA 1DJ0A 1URQC 1S5LX 4NEYA 3OTCA 1U2CA 5EWEA 5D0HA 4PD4H 1WHWA 1U0HB 2KVQE 1IFDA 3CXHD 1L3TA 1M5VC 1PYSB 2F8EX 4EYIB 2LQ9A 1KILC 4NXMJ 4PV1C 1SKUB 5HP1B 4U8YA 1DY3A 3SWFA 2KM8C 2MLZA 1X60A 5A6WA 3EE3A 4DV4F 1N8RT 3C15B 4OYPA 1IBLF 2MQ8A 3CC2S 3SQGA 5K8NA 3O8WA 1D8YA 1U2RA 1SL1A 3MM9B 3MPDA 3H1HG 4RW7A 3GPAA 5L39A 4Q43A 2KFZA 1TL7A 1F1BB 2B4PA 4RW7B 1WACA 4N8NA 1UETA 3Q89A 1QVGR 4O4RA 2VA2A 3LTOA 5FDLB 1TV6A 3UCZP 2L08A 2RQMA 4J9UE 3GFHA 2E42A 2VG6B 1BLUA 3L74G 4P7TA 2XULA 2ZDPA 5HANA 4ZLJA 4ELTA 2E9RX 3QIPA 1JX4A 3MAAB 3PR5B 5APTA 1IWAA 1JLQA 2XSJA 2KI7B 1CC7A 1FX2A 3DXSX 1RT7A 3IBFB 2KVIA 1LTGC 2D3OR 4D6TE 3LWMA 2P8IA 1IKYA 1FERA 1NTZD 2XCPA 1LGHB 4Q7AA 4ID5B 4OZJA 4OJGA 3SXLA 3MM7A 4I4BA 3KK2B 1VQ9S 1NH8A 2IDEA 5HVGA 2B5JB 4TYBA 3CMQA 4TYAA 5C42A 2PRRA 5J2PA 1AFOA 4EDFA 3DDNA 5H1SV 5F8MA 3DRXA 1FHTA 3AAWB 4YB1P 2V8VA 4LF7J 5CCLA 1NSPA 2N7CA 2HBQB 3TJAA 4DHVA 4ZNCA 1QD1A 5AW9B 2PMHA 1SKRA 2W4PA 1VBKA 4ZLNA 1L0LJ 2LKMA 2NPFA 5AW8B 2MQMA 2B3TB 4DR6F 1BCCE 4I7ZC 3OSPA 1V6HA 1DLOA 1NPKA 2YWKA 1SL2A 2HHTA 3I4PA 1KYOI 2A18A 1DBDA 1WKLA 4A46A 3H0PA 1N0UA 3H2UB 4IDKA 4DQQA 2OPSB 3V2QA 4JF7A 2E5GA 3ZZ0A 4LF8F 2WK4A 2YNFB 1KEKA 2B9XA 1NJXA 2AJ0A 1HBUA 2P6SA 4WY4C 3MOJB 4R4LA 1I94F 2MSTA 4UQTA 1M7LA 1N6QB 4MIAA 2JVOA 4PYDA 4XA4A 2EPIA 3C8VA 1U1NA 3R5BA 2EKYA 1GK8A 5H2FE 1VF5D 3TAQA 3PV8A 2RVJA 1RBAA 4DV6J 3AH6A 5I3PA 4FN5A 4N47A 4UF4A 3PYGA 5HMWA 2MKSA 3L71J 4AL6A 2DNZA 3JQMA 3GCWP 1WEYA 2I38A 5DG7A 1X0FA 3DM2A 4L6V3 1NTZK 1PO6A 2YQ0A 1FKPB 5JMNA 1YX2A 4M3LA 1VQKP 2M5YA 1RTHB 4AUWA 1FU1A 3NGDA 2DNQA 4ZHRB 1KWMA 1N7SB 3BZQA 3MFIA 2HLUA 4JUZA 3C6UA 2E9ZA 1YJUA 3UIAA 4OZLA 2PIIA 2KK7A 4M5LA 3SCLE 1H74A 1OQ6A 3SYZA 2J0QD 4A48A 3ZZPA 1D09B 4F7VA 4UY85 3QQCD 2EBEA 1HPZB 1VQLS 3ILOA 1E6VA 1WC6A 3CC7P 2FIUA 3BR8A 2ERRA 1E6VB 2Z56B 3L4BC 1BWVA 5GMDA 1VQ4P 3KLGA 2BM1A 2IZ1A 3UO0A 2OD4A 3HKZD 3R7NB 1K47A 3MM5A 4EI2A 4X64F 2G1DA 3QAUA 2QFIA 1KILB 4M5DA 5LT5A 2A06E 2P2UA 3H1JJ 4KGXB 2P67A 2G2YA 4DV1J 1KQSR 1JLBB 2L9DA 1QVFR 2R3VA 3QWUA 3BN4A 4RW6A 4DCPB 1NKBA 3BO2A 3TP2A 3I0RB 2V9WA 4QPTA 4DR5J 3D3CJ 3F73A 1NB2A 4WY4A 1PIEA 4USVA 4KR0B 3G82B 1N32J 2H88C 2C2ZB 3ZZTA 2UUWA 1NNDA 4DV2J 2XY5A 1RA6A 3M9QA 5GTHH 3NFQA 2W01A 2ZUGA 2FGCA 2CNKB 2VHGA 4C3MA 3JXOA 2DNYA 1GNKA 1S1WA 4FF3A 2KS1B 2ZWPA 1I94J 3S1TA 1FFGB 3BYPA 5AE3A 2ATLA 4GKJF 2W2OP 3IXQA 5KAIH 3PJXA 1MZ9A 3R2PA 1H7WA 1CSBA 2I5JB 2CIMA 4Y3CA 1H8AA 1DHMA 6FDRA 5KTBA 2WBMA 3CNQP 1WWHA 3KLFA 1C0UA 4HHUA 3CO0P 4GC6A 3IGVA 4YB6A 4KHPF 5F3ZA 4W7YA 2EFQA 1CLFA 4M8LA 1WOOA 3L74E 2IAJB 1KV4A 5HQLA 1WEXA 4UZBA 4DI6A 1N34F 3GG1A 5LOQA 4IOBA 4OI0A 4Y00A 3WX4A 2GQ2A 3AJ1A 2M4MA 4HYTB 1P9YA 5KT5A 2D1CA 2KNCB 3H90A 5HROB 1YHQS 2UVVA 3D70A 2K3IA 2HR3A 4OX8A 1I51B 1FWLA 4O4GA 3KLGB 3HI9A 3D0HE 5IT0A 1HH0A 1WSVA 3FBCA 3HHDA 5FD1A 3II6A 3GONA 1RT3B 1MKMA 5AW0B 3G8TA 3E1RA 1NH4A 4L73A 4HKZH 2GO9A 1QSYA 4CQ1A 4GVBB 2XZDB 1ZR2A 1NPRA 4PAAA 3A12A 2R5BA 1SH2A 4PJ0E 2HHPA 1T95A 4KJMA 1Q53A 3EX7B 2IY5B 2HVDA 4EZ6A 3KJFB 2EC0A 3ENVA 3NLCA 4OJ3A 3TQ1A 1RHRB 3HF5A 2CPYA 2XMWA 1JKHB 2V63A 4DQSA 4RNOA 1DX7A 2QIWA 1WMKA 4X66J 3TNUB 4H44C 3I0SA 4I1TA 2BJ1A 2DNPA 1LWUC 3RUBL 3GP9A 1GAOA 2DPIA 3LGMA 3D2WA 1SQPE 4PG5A 3ILLA 1LW2A 3PP5A 4OIXA 2CNOB 3DOKA 1FI4A 1T0TV 2IA0A 3J7Z5 2CDQA 2N9BA 3K7RA 5DZ7A 1IKWA 5TISE 1QE1B 1YJRA 4WTYA 1YWXA 2M3EA 1SUQB 4ZVOB 2R7RA 2VDIA 1LNQA 4H13D 5KLVG 1R31A 4R25A 4LF4J 1MUUA 3KMQA 2WVEA 1P8GA 2LA6A 1Q0NA 2G3AA 4CRJA 5KG5A 4WFZA 2ZVNB 1FKAF 3PLNA 1H6KX 2XNQA 1OQ3A 1RE3A 2E29A 3PXGa 2FLLA 4QIEA 1LWUB 5KAFH 1GMWA 5D4NA 3VGSA 3K8WA 2QMWA 2H7HA 2Y1LB 1UZHA 4J9PA 1X4DA 4PYAA 1RF1A 1X4BA 1USDA 1I5OB 1N88A 2AEMA 3UVJB 1Y9BA 3I82A 3RL0B 1MV8A 5CYQA 3KYLA 4B9UA 2CPZA 2CFXA 1H38A 2KG1A 2JR8A 2ZBRA 1VQNP 5AVVB 2BKNA 2W9CA 3MEEB 1S9FA 1M5PC 3Q1MA 3QJLA 2ZNZA 4UB8H 3EGVA 3H1HJ 3H1LE 2R7VA 3Q2TC 2ATCB 3B82A 2D2CB 4O3RA 4WZQA 2BEZF 2JWNA 1BE3D 4DL4A 3OSNA 1N6QA 2LEBA 3CMEP 2RKIB 1BSNA 2M8HA 2L5GB 2V0NA 4C8LA 1GXUA 2FHOB 3ONQA 4DJBA 4B9LA 3NL0A 5E3AA 4ASWA 3KLEA 1N2DC 3PKMA 3FBBA 4AFFA 2VD3A 3HE5B 1GL2A 2V7QJ 1CULA 1S9EA 1CQNA 1OPIA 3BV8A 2OARA 3ISNC 4IUFA 4ED5A 3QJJA 3PCOB 5KKZC 4IL6E 2UXCJ 2P9CA 3B5NA 4MKYA 5E0OA 1IXKA 1NU1E 1W25A 4ILLA 4DSEA 1UW4A 1SQQD 4QQBA 4ZPWR 3TA1A 4M5JA 1JTHB 1BDDA 4LRFA 3CULA 3MM9A 1SV5B 4LFBJ 1JY3O 1M1KT 1Z1ZA 3V4IA 1BC6A 3MAHA 2GCFA 5AXNA 2R7OA 2DRBA 1ZZFA 1J1DC 4PZVA 1KD1Q 1HWUA 2EBGA 2RAQA 1HBMB 1IKYB 4WWSA 3AODA 3GV8B 4F4AA 3QYYA 3QRRA 4J9LA 2HHHF 2QSFA 2OYIC 1KVIA 3CCQS 3W62A 1NHLA 4BXLA 1UMJA 3TANA 2BVZA 3W2WB 3ZNUA 1YVFA 4B02A 3SSSA 3VGUA 3H5UA 1UP1A 2K1AA 2MZ1A 2KFYA 2F9JA 3H7HB 4KKOB 2LLZA 2M7SA 5F0WA 1X4CA 3M1VB 4HR2A 2IC3B 4FZVA 2L91A 2J58A 4HT7A 3R3TA 3M4XA 4EIJA 4GKGA 2ZH9A 2N3OA 3NEKA 4NYPA 3D66A 3T19A 3K5PA 5DM7Q 1UEVA 3UE2A 1MG7A 2C3UA 1FTRA 2O1KA 3NMDA 1ZPVA 4GT1A 1FESA 3LGHA 1BDCA 4NXNF 2UXCF 2AEJA 2GUVA 2A10A 2J9DA 4ZVTB 2W8ZA 4FVCA 2UVRA 2CRLA 2CQCA 5BYRA 4RWXA 4OQJA 6FD1A 3L4FA 1H98A 4ETXA 1GH8A 4DS4A 1NK7A 1OYDA 1FZAA 1XEZA 2I5JA 1SFCB 5DLFA