1KQFB

Formate dehydrogenase n from e. coli
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
289
structure length
289
Chain Sequence
AMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPADLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELAEQRVAKLKARGYEHAGVYNPEGVGGTHVMYVLHHADQPELYHGLPKDPKIDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIGPNKEVDDDEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
publication title Molecular basis of proton motive force generation: structure of formate dehydrogenase-N.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 87
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2002-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF09163 Form-deh_trans Formate dehydrogenase N, transmembrane
B PF12838 Fer4_7 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.480 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1kqfB03
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqfB01
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqfB02
1SJ1A 1FF2A 1GT8A 1RGVA 1AXQA 2C3OA 1G3OA 1FXDA 1BWEA 1K0TA 1DURA 2FJAB 1CLFA 4XK8C 1F5CA 3MM7A 1Q16B 2XSJB 1FRMA 2V2KA 3EUNA 1KEKA 1FRHA 5BYQA 1KQFB 2VPYB 3HKZD 1FD2A 1R27B 5L8RC 3EXYA 3LW5C 3MM6B 2V4JA 4KT0C 3MMBB 2WB1D 1JNZB 2FDNA 7FD1A 1IR0A 1F5BA 2VPZB 3MMCB 3OR2B 1B0PA 1H0HB 4Y28C 1FERA 1B0VA 2GMHA 2WSFC 1FRXA 1Y5NB 2FJBB 1FRKA 4RKUC 6FD1A 1GTEA 1PC5A 3OR1A 2O01C 4XDDA 2Z8QA 1C4AA 2ZVSA 3MM5B 4XDCA 5E7OB 1H7XA 3IR6B 3MM9B 1KQGB 4ID8A 2FJEB 3MMAA 1H98A 1DAXA 3MM8B 3GYXB 1C4CA 4AYBD 3MM6A 2IVFB 1SIZA 2Y0SD 2WSEC 3MMCA 1B0TA 1XERA 3MM7B 7FDRA 2FGOA 2C3PA 2GMJA 5BYSA 2PMZD 1BD6A 1FRLA 1A6LA 3IR5B 3PNIA 3EGWB 1G6BA 1Y5LB 2C42A 2XSJA 4CI0B 1DFDA 1VJWA 2V4JB 1FTCA 1HFEL 4OV1A 1FDAA 1JB0C 1SIWB 3MM8A 1H7WA 1GAOA 1FDBA 2C3YA 3IR7B 1PC4A 3MMBA 1FXRA 4DHVA 3C8YA 1JNRB 2PDAA 2WAQD 2C3UA 1FDDA 4OMFG 3OR2A 3OR1B 2FJDB 1Y4ZB 4L6V3 1WTFA 6FDRA 5BYRA 2VKRA 1F2GA 1FRJA 5CH7B 2UZAA 1D3WA 2C3MA 1Y5IB 3MMAB 5CHCB 2PA8D 1IQZA 1BQXA 4YDDB 1FEHA 1FRIA 1GTHA 2VPXB 3MM5A 1BC6A 2VPWB 3MM9A 1FDNA 1BLUA 1FCAA 5FD1A 2FD2A 2WSCC 1ROFA
chains in the Genus database with same CATH superfamily
4RX6A 4MIBA 3MXHP 1FE4A 1S0NA 1S79A 1DH3A 1DIPA 2NZCA 2J0XA 1QM9A 3NLCA 4R0EA 4CLSA 1T05B 2KS1B 4LF7J 3H1IE 1L0LG 3SQOP 4R5PA 2YKMB 1S0OA 3HCXA 1WI6A 1XMQF 3OTBA 1IWAA 4YMEA 3HUSC 3DMJA 4RKUC 1ZAVA 4C3LA 2B7BB 3R27A 4M5GA 1IKXA 4RPFA 4TY9A 4QYRA 4PABA 1H2VZ 5DJUB 1KILA 3QJPA 1WC6A 2YWFA 2W01A 1YI2P 4WY4D 3DXSX 2UUAF 1HARA 2Z0GA 2E5GA 5CHXA 1NXIA 3AE4C 1ZS6A 4JF7A 3MPVA 3UD5A 1FDAA 4K50A 4X84A 3OLAA 3ILJA 3CCQS 3MFHA 4NCGA 1A0OB 3AXKA 1Y11A 2AJ0A 3THPA 2DO4A 1JLBA 1O0PA 3M30A 5MLCV 1YBTA 3FBEA 2CK3H 4IFYA 3W5YA 3QZ7A 4EUVA 2NQPA 4DFJA 4DR1F 3NRBA 3NTNA 3G71S 1PZQA 5KLIB 2DHGA 2IFXA 4JI8J 1SC6A 2OSRA 4MIAA 3BSOA 3BCCG 5F9NA 2EG1A 5HJYA 3KOAA 1AT1B 2DGOA 5GTHE 5IZHA 2CJAA 2BCCE 5CYJA 3KTQA 4X65F 1GMJA 1URRA 1BGYD 3ENQA 1H0HB 3E1IA 1FWPA 4C8NA 2KOGA 4YXDC 2OYIA 1XIQA 4K4VA 1WRGA 5KKZC 1RF0C 1KQGB 1R43A 1VL2A 4ILLA 5DDRC 1FX4A 3UW1A 3O3LA 1LFPA 1T03B 4QW9A 1CQNA 2BRLA 3II6A 3DLKA 4E2FB 4A8WA 2V4QA 1KD1T 3H1LJ 2ZH1A 2ALZA 1X4BA 1FZGA 1E6VA 2Q6QA 1HNVA 4DUZJ 1YJWS 3GJTB 4DLEA 2XZTB 3RL0C 1KV4A 3OR1B 3W67A 2WVCA 3K8WA 3IP0A 2J76E 4ZP8A 3UDCA 4CLYA 2K9JA 4GT1A 3H8YA 3D3BJ 2DR9A 1IK7A 1JLAB 1S1UA 2EBEA 3B5NB 3AE5C 2HVZA 5IWAF 8ATCB 2BJ1A 1CS4B 1NTKD 2RKLA 3J7AN 2XSJB 7AT1B 1NU1G 1S9EA 3CWBG 1SQFA 1YJNS 2HWHA 2N9YB 3S9OA 3KLVA 3EVMA 1EC5A 3GHGC 1BXNA 3QYYA 3MUTP 3OJSA 3V2RA 2CPEA 4AXJA 2QTWA 3H98A 4TLFA 4GKKJ 3KYQA 2ZITA 2OYHC 2CPXA 4JBCA 3U02A 3E7KA 2O01C 4HHHA 1VC5A 3CX5E 2MSSA 1BUXA 3H1HE 3OT9A 1T11A 2R8HA 3MM6A 3MD1A 1KOHA 2EFVA 4BCAA 1LT1A 2DGXA 1MMDA 1PJ7A 2FYNC 1IUJA 1OW6A 2XHWA 4ZPTR 4OLPA 4RNFA 4CH1A 3W61A 1PGZA 1RU1A 5HLFA 1TL3B 4OYIA 5F8JA 3CD7A 2C3UA 2BJ7A 4WFXA 1RWWB 4S0MA 2DXFA 3GG2A 2ZT9B 2JLEA 2CYYA 3CUNA 1U1KA 2COLA 1SI9A 3M8WA 2W6JH 1M1JB 3K5MA 3SIPB 1S1VB 2Q7CA 2JFDA 2VU5A 5ETPA 2ZUGA 2D41A 3ZZRA 3EUNA 2K88A 2FQQB 4DEZA 2B5JA 2H5EA 2HMIA 2KHCA 3CE8A 2LU2A 2YWKA 1Q86Q 5HMXA 4F0MA 1CJKA 4TT3H 5EDWA 2KL8A 3GJRB 2E5LF 4RU2A 4N56A 2H88C 3HKWA 5LMUF 1IC2A 1U0HB 1MZ9A 2YX7A 2F7VA 3TAPA 5E3CA 3T1AA 2DR8A 1EKSA 4CLWA 1P1TA 5FLXU 1YQHA 2HK3A 2B6AA 2CJBA 3RRHA 5B0CA 1Y00A 1NGMB 1L0LD 3D1HA 5J2NA 1WF2A 2OTLS 3QT6A 3OTOF 1NMEB 1IBLJ 1ZPWX 1CJVA 4H4OB 5B08A 1A02F 1S5LX 3GU0A 4A8YA 3H0PA 2A2CA 3JAMU 3BO2A 3VAJA 1GAOA 1LP1A 2FTRA 2IM0A 1PC4A 4ECWA 1HIYA 3TVYA 4ANDA 3FMBA 3GTYX 5ETLA 3UR0A 1M90T 1SQVK 4LF7F 3PG9A 4BWJA 1AQ5A 2GHPA 4W7ZA 4NLQA 3V6DB 2NPSB 1R5SA 2KM8B 1QVFR 5EHHA 3PACA 4LVOP 4Y6IA 2W7OA 1ZOTA 3D6FB 3CCJS 4OH8B 3PZPA 2RSQA 2OP5A 3R7BB 2VBZA 4MFBB 4ECTA 2V68A 1L2PA 1ELOA 1HHTP 4ZPCA 3DGPB 4ECZA 1M90Q 2HEKA 3B78A 4DSLA 3VTIA 3BZQA 1RT1A 4PXBA 3IBFB 2IDBA 2KYVA 1TUGB 2J6SA 2JDIH 3K7RA 4OZ1A 1H38A 2GAGC 1VF5D 3KJNB 3AD8C 4QIVA 3C2PA 1LTAC 1OVUA 2XI2A 3J81Y 3JYTA 1MU2A 1P6TA 5TISE 3ELHA 3BCCD 2D3ZA 3B4MA 1J1DC 5M2PA 1TV6A 2QA2A 4GIFA 5F9LA 3TJAA 4N78E 4B9MA 5AVTB 3F44A 2J0WA 2ALYB 2BRKA 2QFJA 3KWMA 4FNIA 4FN5A 3P5BP 3NEKA 4JI8F 4IRCA 2WW4A 1U8SA 1FDDA 2GV1A 5H9FK 3J80Y 1FZCA 1IKXB 1LWCA 2AKWB 6FDRA 2FXPA 3B6BA 3CL3D 1K9MQ 1DQ9A 2NZ2A 5AVVB 1BE3J 5L46A 1KILB 2RF2A 1UWBB 2DD8S 1VISA 1SQPG 1GQEA 4Q0BA 1YITP 2CQ3A 2WHOA 2VQFJ 2WVFA 1X8YA 3QT7A 3KXDA 1MSWD 1AXQA 3BGOP 1KB9H 4L3NA 4QIEA 2U2FA 4LLHA 2JEIA 5LT5A 2VOPA 4TQSA 3W2VB 3M0DC 5K8MA 2P10A 4EU0A 5HK4A 5CMZA 4F50A 4K35A 1NKCA 2HFED 4QWDA 1PP9E 2CPIA 2AXTE 1RQVA 1ZMEC 2PMWA 3VN0A 1MWZA 4FNHA 3M30B 3CJTA 4G1QA 1NTZJ 3H7HB 1NBEB 4IFYB 2HFNA 3Q5RA 2W9BA 4DJGA 4DUZF 4EBEA 2ZE2B 2V0NA 2DK2A 1OSCA 1Q8LA 3T5KA 3CCLS 2E44A 1NB2A 4RUHA 4DV3J 3CWBD 1RAFB 1NKBA 2VL1A 1FAVA 2P2CB 4R4MA 2PO4A 1VLYA 2D3UA 4KV8B 2GJ2A 2V9KA 1K8AQ 3S01A 4K3AA 2HFVA 3M6VA 3D3CJ 2XCAA 4R25A 2AWZA 3OTDA 4C3MA 1X0TA 2AD9A 2D3O1 4FF3A 2KRBA 1G2CB 4YUDA 1RDRA 4ED3A 5A6PA 2E9RX 3G82A 4Q43A 1GL2A 1NZ8A 2HIYA 4GKKF 5K14A 4Q5VA 4CO4A 4QU6A 1FXDA 1S1WB 2B43A 3D1OA 2BBEA 2KK7A 4H44C 3RU0A 1WKJA 1FKOA 1C0UA 2IM1A 3FX0A 1WSVA 4IG0B 2HWTA 2V4JA 1V5VA 2WB1D 1VQOS 3I0SA 2I9SA 3C19A 1N4LA 1Y9BA 3KHLA 2L91A 4HDGA 5A0YA 5J2MB 1GTEA 2ZOMA 2CPBA 4GOFA 2JKVA 3AODA 2RS8A 2RILA 1UETA 2K9JB 2OEKA 1AA1B 1NKEA 2DKOB 2LR2A 4NEYA 2EK1A 2F8HA 1SC3B 4Q8EA 4RESB 3AA9A 4NLVA 2BE2B 3EM1A 1SKWA 3I96A 2OD4A 3L37A 1EDIA 2HLTA 2DR7A 1DLOA 2AJ4A 2ZVNB 3DRXA 3OBIA 3P96A 4GRSA 4U7UD 3GFYA 1NHUA 4OGQB 2YO3A 2BEQD 1UWAA 5AW1B 2G0CA 4NLDA 2R44A 3Q2YA 4XIUA 2OPRA 1PKUA 2WOMA 2XY6A 2OTKE 4V19J 1N2DC 3A1YG 3WX8A 3HVAA 3J81j 2RU3A 5AJ3J 4C2MA 3RL0D 1NK4A 4NRUA 3BGRA 1DARA 5CYMA 2HYNA 1HWUA 3O6QB 1RSCA 4LF2A 1SP4A 2M3DA 4NRTA 3UN5A 2EFGA 3UFCX 1M57D 4TLQA 1C1BA 3L72G 1FDOA 1EZVE 2N3LA 3RG6A 1CJTA 1Q4RA 3G4SP 1IBLF 2BCCJ 3LP2A 1AVYA 3CJQA 2YTCA 5A2QY 1VRTA 4Q2MA 2YNIB 1ZM2A 3B4DA 3NY0A 4LFAJ 2RRAA 3KKFA 1U45A 3BSNA 2QA4P 1T95A 2Q9IA 3A8JA 4KB7A 3L75E 4I2PA 2A2DA 4HR2A 5HP1A 1QVGR 1KB9I 3VMYA 1CJKB 4UOGA 5KFWA 4DPOA 1PGQA 2V8PA 4PYAA 2E1RA 2FJDB 1WNEA 1EHWA 3GW6A 2ZHBA 1KRPA 2RVJA 3OVAA 4TXSA 4DX7A 2YXQB 4XE5B 5E33A 2GGPB 2WSCC 1EQMA 5J2NB 1Q0NA 1NB7A 4N41A 4WFAQ 2J5UA 2QJ3A 1WEZA 2BJDA 2HFUA 1WOPA 3C15A 4ZHRA 1CJVB 1KEKA 1FJGJ 1ZM3A 3AE8C 2BEZF 4JI0J 1NM2A 3VQTA 2NSBA 1Q5YA 4I7FA 4ZVQB 5D0HA 1XMBA 3OJAB 1LW0A 1NJIQ 4U3FJ 3Q8SB 5B0BA 3RW7A 4ZMMA 5KFMA 4M5DA 2VG7A 1V3SA 3SMZA 3T6BA 2YWGA 2QZ8A 2QLJB 1YK9A 5I4MA 3DXBA 5ITHA 2BJ8A 2UUCJ 4PD4D 2JWDA 4CO0A 3G6EP 2B51A 4EDFA 2ZXEB 1FJ7A 2CJXB 3K57A 1PPJE 1KYOD 3H1HJ 4J9NA 1QSYA 3GR1A 2R7WA 2VQFF 1RT1B 1HJBA 1TKTA 4JI5J 4O4RA 2FXOA 3CJ4A 1NDKA 3GPAA 3GIJA 3GYGA 2AEMA 3P8BB 1FS0E 1JLGA 2IPOB 2D69A 2HRUA 1F2GA 2GIQA 1BCCG 4NLPA 1DD4A 3R97A 1Q5VA 3JYTB 1TKDA 1MU2B 1FE6A 2QV6A 5KG0A 4IL6E 5CCGC 1GH8A 4QR2A 3CD5A 2KDOA 5GTIE 2R3SA 3V6IA 4WBFA 2HFZA 2ZT9C 1VHFA 4LR9A 2FJWA 1OS5A 2WSSH 3UDLA 1JLEB 1RA7A 4NLYA 2VC1A 2HW3A 3IO1A 3R5DA 4H13C 3HHLD 4DV3F 5IT9U 1FZCB 2RF2B 2A6MA 3QRRA 4Q0BB 3RBDA 5DLFA 2G3AA 2P67A 1KVIA 4B9LA 1DEEG 1G2EA 1RABB 5KFDA 2BYCA 3M8QA 2CQDA 3L7OA 1NDLA 2GZOA 1LFWA 3BRVB 4GKJJ 2R3CA 2FB0A 2W27A 3SFEC 1BMQB 1PIEA 2K8GA 1HR0J 1HFEL 2VG6B 3AFGA 3BBBA 3RUBL 2KI7B 3RAMA 4UT4A 4IH6A 2LECA 4CCHA 1HUCA 1HHSA 4V19X 1T3JA 4LREA 1L4AB 1QLED 5HMYA 1LK7A 4TVAB 2HNZA 2AYBA 1SH3A 3BSCA 3CCUS 3EQ2A 3VZIA 3DGVA 2D3OR 2HFSA 3T9NA 3TP2A 3MURP 3HT0A 4ASVA 1F5CA 1P1LA 2NPSC 2KM8C 1RT5B 5G0RA 1FRMA 5IXUA 2YH1A 3MEDB 3CMQA 4C46A 1FE0A 1RK8A 2Q3EA 4TU9A 2Z2MA 2Z56B 3FMWA 2XS5A 4N8OA 3FWNA 4ITSA 5KLVG 1IBMJ 1L3TA 1U1LA 2ASDA 2YO2A 2J5AA 2NR0A 3HM9A 1ZTWA 2GAHC 5CXTA 1RE4C 3O44A 3G82B 1GL2B 2Q3IA 4PRFA 5K14B 1OFCX 5HQMA 4PCQA 2X7IA 3MPWA 1SQBK 3B82A 3D0GE 4CLUA 2BANA 2K3KA 4CYUA 4M5JA 1XJWB 1C0UB 1R8AA 3W65A 3SFGA 3OXGA 3L72D 5AJ3F 2V4JB 2DHXA 3I0SB 4HACA 4K4XA 2C2OB 3H32A 2AZ3A 2JLFA 2DH7A 5A0YB 1JO5A 1N5VA 2WTYA 1VQ5P 1JUNA 3MFIA 1T0TV 5IC4B 1L0NE 4UUXA 4A47A 2E74B 3CDUA 1DTTB 2CPJA 2VPXB 3D54A 2JR8A 1W25A 1RI7A 4HYKA 2CPDA 1WG1A 1H0TA 2Q6BA 4PWDA 2QYGA 3D67A 2ROGA 4UZCA 4DPUA 3MUDA 1KILC 1SQQK 1BQMA 1DLOB 4WP8A 3PM9A 2WVBA 3HKZD 1IFMA 1NH8A 3G9RA 2F8MA 1HF9A 1BSNA 1TAQA 4LFAF 5KFZA 3I6PA 3HD7C 3BB5A 3SXLA 3PX4A 2WOMB 4ZVUB 2A06G 4WPAA 4TYAA 4H44D 2DR5A 1PC5A 4CH7A 3CXHD 4C7RA 1Q95G 1EQ7A 3LQVA 1S12A 4AT1B 4WY4A 1S5ZA 4X4RA 1CC8A 2H9ZA 1RHRB 1T3NA 4BWNA 4FP9A 5K8OA 2O1JA 2XZDB 5CYMB 3D7SB 1UAWA 4KKOA 3N79A 5I3UB 2IM2A 2E5YA 4ZN3A 3NGUA 4ECYA 1Y3KA 2BR0A 4CLPA 1U6FA 1N48A 3GLJA 3GF3A 4LJMA 2EKNA 1SLQA 3A0HH 1ZR2A 2GCFA 1JXVA 5DGAA 1C1BB 4O3PA 3IR7B 1M0SA 4JYCA 1CJTB 1WKLA 3LP2B 5CYQB 1FJGF 3A0BE 1BGYJ 3RK3E 3JSBA 5CBNA 3ZZ0A 2MKHA 1GMUA 1NAQA 1VRTB 5DGBA 1RTIA 3E01A 3JCUH 3S1TA 3EZ5A 4TY8A 2OELA 4N3YB 2WW8A 4DV7J 4GO5X 3ZTOA 4I2PB 3SFUA 1K04A 4BC7A 2A6OA 3R5CA 1F5AA 2L41A 5ETTA 3TAMB 2N1TB 1KQSO 2UUCF 3Q23A 2AJFE 1HD0A 3OXFA 2ZH4A 1XK8A 4QCLA 1BCCD 1LWUB 1YJRA 2FZGB 2N82B 3PP5A 4FVCA 2JJLA 2DPJA 4DV2J 3DLEA 5HN0A 4NYZA 5E79H 4XDDA 2KT3A 4NL5A 1VQLP 2IBZG 4JI5F 2FJVA 3MP7B 1HNIA 1ULRA 4LC1A 4B02A 3CO9A 4YS2A 1RT4A 2QA4G 4QU7A 4ZJOA 1EETB 2K1RA 4KHXA 3C15B 1SC1B 2DXEA 5KFFA 1HQUB 3HI9A 4I7FB 2P9EA 2H43A 3F73A 2VBYA 3BF4A 1LW0B 2RRBA 3DKDA 5DM7Q 4NX9A 4Q44A 1GFWB 2VG7B 2Y0EA 1BDCA 1T9TA 2YKQA 4F0HA 2MYFA 5EWGA 2ZHAA 2ZDOA 4OGQC 5FDLA 2XHCA 5APYA 3L70E 3MR2A 2OARA 4M5MA 2M3BA 2VJUA 1KTQA 2BE9B 3LO3A 2ZH8A 2ZEJA 3MEEA 4MK9A 1SJ4P 3L9ZA 1Q16B 2B9XA 1C2PA 2IZ1A 2O3JA 2YMKA 2D1CA 2BZ2A 4UB6H 3PR5B 1DQ8A 2C2ZB 3R6LB 3JXOA 4ECSA 4K5SA 2I5JA 2J7UA 3KLIA 4ZKPA 2Q5UA 3MCOA 2LKZA 1FRKA 1KFMA 4GKJF 5ADZA 3Q3DA 3LUYA 3NAIA 2YWHA 1FKAF 1HR0F 3R4YA 1R0AB 1S72S 4Y65A 3S4RA 3VVUA 3M9MB 1U1NA 3RBZA 3L09A 2FLOA 1T7PA 5APXA 5C5JA 2W2MP 4I6MC 2IBOA 3Q0AA 5FIIA 4C8MA 2XQCA 2CZ4A 3M8SA 5KLVD 2E7VA 1HD1A 5KOXA 5B5EE 1U7MA 4L3KA 5C7PA 3ZTQA 1O8BA 1PBAA 3L75J 1RE3A 4WVZA 2XYGB 1JB0J 2P1JA 5J1NA 2WMMA 4JYAJ 3A12A 3VGUA 5CH7B 1D3WA 1JCDA 3TOQA 2KYZA 3JSVC 5LSOA 3LH2S 3Q1MA 3CI9A 2ZOGA 3UIAA 4NYOA 5BU5A 4JI6F 2HWIA 4TN2A 4NCBA 2XZRA 1IBMF 2VASA 1WUUA 3M8QB 3BBCA 4XK8C 3C66A 3Q89A 2M0BA 5JMNA 5CCGD 1Y9OA 3HVWA 3M91A 4YB7A 3U1CA 4RUAA 2YBVA 5T14A 3IBCB 3E2EA 2P9CA 2ZT9D 1AB8A 3H1LG 5A8KA 4ECQA 1JEKA 3OL8A 5HAOA 2PC6A 1S7HA 3DHXA 1HPZB 2HNZB 3TNUA 2RS2A 3PCOB 1OQ3A 4AYBD 4H13D 2Y1LB 2XGQA 2KSEA 2MKVA 5K9FA 2EWHA 3GMGA 2EBGA 3HTKA 2HRTA 1VQKP 2MZQA 2ZZTA 2FBWC 4NI2A 4WZMA 2KNCA 3HJFA 1Y5LB 2PEHA 4ZCIA 2HBQB 2A06D 2ZVIA 4LR7A 1SKRA 1S6OA 2QE7H 1IKYA 3FDSA 4J9PA 1J2VA 2X51A 3G6VA 4YB5A 3OFHA 3GV5B 2WAQD 1ZRTE 1HWJA 1ZV8A 2PA3A 2MMYA 3OD2A 1VIXA 4LUBA 3Q5SA 2CNKB 2HAFA 4CO3A 4P52A 2ZH5A 2B9EA 1PG5B 3KMSA 1N6QA 4BRYA 3WC2A 2BANB 4PQAA 3Q22A 4X4VA 1GXTA 4CYUB 2IRUA 2BW7A 3WZ0A 4K7QA 4UY8T 3IGVA 2WONB 1OSDA 4KAIA 2QM7A 5GTHH 4KPYA 2WTFA 2L9WA 3NGSA 3M1VB 8AT1B 3OUYB 2W4DA 2OEJA 2V4RA 4LR8A 4FF2A 1UFWA 4USKA 2NPSD 2ZH7A 1NYHA 2NSCA 3ZTSA 4JI4J 2ZVSA 4LMZA 3BYPA 2IHR1 1FBMA 2ZC3A 4F26A 4IOCQ 3W9JA 1FZCC 1GK8A 1B7FA 1N7SB 4Z7CA 1H0TB 3AEDC 4RJTA 4PWDB 3QWOC 1BQNA 2OFHX 4Y2KA 2FGOA 2NXEA 4ER8A 5F3ZA 2CUYA 4YXWH 2J8AA 1E5WA 4OYAA 2H3EB 2JWAA 4ZJLA 2LQ8A 1TVRA 3W62A 1E6YA 1WEYA 3AECC 2G2ZA 3IAM9 1QJHA 5T41A 2W7AA 3I55S 2EI5A 4HYTB 3CMES 2WBMA 4OMFG 2IBZD 2NUUG 2RDJA 1RTHB 1ZZNA 1T3OA 4WY4B 4DR4J 3UVJA 1ZXGA 3HFZB 1FCAA 1H2UX 4RZRA 4P6QA 5J1EB 1L4AC 1ZN5A 2M2BA 4DV2F 3GIKA 3KYLA 4JI7J 1YTZI 1G7CB 3HPOA 2F9DA 1AFIA 4NA3A 2WB4A 3L74J 4KHPJ 2K1AA 4I69A 1TMMA 3D66A 1C0TA 1Q53A 2VFTA 4AYCA 1T2KC 2BE7D 4URSA 3TW0A 1SB6A 4LRDA 2NXNA 3CLQA 5JJBA 2HHUA 2ZBRA 3HUSA 3MR3A 2F9JA 4O3OA 3RR7A 4ED7A 3A13A 2L48A 2P8IA 3CX5H 3HD7D 3FWLA 1NKNA 4KGXB 3VAIA 4YN3B 4DLGA 3GFZA 1N5QA 5ETNA 1BD6A 2G13A 4F67A 2XO6A 1VLOA 3FJ2A 1PAUB 1W2BO 4DF8A 2VJVA 2QM8A 2MZRA 1UPPA 3JSYA 5TJHA 2C3YA 2J9DA 2ZH3A 4ECUA 3IS9A 3PW4A 2GVDB 4DQQA 2KZIA 3HE5B 3W8GA 1YZ7A 1D09B 3GIMA 5KT5A 1HI1A 3OW2R 3P4UB 2UV8G 3AD9C 1D8YA 2KT5A 1T02A 2EFPA 4ZPWR 5LXYA 2E74C 3E8OA 2FIUA 1S0VA 1X4GA 2CZ9A 3MCMA 1NUEA 5D4OA 1ICEB 1NTKE 1VBYA 3CJKB 4PV1B 4I7ZC 2WZ7A 2OPQB 1PGJA 2GW8A 2GVZB 1PYOB 3RR8A 4G6VB 2WVEA 5DO2A 2O1KA 5FDLB 2OD6A 3MF5A 1Q81T 3THTA 4F4XA 2CJ9A 1H98A 2E42A 2HHHJ 2XLKA 3VMAA 3TANA 4O4GA 3FUYA 1OO0B 1RF0A 1NJYA 4F36A 3V81A 5HL7Q 1LEOA 2H8PD 5H2FE 4JYAF 4KO0A 5HO4A 4RNOA 1VFJA 2B9WA 4O3NA 1P9YA 1BE3G 1S4FA 5APQA 2ADCA 3H6PA 4RO0A 3FK4A 2WQYC 2IYGA 2AGOA 5L1JA 4K4ZA 3H1LD 4OI3A 1KB9E 1K73Q 1W7WA 1VOMA 4B9VA 5B66E 4D6TD 2YWWA 4NE9C 3I82A 2BVZA 2EKYA 1YI2S 4C8ZA 2F5GA 1CW5A 4KJMA 4DV5J 2HHVA 2W7PA 2BMBA 4CLTA 4R4LA 2DISA 1G4CA 5D0GA 2LXUA 1NTZG 2G9OA 4OGQD 2FFDA 3PYFA 3TUJC 1RT6A 4IO1A 4Y3CA 2MGZA 5ETOA 4WK3A 3BREA 1U7JA 3KLEA 3JSMA 4O3RA 1HL6A 3GHGA 4FYDA 2N1TC 1UZDA 2FVSA 3MPDA 2XMUA 3KJVA 1YWXA 4IYQA 3SWYA 4B9SA 4F2RA 1LWUC 1KFDA 1JY3N 2OYHA 1XR5A 5DZ7A 2VV5A 1RUSA 4K4YA 1RT7A 1SH2A 5EWEA 1REGX 1S99A 4NEZA 5HATA 5C42A 2Y0BB 3IR5B 5J2QA 1BGXT 2O5DA 2RMLA 2DB1A 2NCKL 4LF1A 5APWA 1LK5A 2GO8A 3QGGA 2KLUA 1NSKL 3G6YA 3Q24A 1VQ8S 3MM8A 1N8RT 5D3GA 3H1JE 1FXRA 1S97A 3H25A 2YQ0A 1YJ9S 2HYIB 2AJ1A 2H51B 3CWJA 4IFVA 4Y99B 1PYTA 3U1NA 5L1LA 1HBMA 3F56A 5A8RA 2BW2A 1UTAA 3BH6B 3H1IG 2M5YA 2MY8A 5J1PA 4JI4F 4NI2B 1OX3A 2KNCB 2YH0A 3CX5I 2AGQA 4EBCA 4KR0B 1N8RQ 2Y1RI 1X4FA 2AV5A 5KTQA 1IKYB 1HLWA 5H1SV 2O1PA 3K17A 1TL5A 3BN7A 2XLJA 4ZMDA 2VA3A 4WFBQ 2AXTH 1PYSB 2HNDA 3LW5H 1N6QB 4OFZA 3VALA 3BCCE 1U4BA 4OHXA 1AA0A 2XGPA 3LWLA 1UEKA 1CI6A 4NLUA 3BKUA 4I2QA 1X4DA 1PAEX 4CT9A 4DR4F 1S7IA 4FF4A 1ZLLA 3Q5PA 3NP5A 4F3OA 3PY8A 3A5TA 1B4SA 3EZOA 3V4IB 1VF5B 2ZFHA 2P58A 2Z30B 4WKRA 2ZH2A 2H4YB 4JI7F 4PXEA 4XPCA 4USVA 3FFIB 2LLZA 4KHPF 1S9KE 5CHCB 3GP9A 1HBUB 1JCCA 3WIUA 3VHQA 2M9KA 3P32A 2E43A 3IWNC 3IA0A 1NDPA 1U26A 4KGZB 2BJEA 3DLLQ 4OWFA 3RBEA 3ZC4A 1DURA 1RAEB 2BCCG 3NXSA 2B4VA 1M1KT 2IRXA 3KK2B 1TVRB 2I2YA 3NS5A 1WD6A 4WCEQ 3HHLA 4K2XA 4WP3A 5KG1A 1RWPB 1IXKA 4KYZA 2RQ4A 3KHGA 2OH2A 4Q8FA 5K5MA 2FJBB 2OKQA 2XKMA 2CPSA 5KT2A 3A8IA 2PRRA 1CQMA 2HGMA 3UVJB 1M1HA 4C7NA 5EUHA 5EGYA 4DF4A 2DJWA 2GA7A 3VAFA 4DR5J 1C4CA 1M1KQ 1NHVA 4L76A 4ECXA 3FQKA 1KOOA 2V2VA 2WSFH 1NU1E 4TKTA 2KT2A 2M3EA 2Q1KA 1R6YA 4A7PA 4OI1A 1WDDA 2HGNA 3TQ1A 4ETZA 1LWXA 5KFJA 1JTHA 4CLFA 1AFOA 4ANCA 1QAXA 3M6XA 4OYBA 5LM7E 2V8HA 2XEXA 3S6EA 3MIWA 1NEEA 2Q43A 3R1LA 2MDAA 4IDKA 2C3MA 2ROEA 1RTDA 4X4OA 3JB9k 5DG9A 2QFIA 4O3SA 2GA1A 4ZS6A 5I42A 4RWWA 1BE3D 3JQKA 1LGHB 2RDIA 3JC22 2XY5A 5KFRA 2XS7A 4U8VA 1GMWD 2MXYA 1OIPA 1YGYA 3NAHA 2JLGA 1SL0A 2HHHF 5K5GB 1S6QA 2X1FA 2V5HG 4OHYA 1U1OA 3A8KA 1L4AD 5GAEU 3M0DA 3KUGA 3D5MA 4YHHJ 3H1HG 4NLGA 5CZVA 1RAHB 1DY3A 3SSUA 1UPMB 2Y1IA 2FGCA 3NXZA 1VC6A 2G8YA 2M70A 2PEBA 1EDJA 1OWXA 1T2KD 1NTZD 4LRAA 4DSEA 3AE9C 4Y0FA 4WYWA 3D4JA 5LJ3Y 1VJQA 2AX1A 3DU5A 1XEZA 3PRDA 5BYSA 4ETXA 4PG5A 4DV5F 2V4HA 1N7SC 3SYZA 1I6JA 2AT1B 3K58A 5KAIE 3MCNA 3MUDC 3HHNB 1FDBA 3CJ3A 2MQPA 1WC5A 3GWCA 5BVZA 4DFPA 3AEAC 1JLCB 1FI4A 1F1BB 3Q8QB 4RW9A 1V9OA 4NLRA 2GUSA 4WXWA 3LANA 3D0IE 3TYTA 1JY3P 5HVHA 5U47A 4OJHA 1I51B 3PVXA 1QX8A 4O4GB 1UW9A 4LIRA 3J7A1 2HVHA 4KO0B 3QQCD 4X4PA 3HXMA 3BPDA 3RB0A 1UP1A 2BM0A 5CCHC 2M5AB 4EWTA 2CDRB 1KNZA 3GMAA 2B9YA 4HLBA 2ATCB 1QSLA 1FEEA 2G2OA 4OZJA 4K0KJ 4MMOA 3I4PA 2QL9B 3QFWA 2E74D 2MQNA 5F8HA 1RY3A 3MD3A 2DNQA 4DPXA 1X0FA 3E51A 1YITS 1VYAA 1H2TZ 4U67Q 1VC0A 2RUGA 1XN9A 3FXDA 2R8IA 2Q1LA 3W8PA 1URQB 2ZAEB 2KS1A 2YNHA 2DIUA 1VQ4P 3H1ID 2YKMA 1NWQA 5CQGA 3CCMP 1BWVA 4NMLA 2IJNA 4YDXA 1NK7A 5KG6A 2GMJA 2FFDB 3KG4A 2IMWP 4XTTA 1RT6B 4DCJB 1KHWA 1TR0A 1XQIA 2ATLA 4DX6A 5KT4A 4MKYA 3M4XA 4CRJA 3H59A 5BU8B 5AXNA 3WX4A 2DGVA 2Z4EA 2OQQA 2BV3A 2DRBA 4ILRA 1KTMA 2DHSA 3EDRB 4WWIA 3BH7B 3RAXA 3HZGA 3IAS9 4I4BA 3KJVB 2HIQA 4E8UA 3OL6A 2QE5A 4P2MA 3GE9A 2YKPA 1WF0A 1XMOJ 2IY5B 1S1CX 3TWZA 1QL2A 4BWMA 4QMAA 1RT7B 4IL6H 4AFFA 1Q7YT 4YR2A 4H4KC 1U1MA 5GTIH 3MZWB 2HK2A 3D6TB 4IR1A 5C42B 1G3OA 4J9LA 2UXDJ 3RRGA 3W1YC 3Q8UA 5HBMA 3O5TB 1DX7A 4QQBA 2CWXA 3J81U 3KUEA 4U7JA 1DQAA 2DGUA 3I5AA 1VQPS 2OO4A 5D3GB 1YJVA 2ROPA 1KP6A 2FDNA 2Y9HA 3SFDC 2NS1B 3L7PA 4PV1C 4IFVB 4QIFA 1SQPE 3QWPA 2OSQA 5KG4A 5AXKA 2DITA 1Q7YQ 4QIGA 4TNOA 2Z57B 4RNMA 2W8KA 4M5LA 3FEZA 2R7UA 5EWFA 2ZWPA 2QMXA 1TKZB 3H4DA 1RH5B 2BCCD 2IYIA 2W8LA 4GKGA 3J80U 1OZHA 5C24B 4ZVSB 2N1TD 4DI6A 1KYOE 2QL7B 5DZ6A 2CWKA 3SBMA 3R9LA 4QYZK 4CTAA 2WT7A 1SQVJ 1WEXA 2CKWA 2R7VA 3AOCA 1HGVA 3DFEA 4LBPA 1T03A 5DDPC 3DNCA 4WJBA 4ZNCA 4UB8E 2QJKB 2XMAA 1T94A 1SQXK 1GMVA 1L0NK 5JVGQ 1EZVI 2JC0A 4C6AA 2AGPA 5APSA 4C9DA 4I2QB 4GODA 1U02A 4DSFA 3EXCX 3ZNJ1 3QRQA 3PRBA 4P7VA 2CVIA 2IVMA 4KQZA 4A48A 3TNVA 4DR5F 1WT6A 2W2QP 3U27A 3IRWP 4QIWD 1PP9G 2YNFA 1EXIA 2LEAA 2KKHA 2X3DA 1FVSA 3CMAP 3EDQB 4WFNQ 1ZA2B 2XYHB 4P2SA 2MKKA 2PSZA 1RAAB 4XPEA 2XG8A 5KFIA 2K3RA 2B87B 5HANA 2FYUK 1GD2E 3KUHA 4MYUA 1JY3O 4AE5A 4KBIA 4OVNF 3WUUA 4V1Ak 1L3UA 3FEXB 1C1CA 2FYZA 2Y0SD 1IO4A 3V2UC 1BGYG 4F8RA 2J9EA 3UE2A 5H9FJ 3HHLB 4YY3J 2CG4A 4CT8A 1VQMP 3EPGA 2JVRA 1PCAA 1HMVB 1M5HA 1JB0C 4DXLA 3CX5D 3G4SS 3HSJA 3R2DJ 4C7QA 2QMWA 1SQQE 3W63A 3H1HD 3DC2A 2FPHX 4M1KA 3FSXA 3MEGA 1A9NB 1RTZA 1VRUB 2APOA 4C7NB 3FEYB 4KH0B 2A45H 3PW7A 1QDUB 4GOEA 3H1JJ 3MM9A 1UJ4A 3VGTA 2RJZA 2QA4S 3AXMA 2KXNB 1M5OC 3TI0A 1TL3A 4Y99C 2RH3A 2XDJA 4AQRD 5E79E 4YHHF 1MUUA 2CRLA 1N36J 2EG2A 3K5LA 3V6HA 2JSXA 2DGTA 3FSYA 2ZNZA 5EX3A 1R7IA 2PFDA 3TGUJ 2W4PA 2KVIA 2GX8A 3V2NA 5L8RJ 4H0LB 4IDKB 2W8ZA 3HD1A 3H5YA 3ISND 1V3ZA 4NOHA 2ZM6J 1HBOA 4O3QA 3F5HA 1LWEA 1VHIA 5APUA 3H20A 2FHKA 2A3JA 2CNOB 4DOZA 1F9EB 4Z1MH 1U0HA 4LSZB 4CO1A 3TZXA 3J7YI 1CEZA 1U57A 1NU4A 3CCVP 2KG0A 5K20B 3EGWB 1F9FA 2ZBCA 2E76B 2DY1A 4MK7A 4J9KA 2XWYA 5AE2A 5B09A 4XAKA 3AJ2A 4L6V3 3HO1A 4UB6E 4J5OA 2YNGB 1BQXA 3A0BH 3G6ES 4K0KF 2FLLA 3M0AA 4HJGH 2CIMA 3CNQP 1F60B 3VAMA 2ZZMA 4LBHA 3M05A 3OL9A 5AW6B 3CT9A 4DBQA 3ZNUA 5KFAA 5AXLA 1WSRA 5A2QU 3EVWA 1NO4A 3V6DA 1EZVG 2NPSA 3BYRA 5AVZB 3PO5A 2KUBA 3PHTA 2JP3A 4I6YA 3IG1B 2GQ2A 3SSRA 4E98A 2RH0A 1S4XA 3CXHE 2FZCB 1YBUA 1WG4A 1JX4A 3N28A 3W2WB 2Z5IA 4PXCA 3DGPA 1RHUB 3L75G 5DJTB 1RE4A 2IMOA 3IRXA 2VUGA 2HBZB 4IH5A 4C8YA 3W9IA 3NKYA 2HHTA 4TU7A 1XMOF 1PIXA 1N5SA 1N32J 3L4BC 2R2TA 2XWXA 5K8NA 3VZHA 5KOWA 1HNZF 1FVQA 4ZITA 2JZ5A 4I0WA 2JH3A 4PXDA 4LGDE 2UXDF 1NHLA 1Z2ZA 5GAGI 4ZP6A 4G1IA 3KK1B 1XNQJ 2LXCB 3LWMA 4R0JA 1N7SD 2PI5A 4DS4A 2YNHB 4N78D 4ID5B 3LGHA 1GTHA 3AOBA 1T9UA 3CC4P 3HF5A 3P8MC 3N5FA 3RRKA 4IUFA 1I5OB 1EX8A 4HI2A 3Q8YA 1R8PA 4IG3B 1ZW0A 3OVSA 2VPYB 1Y3JA 4EEYA 5HROB 5AVSB 1UWBA 1NH4A 3GIIA 3VF0B 4WFYA 1BCCE 4G3IA 1NTMK 5A6WA 2XO7A 2AEFA 3QT5A 5CCHD 3SWFA 2FVCA 2C0WA 3HD7A 1QLNA 3KZIH 5ETQA 2XU6A 1GNKA 5E3PA 3W2VA 2AX0A 2LU1A 1VQSA 5L39A 1PPJG 2EK6A 3N4WA 2A45I 3GG1A 1XERA 9RUBA 3QT8A 5HBMB 1NSPA 1S1XB 3QSYB 2FHMA 4HHJA 4DQIA 1PP9D 3R2PA 3DRPB 3MUVP 1X9SA 3QRPA 2ZE2A 1QUPA 3TUPA 1BY9A 3OTCA 3NOCA 3OJUA 2ZOFA 4DS5A 2ASJA 3MTJA 5B5EH 5D4NA 2B56A 4I56A 4LQ9A 4WXOA 2N3OA 5KFCA 2YPZA 2C9NY 4W80A 1XR6A 3VOPA 4RR5A 1UVIA 3MM5A 1T9YA 4WBAA 5D6GA 2CFXA 2DO0A 4KV8A 1X22A 2RN0A 3DI6A 3A8EA 4CQ1A 2BQRA 1RGVA 1VQ8P 5BXIA 5LSRA 3MECA 4ZPAA 4ZVFA 4N77A 5SZTA 4CTAB 2ZBQA 2WT7B 3W3SA 1YBKA 1RBLA 1G2CA 2VOOA 1YJ9P 1VQ5S 1QAJA 1ZETA 1RYRA 2B4UA 1IR0A 2RHQB 3HE4A 5GMKa 1S1WA 5AE3A 4YY3F 1YDLA 1R3NA 3B8HA 4D6TJ 4JI2J 2QJYB 4DPWA 3J7YU 4Y2CA 4IG0A 4PV1D 3FBBA 4NLTA 3PDNA 2XM3A 1ZH5A 2VODA 1URQC 1WC1A 1YJTA 5KG2A 5J2MA 3I9V9 4F02A 2WPQA 4ATNA 4D3HA 4B3SJ 5D8HB 4J9MA 1G6BA 1NRKA 3FZ2A 3M9NB 2YNFB 2V2QA 5B0GA 2FFDC 5IQQA 1P9QC 2DW3A 1YLXA 5LSLA 1Q8BA 3V6JA 1MLAA 3SSSA 2BE2A 1N36F 5KG3A 3L74G 5KAKA 3P5TL 2R42A 2G0IA 4U8YA 3NS7B 1U6BA 1GX5A 3RB6A 1C1CB 2ZWOA 3AA8A 4I64A 4IQXA 4DZOA 1WHYA 4A4JA 3W7BA 2XMMA 4BS2A 1AUDA 3HSDA 3ZZPA 3HJVA 2ZM6F 1X9VA 1FD2A 3FCWA 1L5UA 2VONA 1ZR4A 1R8EA 1EAYC 3A3NB 3MEGB 3G86A 1OW8A 1NSAA 1ZYQA 1REVB 2BUNA 3UN2A 2OPPA 4J90A 3E3XA 3O6QA 2NXJA 3MM9B 4AXIA 4JV0A 4ELTA 4WP9A 4DL5A 2KVQE 1NO8A 2V8VA 4J91A 2LXFA 2IVFB 3CCTA 3BR9A 4GC7A 3GZ7A 2PD1A 1Q86T 1EIYB 2HHXA 5GAGU 1EZVD 2XMTA 4B9TA 2HHPA 3M8YA 3ULHA 2A10A 3FCVA 2AYEA 3FRYA 1PJ5A 4NLXA 2FHJD 2RKIB 1JXEA 2HHQA 2HODA 1IQTA 2WPVB 3IMQJ 1SQEA 2X1BA 1YSJA 1HVVA 3BDEA 1TTHB 2CQBA 2YNIA 2E75D 1VQLS 5K8PA 4H13B 5F8MA 2F65A 3L75D 1HBOB 3Q8RB 1M7LA 5F0UA 1FC2C 3N6MA 1LWEB 2YY3A 2H5JB 5DDOC 1CG2A 4P75A 4MKAA 2C3OA 4A8QA 2QJKC 3US5A 1ZA1B 4XO0A 3H2VE 3NWGA 1LTSC 3EJMA 4KGKA 5KJ7C 1FFWB 1AZSB 2ADBA 4USIA 3ZFVA 2GNKA 3DOMA 4NPFX 3CO0P 4OYWA 1NTKK 4G65A 1VS3A 2AJQA 5ETSA 4QOTA 1JLFA 4ECRA 2GGPA 1KQSR 3U1MA 1OYEA 4M5KA 2LQBA 1SQBJ 1GXLA 3WHIA 1N32F 3BV8A 2DEIA 2W1BA 3IF4A 2GHVC 5APVA 3MCSA 3UPFA 1QAIA 2BEFA 3DLBA 3DRRB 1FNXH 1XNQF 1USDA 2PMZD 3MAQA 4DQRA 3IFMA 4AL6A 1IZNB 3TX0A 2PP6A 4MAKA 2UVWA 2RAQA 3BGUA 3LGNA 2QC3A 2XCPA 3P7KA 4A8OA 2AU0A 3HHLC 2LA6A 4WYLA 2KI2A 4ZVGA 3KPEA 3CC2P 2UZAA 1PPJD 3PJSK 1SQQJ 2IFNA 2OGUA 2CNNB 2R3VA 2PFXA 3IRXB 4ZIWA 1SJ1A 5F8LA 2MZJA 2K3IA 3ILOA 5A8WB 5L1IA 3VP8A 2P6TA 2PGCA 2JHEA 2C9LY 2JRSA 1P84E 2V2KA 5DQGA 2K9YA 3QBCA 4RBUA 1K44A 3PR4A 3L71E 2N4DA 2UV8A 4PUOB 4RBVA 2E9ZA 3KQGA 1LTBC 4ZLLA 1K9MT 4URGA 4ZP9A 1KILE 2VC0A 5KFUA 1HNWJ 2L08A 2ZJSE 4I1TA 2ERRA 2XYPB 4DPTA 1HW9A 1OQ6A 5IM0B 1RT2A 1AW0A 4H0LC 1JLEA 5IS2A 2R5BA 2MQLA 1U2CA 2DNMA 4ED1A 2NYHA 2E5JA 5H2FH 4C4WA 1L0LK 4B3OB 3CCZA 3LA0A 1UW4A 1SFCB 4USTA 1VBKA 4B3TJ 2HVEA 3MGNA 4OQJA 4C8OA 4B3MJ 1DEBA 1U48A 1S5LE 5B66H 4X62J 2YIUB 3ITHB 4GDOA 3HD7B 2ZUAA 1H89A 2E76C 4DSKA 1IQZA 4KHMA 1FRIA 4Q45A 1HJ0A 3MMJA 1D0EA 4Z37A 2W24A 4ED6A 1VQKS 1W5CE 4F3QA 4PAAA 2VG6A 4OZ5A 1GMWA 1NH7A 2DGQA 4RLEA 3TQEA 2ZJQQ 4RNHA 4WIIA 1K8AT 2FJAB 2VZ9A 1YJUA 2RQCA 2DNYA 4JI2F 3LAKA 1L4AA 3CPWO 2B88A 4ERDA 4ZCKA 4DT0A 3OFFA 3L74D 3I56P 2OFGX 1WACA 2HZCA 1RHMB 3ZZYA 3L3CA 1FNOA 1RQ0A 1HW8A 2IAJA 4B3SF 1N73B 3NGRA 3MM5B 1RT5A 5IT0A 3MEDA 3DI6B 4X4TA 3O2IA 4DX5A 2PE8A 1NK8A 1FFSB 1VQPP 3MECB 2I6WA 4DL7A 3D2WA 2PAJA 4JBZA 4NZ7A 3H5XA 3AAWB 3M6UA 3ILIA 3QATA 5AVRB 5HQLA 3AEGC 5D15A 3HE4B 3KNAA 1FU1A 2Y0CA 2VIHA 3GJQB 2QVAA 2RQMA 3UQSA 3A3YB 3AY0A 1UKUA 1WC0A 3WUTA 3SV4A 1RWKB 2RD5C 4EFAC 3KNGA 2W83C 3ETMA 1VBXA 2QG9B 2DTJA 2K7KA 3PTWA 3TYYA 2KB7P 1MFTA 1JLQA 1Q82T 2IC3A 3H1IJ 5KT6A 3D70A 1IKVB 1L0ND 1VQ9P 4USWA 1ZZFA 5H9EK 1RLDA 2H48B 1DTTA 1I3OB 1GXUA 2OAUA 3IN6A 3VR1A 4ZP7A 3UDVA 3DLHA 5CZXA 3PFEA 4QBUA 3MAHA 5AW0B 1UFLA 2Y9YA 4XA4A 2VBWA 4ZCMA 2UXBJ 5KFYA 5E3AA 3SDEA 1KS2A 4RJVA 3LP1B 4QW8A 1AFJA 4IKAA 3FBFA 1Q82Q 1RWVB 1Y8AA 2QJPB 2MKYA 2WSEH 5KFQA 1NLKL 2I0XA 4U7CA 1S4EA 3NGTA 1UEUA 4W4MA 3G8QA 1NU1K 3Q2SC 4P72A 3V5RA 2DNLA 2CAJA 3PJWA 4OI2A 4FS1A 3QGIA 3W5XA 3PRJA 1RLCL 3DOLA 1URQD 4IOIH 5C2GA 2OPPB 1YTYA 3SI8A 1SUQB 2LFVA 2N9BA 1RT3B 5I3UA 3MR7A 3M32A 4HVZA 1IBCB 3H4BA 2OHDA 4KC5A 3DYAA 2LA4A 4Y00A 2V94A 2F4FA 3BO3A 1LKZA 2GQCA 5CD4H 2BX6A 5CYQA 1F3VA 3VGVA 2HODB 2CG8A 3RK3D 3OHAA 1FA0A 3KDOA 4DV1J 3TUIC 1RHZB 4P9SA 1WELA 4J9SA 1YJ7A 2D9PA 3MWBA 3SCIE 3UR3C 4M63A 1UIIA 1VQ7P 3C14A 4F4WA 3RK2B 3DDIA 4CO5A 2FYXA 2VA2A 4PG4A 3TAMA 2N1TA 2BKPA 5RUBA 3I31A 2FLPA 1FNMA 1LWUA 4DN9A 2ZZNA 3IC1A 2QJYC 1WI8A 3H1KE 3DOMB 2CA9A 4CPGA 1NJIT 3IXQA 5GMDA 2MKSA 3LPEA 1CBKA 3G87A 1JLFB 1W2BR 4ZN1A 1SIWB 2C2RA 1QEXA 3PKMA 1U2RA 1X60A 1N86A 4DHVA 4U7UK 4X4NA 4ZOSA 3M2VA 3I87A 4PR6A 1EETA 4C3KA 3F89A 4EI2A 1HQUA 5L1KA 3MOZA 4DUYJ 5LOQA 4DCPB 1RYSA 1K0VA 1UIXA 1VGYA 1IR1A 4IQMA 4C11B 1HNWF 4F04B 3QLHA 1PILA 4KSEB 5HVGA 1H6KX 2YKAA 1T9WA 3AB4B 1ZM4A 4JI1J 2DNOA 2C2DA 5AVWB 2VG5A 4USMA 3MPYA 2H54B 3MMCB 3HT3A 4JQ0D 3GSDA 2W25A 3TA1A 5KJ7D 4CDIA 1U1PA 1LV5A 4ZLNA 3BGFA 3ENVA 3WIVA 2LQJA 5ETVA 2PN6A 3M2RA 4GVBB 4B3TF 3UI3A 2M4MA 3BS9A 2B0GA 4B3MF 1VQYA 2ILYA 4RW4A 4X62F 1SIZA 3TK1A 3EGNA 2OMOA 3VAKA 3TX8A 1YTZT 1UA1A 3RBXA 1SVFA 1OWAA 2IFMA 2R4FA 4QWCA 2HPCB 4OV6A 1VCTA 3GYNA 2POHA 1R0AA 1NJXA 2GO9A 4GMKA 4O9BA 3T97A 5KAIH 2HSEB 5AW9B 3BGLA 4CLKA 1KQLA 1MN9A 4HB1A 3SQGB 3JTOA 2JFKA 4M3LA 1K1SA 1RT2B 5AXMA 3HHKA 1WTBA 4YOEA 1ZM9A 2J58A 3GONA 1BE3E 1PGPA 4GVLA 1N5YB 4HH1A 1K0TA 4YB6A 1RXOB 2UUTA 3PJ9A 3M06A 3QJJA 3PW5A 4B86A 1R27B 5L8RC 2QIWA 4LFCF 4N76A 2L9NA 4EZ6A 1KKHA 2DH8A 4W7YA 2BOPA 3CCEP 2D2CD 1S9FA 1YKWA 4KGMA 2VFVA 2UP1A 1SQVG 2E66A 1X4EA 1KVKA 1SQPK 3JQJA 3JTNA 1RJJA 2OTJP 2MHNA 4RWXA 3W9HA 3J7Z5 2WSEC 1N5TA 1RWUA 2G1DA 4N5SA 1FX2A 1RAIB 3EGVA 1BDDA 2O01H 4NA1A 5CCMA 3V2PA 3RAQA 4LF4J 1NCLA 3IAOA 4QWEA 4H0LD 4U96A 3PHLA 3J7ZT 1HPZA 3SEOA 5IC6B 2NYIA 3QWUA 2EC2A 2LDYA 4YR3A 2JWNA 2Y3YA 3D6YA 2IAJB 3TVZA 2LEBA 2E29A 1DRZA 2HFOA 1LT9B 4OYZA 3IBWA 4DSJA 2X1AA 4PQUB 3KLFB 1X0PA 4RW6A 2A0FB 1S59A 4B9NA 2XSFA 3U1LA 4JI6J 1Q90D 2UXBF 1ZRTD 2E76D 4UOFA 3ONQA 3DLGB 4OJ1A 1RF1B 2LQ9A 2KG1A 3GQCA 3I5BA 2DH9A 2C22A 4A8SA 1R6VA 4KRWA 3NMAA 5CJ0A 2NXUA 2CDQA 2W2PP 5C2CA 1X4AA 3VV2B 3L71J 4Y28J 2WONA 3L73E 1X4CA 4OL8A 1TZ0A 2CQGA 1NDCA 2DCLA 3GYXB 3L95X 3M1VA 4PD4H 5F8IA 3NGDA 1JLQB 1NPKA 3OUYA 2IC3B 1LJ2A 1SQXE 2YQ1A 1H88A 2PIIA 2I8EA 3M8PB 1UVNA 1KYOH 2GJFA 2UXCJ 2MQQA 3PNIA 4IFMA 3H1JG 5KFPA 1JM0A 1JMTA 2H5IB 3NNAA 4I7ZB 1IFIA 2KRRA 1HYSA 1R89A 2HKEA 4MH8A 1K1QA 2R9LA 1N7SA 1HQEA 3EYZA 1QL1A 2I8DA 2BQ3A 1RTJB 1ZOYC 3SDEB 1SFCC 1HBWA 4UB8H 5F8GA 5EN1A 3I9ZA 4DV1F 1VBZA 3TGUG 2VICA 2OPSA 2DNNA 1SVDA 2YIUC 2B9BA 1GTWA 3OFGA 3TA2A 4DL2A 2EXUA 2FYUE 3KK3B 2R2SA 4I1LA 2I1RA 3T6JA 1T9VA 2V7QH 2XTJP 3I0RA 4B17A 2FC9A 3OAKA 1RTHA 2GM4A 2YX4A 5I3QA 2KLVA 5CCHA 2W2NP 2N4CA 3DOLB 1PP9J 2OI2A 5AW8B 3DOKB 4KFBB 3LW5J 5J1EA 3M32B 2DEJA 1L3VA 2RIJA 3DYAB 3IM9A 1TL7B 4ICLB 3L7UA 4HT5A 1SJQA 1N73C 2XZWA 2ZJPQ 5C39A 1N33J 4DUYF 2R7RA 4OV1A 5F3TA 1IK9A 5L38A 3C8YA 4MT1A 2KFYA 5C25B 4DWIA 5F8NA 4JI1F 3PYEA 3C14B 1FRJA 4EO6A 1XTCC 1CPZA 4HHUA 2DNRA 3C16B 4QPXA 1RWXB 2IX7C 4WF9Q 3UWTA 3PX0A 2Y1JA 1UA0A 4RL1A 2GUVA 2BOAA 2GVDA 3KLHA 4H4KA 3HE5A 1JNMA 1WORA 1KD1Q 1APSA 4X2BA 3X1LB 4L75A 1LTGC 3AEFC 3M2VB 3NOGA 4CNZA 1Y5NB 4J9QA 3GIRA 3KG1A 3HMJG 3CD0A 5F41A 3V4MA 2AXCA 4U3FE 3QIPA 2RDDA 3CJKA 3UCUP 4X64J 2WSFJ 2XB2D 3IFEA 2OMLA 1Q1KA 3PJXA 1N7LA 3TEGA 1VQNS 2ZYGA 2OPQA 2FVPA 2KSJA 4GO7X 1YHQP 2GVZA 3QLHB 2VQEJ 2HS0A 4LRCA 1TFYA 3HRNA 5T7LA 4L74A 3PW2A 2VG5B 4P7TA 2QJPC 2YMYA 1HI0P 2MKCA 4FKXA 3C6UB 4D3GA 4EMDA 3BJYA 1SQVD 1PSDA 2ZHOA 1VQ4S 3UDEA 2JEFA 3PXGa 2G0JA 1TKXA 3M2RB 2DCUB 2SXLA 1KZUB 2QMUB 3CCMS 4ZKAA 3TO8A 2ACYA 3A3OB 5GAHI 3QO9A 1WDTA 4EYHB 4ZPBA 2KZJA 3PLNA 4RW4B 1ROFA 2K2PA 4KH1B 1KB9D 5IOLA 4IOBA 4Y2IA 3KZIE 1JOCA 4DU8A 4PD4I 1AJYA 3VGSA 2UWJE 3T97B 2QLFB 3AE3C 2MHEA 4W98A 1FK9B 2U1AA 1KYOI 1AQTA 1D1UA 4X66J 2HZVA 4ENOA 2Z2LA 4LF4F 4A46A 2PI4A 3DRYA 2ZXXA 1H7XA 3CXHH 2KFZA 2B3TB 2DT9A 2ILZA 2WZ1A 3DCAA 4PG6A 2CVEA 1IJDB 5JUMA 1UVMA 3P8CE 2FUG9 2MKJA 4ES3A 3RK2C 4JPZB 2ZKTA 5IV3A 2FHJA 2DNGA 5EX0A 2E1AA 2H65B 1M1GA 1S6PB 2IJFA 5B0EA 2JVOA 3NG8A 2F4VJ 3VTPC 5KFEA 1GU4A 3H1KJ 1R0BG 5J2PA 1J2JB 3ENWA 4NCAA 5G4DA 1T8ZA 4DN0A 3BRTB 1NK5A 1NTME 2QIFA 2R8KA 1BC6A 2XMWA 1FDNA 5A76A 3F0NA 1LXNA 4A8KA 2HNYB 3ZZZA 3H1JD 1TP7A 1X5PA 2M88A 4UQTA 1UJ5A 4OI4A 4D6TG 4BLGA 2ZYDA 1J5EJ 3BQ2A 1T3UA 1LTJB 1GEHA 1RBOB 1RBAA 5MAOA 4UZBA 1PGOA 4JV1A 2HPUA 3TGUD 4TLRA 1U8WA 2UXCF 3TRGA 4U9RA 3EMTA 4MKBA 4JP8A 5CAAA 1YIJS 4NPEA 2ZD1A 1J5OB 4RW6B 1DAXA 2NREA 2Y9ZA 1KMIZ 1T6AA 4JYBA 1J1EB 3AQPA 2LQ5A 5KFGA 3TJ8A 1YG0A 3BPSP 4DPYA 1F6TA 5DM6Q 2LDIA 2Z2YB 2UU9J 3Q83A 1ZBTA 1CJUB 4NYPA 3CMAS 4UY85 3AE7C 5KAFE 2RNEA 3MTKA 1TAUA 1JQGA 1FHTA 1FDIA 5KLVK 3H2UB 3DRSA 3MD0A 1RACB 1Y4ZB 1HH0A 4OHVA 5BYRA 2FC8A 4R5PB 5D0EA 2EFNA 1FEHA 3AQOA 3UNYA 2QLBB 1H73A 3AJDA 4C8LA 3V4IA 3A7OA 1KDNA 2W6AA 3FQLA 1AYEA 1VQMS 3DMJB 4OLOA 2CQPA 3FFIA 1FOSE 4K59A 3HX9A 3U1AA 1S9KD 1HYSB 1HBUA 2WSCH 2A1BA 1HQEB 3C6TA 3B8EB 2WWWA 1B0PA 1FERA 4CZCA 2QEXP 1H74A 2V63A 4UF4A 4ZLPA 1N33F 1NAYA 3KK2A 1HNXJ 3GG0A 4RNNA 3AE6C 3WDOA 2OPSB 2P7JA 2VF3A 1N54B 3ZXWA 2W9CA 3T5HA 5AW3B 3DU6A 5CCLA 4DR2J 4OYOA 4DV0J 4MTPA 4NCGB 2LVWA 1X4HA 2YKOA 3I0RB 1LNQA 1JLBB 3R3TA 4OHWA 4LF5J 1KR4A 4YP3A 2V69A 1AROP 4UUWA 1IVZA 2C42A 4LT6A 1X31C 4FPIA 3BEGB 3M6WA 1FTCA 4K2JA 5GAHU 3D71A 4OX6A 1JNRB 2AW0A 1FESA 3ILLA 1NU1D 3SV3A 3QAEA 5ETRA 2R8GA 4HKZH 3N6NA 4LIWA 1F3FA 1BGYE 1S57A 3VAHA 3QIDA 4DR3J 2Z2ZA 2KZZA 3CCVS 1SFCD 3N6LA 3RL0g 4OJ3A 3CXHI 3OV7A 1SQBG 3KHUA 1LT9C 2WK4A 2OYIB 1AVOA 2E7XA 1G1JA 4X64F 3SZ2A 2K37A 1WC3A 4DUTA 2NZ4A 1FJKA 4ED2A 4YPCA 2M7SA 1GK6A 4WIQA 3PIOQ 2MLYA 3TZWA 2VQEF 2QA1A 1HHQA 3LALA 4WWSA 3DLKB 1KQKA 2Q3PA 2W9AA 4OZNA 1RF1C 4DFKA 3MHYA 2B4OA 4N7TA 2AJ2A 3CCSS 1E6VB 3ZTRA 1HNVB 2WVDA 3LOUA 1SBRA 4PZVA 4QYZJ 4ZVTB 2MZTA 3RGUA 3LAMA 4E0DA 2G2YA 3KLHB 2QRXA 4ZPDA 3L73J 4IFDK 4O44A 1WMKA 1M5VC 1SQQG 4F4ZA 3CEDA 3G8SA 3UD4P 4ES1A 4KJIA 3GCWP 1SQXJ 1U09A 1S1UB 1L0NJ 4ZK7M 5DG8A 3N4XA 2HS3A 3QMQA 4ZPVR 1VQ6P 3QIPB 1NKZB 2XNQA 3FVYA 2BXJA 3G6XA 2DPIA 1S9EB 4I67A 1EXJA 4L73A 1EKRA 4P73A 3AT1B 4X66F 5T7LB 4CP5A 2V6AA 3O1LA 2VB6A 1JLCA 2WITA 1K73T 4DMZA 4A8FA 2HHSA 2IJRA 5CA5A 4MKVA 1EJ7L 1D9DA 2FYUJ 3MM6B 5F0WA 4AD6A 4I6AA 5JXSA 2KHDA 2XNDH 1M5PC 1TKXB 3CC4S 1IM6A 1Y47A 4QWBA 2M5AA 2DBBA 1QTNB 3QO9B 5HLFB 4DV6J 3TZYA 5KLIC 3CCRP 2F4VF 3O8WA 4NXMJ 3U59A 2KFNA 4P71A 1OPZA 2YWEA 4K4UA 3TAQA 3CIZA 3CSKA 3X3UA 1MN7A 2HQGA 1TL4A 1URQA 5LL6d 3CGIA 3EWKA 3OTEA 1YRTA 3MAAA 2I38A 4Z2XA 2V2ZA 8RUCA 1U49A 3AH6A 4HL9A 3CW2C 4ILMA 2CJKA 3ENAA 1J5EF 4IL6X 2FVRA 2B5JB 2NPIA 4NWBA 5AVXB 2ZC4A 2HMIB 1BLUA 2MLXA 5KFNA 2C0XA 1FFGB 5AVUB 4WK1A 1RWMB 1CULA 2GHWA 3VMXA 4QWAA 4ED8A 1QGKB 3ZO7A 4KIAA 2Z4PA 5E3QA 2RQKA 4QR1A 1P84H 2E75B 1X9MA 1FJPA 5GAEI 2B6AB 2XULA 4BDPA 2DVIA 4M8LA 5J2PB 3BM7A 1L0LE 1HBNA 1WC4A 1UVKA 1MROA 3WU2E 3CJ2A 1VR6A 2MTLA 4ZIVA 2UU9F 4DR7J 4NZ0A 2CQIA 4MYTA 3B5NC 2DNPA 4C0HA 1LP1B 4Y34A 1D8ZA 4IH7A 2IA0A 4M5HA 3CJSA 2FKWB 4M5NA 1A6LA 1Q8IA 1SQPD 4PWUA 2HBYB 1HTLC 4NMXA 4M94A 2EEYA 1TKZA 4QZVB 2Q6CA 4DDFA 3RK2D 1S5LH 4RW8A 1W26A 5C24A 2LEPA 3L70J 2CPFA 5KG7A 1VDHA 4LRBA 2ZD1B 3CDWA 1RADB 3OXLA 3NGKA 1TUWA 2DGSA 3H90A 1LWFA 3CC7P 3W64A 2KIKA 4USHA 2G1HA 1D9FA 5DLGA 3FNNA 1CLFA 2NLWA 5GVQA 1HNXF 1LTIC 1U25A 4FVMA 2F3JA 2HS4A 4LBIA 1MV8A 4DR2F 5KJ7A 1H72C 3VP9A 2QYCA 3DRSB 1TV6B 4DV0F 2CQ0A 1RAOA 1FT8A 2NPFA 4USJC 4LF5F 5AT1B 1IFDA 4RUBA 2GMLA 2QSFA 1M1JC 1DJ0A 1SL2A 3G8TA 1Y7PA 2HQCA 1JMMA 1SQBD 1YZ6A 3NNHA 4LRFA 4ZLJA 4CIOA 1LWCB 2LCWA 3MTUE 3T1HJ 4AQYJ 2Z5HA 2B87A 1WHWA 3D9BA 3C6TB 1IWGA 4OZ3A 2CJQA 4DR3F 1FZEA 3Q8PB 3NWRA 4DQPA 4OYMA 2UUBJ 2IYPA 4Y2AA 3CB4A 4NLWA 3OR2A 1RHKB 1Q7LB 5KTBA 1UVJA 3QSIA 3JTPA 1QSSA 1S3JA 2C2KB 2XMKA 1NVOA 2W9CB 3ISNC 5AVQB 2DNZA 5HQ8A 4ZDNA 1HMVA 2YKNA 2PT0A 5KFOA 2WPSA 3M9HA 2HGLA 1SQQD 3SSQA 1NTMJ 4G1QB 1VRUA 4NPDA 2FZKB 4USUA 2VFUA 2W9BB 1GU5A 1KQFB 3ISZA 4OI6A 5LJ5Y 3L74E 5DQIA 3CWBE 2L9DA 4FDFA 3PIPQ 2GS8A 1TFWA 2VH7A 3AE2C 1LTJC 3PX6A 1FWKA 4ED4A 3CCQP 2BM1A 3OLBA 2Q66A 1TQLA 3WMM0 3W5ZA 4FBTA 1IKWA 4HI1A 2IBZI 3GCXP 4A8XA 3A3PB 4DV4J 3BN4A 2J9DE 4H4MA 4A8MP 4WKYA 4LF9J 3G71P 3JQMA 2DHHA 5D78A 2CQ4A 3UN3A 1VJWA 1J1EC 2YXLA 3OVBA 4QJVA 2B4PA 3K59A 1DD3A 1WWHA 1P84I 3CDEA 5JVHQ 3ZZUA 1FKOB 2AEJA 3TF5A 4DSIA 1QD1A 1WOSA 2ZDPA 4PYDA 1R8CA 2BQUA 1B64A 3TJ9A 1NSQA 4F2SA 3GILA 5KFTA 1D7MA 3BVHA 1PFIA 4ZVRB 1RB0A 1KSPA 2J0SD 4O44B 1NAFA 4OI0A 1EZZB 1OXZA 3KG0A 1JMBA 1YX2A 4DV6F 1NZAA 3CJ0A 2YNGA 1MWYA 5KFKA 3H2LA 3QNWB 4NXMF 1VPCA 2JEJA 1YRXA 1F5BA 2VPZB 3CC2S 3FSIA 4Y28C 5GMEA 2VBXA 1VMBA 1YBAA 1YJWP 4YR0A 2B89A 3CD6S 1L3KA 3PV8A 1I94J 1EQ0A 2XC9A 2FJEB 2Y0DA 2WCXA 3QZ8A 3LIEA 3EICA 4HTJA 5M2RA 3AOAA 4PG7A 3OFEA 3FCHA 3PKYA 3LPYA 2OPRB 1HA1A 1CC7A 2C3PA 4DR6J 2GFFA 2AMCB 3IG1A 4DCKA 4HH0A 3DN9A 2V67A 2R5DA 5KT3A 3CDAA 3W2WA 3KHRA 4WTOB 2LP4A 1CSJA 2DIVA 3BGRB 4KHRA 5FLXY 4FZVA 1YJNP 1VQNP 4I68A 1X7VA 3RZAA 2KZMA 5BJRA 3V6KA 2MJNA 3QGPA 2CNLB 5KFXA 1IFPA 5DETA 4ED5A 3HLUA 5HMZA 2HBRB 2HQIA 2AYGA 1FJEB 1KONA 1F0XA 3JAMY 2IPPA 4UQGA 1K05A 1CZQA 4DR7F 5LMNJ 1JJHA 1UEVA 3KK1A 2HHWA 2KXFA 3MHVA 5ETMA 1PJ6A 1RCXB 4JI0F 3MAAB 4ID5A 1HKAA 3LW5C 2R32A 4C0BA 2OYIC 1HQ2A 2MEWA 5THWA 3HVRA 1YRUA 4IFFA 1RZMA 4B08A 2R8JA 3VYIA 3LF0A 2VD3A 3MDFA 1SKSA 5HP1B 3PEHA 2BKNA 4IG3A 5HMWA 3PW0A 2OLWA 5HROA 5HI7A 4CLLA 3ABVC 3POTA 2KJWA 2CJYB 4XFJA 3RK3B 1CULB 4FYYB 1NTZK 3FGAD 4JI3J 1XTGB 3QH9A 2GIFA 3I56S 1HNZJ 4CLZA 4ECVA 2KO1A 2M52A 4J9VA 1HBNB 1MROB 5D0RA 4M5IA 4BC9A 4Q2LA 4ES2A 1GK4A 4ZHRB 2VKRA 1OMSA 1S1XA 1QVFO 1NK6A 2QO3A 2MZSA 4HEA9 2AHOB 3DRPA 3BSAA 1M5SA 2FY8A 1IJEB 2ZH6A 3T1YJ 3OPKA 9ATCB 3BASA 2H4WB 3K2YA 3VWSA 1NTKJ 2Z58B 2RRNA 3AB2B 3EE3A 3V5BA 1KFSA 3Q8VA 4M5DB 3V4WA 2MLZA 3GFHA 3NCQA 3L71G 1X8DA 2EVZA 1QY7A 1R31A 2OTLP 1SV5A 3V4QA 4PD4E 4W92B 1DHMA 3CPWR 3I32A 1FO1A 4WU2A 1NK0A 4MJKA 4RW8B 1H8AA 2WSFC 2HLUA 1RHQB 2J7KA 1OPIA 4PJ0H 4KT0J 3T1HF 3M8ZA 4NPOA 4AQYF 2CQ2A 3UNGC 1ZAWA 2Z8QA 4EO8A 5APTA 1LWFB 1NJWA 1TKTB 2UUBF 4CM2A 2B8QA 1JWWA 2JEEA 4GC6A 4FYVB 1VQ9S 4CWBA 2MKIA 1B0TA 1HI8A 1JLGB 1EB0A 1MFZA 4YB1P 3CULA 1XBWA 2R7QA 2R2RA 4NA2A 4OIXA 3B5ND 3NCPA 3HDSA 5BR8J 1S9GA 4ANEA 3CCJP 4BHQA 2QGFB 2B8PA 1B3TA 1LTTC 3A2AA 4WB4A 1YIJP 2N7CA 4L72B 4K8RA 3KHHA 4YQWA 2FLNA 4OJGA 4AUKA 1BSHA 3HFKA 2C28A 2EC0A 2PGDA 3IWLA 4OX7A 1X5OA 3L36A 2ABYA 3LTOA 3ZTPA 2Y8YA 4FF1A 1KFNA 2GC8A 4HH2A 2JX2A 2ZFCA 3V2QA 3NS6A 5IT4A 2AYMA 5LXRA 1S2EA 4OYXA 1EP4A 2JJ4D 4DV4F 3OR2B 3BKTA 4AL5A 3GJSB 4LF9F 1DTQA 2E75C 4UW2A 3CTRA 3H5UA 2K7JA 4C97A 4I6WA 2V8DA 1L0LJ 1NPPA 2YKNB 2W2OP 3HHEA 5E0OA 2LXIA 2F40A 1B99A 3M9QA 3HULA 2PMHA 1REVA 1N0VC 1SS1A 3EPIA 2KTQA 4FS2A 5DRKA 2D2CB 5ETKA 3FRZA 1GDTA 4N8NA 4FXWA 1E79H 3PTZA 1VQ7S 3AE1C 3D6ZA 3M9OB 5G0RB 1QE1A 2VPWB 1S48A 1IKWB 2RKIA 2QG4A 3OSPA 2KP8A 3SWKA 4B9UA 1FOSF 2OIHA 4H4MB 3M2UA 3BBFA 4ZCLA 2MQ8A 1I94F 1XTZA 1IBKJ 4DCOB 2J59M 3CCLP 2DR6A 4ZVHA 2HURA 3PFOA 4P2XA 1RU2A 2QSIA 1FDMA 2ZBPA 1YYCA 4C98A 4OHZA 3GV8B 2DYAA 1VK8A 3JSRA 1T9XA 4DR6F 3BCCJ 2WSEJ 3L72E 1AZSA 1S6UA 4DU7A 3IR6B 1SL1A 3MMAA 1A7GE 4HACB 4EIJA 2RU9A 1JJ4A 3H32B 1NNDA 1X5TA 1XR7A 4NZ6A 1Y0HA 4ZA1A 3CVKA 1RE1B 2LMIA 4KY3A 3G9CA 3F41A 4FKYA 5L9NA 3D0HE 3CJRA 1Q78A 1Z4UA 3QAUA 2WPRA 5CBOA 3CCSP 3MMBA 4HTIA 2J6TA 5LMNF 5HSPA 2AP6A 3DRRA 3OL7A 1BQMB 1VQOP 3FBCA 2AIRB 5H9EJ 4I2LC 2FD2A 3HVTA 3TA0A 3TEHB 1KLNA 2POKA 3CCWA 2NRGA 4DV7F 1BWEA 1QTMA 1NOHA 2MPUA 3JS9A 4N6JA 2JOQA 2QSWA 4OZ0A 2RMZA 3H5SA 5DQHA 2QRRA 4PPDA 2MSTA 2SPZA 2CXEA 3UCZP 4AL7A 1W2IA 2FJXA 2R7OA 4OYPA 4ZVEA 5CD4A 4KKOB 4JI3F 3BATA 2RE1A 4HT7A 6FD1A 5A8WA 2C2MB 3TZZA 2OJ3A 2HVDA 2V50A 3FKBA 4J9RA 1P84D 1BHNA 4RKUJ 5AVYB 1NU1J 3CWBJ 4PUOA 2W6BA 3H1KG 3L71D 1IR2A 1KILD 1QVGO 1GW3A 1X5SA 2H89C 3CCES 5IM0A 1SJFA 3T1YF 2XNRA 1RP5A 5AW7B 1RTIB 2EFQA 3E01B 2JEGA 3TARA 4TY8B 3AD7C 3UCGA 2XLIA 5E3RA 3C46A 1P27B 4P10A 2H7HA 2FY1A 2MY7A 1XC9A 3LP0A 4DG1A 2OTJS 5EFWB 4KTQA 2AQ4A 3SCJE 4ELUA 3KJQB 1GL2C 4PG8A 3FZBA 5KFVA 4B3OA 1SFCA 3POTB 3RJMB 5HVFA 3TR5A 3UD3P 1SQGA 3G2XA 5I3PA 3VAGA 2QLWA 4IOAQ 3DLEB 1G1XA 3EFFK 3MM7A 3RB3A 4AUWA 3ITHA 3VCDA 4X4SA 5AE1A 3P6YC 2DRDA 2HVIA 2UVUA 1Q8KA 1ITPA 2ZNYA 1RKJA 5IFMA 3BO4A 4EYYQ 1HNIB 3RTVA 2RT3A 1IM4A 1HWIA 1RT4B 1B0VA 3PO4A 2K1RB 2RUSA 5E5NA 1ZPVA 2HAIA 5SUHA 5BR8F 5E7OB 3NL0A 4LFBJ 4EK2A 3OSNA 2ZVOB 3DHWC 2MB0B 3N0VA 3GV7B 4LF8J 1GW4A 2MQMA 5IT9Y 1KLMA 3TSIA 1U6ZA 1AV1A 2PFFB 3EFGA 1N73A 1SV5B 2R7SA 4YEAA 3VQSA 4U95A 4DZ6A 1TL1A 1SQVE 2EPIA 3VMZA 1LXJA 5KT7A 1RISA 4PKDB 1YQ3C 3MEEB 1N88A 2IBKA 1S1TA 1O6XA 3Q2TC 3NBPA 2HR3A 2B7CB 1S77D 3PYGA 4JUZA 1RAGB 3TUZC 2I5JB 1FF2A 3KLIB 4NLSA 3GB0A 1Q81Q 2P6SA 1USEA 1BE4A 3DM2A 6AT1B 1WJ9A 1S9GB 2DRAA 1JKHA 5CABA 3ET6A 3T5LA 1N52B 1FJCA 3R5GA 4JV2A 1IKVA 5KLVE 1SC4B 4DQSA 2WRMA 2O01J 2C2EA 2WVRA 2VRSA 3NFQA 3BQ0A 4MIWA 2ASYA 1YQ4C 1FRLA 2RB7A 2KXHA 3LP1A 4TU8A 2ZBIA 1MMNA 3RK3C 1EP4B 4HKQA 1H7WA 1TK8A 5KAFH 5TISH 2PDAA 1DTQB 2QLXA 1V3RA 2E1CA 1IBKF 1WKKA 4LSLA 1WTFA 1N34J 3W66A 3D6HB 3PH0A 3MEKA 2M8HA 2XI3A 2XY7A 5DJBA 2BJ9A 2IDLA 3CJ8A 4C0OC 4CM0A 3TVKA 3EGZA 4B3RJ 4JB8B 5A8KB 4UOCA 3THVA 2ACMA 4ZJQA 5KFHA 4ZVPB 1SUQA 4LVNP 1RT3A 3K5NA 1ZAXA 4F25A 3TNUB 1HGZA 5D4PA 2EW9A 4DZDA 1SQPJ 4LF6J 2J9CA 2XS2A 3L73G 3TGUE 1L3SA 1RKIA 3R8YA 3FXEA 3HTKB 4MN4C 2FXMA 2CQCA 1QE1B 1QAYA 3OA7A 1WHVA 3C1LA 2A06E 1Y10A 1SQXG 2CADA 1IN0A 4EOTA 3R5JB 1L0NG 2VFSA 2A45G 1MKMA 1JJCB 4ASWA 3M2UB 1R5LA 2JL9A 2FHOB 3K0JA 3P45B 1FD8A 3K5BA 3CCUP 4RW7A 3KLGA 2ZJRQ 2C1EB 1JY2N 4J9OA 1S76D 1TU3F 3BR8A 4JV5J 2J0QD 4BRYB 1YVFA 1TUVA 2L5GB 1KC8T 4EGLA 2ZYAA 4WTYA 2MJZA 4IRKA 3HSGA 1U2FA 1OMIA 4EZ9A 4MK8A 1I1GA 2HQFA 3PYDA 2D74B 5DS7A 3P49B 4W90B 3H1KD 2XBPA 3MMAB 3GSIA 1YHQS 2GIRA 1WG5A 4LQ3A 2F63A 2FYUG 4WU3A 1MG7A 2P9GA 1X9WA 1GX6A 2W4CA 2P2UA 2V7QJ 3HD2A 3T5JA 4R8UA 1GT8A 3T19A 2DHAA 4PWWA 2QL5B 4IO9Q 2IDEA 3H40A 4H54A 4PEOA 1KC8Q 3KFWX 1EDLA 4RBTA 1VIOA 5DDQC 1JJ2R 1F9HA 4BBYA 1HWKA 1M5KC 3OHBA 2GJIA 1RQUA 4FBUA 3MMBB 3C3LA 5IV4A 4Q7AA 1BQNB 1OW7A 4KPCA 2F8EX 4C11A 2JC1A 3ITKA 4F4YA 1E6YB 3N01A 2M8RA 3HVTB 2KH9A 3DLJA 1F2HA 1M8OB 3MMCA 2R7XA 2IBZE 4U6PA 3KDPB 1JXLA 4YTPC 3TDKA 1Z2LA 2VDIA 4G1PA 3R2CJ 3AJ1A 3IR9A 4GVBA 2JDJA 3CD6P 2RHSB 1OY8A 1UCNA 3ADAC 2LXBA 1FKPA 3USSA 2E9TA 4NASA 3CIMA 2UUWA 2GQQA 2D2CC 1T8EA 2QN6B 1ACMB 2K06A 1XNRJ 3GFXA 2HPCA 2PA8D 1C0TB 2X1GA 2J8SA 3VVTA 4FPRA 3N9UC 2BKOA 4CO2A 2VFRA 4EBDA 1UVLA 3RYLA 1N56A 4O23A 4UTGA 3SQGA 5AW4B 2BA9A 3K5PA 4LFBF 3HUSB 2BABA 4WE1A 1TK5A 4KGVB 2WBRA 2BJ3A 3I5CA 1V5IB 3MPUB 3EWGA 1H3DA 2D9OA 1EDKA 1RWOB 1WF1A 4LF8F 4U3FG 1LW2A 3DDKA 3NCRA 4ELVA 1FTRA 2GMHA 2M0GB 3LP0B 4DG1B 1N5YA 1TU0B 3HSZA 5M2UA 1U1RA 3KJFB 3EX7B 2QT7A 2OEMA 1VI7A 3IS9B 4DJBA 4KE5A 1U0SA 3PRVA 1V6HA 3L70G 3MM7B 3L72J 2NUHA 4FXDA 3SCKE 2O66A 4CI0B 1CVJA 3QGHA 4RUCA 1OVVA 2ASLA 1WOOA 1KN6A 1Z1ZA 2Q79A 2I1KA 3L35A 1ZP0C 2BDPA 3QFHA 2H1YA 5E2QA 3M9BA 3NMDA 2CZVC 4DOJA 1FZBA 2P5VA 2IVYA 3OQ2A 4X4UA 2HG5D 1OY6A 1KLMB 2MJUA 2ZKUA 2HZAA 2ZH9A 3C9IA 2CPYA 1KHVA 3ZZTA 4C48A 3AEBC 1U47A 1GL2D 1SCJB 3CXCR 1KVJA 3FGVA 5FJ4A 2YVSA 2ITAA 1LT9A 5HJXA 4N47A 2F1FA 4LFCJ 1RHJB 1TL1B 5KKZB 4PQUA 1CSBA 3KLFA 4OZLA 3V81B 1VDFA 3NNCA 2QX0A 4DL4A 2UVVA 4J9UE 3M8RA 4WY4C 2XNXA 3WU2H 1S1TB 2DNKA 3BKFA 3NBPB 3IN5A 1KTVA 4M95A 3K5OA 4ID8A 3DLGA 1PL5A 1X79B 1DBDA 3H1LE 4RU9A 1RF1A 4LSNA 1SXLA 3R6GB 3WC0A 5GADI 4D6TE 3R7NB 1FZFA 1SH0A 1KBRA 1N34F 2E5TA 3DM2B 4K4TA 1UL3A 3EZUA 1IFJA 1N0UA 3KDNA 4OZ2A 3RL0B 2IA6A 2DNHA 1JKHB 4DX8H 1GZLA 1T05A 4WFZA 4DL0C 3ET6B 2QEXS 3L73D 2KYXA 5DG7A 4J7CA 2O01N 4CNYA 1OIAA 2CPHA 3WBZA 1MMLA 3NMRA 4B3RF 1NTMG 1DZ5A 1SQXD 3GF7A 3M8PA 5KFBA 3EVOA 5AW5B 3HK2A 3GR0A 2J7WA 2MGZB 1KWMA 1U24A 3WQPA 4EYIB 1NK9A 4LF6F 5B7WA 3KLEB 1Z56A 2CQHA 3ICLA 3JSMB 4Z7YA 3R5AA 4NXNJ 2JO1A 3GHGB 3S8SA 2E1PA 1RTJA 1S72P 1RA6A 5D4LA 4C8KA 2AF6A 1JY2P 1FRHA 5BYQA 1BCCJ 2OYHB 2W90A 3CF5Q 2N7YA 3P3DA 4OX9J 2KXPB 2HLOA 3KMQA 5AW2B 3C8VA 3UO0A 4LSLB 3MR5A 4DFMA 2FYUD 3KK3A 3SCLE 5J2QB 3ZZOA 1C4AA 4WZQA 2FYNB 1O51A 4JV5F 3HHDA 4QR0A 2I1JA 3MM8B 4O0IA 4IRDA 1UZHA 1S49A 3WUVA 1XMQJ 2E5HA 2X3GA 3DOKA 4KFBA 2BASA 3IM8A 5L9XA 3HP6A 4URQU 1LQ9A 5KFSA 1DFDA 4K5RA 1JK9B 1RWNB 1HBMB 3QJLA 5A8RB 3HZEA 4P2FA 3Q86A 1TL7A 4ICLA 4J37A 2J6UA 1KORA 4O0NA 2UUAJ 2AZ1A 1M56D 3ZDMA 2KB2A 4ZVOB 2XMJA 2HG4A 3T9ZA 2A18A 4FYWB 2LYVA 3MR6A 2V34A 1RCOB 2R2UA 1SKUB 1Q79A 5C25A 4RW7B 4HDHA 2WSCJ 1QUVA 3KLGB 4Y2MA 4ED0A 1RAJA 2HNDB 1TK0A 4F3MA 3K89A 4JOUA 1OYDA 5B0DA 3C16A 1VQ6S 1MNEA 4KT0C 1B70B 1CI6B 7FD1A 4DR1J 4P74A 2YQ3A 3E1RA 3IGNA 1NHKL 3A4TA 2YPYA 4DL3A 2MQOA 1FRXA 3OR1A 1S10A 1MWQA 2XV5A 2MZ1A 2IRYA 3ETOA 4F4KA 1UJ6A 2OYOA 3K8VA 3H42A 3W68A 3QPIA 1SQBE 3D6MB 3G96A 4R8UB 4FYXB 4X65J 1MW7A 5D77A 1XWLA 1JLAA 4DL6A 3B5NA 1TMJA 2HQDA 3O8ZA 5KLVJ 1XNRF 2YXRB 2VHGA 3N7NA 4TYBA 1CS4A 3R5BA 4TQRA 4U3FD 1S0MA 3A0HE 2XSJA 3G3ZA 1RE3C 3D28A 4F4AA 2DXDA 5B0AA 1PBUA 1JIHA 5B0FA 3CCRS 3S1KA 1UFKA 3JCUE 3L70D 1SJ3P 1U1QA 3C6UA 2V9WA 1SJRA 2G4BA 3RGIA 2VKZG 2LKMA 2C2NA 2NXCA 1U7LA 1NPRA 4OX8A 4YFUA 3BDPA 2BACA 1O5JA 3AEEC 4QPTA 2E1MC 1FKPB 1JNZB 2FVQA 5GADU 5CCGA 2DGWA 3RW6A 5IWAJ 3I55P 1J1DB 2UVRA 4FXVA 3S7RA 1KN7A 3CMEP 2M8DB 1JTHB 2YNYA 2O3DA 2HQ3A 4F7VA 1PO6A 1PV3A 3MI7X 3AHPA 2V8GA 1ZTTA 2YX1A 1M1JA 3L4FA 1EARA 3R7SB 4CH0S 1FK9A 3MUMP 1TELA 3D1QA 1IFNA 3M7VA 7FDRA 1S1VA 3MOJB 2IYOA 4WE1B 3MGJA 1RTDB 3T3FA 2KU7A 1K47A 1JY2O 3W60A 1R0CB 1HWLA 3MZIA 4ZKUA 1B7YB 1NTKG 1LW2B 5I42B 1OJ4A 2O67A 2KN4A 1J27A 4UOHA 3P8CD 2EFOA 4F0KA 2E5IA 3OW2O 5E41A 2XMVA 3B54A 3R1HA 3GLMA 2KJVA 3HFVA 1Y5IB 1Q2NA 3FC9A