1KQFB

Formate dehydrogenase n from e. coli
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
289
structure length
289
Chain Sequence
b'AMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPADLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELAEQRVAKLKARGYEHAGVYNPEGVGGTHVMYVLHHADQPELYHGLPKDPKIDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIGPNKEVDDDEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
publication title Molecular basis of proton motive force generation: structure of formate dehydrogenase-N.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 87
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2002-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF09163 Form-deh_trans Formate dehydrogenase N, transmembrane
B PF12838 Fer4_7 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.480 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1kqfB03
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqfB01
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqfB02
1HFEL 2V4JB 3EGWB 2WB1D 7FDRA 1DURA 2FDNA 2VPZB 5L8RC 2O01C 1C4CA 3MMBB 3HKZD 3GYXB 1DFDA 1KQGB 2VPYB 1BD6A 2Z8QA 7FD1A 1FDNA 2C3UA 1H98A 3C8YA 3EUNA 3MM9A 3MM7A 3MM6A 3MM5A 1KQFB 2XSJA 1A6LA 2FGOA 1VJWA 2Y0SD 3IR7B 2WSFC 1Q16B 2IVFB 1FRKA 1FRJA 4KT0C 2GMHA 1GAOA 3MMCA 1FF2A 1F2GA 3EXYA 4OMFG 1K0TA 3OR2B 4XDDA 3IR5B 1FXDA 1JNZB 2FJDB 4XDCA 2FD2A 4YDDB 2VPWB 1Y5LB 1CLFA 1BWEA 1B0PA 3OR1A 3MM9B 4L6V3 3MM6B 1B0VA 1FRXA 3PNIA 1B0TA 1FTCA 1Y4ZB 1GTEA 3MMAA 1Y5IB 1SIZA 1IQZA 1GT8A 1F5BA 5BYQA 2C3YA 2WSCC 2VKRA 1FEHA 2WSEC 3MM8B 1FDAA 1AXQA 1G3OA 2C3OA 2V4JA 2FJAB 2GMJA 1FRHA 1C4AA 1FERA 5CH7B 3MMBA 2PMZD 1SIWB 1PC5A 1FXRA 2FJBB 1KEKA 1FRLA 1FD2A 1F5CA 1R27B 1Y5NB 1FCAA 4DHVA 1H0HB 1GTHA 3MM7B 4CI0B 3MM5B 1IR0A 1FRMA 2V2KA 2XSJB 4Y28C 3LW5C 1PC4A 1BQXA 2WAQD 3MMCB 1SJ1A 4AYBD 6FD1A 1WTFA 5BYSA 3OR2A 1DAXA 5E7OB 1FDBA 2C3MA 4OV1A 5BYRA 2C3PA 1FRIA 1D3WA 1G6BA 1RGVA 3OR1B 4XK8C 5CHCB 1JB0C 1FDDA 1H7WA 1ROFA 2VPXB 1BLUA 3IR6B 1BC6A 6FDRA 1JNRB 5FD1A 3MMAB 2ZVSA 1H7XA 2C42A 2PA8D 1XERA 2UZAA 2PDAA 3MM8A 4ID8A 2FJEB 4RKUC
chains in the Genus database with same CATH superfamily
2HNDA 2JVRA 1AJYA 2RQMA 3BM7A 1LTAC 4J9OA 1UVIA 1LOUA 2IRUA 1YJTA 1UVKA 1TL1A 4A8YA 4CIOA 1IJEB 2EPIA 3NWGA 1N8RQ 1RT5A 2M88A 2BR0A 1IBCB 3GIMA 1LK7A 4USWA 4OLOA 4B86A 2FD2A 3VAIA 1NJXA 5K14B 4BC7A 2ZM6J 2W9CB 2DY1A 1FZAA 1Y5LB 3I5AA 4AQYJ 3TUIC 3N6MA 3BYPA 2AP6A 3K5BA 4QQBA 1PIEA 1EZVG 5DRKA 4K0KF 1VC6A 2EW9A 3W9IA 2NSCA 3AE3C 4JI2F 2NCKL 5RUBA 3L74E 4NPOA 5DS7A 4DHVA 1H0HB 1EDKA 3Q8UA 1LT9C 2UVWA 1EZVI 3GV8B 4B3MJ 5KAFE 3SSQA 2YNIB 3HXMA 4ZLLA 1MMDA 5I42A 3M9MB 3PW2A 3J80Y 3QWUA 3T5LA 3C6TB 2JJLA 1N52B 4MFBA 4F4XA 5KFVA 3M91A 1ZTWA 5K20B 4ZVEA 3O2IA 3OUYA 3CJQA 2A6MA 2Q6BA 3PDNA 2ACMA 2W9CA 1RT7A 2YWGA 3CDUA 4DR7F 1SUQA 4DR6J 3DYAB 5C5JA 4RWXA 1FDNA 1L0NG 1ZETA 4YTPC 3LP0B 1TKTB 3G82B 1U48A 4K5SA 1NYHA 3Q83A 2OYHC 4FYYB 2Q43A 2VG7A 3GIRA 1HWKA 1NK6A 4K2XA 4JV5F 4C0HA 1IN0A 3CL3D 4WFXA 1F6TA 1FEEA 2HWIA 4UY85 4DR4J 3FK4A 3MOZA 2K1RA 3GIJA 2JFKA 3H32B 3CX5E 2VODA 1XNRF 2FZKB 3JB9k 1K73T 3HCXA 1FWKA 1V9OA 4IDKA 2OEMA 5F9NA 4U96A 3UNYA 2W27A 2XCAA 1PP9J 3NG8A 4PD4D 2DYAA 2ASDA 3SSSA 2ZVNB 3H59A 3EJMA 3K17A 2N1TC 3HD7B 3H1KG 1JY2O 2CPHA 4WFBQ 2RSQA 4DSEA 4NI2A 3MP7B 3FNNA 3V6DA 3DM2A 3WMM0 1UMJA 3DYAA 2U1AA 2H5IB 5AW8B 1P27B 4CLKA 2NSBA 3DGVA 4EIJA 3IG1B 3KLHB 4OYIA 4GKJF 3D5MA 4OI0A 4WKYA 3C9IA 1KHWA 2WSFH 4ZPAA 2Z4EA 2K9YA 3ITHB 4CDIA 2XG8A 4ZMMA 4LF4F 3RL0C 2IFXA 3GR0A 1D9AA 5DG8A 2E9ZA 4ZPTR 1QX8A 1SL2A 3C14A 2H65B 5KFLA 2MQPA 2BM0A 3CB4A 3RG6A 1QJHA 2CAJA 2ASYA 2W90A 3M7VA 5APWA 3NEKA 1FEHA 4ZPWR 1VMBA 3MEEB 3U1AA 3OQ2A 3HD7A 1MFTA 1FAVA 4Y2KA 4CP5A 3CMEP 1CS4A 1FXRA 3OL7A 4ZCLA 1NAYA 3HE5B 1UCNA 4DSLA 2G4BA 1ITPA 2FTRA 4ZLJA 3I0SA 4JI7J 1DX7A 3UIAA 2DCLA 1HNZF 3D6FB 1RE1B 5HANA 1IFJA 2QO3A 3UDEA 4DF4A 3KJFB 1G6BA 3OTEA 2B9WA 1R6YA 2ZBPA 4PR6A 4XK8C 1SH0A 4RJVA 4M5MA 4I1LA 3F5HA 4RW6B 2JDJA 3QT5A 3GHGA 1GFWB 3SMZA 1G7CB 2AF6A 3GFZA 1LFWA 3M2RA 2QLWA 4ED5A 2FDNA 2ZH1A 3CO9A 2YWKA 4OHZA 4MK9A 3OTDA 1GMVA 4NYZA 3MCNA 2DVIA 2CJXB 1IK7A 2FY8A 5TISE 4WP9A 2IRYA 2ILZA 1NH8A 4NEZA 3CCLP 2DNOA 2HQ3A 5ETSA 1WEXA 4CTAA 3D6TB 4ZVUB 3QLHA 4ALZA 4QW9A 3IP0A 3FEXB 1CLFA 4U7JA 1IKXB 3IO1A 1HNXF 4DR1F 1MN9A 7AT1B 2DITA 3M2VA 1VRTA 1VQ4P 3FWLA 5CYMB 2ZHOA 5E0OA 4H13D 3HP6A 1FX2A 3AJ2A 1B99A 4LRAA 3Q86A 5DM6Q 1DY3A 2HLTA 2LQ5A 1RZMA 1CW5A 3M8ZA 1OPZA 2HHHJ 3UN3A 3I9V9 3DMJB 1OW8A 1NKZB 4K4TA 4KHMA 1N6QB 2D2CD 2CQ1A 4USVA 3B6BA 3NGUA 1VLOA 4ZJQA 3G96A 4HKZH 2UP1A 1K73Q 3VP9A 5CHCB 5GMDA 4C6AA 5LMNF 3LQVA 5E3RA 2F8MA 3J81U 1QSSA 3FQLA 5FD1A 2RVJA 3I9ZA 3HM9A 3A12A 3KUEA 2R8HA 2IZ0A 1M5VC 1TK8A 4ILMA 1RWVB 2VFRA 3NGTA 4PG4A 3VGSA 5IT4A 3FGAD 3ETOA 4Y00A 5IV3A 3EUNA 1LW2A 4OGQD 2WSFJ 2AYBA 2J7WA 4GOFA 1IKVA 5CYMA 1RU2A 1EZVE 2JLFA 5KTQA 2PMWA 2YWWA 2XS7A 3IBCB 4U8VA 2M3EA 4I64A 1MW7A 5LXRA 3Q8VA 4W7YA 5AW3B 3CIZA 4WYLA 5GTIH 2JEEA 4ETZA 2UUCF 3VTIA 2VQEF 1DLOB 1UFKA 1NTZD 1V5VA 3TWZA 4DUYF 1WELA 1U1OA 2FJBB 5GAEI 2QZ8A 2D41A 1ZPVA 1FCAA 1OVRA 3NKYA 1ICEB 3PH0A 2QJ3A 5KT5A 1PP9G 4FPIA 4AYBD 3OR2A 5LM7E 1IBMJ 2VD3A 1LTTC 3WX8A 2YKOA 5D4OA 1JB0J 1Q1KA 4J9QA 4X64J 2CNOB 4PV1D 4X66J 4IRKA 3D70A 2MJUA 4FNHA 1X8DA 1O5JA 2MJNA 1U09A 5DQHA 2UUTA 4I67A 2OI2A 4QJVA 1L3VA 4DQQA 1UA0A 4IOIH 1CC7A 1VRUB 3MURP 5LSLA 1NTZJ 3AB4B 5DJTB 4DCJB 3R7NB 2R3CA 1RE3C 2YKMB 4CCHA 3NCRA 3PP5A 3P32A 4IFDK 2DTJA 2HVZA 1RE4A 1YRXA 1Q7YT 3HZEA 3D9BA 1YSJA 2QV6A 1TL7A 1VR6A 2B4UA 1SKSA 2Z5HA 3CCMS 5D4PA 2HZVA 1H74A 4U6PA 1HARA 1X5TA 4PPDA 2KZIA 4Y2MA 5GAHI 3N28A 4EYYQ 2HHTA 1YKWA 3H1HD 2C3OA 2HBRB 1SPBP 2YQ3A 5E3QA 4OZ3A 1G2CA 3W60A 3C16A 3H1KE 2CA9A 3JYTA 4ES3A 2QL5B 2QMXA 1S9EA 1EKSA 4P75A 2JWNA 1HWJA 1K1SA 2RHSB 1U1RA 3S7RA 1SJ1A 2KB7P 1R5SA 1M0SA 1RA6A 1JJHA 2B51A 4ZPDA 5CABA 3TF5A 4NYPA 2HGNA 3M2UA 1KB9E 1WEZA 1Q78A 4FZVA 1FDMA 1H7WA 3GFXA 3ISZA 3M8RA 6FDRA 3RTVA 1QVFR 1VQ5P 1YRUA 3X1LB 1FS0E 3DLKB 3HK2A 1H38A 3QFHA 4W90B 4KHRA 1RBAA 1S4FA 3CTRA 7FDRA 3EWGA 4G65A 2BYCA 3LH2S 3LP2A 1Q81T 4MN4C 1NDKA 4F8RA 3LOUA 2COLA 3M05A 3H1HJ 1K1QA 2MZQA 1NTZK 1SQVJ 4WKRA 1M1KQ 3DRSA 2H4YB 4XE5B 3KG1A 1CSJA 4I2PA 4LF6F 2CQIA 1VBZA 4Q45A 1HGZA 4C98A 3PNIA 3TX0A 2J9EA 4Q8EA 5KT2A 1LTIC 1S6QB 2XZTB 2FY1A 3CO0P 2FFDC 1RF0C 2BCCD 1DRZA 1BUXA 2EC2A 1X31C 1SQXD 5CH7B 3KWMA 5HJXA 4KIAA 4CI0B 1VGYA 3MMJA 3I56S 4OX9F 4QIFA 3QIPB 4HL9A 1HBOA 1AUSL 5C24A 5J2PB 4I7FA 3TVZA 1U0HA 1U1MA 4DLGA 4QU6A 2OARA 1R5LA 1U1LA 5C25B 2VPXB 1S3JA 1BLUA 2C9NY 4R4MA 4DX5A 2EXUA 3PTZA 2YX1A 4ID8A 5B7WA 3DI6A 2CZVC 1XR5A 4H0LD 3R2CJ 1SVFA 4H13B 2HQFA 1GZLA 4ENOA 5KOXA 4QR0A 3GF3A 1P84I 2IBZG 2GNKA 1KQLA 2BCCJ 1WOPA 2ZVIA 2B8PA 3I4PA 1FDIA 3I5CA 3I31A 1SQXJ 3IWXA 3T1HJ 4AYCA 4ERDA 2ZITA 4K59A 4OMFG 3N5BA 1HBNA 2DHXA 1IM4A 1SQVK 1AVYA 3M30B 3D66A 1ZA1B 1KR4A 2D2CB 2XV5A 5CZXA 2IBZI 4H0LC 2AGOA 2K7JA 1WKKA 1U1NA 5KAIH 2BKNA 2WOMB 1XMQJ 3MR3A 1S9FA 4HB1A 1TZ0A 1K44A 4Y34A 3TEHB 1VQ7P 3SIPB 1Q7YQ 2IDEA 5AXMA 3KLVA 4KHPF 1IR0A 3KJVB 1A9NB 3R5CA 1KZUB 4NL5A 4RZRA 2Z0GA 1L0LD 4DUZJ 2CJQA 4JI1F 4G1QB 5B0BA 3CXHH 1U47A 2WTYA 1H73A 3B71A 3ONQA 2QSWA 5K8PA 4OL8A 1U8WA 1S1UB 2BOPA 3BR9A 1VQ6P 1IBLJ 2NPFA 5J1PA 3KG4A 3GW6A 1N7LA 2IPPA 3VMYA 2B7BB 4KV8A 1UWAA 2EEYA 2HPCB 2B56A 4IG0B 4N78D 3RK2D 3V2PA 1ZMEC 2GUVA 1X4GA 3G2XA 1RT6A 5C2CA 3DLGA 4IH5A 4RNHA 2Y0SD 2B9BA 1NTKD 1X5PA 2UV8A 5E3PA 1F2GA 1SH3A 1SQXK 4C2MA 4A46A 3EGZA 2ROEA 3V4QA 2AXCA 1L0LJ 4FYXB 2Q79A 1RCOB 5LSOA 3KJVA 2E7XA 1YJ9P 4PV1B 4PQUA 3BN4A 2CPBA 2IC3A 1H72C 5FJ4A 4OJHA 1PP9E 2ZBIA 3EXCX 2RD5C 2I6WA 4WBFA 3ZFVA 1OPIA 3UPFA 4ZN3A 3ZZYA 3TGUJ 2M5AA 3Q24A 3KMSA 4B3SJ 3MGJA 1R7IA 4N8NA 1RJJA 1RT1B 1CJTB 3DRPA 5KAKA 2NR0A 1VQ7S 4CZCA 2CPFA 2GZOA 2QX0A 4A8FA 4K4YA 1T11A 4NPEA 3MD0A 2VQFJ 3A0BH 1HKAA 1JOCA 2VONA 1WC6A 3M1VB 5J2QB 1JCDA 2MQNA 5APTA 4A48A 1FNXH 1S1TA 3N5FA 4YR2A 1YIJP 4RBTA 5JXSA 4TY8B 3MPDA 5ETVA 4WY4C 2YNFA 2O01H 1X79B 1MROA 1QL2A 3FJ2A 4UUXA 2DGSA 2HVEA 3CJ8A 3A8KA 2Y9ZA 1SQVG 1I6JA 3V4IA 5D0GA 3POTB 1TQLA 2KS1A 3KK2B 4CLTA 1IK9A 2BZ2A 3G4SP 4J91A 1UZDA 1IR1A 1UA1A 1L0LK 3GIIA 5D6GA 3C6UB 3HUSB 3EVWA 3VAGA 1HHSA 3GFHA 5CCHC 3GHGC 4OYAA 4PXEA 2R4FA 4USIA 1FD2A 1FE6A 1RT1A 5A8RB 1X9MA 2FFDB 2LXFA 2QN6B 3RK3C 3TQ1A 5L1KA 3KLEA 3R5AA 1J5OA 5KFNA 1YJ9S 2DB1A 3N01A 3SQGA 4RW8B 5J2QA 3OR1B 1S6PA 2HG4A 5E79H 5J1EA 1JLGA 2YNHA 2KSJA 3LUYA 5FDLA 2W8ZA 3K5LA 3MEDB 4B3OB 3MIWA 1N5VA 4DSIA 1JY2N 1M5HA 1T7PA 4NMXA 2KTQA 3W2VB 5LSRA 5HMWA 3ENAA 1AFOA 1XMOJ 3KKFA 4ASWA 4O0NA 1JXVA 2NZCA 3OVSA 2E1CA 3OHBA 1EDJA 3T97A 2OPPB 3IM8A 2MHNA 2DPJA 4OI1A 3KUGA 5KG4A 2KJVA 5L1IA 1UKUA 2E76C 2J0WA 4P7TA 4TKTA 1SQBG 1KILA 4Y6IA 4ZCMA 4DV7F 1V5IB 4RW9A 3HHLD 1YITS 1XEZA 2LQ8A 3BSAA 1YIJS 2HS4A 3B82A 4WFZA 3OVAA 1PZQA 1H8AA 1FOSF 3U7JA 4H0LB 1GL2C 4ZMDA 3MDFA 4DR3F 2W01A 1JLQB 1RWPB 1RBOB 2V94A 3PYGA 1TL4A 3G4SS 2F7VA 4BWJA 3QNWB 4ASVA 3FBEA 5M1BA 1VDFA 3OTOJ 1WF0A 2DNQA 1B7FA 1X4BA 2C3PA 1O6XA 2X1AA 5IWAF 2G2ZA 1S10A 1FDDA 5KFAA 4FYDA 2G8YA 1TVRB 4FKYA 4DPYA 3PW0A 2I5JB 4OI3A 3MEKA 2OPPA 1ZAVA 3MM8A 3AXKA 2O01C 1LWUA 3M8PB 1AA1B 4OIXA 3A7OA 3WQPA 3G87A 2ZXEB 4DV4J 3BSNA 3HJFA 4X2BA 2L48A 1M57D 1VHIA 3JAMY 2M52A 2FLPA 1FJPA 3O8ZA 1WF1A 3Q8YA 1KFNA 3OA7A 3T19A 2M5YA 3PVXA 3KNGA 3EM1A 3JSVC 3R4YA 3R3TA 1YHQP 2CQ4A 1Z2ZA 1OW6A 3EDRB 1LK5A 3OAKA 4ETXA 3DDKA 2HK3A 4PCQA 4JOUA 3RK2B 3PACA 4CO1A 5L39A 3QATA 4QBUA 5KT7A 4PPZA 4ED3A 4NCAA 3SSRA 1H0TA 4J37A 3HVRA 1N33J 1HNIB 3ZZUA 3TGUG 3KYLA 4H4MB 2RUGA 2W9BA 1Y9OA 3SCIE 2K06A 1FJ7A 1KRPA 3PTWA 3O6QB 2PIIA 1ZZNA 3HSDA 5F8GA 4GVBB 1V3ZA 1VF5C 2HS0A 3CDEA 5L8RC 5KG3A 2EVZA 2GGPA 1WC0A 1R0AA 4J9NA 1GTWA 2HBQB 3DCAA 3BREA 1FE0A 1G4CA 4LF7J 2V0NA 2IM1A 4ED1A 1NJIQ 4H54A 2ZZTA 1YGYA 1KLMB 3GFYA 4DBQA 1Q5VA 1WRGA 5L8RJ 4TU8A 2HVHA 4WY4B 5G4DA 3J7YU 3AD7C 4M95A 1UTAA 4O3QA 1MUUA 2PI4A 4DL4A 4R8UB 1K05A 2WBRA 3VTPC 4Z7CA 1T3JA 3MWBA 4WFAQ 1F0XA 1RAFB 3H8YA 2AZ1A 1PC5A 1RWMB 1TL3A 3NAHA 2AW0A 5L1JA 4I4BA 3AY0A 3I0RB 3J7A1 4HYKA 3SCJE 3CCTA 4QOTA 1DZ5A 4ECXA 2VG5A 3CE8A 2B9YA 2Z2MA 2ZJQQ 3HFVA 1KN7A 5AW1B 2O66A 4USTA 1PSDA 3UO0A 3UWTA 3PW7A 2IJFA 2DGOA 3NL0A 4O0IA 3PRVA 2B9EA 1RDRA 2IYGA 4KH0B 1LV5A 1QD1A 3V2QA 2HQCA 1QM9A 3IF4A 4LSZB 4NLQA 2HHUA 3H1HE 1FKPB 3AA8A 4I2QA 2BANB 5ETPA 3GYXB 4EO6A 3J7AN 1SQVE 2VH7A 3THVA 2C3UA 3T6JA 1PGQA 1KQFB 5KG6A 3BF4A 3OFGA 2OPRB 2OHDA 2XDJA 2WVDA 1NKNA 2W8KA 3CXHI 1YTZI 3H4BA 1H89A 2UWJE 1RQUA 4RW4B 5D0HA 1ZPWX 4JI6J 4YP3A 1UAWA 3I0RA 2RS2A 4MK7A 2AIRB 3BGRA 3IFEA 3PX4A 3PRBA 1RTDB 3UVJB 2E44A 3JSBA 3JTNA 1GXUA 5E3AA 4DXLA 3P4UB 5KG0A 2AZ3A 1R8PA 2DBBA 1LXJA 5DJUB 2VDHA 5AXKA 3D71A 4NWBA 3IWNC 2YO2A 2UVRA 1RT4B 1H2UX 2CPXA 1QAYA 4P6QA 1TR0A 3CCES 1VYAA 4Y2CA 5F41A 3H2UB 3A0HE 2O3JA 2J58A 4OZLA 3HFZB 2VV5A 4DL2A 2FXPA 3DN9A 3GCXP 2BCCE 3HHLB 3UI3A 3H98A 4LSLA 5D8HB 4U7UD 1IFDA 1HR0F 4ED0A 2WVEA 1JJCB 3CJ4A 1T05B 1OY6A 1N86A 2R7UA 3TUJC 3CWBD 2Z56B 4O44B 3U1CA 4U3FJ 1SQBE 5CHXA 2H8PD 2DD8S 4QMAA 4DZOA 4TYAA 2FVSA 4K5RA 5HK4A 5DQIA 5AVUB 4FYWB 2UUAF 1KN6A 4AFFA 3ENWA 5IQQA 1JEKA 2NPSA 1PL5A 4LSNB 4ZKUA 4ECQA 3RAMA 1LTSC 8AT1B 1VLYA 1ZR4A 3HSJA 2HG5D 4IR1A 4AUWA 5CJ0A 3PCOB 3IRXA 2ZKTA 2ASLA 1S7IA 2UXDJ 2OTJS 1F5CA 4XFJA 2E7VA 3CEDA 3HE4A 1JKHA 1H2VZ 1P1LA 5KFZA 4J9KA 2EG1A 4LF2A 2B87A 1F9EB 3Q8QB 5CMZA 3IBFB 3BRVB 1VOMA 1GMWD 1RCXB 1UJ4A 3WUTA 4TLRA 5KFJA 4AL7A 4LF9F 3IGNA 3AEDC 4J9VA 1OX3A 3H25A 1BQMA 1SQQJ 1PGOA 3EDQB 2ZC3A 3KUHA 1UEUA 1VQ8S 3FDSA 1YQ4C 3MMAB 4MTPA 2YH1A 1NK7A 4O44A 2PAJA 2PFFB 3NNHA 2FYZA 2E1AA 3BN7A 4WXWA 3AJ1A 2J7KA 2DHGA 3OFFA 2DISA 2LP4A 1X5SA 4N3YB 2Q3IA 1KQGB 2RKIA 5IV4A 2Q5UA 3E51A 3L71J 4USMA 4F4WA 3QT7A 1QEXA 3KLFB 2GMHA 2DNMA 3D1HA 1L0LE 4XDCA 2WZ7A 1M1JA 4KGKA 1SQGA 3CC7P 1GX5A 3R27A 2E43A 2BJDA 1HNWF 2GCFA 2DGWA 3E01B 1D9DA 3R2DJ 2V2QA 4OHVA 4NRUA 2ZJPQ 1SJRA 2NUUG 1NCLA 4YHHF 3P3DA 1T9XA 5GADI 2YPYA 1AXQA 2ZUAA 4OYOA 3EGVA 3TGUE 2IAJB 3AOCA 3MFHA 1TAQA 4URQU 1XN9A 5GTHH 3ZZ0A 2HWHA 2H9ZA 1X0PA 3NS5A 4GKKF 4KFBB 2K88A 3B78A 1XIQA 1PJ6A 2CQPA 4IR9A 4U7UK 2XNRA 3CXCR 1N48A 3IAM9 1IFNA 1L4AD 5C7PA 2GVZA 2M3DA 1TV6A 4F3MA 1RWNB 1SQQK 4P10A 2KYZA 5DGAA 3BGFA 1VC5A 3TJAA 1LWFB 2VJUA 3MPUB 1HI8A 1FK9B 1RAIB 2V4JB 1RQVA 1RWUA 3P96A 3O44A 1OIAA 1HBWA 1OW7A 1UW4A 3LAKA 2HAIA 2ACYA 2HYIB 3CCUP 2CPZA 3AE9C 5AVSB 4LIRA 2RKLA 4PD4I 1RXOB 4O3NA 1HQUB 4NCGA 2QFIA 4LFBJ 1DARA 2Z58B 2RN0A 2WT7A 1Q86Q 2BKOA 2HR3A 2YWEA 1KYOH 2AYGA 2FJVA 2LDYA 3R6LB 4KY3A 2LEBA 4IFYA 1CG2A 1Y5IB 5KAIE 3MUTP 3PYFA 2JP3A 2HS3A 2HODB 5LT5A 1BGYD 5IT9U 4F4YA 2E75D 3M0AA 3KK1A 3HPOA 1AROP 2HRYA 3M8QB 1EETA 1R27B 3BZQA 1K8AQ 4HACA 1VQNS 3UW1A 1FRMA 5GAEU 4E98A 5DQGA 4DPOA 1S5LH 3VAMA 1WTFA 3CXHE 1KLNA 4HH1A 4UT4A 5HQ8A 2UXBJ 1FZEA 2N4CA 3JTPA 2DNRA 2E75C 1YBKA 2ZUGA 3BEGB 2RH0A 2R7SA 1KILC 2QLFB 5D4LA 2KT5A 1M5SA 1DIPA 3I32A 1BDCA 3GPAA 3EQ2A 3ISND 4ZOSA 2HZAA 2HAFA 1TKDA 4KT0C 3MMCA 2OTKE 2LFVA 2VC0A 3TANA 1FXDA 2BJ1A 4U3FG 2W7AA 2RMLA 2YBVA 4NRTA 4YB6A 1BQNA 3TNUA 1OYEA 1SQPD 4ZVHA 2A1BA 5D3GA 4WZQA 3CJKB 4EMDA 4RW7A 5HROB 2P67A 3CCUS 4X4TA 4KT0J 3J81Y 4KGZB 2DO4A 3L9ZA 1S72P 4BBYA 5GAHU 1C4AA 2NYHA 2XS2A 2GAGC 2AEJA 5IOLA 1GTHA 2P9CA 3KFWX 2XI3A 3TOQA 1AVOA 2CPYA 2V2KA 1LWUC 4JI4J 1FFGB 1HNVA 3KHGA 1OQ6A 3V5RA 5HP1B 2LU1A 4N5SA 4AL5A 1KYOD 1AQTA 4LF8J 1PGPA 1JY3O 5IM0A 5A6PA 4B9VA 1M1GA 4DL7A 1SQQG 1H7XA 4RESB 3CMAP 3GJSB 2HBZB 1F3VA 2WB1D 4NLRA 2LXIA 2OP5A 2UV8G 1H98A 3QH9A 5ETMA 4ID5A 4JV2A 5F0WA 3WC2A 2YXQB 1E6VB 3NXZA 5HAOA 3CD0A 3D6MB 1JTHB 5DLFA 3K5NA 3TX8A 2K9JB 2V7QH 2ZM6F 3A3YB 2Q7CA 4QR1A 2DNKA 2V6AA 4EDFA 2KVIA 1AFIA 5KJ7A 4IL6X 2ZXXA 2W6BA 3EZ5A 4DV0J 3HJVA 3O5TB 1WDDA 1HBMB 3V6JA 3MR2A 1YTZT 3CJTA 4WVZA 4WJBA 3GF7A 5IS2A 3BKFA 2OELA 4USJC 2KYVA 3M4XA 1YJUA 1KS2A 3NXSA 5APXA 2L9DA 2D3O1 3L4BC 4L3KA 2J7UA 2W2MP 3DRRB 4BLGA 1FKAF 5E79E 1S72S 4B3MF 1LTJA 4PRFA 2CJYB 2VKZG 3L35A 3AE5C 2BEZF 2C42A 1E6VA 2Q9IA 2YKNB 2KDOA 3T5JA 3U1NA 1R8BA 3K59A 4YR0A 1F60B 3BCCD 2BACA 1ZXGA 4S0MA 1P9YA 1GMWA 2K9JA 4A8WA 2KZMA 4ZA1A 4Y99C 1GMUA 1Z1ZA 2KRBA 2WW4A 1WACA 3TK1A 4TQRA 3HF5A 3BO2A 4DR6F 5A8WA 4DR2J 1QLNA 2RMZA 1M8OB 3M9QA 1UPMB 3H1IG 5M2PA 4PABA 4B9LA 3NMDA 4YDDB 3QAEA 3A8EA 4FP9A 1ZOYC 1L4AB 4RU9A 1RTIB 2FJWA 4ZPCA 4C0OC 2J8AA 2O5DA 2XZDB 1RAGB 4F0HA 4CH0S 3V4MA 3WU2E 4DR4F 4H4KA 2XY6A 3AE7C 2CPIA 1RU1A 3MM5B 1X4CA 1JM0A 4Z2XA 4DF8A 4DX8H 5CYQB 3BCCJ 2MQQA 1HTLC 2JRSA 2MB0B 1Q79A 4ED8A 1GU4A 1NOHA 4HI1A 3L74D 1VQLP 3DRYA 1TUVA 5DG9A 2MZRA 3DOKB 2QEXP 2W1BA 2JL9A 1KTQA 2G0CA 5BU8B 2GQCA 2R7VA 1RA7A 2G2OA 5I3UA 4RKUJ 3IN6A 4DDFA 4WP8A 5KFUA 4NXNF 1BCCG 2E75B 2B5JB 2OD4A 3MTJA 3PJWA 1HQ2A 1QE1A 1S9GB 3W62A 4D3HA 5C42B 3PX0A 3OVBA 4FVCA 2NZ2A 4DR7J 4DS5A 4ECVA 1L3SA 2CPJA 3P5TL 2XMAA 3NGKA 1S0NA 4TLQA 3KLGA 4PZVA 1RACB 1IKWB 2V7QJ 3L74J 2P6TA 4WB4A 2EWHA 1PILA 4NLOA 5EWEA 3JCUH 1Q90D 1PO6A 1QDUB 3LO3A 1I94F 1YQHA 3D0IE 2I2YA 1YJWP 1FZFA 2H3EB 1J2VA 1VBKA 5KFDA 1S6UA 2QLJB 2V9WA 4JI7F 3SWKA 3HT0A 4OWFA 2N9BA 3AEGC 2CG8A 4CO2A 1S99A 3N0VA 4TXSA 1NU1J 3NCPA 2O01N 1SJQA 5C42A 4DL6A 2JEFA 2DHHA 2OEKA 1EC5A 4OJ3A 4DX7A 2P2CB 1VISA 1VQ9P 4C7NB 2NPSC 3EGWB 4M5DA 4B9NA 2KKHA 1CPZA 2DR9A 5LJ3Y 2YTCA 4U3FE 2QLBB 2ZDOA 4KGVB 3UD5A 2QFJA 3M6XA 2R2RA 5F3TA 1EXIA 1IKWA 2VG6A 4QIEA 1AZSA 1A02J 3I87A 2RDJA 1GK8A 2HFUA 4RNMA 5AT1B 4LF4J 4FXWA 2BUNA 1L2PA 2R7XA 1NB2A 2W25A 3KHRA 3LWLA 3HVTA 4ED4A 1URNA 3FC9A 4P52A 5SZTA 2A10A 2AJ2A 4ZITA 2OH2A 3D3CJ 2VOOA 1DBDA 1LWCB 3TZXA 1VFJA 3L72G 1AYEA 4NLUA 3SI8A 3JSYA 2IBKA 2HVDA 1C1CA 1CJKA 3N6NA 3GCWP 4FDFA 3AFGA 1JJ2R 3Q89A 1SQQE 2R2TA 4C7NA 4X4NA 4QPTA 4ZHRA 2C3MA 5KFQA 1Y47A 2ZH5A 4TN2A 3BSCA 3IS9A 2WPRA 1HNZJ 4F26A 2AGPA 2HIQA 2MGZB 1JLAA 4CWBA 1NU1K 4ES2A 3BRTB 4I6WA 3L71E 1RAEB 3MCMA 1WG5A 3IXQA 5DDPC 1YJWS 1C4CA 1FC2C 2W7OA 1DEEG 1S2EA 1VJQA 4C11A 1OSCA 4UQGA 3SDEB 2OPQB 2GQQA 2OYIC 2BEQD 2XHCA 3MAAA 1SKWA 4EWTA 3F89A 2NS1B 1NM2A 2OAUA 2GAHC 1D0EA 2HK2A 2PA3A 4U9RA 1LWCA 2D7SA 3D67A 1VQ9S 1B0VA 4LBPA 2PGCA 1NTKG 1XWLA 3TA0A 3L75J 4V19J 4Q2LA 1PYSB 5AVYB 1N73A 2YVSA 1W5CE 1EIYB 4YR3A 3RBDA 3TA2A 4LR7A 2E7WA 5CQGA 5LJ5Y 2OLWA 1D8YA 5AVTB 4LRCA 2E9TA 3IC1A 4GMKA 1JUNA 1J1DB 3PJXA 3FFIA 5KG5A 3QGHA 1RT3A 3DOMA 2E9RX 4Y65A 4LFAF 2L9NA 1IBMF 2HPUA 1TK0A 4I56A 1SFCC 1UVNA 3BS9A 3H1JD 4WE1A 3L4FA 2BMBA 3EZOA 3CD5A 3H1LG 4X65J 4O3RA 2KM8B 2UZAA 4X64F 3EFGA 1GK4A 4X66F 3BO3A 1K9MT 4Y0FA 1M56D 4LFCJ 4F2SA 3VZHA 3QZ7A 1SQEA 3H1IE 2IM0A 4AT1B 2BJEA 2XMTA 5J1NA 2ZT9D 1BE3G 3HVAA 3JXOA 3MCOA 2IRXA 4O4GA 4EYHB 5HSPA 4OI2A 2BJ3A 2FJDB 4NZ7A 4FYVB 5ETQA 3L73J 1UEKA 2B43A 1TU0B 4Z1MH 1FRXA 2HQIA 2A2CA 2XGQA 2JEGA 2F3JA 3CDAA 2ABYA 1EZVD 2G3AA 3PO5A 2QYGA 3RBEA 5KFFA 1RLCL 3H42A 2P2UA 3NOGA 3MMBA 4ED2A 3H1JJ 4PWUA 2J5UA 1WHVA 2M4MA 2YO3A 2OO4A 4AXIA 3HSZA 1XJWB 2XSJB 4LR8A 4DUYJ 4TYBA 4FF4A 2CIMA 4J90A 3ULHA 1U4BA 4KPCA 2CDRB 4F50A 2QVAA 3ZZZA 3OW2O 4IRDA 4F02A 2C28A 2OSQA 1BCCE 1L5UA 4HTJA 2V63A 2BE2A 2EFVA 2JLGA 4C8KA 3P49B 2YIUC 2PRRA 1NU1G 2HNYA 2L3MA 1HMVA 4X4OA 4N8OA 2LDIA 1AUDA 2E1MC 1EDIA 3P8CE 3EWKA 1YTYA 2E74C 3G8SA 4X4VA 3B5ND 4UF4A 4Y2AA 1OYDA 1L0ND 1KILE 3T5KA 1JIHA 2XMKA 1NSPA 2K1AA 1TKXA 4EYIB 1WI6A 2P9GA 2XBPA 2MZTA 3KPEA 2GVDB 3PRDA 2BVZA 1T6AA 1R3NA 2WITA 3UDVA 1EXJA 3MM9B 1HYSB 1WI8A 3M6VA 3BASA 2DGXA 1Y7PA 2HHQA 1T9TA 4CLFA 1NK0A 5T41A 1FFWB 4C97A 3M32A 3RGUA 3EVOA 4JBZA 2LU2A 4MIAA 3QWOC 3B5NC 2C2KB 3VMAA 1M5PC 4Q0BA 1U2FA 2VDIA 4J9LA 4IFMA 1O51A 5GTHE 1PPJG 2I9SA 2MDAA 4I7ZB 4GO5X 4ZJOA 3FCHA 1KP6A 5KT6A 3GV5B 2HSEB 4EO8A 3RB6A 2WBMA 3H1KD 1L0NJ 4KO0A 2IX7C 1FRIA 1PG5B 4DN9A 5AVQB 1TUWA 5HVHA 1S1WB 2A06G 1ZH5A 3ZC4A 4CQ1A 1FI4A 3UFCX 2DW3A 1OVVA 4NLYA 3DU5A 1KC8T 3NTNA 2QYCA 1YJ7A 4U8YA 4I6MC 2QJPC 5KJ7C 4J9UE 3TR5A 3VF0B 4B3TJ 3MM9A 4ECTA 1WMKA 4JI0J 4CYUB 2GIQA 3GONA 1V3SA 2DRAA 2XNQA 4AUKA 5G0RA 2JKVA 1NHKL 3H40A 3T1HF 5D15A 1EQ0A 1K9MQ 4WFNQ 2JC1A 2KZZA 4TNOA 2XMJA 2ZKUA 4TY9A 4FF3A 3M6UA 1RISA 3L72E 5B08A 3HHNB 3D28A 1LW0A 2XS5A 2J6TA 3CF5Q 1RWKB 1SI9A 2WSCC 3K57A 4O3OA 1LTJC 5E2QA 2JLEA 1N32J 4G1IA 2JO1A 2JVOA 2FUG9 3AE1C 1KEKA 1XMQF 2HHPA 1MSWD 3PHEA 2GA1A 5CCGC 2VUGA 1VQOS 3TYYA 1P8GA 4XPCA 3JQKA 1PIXA 2QIFA 4WPAA 1ZS6A 2X3GA 2OGUA 2RQCA 1FVSA 2XU6A 3MECA 2QJYC 3DLJA 4P71A 4DUZF 2M8DB 3UD3P 2XY5A 2KT2A 1L0NK 4WU3A 5ETOA 2WK4A 3HO1A 2OD6A 2GQ2A 4QW8A 4CYUA 1EARA 1DTQB 5KFGA 1W2BR 2Y1LB 4M5KA 1DAXA 2XULA 2K2PA 1IBLF 4UUWA 4M3LA 4W4MA 1Q8LA 1SFCB 2Y3YA 2ZVOB 1R6VA 4DFJA 1RBLA 1F1BB 4UOCA 3UE2A 3P8BB 2RRAA 2M0BA 4B3RJ 2A45H 3H5SA 2XCPA 2RF2A 1JY3N 5C39A 1HQEB 2CNLB 1FZCC 2KG0A 4H4KC 1MZ9A 5F9LA 2JX2A 2DGTA 5EGYA 3TJ8A 2HMIA 2EI5A 3LAMA 3ZNUA 4HEA9 1URQD 3KLIA 4KRWA 3O1LA 2R3VA 1EKRA 4IFVA 1PFIA 3L73G 1U1PA 1NZ8A 1N7SA 1VBXA 5A8KA 1SC6A 1XBWA 3CDBA 4NXMJ 1S1VA 4DSFA 2VBWA 3NGSA 3VHQA 2OTLP 5APYA 3R5DA 2HBYB 1YYCA 3CT9A 3A3NB 2V67A 4KH1B 4OLPA 2H89C 3GYNA 3W2WA 3W64A 1LWEB 4F0MA 1URQC 1C0TB 3CPWR 1DTQA 5CYJA 2P58A 3H1LE 4RBVA 2BW2A 4W80A 3DFEA 4B3SF 3H2LA 1MMNA 4DLEA 1W2IA 4WBAA 1J27A 4ATNA 1UPPA 5KG7A 5D0RA 4X4RA 1FTRA 3MTKA 3J7YI 1ZR2A 2ZJSE 2H54B 5KKZC 2E5TA 4DEZA 2G2YA 2LEPA 5KFXA 2R5BA 2QA4G 3DGPA 3PYDA 3W65A 3ZTRA 1Q16B 4A8QA 2BOAA 4QR2A 2HRUA 2BE9B 2M9KA 2XMWA 4BS2A 2KHDA 1RT2A 2ALZA 4F25A 1RAHB 2WVCA 1YVFA 5EUHA 1KC8Q 1CBKA 1NO4A 5JVGQ 5GMEA 4OZJA 2Q3PA 3L70G 2K7KA 3CGIA 4OHWA 4IG3A 1G2EA 4A8SA 1QLED 2VZ9A 2MY7A 1RB0A 3IBWA 1JY2P 3AHPA 5GADU 2XLJA 2QL9B 1T9WA 3NP5A 1XTZA 4OYWA 1CI6B 3B5NB 2CG4A 1FU1A 1OMIA 2XB2D 3QRRA 3PRJA 1PP9D 3BBBA 3DLLQ 2W83C 3GJRB 1E5WA 1NU1E 5K14A 2H48B 1NTMK 2MHEA 2DNPA 1R8EA 2LXCB 1KOOA 1YBTA 5HO4A 2OTLS 3VMXA 3R2PA 4F7VA 1U8SA 2RJZA 1XERA 1N0VC 3MUDA 3A13A 3G8QA 3N6LA 1NAQA 1VQYA 3T41A 2Y1IA 4CM0A 4NYOA 2GIFA 5KFOA 1JLCB 2FHJA 3TA1A 2N1TD 3C8YA 1OFCX 3FBCA 1B70B 3PX6A 2ZEJA 3AJDA 1XMOF 1WF2A 3HX9A 5CD4A 5L1LA 2PT0A 3CD6P 2HQGA 1FXLA 2YNIA 3Q2YA 1WKLA 3D54A 2HRTA 2RQKA 3OJSA 1JLFB 2BQRA 2M70A 1KTMA 1P84H 3C6TA 2N4DA 1PPJE 3K5PA 4CLYA 1TMJA 4CT9A 1SQFA 3RB3A 3W9HA 1REVB 3PKYA 3SQOP 2XY7A 3ZNJ1 3K58A 1WG4A 1RHZB 3VAKA 3RL0D 1FERA 4G6VB 1FZBA 2NYIA 3G9RA 3DLEB 3LP0A 1M90Q 1TKTA 2FC9A 2MKYA 2ZH3A 3G82A 1U6ZA 2JR8A 2VIHA 4OYBA 2DRBA 3DHXA 2A06E 3J7Z5 3ZTSA 5L46A 1HWUA 2R7RA 4PYAA 2MEWA 4WIIA 4PUOB 1GX6A 3HD1A 3TYTA 2QJYB 2L91A 3H32A 2RB7A 4ECSA 4DX6A 1MU2B 2AJQA 4LIWA 4U95A 1PBUA 2EFOA 2DO0A 2FYXA 3Q22A 2DXEA 1JLFA 4KYZA 5F8MA 1WNEA 4HT5A 3CCWA 4PXCA 4DV4F 2ZE2B 2CQHA 2V2VA 4F04B 3L75E 4L75A 3R7BB 4ILRA 1FZCB 1S9KE 3QJPA 2HNZB 5DDQC 3E8OA 1WG1A 4X4UA 1SL0A 2OPSB 1HD0A 2RIJA 3US5A 3IG1A 3KLHA 1HI0P 3JCUE 1FRLA 3CJSA 1DQ8A 3T6BA 1HW9A 4DV7J 2B6AB 3T1YJ 3RAXA 3DLBA 5IC6B 2EK6A 1PGZA 2YMKA 2FPHX 3CD6S 3ITHA 2W9AA 2RNEA 3B4MA 3FMBA 4IOBA 3M9OB 1OWAA 4FXDA 3HKWA 3CCQP 1AW0A 2N3OA 4QYZJ 4HKQA 3KHUA 1NTMG 1P84D 1N33F 1IKYB 1URQB 4RUAA 1QGKB 3Q2TC 3VAFA 2A18A 1T03B 2QE7H 4C3LA 1VS3A 1UWBB 3Q8SB 3DXSX 3VVTA 1LJ2A 1K04A 2OEJA 2RT3A 3MEEA 3H4DA 3HI9A 2A6OA 2A0FB 5GAGI 2YQ1A 4X4PA 5T14A 2CQCA 1NJYA 4NEYA 3HE5A 4PJ0H 2AJ4A 1DQ9A 3CNQP 2HNZA 3IR7B 1T8ZA 4WYWA 3L73E 3EVMA 3QSIA 4XAKA 1NB7A 4LF7F 3R1HA 4LC1A 2PFXA 4YMEA 3MEGB 3CUNA 1CQMA 2HFOA 2FYNC 3N4WA 1KFMA 4HLBA 4DG1B 2B6AA 1CZQA 4RW6A 4K4VA 4EZ6A 3W67A 3H1JE 5KFKA 1JXLA 1IQZA 1I3OB 1F5BA 4NA3A 3IWLA 3SCKE 3CCRP 4EBEA 1AT1B 2IA0A 1LT9B 3RZAA 2FC8A 3W8GA 3LA0A 3CMES 2DJWA 5A0YB 3NLCA 3RB4A 4GKGA 1SB6A 1ZM9A 1B64A 5T7LB 4RJTA 1YDLA 4GOEA 3AE4C 1OY8A 3V81B 1BGYG 2I1KA 3RRHA 3FEYB 4JYBA 4ZVQB 4F2RA 4C4WA 2FLLA 1IKXA 2W7PA 4DZDA 4QYZK 2AHOB 4DU8A 1FESA 2ZFHA 3IR6B 2ZFCA 2AEFA 2I1JA 1RF1C 3JQMA 1WC5A 4F4KA 1TTHB 1VK3A 1FT8A 4R4LA 2DNHA 2W2PP 1S5LX 1IFMA 2OYHB 3W5XA 1IBKJ 5I3PA 4RWWA 5E33A 2QE5A 3N4XA 3VV2B 5KG2A 3L70E 3DOLB 2KUBA 3DMJA 2LLZA 3N7NA 4CNZA 2KXPB 2A45G 2UXCJ 1JLEB 1N6QA 3GP9A 3CSKA 3CCLS 1JNMA 2ROPA 4N41A 3KDOA 4EU0A 1B7YB 3NS6A 2C0WA 4NPDA 2FVRA 3NMAA 3VWSA 2WVBA 1GTEA 2XZWA 3IA0A 2JOQA 3LP1B 4JI6F 1TAUA 2GO9A 3AEBC 1VQ4S 4R0EA 1HPZB 1NHLA 2A45I 1K47A 1SQPG 1T2KD 2J9CA 2N1TB 1UFLA 1E6YB 1PC4A 1L0NE 2LA4A 3MAHA 2V69A 2V9KA 3SV4A 3A0HH 4C8MA 1ZP0C 5AW2B 1U24A 3CMQA 4K50A 2HGLA 4KJMA 1E79H 1Q2NA 2I0XA 4LVOP 4UB8H 4YXDC 2B7CB 5LOQA 1ZLLA 1GXLA 1OY9A 3LIDA 4RNOA 4OI6A 3PIOQ 1T2KC 3DOLA 3BSOA 2ZOFA 3A3OB 1DLOA 1SV5B 2MKVA 3NCQA 1JLEA 3ZXWA 1CVJA 1F2HA 4OZ1A 3M9NB 3RL0B 3WX4A 3MR5A 2N3LA 2XI2A 3AEFC 5DDOC 2G0IA 3VAHA 4OYZA 4IKAA 1S0OA 4JI3J 2W2NP 1NKEA 5GVQA 1OJ4A 4KSEB 4WK3A 3QGPA 1SQVD 1IJFB 3WC0A 4LRFA 4Q43A 1DTTB 1Y8AA 1YWXA 3FMWA 1VHFA 3BVHA 3PW5A 1UETA 3FWNA 1S1XB 5KFPA 2XNDH 2H5EA 2LKZA 5K5MA 2CZ9A 2CJKA 2R7TA 5J2MB 3AT1B 1X9SA 2KG1A 1EQ7A 3S8SA 3IRWP 3UNGC 1MNEA 2QRRA 2IFNA 1VRUA 3EGNA 5HLFB 2XYGB 2UXDF 1XC9A 2WAQD 2VFVA 2YKMA 3TAPA 5KFYA 1SV5A 4M63A 4RBUA 8RUCA 2FXOA 4ZS6A 3U1MA 1Y9BA 4NLPA 3QPIA 5DO2A 1NUEA 2DT9A 2C2EA 1N7SC 4F4ZA 2DR5A 3TRGA 4BRYB 1S4XA 4B9UA 2GX8A 2K3KA 3WBZA 2IJNA 2RDIA 2D3UA 1FA0A 2ASJA 3C8VA 3OLAA 1T0TV 4D6TG 4F36A 2KVQE 2J8SA 1X7VA 3FUYA 2OFGX 1HIYA 3DU6A 3W1YC 2KFZA 2XKMA 4ZIWA 2AKWB 4HI2A 2B89A 1KD1T 3R5BA 2LXUA 1EX8A 1QTMA 4IUFA 2MZSA 1KSPA 2GFFA 1DD3A 1SQBD 1N2DC 3DLKA 3BGLA 2YMYA 1S7HA 1RTJB 2UUAJ 1JLBB 2FYNB 3NRBA 3Q23A 1TKZB 4DSKA 1BXNA 3I6PA 2V5HG 3AA9A 2OYOA 3VVUA 3W66A 1KFSA 5AW9B 2AX1A 1ZN5A 1NTME 3VP8A 1QVGO 4USUA 1UP1A 1TK5A 1TMMA 2YNGB 3LW5H 3MPYA 4YEAA 1CULB 1VI7A 1NVOA 2FVPA 5AE2A 1S6QA 3QIDA 2E1RA 1VC0A 2O1PA 2FJEB 2QA1A 1D7MA 3AOAA 1VQ5S 2DEJA 1ACMB 1RF1B 1SQBJ 1NWQA 3IFMA 1LXNA 4OYPA 5AVZB 3GE9A 3NBPB 1GMJA 2IMOA 4IFFA 3E1RA 3QIPA 1R8AA 4NA2A 5J2PA 2GHVC 1Q4RA 4MT1A 2AMCB 2X3DA 4CH7A 5AW6B 4PWDB 2AEMA 2QG4A 3BGUA 1SC4B 5C25A 4X62J 1Q95G 1WT6A 4QWEA 2Y1RI 1NK8A 3T3FA 4AXJA 2FYUG 2D9OA 5AW4B 2WZ1A 3KZIH 4E8UA 1FX4A 1RTHB 3VR1A 4KKOB 3OSPA 2A3JA 3ZZRA 3G71P 1FKOB 1Q8BA 1NK9A 5IZHA 4Y28C 1BQXA 1BMQB 2PMHA 1N54B 2ZZMA 1NH4A 4DPUA 1NRKA 3QSYB 3TGUD 2IDLA 1FDBA 3M30A 1BDDA 1O8BA 4R5PB 3TQEA 4R0JA 1FBMA 2XEXA 1CJVB 3M6WA 4Y28J 2UU9J 2YH0A 3RAQA 2UXBF 1DJ0A 1KMIZ 3VALA 2WOMA 3T9ZA 4ILLA 1QAXA 3QFWA 4LT6A 1PKUA 2V8VA 3NNAA 2H7HA 4F3QA 3J7ZT 1U6FA 3N9UC 2Z8QA 5B66H 4NLXA 1EJ7L 1RWWB 1SQBK 1Q81Q 4JI8F 1GW4A 2BJ7A 1NK5A 4PG8A 3CX5I 2DNNA 1NJZA 1LTBC 4N47A 2WPQA 4G1QA 1RLDA 1YJNP 3BB5A 3BKUA 4JV0A 1BY9A 2QMWA 3ZZOA 2F5GA 2HZCA 2CQ3A 3VQSA 1S1UA 1Y3KA 2PEHA 1OIPA 2OIHA 3L37A 4H4OB 5KLVG 3KYQA 2BDPA 3R97A 3EPIA 4EGLA 1WC1A 4B02A 1PAUB 2HPCA 2EKYA 1X0TA 1LTGC 3II6A 2DGQA 1T9VA 4IG0A 4WY4D 4BCAA 3EMTA 4DFMA 5HBMB 4R5PA 2R8KA 4IQMA 2MY8A 2KNCB 4WP3A 4F4AA 3MM7B 3H5XA 1EP4B 1C1BB 3LW5C 3JSMB 1S97A 2V8GA 1MLAA 2J6UA 3FXEA 3BR8A 2XNXA 4JI4F 2F9DA 3LPYA 2FGCA 2XSFA 1UJ5A 2M7SA 5AJ3J 4HH0A 3HD7C 1NHUA 2X7IA 5CCHD 1WKJA 1YBAA 3D1QA 3IGVA 4LF8F 5B09A 3LW5J 3FEZA 3CXHD 4PEOA 3G71S 1Z2LA 1L3TA 4YB7A 1VQ6S 2E5YA 4OI4A 3M8YA 2D74B 3PW4A 2WONB 2K8GA 3BATA 2WWWA 3RK3D 3NAIA 3USSA 3SWFA 4HHJA 3KQGA 4PYDA 3Q5PA 3DDNA 1FJEB 2QSIA 1SP4A 4M5NA 4XDDA 1HGVA 1U1QA 4P2SA 1WUUA 2DNLA 4OZ0A 2KHCA 2NZ4A 1S77D 2JEIA 2E42A 3OL9A 1B0PA 1CJTA 3CVKA 2W24A 1YG0A 2Y9HA 5B0DA 3C2PA 1JO5A 2RS8A 3MF5A 3TW0A 4DJGA 3ICLA 3L7OA 2HNDB 3TP2A 1R8CA 3ILLA 3V4WA 3M1VA 1FOSE 3ABVC 1TL1B 2Q66A 3LANA 3BPDA 4ZLNA 2VA3A 4TY8A 1P9QC 2DNZA 1JK9B 1RT5B 2QTWA 5HQLA 2E76D 5IQ6A 4BHQA 3W68A 3POTA 3KK2A 3GJQB 5A2QU 2R8JA 4EBDA 2UUBJ 3DRXA 1SCJB 5IT0A 2GHPA 2HFVA 1GL2D 3C6UA 1LEOA 5H9EJ 2FZGB 2FHKA 3EZUA 3HUSA 1S4EA 4MK8A 2MYFA 4ZVSB 3NOCA 2LEAA 1SLQA 4GRSA 3MUMP 2DHSA 1ZM4A 5IFMA 5DZ6A 4DV2J 5A8RA 2FFDA 5BJRA 2DR6A 1SL1A 2MKHA 1FFSB 2J5AA 3AECC 3H20A 2LKMA 2QL7B 3U27A 2R32A 3L95X 5U47A 5THWA 1Y3JA 1ZZFA 3WU2H 4DR2F 4KR0B 3CULA 5F8HA 5I42B 4RW8A 4XO0A 4ECWA 4HHUA 3OR1A 1P84E 5AVWB 3G8TA 2VBYA 4JP8A 4C8NA 2D69A 1B0TA 4P2XA 4TU7A 2B9XA 4MFBB 3MEDA 4B3OA 2QMUB 4PD4H 3OUYB 1URRA 2VU5A 4DS4A 1S12A 1X4EA 1WHXA 3W2VA 3WUVA 1RT7B 2ZH2A 3G3ZA 4AL6A 1SUQB 3CJ0A 3X3UA 2XHWA 4DR5J 1N5SA 1NLKL 1JMBA 2WSEH 2OFHX 5C2GA 2IBZE 4DV6J 1F3FA 1YZ7A 1QAIA 2VG7B 3UDCA 6FD1A 1REGX 2QC3A 4DPXA 4QYRA 2IJRA 1HUCA 4IRCA 3NGDA 3C1LA 2E5JA 1HA1A 2K1RB 3MR7A 3CCJP 1PYTA 5L9NA 2HWTA 5H9EK 3SFUA 3ZZPA 2O01J 4PKDB 2A2DA 4JI5J 3GWCA 1Q0NA 4IDKB 3CC4P 1S79A 2O1JA 1JLQA 1Y10A 4P73A 4C0BA 5K8OA 2ZWOA 4DQIA 1WJ9A 4YXWH 2QT7A 2FYUE 1YK9A 3IR5B 5B0GA 4NI2B 1W26A 3V6DB 2W6AA 3D0HE 3DM2B 1VF5D 2CQ0A 1XNQJ 4L76A 4CLZA 3LPEA 1TVRA 3CWJA 3HULA 4I6AA 4GC6A 2I5JA 2FBWC 3WUUA 5BYQA 3R5JB 3MAQA 1IWGA 1WHWA 2D3ZA 1D09B 3FRZA 4K4UA 1Z56A 3M8PA 2HLOA 1S76D 5HMXA 2VBXA 2ZNYA 1RE4C 2FLOA 4OYXA 4NASA 3KJNB 1LKZA 2RUSA 2R7QA 3C14B 3EYZA 2Q1LA 4XPEA 2ZDPA 1F9HA 3FKBA 4P72A 4BXLA 1D3WA 3A4TA 3GR1A 2PE8A 2MKSA 5CAAA 1ROFA 3HHDA 1FZGA 5KOWA 4C8YA 1LWXA 3ADAC 1N34J 1K0VA 4ECZA 1HFEL 2YKPA 3VAJA 1L3KA 1CS4B 5K8NA 5LMUJ 4AD6A 2MMYA 2LR2A 4PJ0E 1KOHA 4URSA 3OFEA 5HMYA 2QSFA 1H88A 3I0SB 4J5OA 2Z2YB 1BE4A 4B9SA 3JTOA 3KOAA 5KLVE 1D8ZA 3GLJA 4NXNJ 4RLEA 3T9NA 1HNIA 2AX0A 4P7VA 4H4MA 4JF7A 3UN2A 2GO8A 3Q1MA 3CCJS 3KXDA 2F4VJ 1U26A 1YI2P 3ZDMA 4HDGA 3S1KA 1A02F 3O6QA 1LQ9A 3GHGB 1XMBA 4NLGA 1RAOA 1HW8A 5AXLA 3CC4S 2WSEC 3WIVA 4GVBA 4MKYA 1YHQS 3M2RB 2C1EB 5KG1A 1KB9I 3RK3B 4HTIA 2P1JA 2NXNA 1U45A 2EFQA 4MMOA 1DEBA 2K3RA 1TU3F 3CJ5A 3OD2A 1JXEA 3R6GB 1Q8IA 1KLMA 2WSEJ 2BKPA 1I94J 4CTAB 3QLHB 3HDSA 2H5JB 4NOHA 4WY4A 2DXFA 2AT1B 4L3NA 1XK8A 2K3IA 5HMZA 4V1Ak 3M2VB 4L73A 1VRTB 3OPKA 3AQOA 3V6IA 1EQMA 4R8UA 1HHTP 4C8OA 1M1HA 2IVMA 4A8XA 2YXRB 1ELOA 3VZIA 3UN5A 2U2FA 3I5BA 2VPYB 3CJ3A 1BD6A 2BQ3A 2E5LJ 3TAMB 1FE4A 1FNMA 4PXDA 2EBEA 4IOAQ 3PEJA 5FLXY 5CCHA 4Q7AA 1NBEB 1U25A 4YS2A 4OZ2A 3Q8RB 1UZHA 3MPWA 3OLBA 2E76B 4U3FD 4J7CA 1NH7A 1RHMB 1NKCA 1S0MA 4FNIA 3GQCA 5DG7A 1XTGB 2APOA 1QVGR 2Y0BB 2Z57B 4A4JA 2XYPB 1GL2B 2MKCA 4LF5F 1RQ0A 3NNCA 1QUVA 3QRPA 1FRHA 1FKPA 4CNYA 2WTFA 4GODA 4OZ5A 2BANA 3CCZA 1VBYA 3MTUE 3OT9A 3V2NA 3CIMA 3LGHA 1H2TZ 4O3PA 4DV5F 2JC0A 4M5LA 5BR8F 1LW2B 1FDOA 2FZCB 2J9DA 3M0DA 2E29A 2OPRA 2GHWA 2JDIH 4FBTA 5K9FA 1UVLA 1TL5A 1X22A 2Q1KA 1IKVB 1VDHA 1YI2S 1NJWA 1VQPP 2OSRA 3H5UA 3C3LA 1U2RA 4RW4A 3DLHA 2E1PA 2E5IA 4NLWA 4UB8E 5BVZA 3SFGA 1GQEA 3TAMA 5I3QA 3V2UC 4ZDNA 6AT1B 5APUA 1SQQD 1Q7LB 4BWMA 3FSYA 4X65F 2KL8A 1XTCC 3N79A 1B4SA 1RTDA 3UVJA 4H13C 2RRBA 4LFCF 2WSFC 4JYAJ 1T3UA 5JUMA 3UCGA 3G86A 2WB4A 2HYNA 1M1KT 3L71D 1GAOA 3RUBL 5L9XA 1GL2A 3OR2B 3CCMP 2ZH8A 1KKHA 3AAWB 1RT4A 1EZZB 5B0CA 4CLSA 3KHHA 4DFPA 1KFDA 4IL6H 4WXOA 4WFYA 2D2CC 4OYMA 4YN3B 2MTLA 3PHLA 2AGQA 2FJAB 3HHLA 4BDPA 5SUHA 3IMQJ 4FXVA 3Q0AA 3SSUA 2Z5IA 2ZOGA 1PBAA 1T05A 2L41A 4DWIA 3JQJA 2XLKA 2ZHBA 4IYQA 2XYHB 3W61A 3TZZA 2W2OP 1NPRA 1IJDB 4OGQC 1TL7B 1OMSA 1JB0C 3VN0A 1VF5B 2NREA 4LSNA 2PI5A 2VC1A 5CCMA 1IQTA 1LGHB 1PAEX 4LFAJ 4J9SA 2VPZB 1G2CB 3C16B 3D4JA 5GAGU 3JYTB 2YKQA 1VQPS 1S9EB 4K3AA 1JMTA 4Z37A 1ZRTE 2IVFB 3SYZA 1FRJA 5JVHQ 2G9OA 3QJLA 3PFOA 2GUSA 2JJ4D 3H1ID 1LP1B 2KFYA 2OMLA 2C2MB 3WHIA 1MN7A 3M2UB 1RHUB 1Y4ZB 4ER8A 4K8RA 2R8GA 3MMAA 2AYMA 4JV1A 4DZ6A 2EG2A 1SJ4P 1X5OA 1P6TA 3ENVA 1S49A 4PV1C 1YQ3C 2LQ9A 2IFMA 3I56P 4EI2A 4W98A 4ES1A 1U7JA 3LP2B 1LT1A 4DV1J 2FXMA 4QPXA 3W3SA 5HN0A 3KLFA 5KLIC 2XGPA 1OQ3A 2X1FA 4M8LA 1VQSA 1FWPA 3DRSB 5CZVA 1IUJA 1B3TA 4HH2A 3AE2C 1RGVA 5ITHA 1YBUA 2KXHA 4I2PB 4DQRA 3FCWA 3E01A 5CCLA 1MKMA 2G1DA 2ZWPA 2V4RA 4O3SA 3H1IJ 4ZVGA 2CYYA 5HL7Q 3PXGa 3H90A 2IAJA 5EN1A 1LP1A 4HVZA 2E66A 2KIKA 3PHTA 1BCCD 4B17A 1IC2A 1YX2A 5K8MA 4USHA 2KU7A 4KFBA 4B3TF 5APSA 1HBOB 4YY3J 2YNYA 5C24B 4NE9C 2FKWB 3P8CD 1OO0B 4JI0F 5DGBA 4I7FB 1NNDA 3OTCA 1U0HB 3PV8A 3OXGA 4WCEQ 1X60A 2EC0A 3D6ZA 3NS7B 4IO9Q 1KILD 1KVIA 3ZTOA 1KQKA 2XWYA 2H88C 3CC7S 3E3XA 1Q82T 1OWXA 1F9FA 3KZIE 1JX4A 3AOBA 1LWFA 2CK3H 1FK9A 3DI6B 2Y0CA 2V4JA 2DIVA 1ZM3A 3HHKA 3HUSC 3RK3E 4OX8A 1N32F 2F65A 3T5HA 1Y5NB 2I1RA 4O4RA 1IM6A 4K4ZA 1S48A 4QWCA 1JY3P 2PN6A 3I4HX 2DH9A 4ZP6A 1HBNB 1BCCJ 1HQUA 3S1TA 5KFIA 1T3NA 2J6SA 2B0GA 2NPIA 3GV7B 3FVYA 2W4PA 4NA1A 1N36J 1J5EJ 2GJIA 1UVMA 2CADA 2HODA 2CZ4A 2CNNB 2MLXA 5B66E 3QGGA 1RHQB 3M8QA 4EUVA 3P7KA 3D1OA 4ANEA 1BSNA 2DHAA 4B3RF 1JWWA 4ZP8A 2P9EA 2HIYA 4FKXA 2D3OR 4JBCA 4I0WA 2CUYA 4GO7X 3AE8C 4WU2A 2BJ9A 4C8LA 4KV8B 1N88A 2ZH9A 1N0UA 4LLHA 2WRMA 5L38A 1FJGF 4NXMF 4E2FB 2CJ9A 3TEGA 2YWFA 3TNVA 1RT6B 3IAS9 3OSNA 3L72D 3DLGB 4TLFA 3BPSP 2KP8A 2VL1A 4ELTA 2NXJA 2X1BA 2IHR1 1IWAA 3OBIA 2Y0EA 4NX9A 4OV1A 1PV3A 2MKKA 3NMRA 2IM3A 4WZMA 2EFPA 3CJKA 1FWLA 2NUHA 5HROA 3ILOA 4PQUB 4OGQB 2H43A 4UY8T 1PCAA 2IC3B 2CDQA 1XR7A 3FGVA 2MQ8A 5DETA 2V50A 1U57A 2GJ2A 4OX6A 3Q5RA 4DV3J 3BQ2A 2DR8A 1RHRB 1UL3A 4AE5A 2CPDA 4AQYF 2M5AB 4LRBA 5HP1A 1DHMA 3ZTPA 4WK1A 3L72J 2EFNA 2IYIA 5HI7A 4RNNA 1HD1A 5ETTA 2VPWB 3BGOP 1HVVA 3W5YA 1CJUB 3TO8A 3DRPB 1JJ4A 1T3OA 3OXLA 4P74A 1NTZG 3ENQA 2ZYDA 4K35A 4UB6H 1KNZA 4MAKA 4ZVRB 4LQ9A 2HFED 4OV6A 1RY3A 1S1TB 1Q8KA 3W63A 3Q5SA 3AEEC 4CLPA 4DPTA 3E7KA 3RK2C 2YNFB 2BBEA 3PYEA 5KFHA 1MROB 5H2FE 1MWQA 1JTHA 1Q82Q 4NZ0A 2FHMA 2FVQA 1TFYA 3V4IB 1NDPA 2KS1B 5BYRA 3H7HB 5KLIB 4GT1A 2ZZNA 3PY8A 2KOGA 1RTZA 2RH3A 3H1LD 3D6HB 3F0NA 2VA2A 3EICA 3RRGA 1GW3A 1HBMA 3CMAS 3MR6A 3HHEA 4UW2A 3LIEA 1CJUA 1NTKJ 1SKRA 1KWMA 4M94A 2L5GB 1RYSA 4WIQA 1S5ZA 1PYOB 4QCLA 1FF2A 1BE3D 1VQMP 3KLEB 5KFCA 4F0KA 1J5OB 3EE3A 3DRRA 3SQGB 3U59A 2F8EX 1Q53A 1S6PB 2VFTA 1GEHA 1SJFA 4ZP9A 5J1EB 1YITP 2UVUA 1JLGB 3B8EB 4K0KJ 4DUTA 2YNHB 5FDLB 2VFSA 4PD4E 4JI2J 2YKNA 4P9SA 3H1HG 3B54A 4LVNP 2HHWA 1G3OA 4ZN1A 2GMJA 3DXBA 4ICLB 2VASA 4GDOA 3C15B 5APQA 4C8ZA 1RUSA 3H1LJ 2E5GA 1C0UB 2V2ZA 2O67A 3QWPA 3T97B 2N82B 3SFDC 3FCVA 1T9YA 3P45B 2EK1A 4IQXA 5CBOA 1MWZA 3FBFA 1BE3J 1L4AA 1RTIA 4ZK7M 1KILB 2C2NA 2ZVSA 5E3CA 4QWDA 4RW9B 2ADBA 3HT3A 2CWKA 3GIKA 3RW7A 4DU7A 1NU1D 2KJWA 2GMLA 2BA9A 1V3RA 4KGMA 1ZTTA 4URGA 2VF3A 3K5MA 3MM5A 4JV5J 1NTKK 1NJIT 5CYQA 3FXDA 1FRKA 1RHJB 2BJ8A 4ZVFA 4DL3A 2PC6A 5CXTA 1HI1A 3S4RA 3B8HA 4DFKA 3M0DC 4MKVA 1U1KA 1RABB 1S57A 4ICLA 3C15A 2NPSD 1MG7A 4KB7A 2LVWA 3DOKA 3LALA 1C0UA 2WCXA 1XNRJ 1RHKB 2BCCG 3MM8B 1RWOB 5AVXB 3IAOA 1SQXG 3QMQA 2XO7A 1LWUB 1HJBA 2PMZD 1SIWB 2J0SD 2M8HA 5ETRA 2ADCA 1VQMS 2B5JA 2DCUB 1WSRA 2HLUA 1PPJD 3BH7B 1N5YB 1DH3A 4NPFX 1S9GA 2IBOA 3VOPA 3T1YF 1KBRA 5BYSA 1HL6A 4ZVOB 2DY9A 3ITKA 2R5DA 3HTKB 4CO4A 4GKJJ 1VQLS 2A06D 3V2RA 5M2UA 1I5OB 1M7LA 5F0UA 4N56A 2QEXS 4QZVB 2RU3A 4M5IA 3MD3A 1UIIA 3BBCA 4ANCA 2NRGA 5B5EH 3HHLC 3KDPB 5IC4B 2QM7A 9RUBA 1H0TB 2CWXA 3CCVP 4EZ9A 4CH1A 1QL1A 2R42A 1CSBA 2P6SA 4LRDA 4DCOB 4I1TA 2Q6QA 2W9BB 3THPA 3HMJG 4N76A 2ZYAA 1GH8A 4F67A 1FTCA 1N5YA 4YOEA 1SC1B 4ZJLA 4FBUA 1TFWA 1HBUB 3RL0g 4C7RA 4JPZB 3L75D 2HHHF 2ALYB 2M3BA 2GGPB 1S9KD 2DNYA 4MYUA 1R0AB 1HF9A 3HTKA 4JQ0D 2KB2A 1M1JC 2DGVA 1R0BG 4NMLA 2J76E 4QIVA 1L0LG 2KSEA 2H51B 3K89A 2POHA 1QAJA 1EAYC 3F44A 1AV1A 4GC7A 2KK7A 1I1GA 3O3LA 3GZ7A 4DT0A 3PZPA 3CDWA 1RKJA 3BBFA 2K37A 4OJGA 2L08A 4Y99B 4Y3CA 3FRYA 2C0XA 1TL3B 2DH7A 3SFEC 2RRNA 4HDHA 1WOSA 2QM8A 2FGOA 2KXNB 2MKJA 5LXYA 2C2RA 1IBKF 1SFCD 1HBUA 2VG5B 4UTGA 4LREA 3HLUA 1HNXJ 4DR1J 2ZD1B 2R44A 3FZ2A 1NTZE 2RE1A 2KLVA 4CO5A 2D1CA 3PO4A 2UXCF 1DQAA 3JS9A 4RR5A 3L73D 3PR5B 1VPCA 2HURA 2XMVA 2MGZA 2PO4A 2C2DA 3WDOA 1RAAB 2R2UA 5E41A 3NWRA 4ZVPB 3LGNA 1OZHA 3U1LA 1GD2E 4I2QB 3GMAA 4MH8A 4HHHA 5B0AA 5CA5A 5EWGA 3CCVS 2RHQB 4UOFA 2CKWA 3SDEA 1X0FA 1IXKA 2OPQA 4KGXB 2Y9YA 4CM2A 2IPOB 4I2LC 2AJ0A 5LMNJ 2V68A 3CCEP 1FJCA 1IZNB 5AW5B 1T94A 2CJBA 2ZNZA 3CC2P 2BRLA 4HJGH 4P2FA 3TAQA 1KQSO 3BGRB 2J59M 1QUPA 1DURA 1ULRA 2ZD1A 1EHWA 5MAOA 2ZYGA 2FVCA 5F3ZA 3EFFK 4M1KA 4RUBA 1NSAA 3UCZP 2WMMA 5CJ4A 2BRKA 4GIFA 4N77A 5HQMA 3VGUA 1JNZB 1NDLA 1AA0A 1NDCA 4JI3F 1HHQA 1J2JB 1NKBA 4IL6E 2QJKC 2WSCH 2UUCJ 2VQEJ 2Y8WA 3RW6A 1BHNA 5A2QY 3AH6A 3I55P 2E74D 3L70D 1Z4UA 3GLMA 3R9LA 1GT8A 2XO6A 2GJFA 1F5AA 2Y0DA 2OTJP 1UW9A 2ZOMA 1MWYA 4I6YA 4LSLB 4RO0A 3E1IA 4WWIA 3M8WA 4KTQA 4LBHA 3LGMA 3CW2C 3I96A 2V8PA 3NGRA 3T1AA 1KORA 5GTIE 2KYXA 3IM9A 5KTBA 2DKOB 2XWXA 5EFWB 1VQ8P 1VL2A 2KLUA 4U67Q 2KFNA 2NPSB 2F9JA 2HFNA 5AW7B 1R43A 2H1YA 4DL0C 2JSXA 1YZ6A 4Y2IA 1WSVA 2R3SA 1NHVA 3G6VA 1X4FA 3JC22 3IRXB 3L70J 2GC8A 1DFDA 1LNQA 2C2OB 2DK2A 2WW8A 3UCUP 3D7SB 4OX7A 4OJ1A 2XSJA 3HE4B 3KTQA 1JKHB 2MSTA 2IYOA 1EDLA 5HATA 2B87B 3CC2S 2QA4P 2JHEA 1Q86T 1X4AA 3DDIA 1PJ5A 3L09A 1NPKA 3J80U 1SQXE 3HRNA 1BQMB 2V34A 3MPVA 3G6XA 4L72B 1HLWA 2X1GA 1YJVA 5KJ7D 3QGIA 2IZ1A 4QWBA 1X8YA 3OL6A 1K8AT 2RKIB 2QIWA 3PLNA 2GW8A 2AYEA 4IH6A 1H6KX 4A8KA 2V8DA 4ZPVR 2QG9B 1SH2A 2MJZA 4LUBA 1WTBA 4DSJA 2DEIA 3HFKA 2Q6CA 4MIBA 3I55S 3HZGA 1M1JB 2B4OA 5BXIA 2GVDA 2Z4PA 1VIOA 1HYSA 1U6BA 4OVNF 2N9YB 3MHYA 1KTVA 3FSXA 2IDBA 1JNRB 2ZH4A 4MKAA 1VIXA 3RJMB 5CCGD 2H4WB 2AD9A 2AXTH 1S0VA 4DCPB 3WIUA 2OYIB 1NO8A 3CWBJ 4DCKA 4ZVTB 3V6HA 5B0EA 2GA7A 3QAUA 4QU7A 4CRJA 1NXIA 3HSGA 5KFSA 3DC2A 5D78A 4W7ZA 5DM7Q 1KHVA 2VBZA 2QLXA 1LFPA 5ETLA 4C46A 4LF6J 2Y8YA 3L3CA 4FPRA 3RBZA 1BWEA 2GVZB 1TV6B 3GB0A 3KK3B 1U7LA 2B88A 1O0PA 3GSDA 1S1WA 2BXJA 2CFXA 4X62F 5EHHA 1KONA 2WSCJ 4J9MA 2HVIA 1JCCA 1C2PA 3IR9A 1VQNP 2LECA 1QSLA 4W92B 4OX9J 2QA4S 2V8HA 4CO0A 4X4SA 1WDTA 3PFEA 2IVYA 4NCGB 3FX0A 2KH9A 1Q5YA 1I51B 4TQSA 4N78E 2WT7B 2CRLA 2OYIA 1NTMD 3QJJA 3K5OA 1U2CA 1N4LA 1WC4A 2E5HA 4IFYB 2NLWA 1NTKE 4FF2A 3D2WA 3TVYA 2UU9F 3TZWA 3KK1B 5DDRC 2YX4A 1EETB 2GM4A 1JQGA 4HACB 1NEEA 3KK3A 2EFGA 3BDEA 2VICA 1CQNA 4F3OA 3OTBA 3IN5A 4NLSA 2AJ1A 2DR7A 3E2EA 1PJ7A 5AXNA 2NXCA 1OS5A 3TARA 4DJBA 4EK2A 3SZ2A 2HKEA 2HQDA 2BV3A 2MQLA 1L4AC 2YPZA 2VB6A 1NTMJ 3M9HA 2HFZA 2QJKB 4KHPJ 1SFCA 2CQDA 4QIGA 5KFTA 2JFDA 3A8IA 1X9VA 3D0GE 5K5GB 4JI1J 1A0OB 2B3TB 1HQEA 4RL1A 3MMCB 1NK4A 1BE3E 3RBXA 5F8IA 3UR0A 4EOTA 4C7QA 3TSIA 1S59A 2JH3A 3B4SA 1OVUA 3CCSP 1BQNB 3TNUB 2VQFF 2YIUB 5D3GB 1AQ5A 4M5JA 5AJ3F 4RW7B 4ELVA 3AE6C 2G1HA 3V5BA 2VFUA 2E74B 1GXTA 1T95A 4ZNCA 2GS8A 2N7YA 2Q3EA 4C48A 1OSDA 4UQTA 1BSHA 3UD4P 1KVJA 3ILIA 2LMIA 1VJWA 4LF1A 5AVVB 1QY7A 2OJ3A 1LWEA 1HNVB 1C0TA 2R8IA 3KMQA 3QT6A 1EB0A 4PG5A 5H9FJ 3TZYA 3PJSK 4O9BA 4JI8J 1ZW0A 2ATCB 2J9DE 5IM0B 4MKBA 1NU4A 3VQTA 2YWHA 3L36A 2YX7A 1BGYJ 2C2ZB 3RGIA 3S9OA 2OUGA 3MGNA 4UB6E 4ZKPA 3SCLE 3AXMA 4FVMA 5A6WA 3G9CA 3PR4A 2ZH7A 4PQAA 2B8QA 2R7WA 2P5VA 5KT4A 3FQKA 2XTJP 3OHAA 4ID5B 2Z2LA 2MZ1A 3U02A 3K8VA 1T9UA 4K4SA 3R1LA 1WEYA 2ZH6A 3ISNC 1FNOA 1IO4A 2YY3A 5DZ7A 2XMUA 1G1IA 1NPPA 1QTNB 2WQYC 2BEFA 4RNFA 2ILYA 4NLTA 2F4FA 4EFAC 2QJPB 2ZAEB 2IA6A 2UUBF 2FLNA 5DJBA 1VCTA 1BGXT 4HYTB 1CI6A 1ZM2A 3CWBG 1KVKA 4QWAA 3C46A 1APSA 3B5NA 3CCSS 4AQRD 3RR8A 4DV2F 4OHXA 3A0BE 3Q2SC 3W5ZA 2DGUA 1HJ0A 3AD8C 1HWTC 1SQPJ 4TVAB 4A47A 2G0JA 2CVIA 5H9FK 5AE1A 2N7CA 3MM6B 1LTJB 2RU9A 2XZRA 1W25A 4ZLPA 4DI6A 2G13A 5B0FA 3L71G 3MUVP 1KDNA 4LGDE 2SPZA 3G6EP 3GYGA 2KZJA 5ETKA 1JLCA 4J9RA 1VQKP 1SC3B 1SBRA 3OTOF 1UFWA 4UZBA 1JMMA 5A8WB 4DR5F 4MIWA 3K2YA 4DV6F 5KAFH 4ZPBA 3RYLA 3SXLA 4FS1A 5FIIA 3SV3A 1N73C 3AQPA 1RP5A 2HHSA 1BC6A 3P5BP 4EEYA 1REVA 3R7SB 4FF1A 4LR9A 2FQQB 1TP7A 2EBGA 1RK8A 1FO1A 3DLEA 3MM6A 3BKTA 3D3BJ 3FSIA 2UUWA 4Q8FA 4J9PA 4OQJA 4JI5F 1N56A 3KG0A 4D6TD 1M5KC 1K0TA 3A2AA 3P8MC 3MZWB 4CLUA 1SS1A 4K7QA 5CCGA 4I68A 1IFIA 3A8JA 2F40A 8ATCB 1SQPK 3OXFA 4L6V3 4PUOA 2HHXA 4ZIVA 2YQ0A 4LMZA 3KHLA 4H44D 4YFUA 2HW3A 2VKRA 5I3UB 1XNQF 1ZOTA 3CX5H 1MU2A 4DR3J 1USDA 3K7RA 4YDXA 1KV4A 1W2BO 2VJVA 3BO4A 3MD1A 4FS2A 2JWDA 1QE1B 3MOJB 1FJKA 4HT7A 1KQSR 5A76A 2L9WA 3F73A 2IIHA 1T02A 5IWAJ 2ZE2A 4HR2A 2CQGA 3SBMA 5KFEA 5IT9Y 1FZCA 1J1DC 3MFIA 3G6ES 4H44C 4Q44A 1ZAXA 2X51A 4D6TJ 2IBZD 3KLGB 2M0GB 3CJ2A 4IH7A 2W6JH 2NQPA 1VQKS 3CI9A 2PA8D 2OPSA 1CC8A 4JUZA 5KKZB 4YPCA 1RADB 3AD9C 4RKUC 3M9BA 5GMKa 3M06A 1VRQC 2MXYA 1H3DA 2C9LY 2KM8C 2J0XA 5B5EE 1N34F 2PP6A 5LMUF 3A5TA 4IOCQ 3THTA 1NSKL 2XLIA 5EX0A 3OW2R 5JMNA 1U0SA 2DNGA 3CPWO 3TVKA 1RWXB 2W4CA 1IKYA 1URQA 2BM1A 1T03A 2IM2A 3MZIA 2FYUD 1UWBA 2F4VF 5JJBA 4RUCA 3L7PA 5D4NA 4KE5A 9ATCB 4M5DB 2CVEA 3EPGA 2CJAA 2BX6A 2R9LA 1GK6A 3VGVA 2NXUA 4KAIA 2P8IA 3A1YG 2RAQA 1AFJA 1R31A 2HHVA 4L74A 1WWHA 2AU0A 5AVRB 4ZP7A 3BH6B 3O8WA 2VG6B 2JEJA 3KJQB 1AZSB 2O3DA 2JZ5A 3PM9A 4G3IA 4MYTA 3MEGA 4P2MA 2VOPA 3W8PA 5EWFA 4OHYA 1RYRA 3NFQA 4DG1A 1N5TA 3CCQS 3ILJA 1P1TA 2Z2ZA 2MSSA 3HVTB 3F41A 3LF0A 3CX5D 1U7MA 3LWMA 1NZAA 3KNAA 3HKZD 1LT9A 1HWLA 3GU0A 3P6YC 2FYUJ 5ADZA 2CXEA 4CO3A 3QQCD 1A6LA 5A0YA 2C22A 4KPYA 5TISH 2ZBCA 1C1CB 1CJKB 2VHGA 5T7LA 2E5LF 4DPWA 2F8HA 3V81A 1CEZA 2ATLA 4KHXA 4JYCA 2FIUA 4ZHRB 3PKMA 2WVRA 5CBNA 4B9TA 4ECRA 4KBIA 2POKA 3IS9B 4B08A 5ETNA 5KLVD 2WHOA 2R2SA 1JLAB 3W7BA 1Y11A 2C3YA 1IR2A 4NLDA 3PIPQ 4ITSA 2PFDA 2OQQA 1RSCA 3VCDA 2OYHA 1XQIA 2WVFA 3Q8PB 1DD4A 3CCRS 2B4PA 4C11B 1ZBTA 3CJRA 3MAAB 3OJUA 2W4DA 4C9DA 1ZA2B 4NZ6A 2OKQA 4I7ZC 3GG1A 2ERRA 3ELHA 4QIWD 2FB0A 4DOZA 1NAFA 5F8JA 1USEA 4JB8B 4XIUA 3GMGA 2FJXA 3QBCA 1W7WA 3LP1A 3LTOA 3CWBE 4WWSA 1N73B 5APVA 2OMOA 1MMLA 1TELA 1HPZA 4C3KA 5I4MA 1KYOI 3ZZTA 5KLVJ 1X9WA 2IMWP 3BJYA 1IFPA 2N1TA 4PAAA 2FYUK 1E6YA 3K0JA 1MV8A 2Y1JA 1OXZA 3FFIB 4X4QA 4TT3H 4Q2MA 1RT3B 4JYAF 3JSRA 2MQOA 3DOMB 2ZBQA 4N6JA 3PJ9A 4M5HA 1N7SD 2ITAA 4CLLA 3GTYX 4K4WA 2KO1A 4DOJA 3H6PA 1ZV8A 2I8DA 4WE1B 3K8WA 3VYIA 4NLVA 4DN0A 5HVGA 2PSZA 3SWYA 1HWIA 1Y00A 4CPGA 2KN4A 3C66A 3WZ0A 3DNCA 4ZKAA 1L3UA 2LQJA 1A7GE 1R89A 4B9MA 5HJYA 2ZHAA 2MLYA 3PEHA 3MI7X 4M5GA 4FN5A 3C19A 4LF5J 2JWAA 1RAJA 4O4GB 2F63A 4ELUA 5CD4H 4K2JA 1N5QA 3GG2A 4DV5J 5BR8J 1J1EC 1X4HA 3F56A 2ZC4A 2IYPA 5KFRA 4OZNA 1DTTA 3FBBA 3A3PB 4PXBA 2AV5A 4GVLA 2ZJRQ 1S1XA 3H5YA 1D1UA 5AE3A 3QRQA 2PDAA 1HR0J 4C3MA 4H44B 3BCCG 5F8NA 3MMBB 5J2NB 3UR3C 5J2MA 4LJMA 4YQWA 4R25A 1UEVA 4YB1P 7FD1A 3ZTQA 5KLVK 2CNKB 3GJTB 1RI7A 5HLFA 2ROGA 2KI7B 4OH8B 3G6YA 3MXHP 1FVQA 2I38A 1NGMB 1X4DA 2VRSA 1UVJA 1AB8A 4LQ3A 5KFWA 3DHWC 1GDTA 4UOHA 2NXEA 3DKDA 2BE2B 1YRTA 3BDPA 2HNYB 1WORA 1HMVB 3Q3DA 4BRYA 3QO9B 1S6OA 3EX7B 2RILA 4RU2A 2LA6A 1NSQA 2YKAA 2IY5B 2W2QP 1V6HA 1FHTA 2M8RA 1UIXA 4LF9J 5KFMA 1RKIA 1HH0A 2YXLA 4ED7A 1TKXB 4DV1F 2KXFA 5KT3A 4MJKA 3L74G 3FZBA 5J2NA 2GIRA 4DQPA 1SVDA 2ZT9C 5EDWA 4KC5A 1MFZA 2DXDA 1KB9H 4I69A 3GSIA 4PG6A 3AEAC 3M32B 2AXTE 3J81j 2FHJD 1RTJA 1JLBA 1FD8A 3D6YA 1TKZA 4BC9A 4Q0BB 3UDLA 2J0QD 4NCBA 2F1FA 2AQ4A 3MHVA 1WC3A 3HD2A 4LFBF 3M8SA 2XM3A 2CQBA 2DPIA 4E0DA 2M2BA 4ECYA 3EXYA 3AODA 1HNWJ 3NY0A 3QYYA 3H0PA 2UVVA 1WD6A 4ED6A 2P7JA 3S6EA 1BGYE 4KO0B 3MUDC 3QO9A 2YNGA 2PGDA 2SXLA 4YY3F 2BW7A 1G1JA 1CULA 4YHHJ 1ZRTD 2ZBRA 3CD7A 4V19X 2PEBA 4ANDA 4U7CA 1SXLA 2DIUA 1VQOP 4BWNA 3ET6B 2LQBA 2W8LA 4G1PA 1M5OC 3MCSA 5EX3A 4GKKJ 1RF1A 3W9JA 1TUGB 2CPSA 3D68A 5HVFA 3JAMU 3QT8A 3NBPA 2Z30B 5G0RB 1PGJA 2KRRA 4PWDA 3TUZC 3AB2B 4PG7A 3TDKA 3V6KA 4A8MP 2CQ2A 1N8RT 4OFZA 1Y0HA 3PG9A 1LW0B 2ZT9B 4DQSA 3RU0A 2LCWA 4WTYA 3TJ9A 1N36F 1J5EF 4KQZA 5D0EA 1RTHA 2DH8A 4EBCA 4KKOA 5DLGA 4X84A 2XMMA 1FKOA 3B4DA 4Q5VA 1YLXA 2HEKA 1SQPE 2BE7D 2JNJA 3RR7A 3HVWA 2I8EA 3HD7D 4A8OA 4ECUA 1NMEB 3S01A 2GV1A 4WTOB 2KI2A 1IVZA 2WPSA 3MECB 4KJIA 3ET6A 4K4XA 2QRXA 1KB9D 3BQ0A 1SJ3P 4A7PA 3OL8A 1CJVA 1UJ6A 4PWWA 3GILA 4TU9A 1U49A 1KD1Q 1R8HA 4D3GA 3OV7A 1SIZA 4LBIA 1VK8A 1FDAA 2O1KA 3OFHA 3UQSA 4RX6A 3VGTA 3QZ8A 3R8YA 4WF9Q 1BWVA 3GG0A 1KYOE 2DRDA 1RE3A 2EKNA 4DL5A 3KDNA 2RF2B 2BABA 2BASA 5TJHA 1U02A 3ZO7A 4UOGA 1W2EA 3H1KJ 3BQ1A 2HMIB 2HFSA 3L75G 3BYRA 1XR6A 2HGMA 3KLIB 4ZCIA 4IFVB 4ZCKA 2V4QA 3I82A 2V4HA 4H4OA 1N7SB 4XA4A 5A8KB 1G1XA 1S1VB 1J1EB 2B4VA 1S5LE 1RH5B 1S1CX 4USKA 5LL6d 3OJAB 3TUPA 2MQMA 2RDDA