1KQFB

Formate dehydrogenase n from e. coli
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
289
structure length
289
Chain Sequence
AMETQDIIKRSATNSITPPSQVRDYKAEVAKLIDVSTCIGCKACQVACSEWNDIRDEVGHCVGVYDNPADLSAKSWTVMRFSETEQNGKLEWLIRKDGCMHCEDPGCLKACPSAGAIIQYANGIVDFQSENCIGCGYCIAGCPFNIPRLNKEDNRVYKCTLCVDRVSVGQEPACVKTCPTGAIHFGTKKEMLELAEQRVAKLKARGYEHAGVYNPEGVGGTHVMYVLHHADQPELYHGLPKDPKIDTSVSLWKGALKPLAAAGFIATFAGLIFHYIGIGPNKEVDDDEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of proton motive force generation: structure of formate dehydrogenase-N.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords FORMATE DEHYDROGENASE, NITRATE-INDUCIBLE, MAJOR SUBUNIT
total genus 87
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 2002-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00037 Fer4 4Fe-4S binding domain
B PF09163 Form-deh_trans Formate dehydrogenase N, transmembrane
B PF12838 Fer4_7 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.480 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1kqfB03
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqfB01
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1kqfB02
3MM7B 1SJ1A 1B0PA 4XDCA 1AXQA 4DHVA 1FRMA 2V4JB 1SIWB 1FERA 2UZAA 4OMFG 1FXRA 1BLUA 1BC6A 4OV1A 1G6BA 2XSJB 1GTHA 1FF2A 1GTEA 1PC5A 2FJEB 3EUNA 2WSFC 5BYQA 2FJBB 3MM9A 1FRLA 1FDBA 2FJDB 2WB1D 2C3UA 2O01C 1FEHA 2WSEC 3OR1B 4YDDB 3MM8A 1Y4ZB 3IR7B 1ROFA 4Y28C 1Y5IB 2C3MA 1H7XA 3MM8B 1KEKA 1FTCA 1C4CA 3MMAA 7FDRA 2PDAA 4RKUC 1FRJA 1H98A 2C3YA 3OR2B 3MM5A 2ZVSA 1FRKA 1Q16B 5CHCB 3MM9B 1Y5LB 1JNZB 1RGVA 1C4AA 3MM6A 5FD1A 1FXDA 3GYXB 6FD1A 3EXYA 1SIZA 1CLFA 2C3PA 1JNRB 2V2KA 1B0TA 3EGWB 3OR1A 2GMHA 1VJWA 2WAQD 1HFEL 2PA8D 3OR2A 2Z8QA 1GAOA 1XERA 1FRIA 1BD6A 2IVFB 1WTFA 2VPWB 4KT0C 2WSCC 1FRHA 1A6LA 1H0HB 4CI0B 3MMAB 5L8RC 5E7OB 3MMBA 3LW5C 1FDDA 3MMCA 1BQXA 1IQZA 2GMJA 5BYRA 1JB0C 1FCAA 2FDNA 2XSJA 2FGOA 1B0VA 2VKRA 5BYSA 2VPYB 1FDNA 1PC4A 2FJAB 2FD2A 1IR0A 2Y0SD 1K0TA 3MM7A 1FRXA 2PMZD 2C42A 5CH7B 4XK8C 3MM5B 4L6V3 3MM6B 2V4JA 1BWEA 3HKZD 1FDAA 1KQFB 2C3OA 3IR6B 6FDRA 1R27B 1DURA 4ID8A 3MMCB 3IR5B 7FD1A 4XDDA 1F2GA 1GT8A 1H7WA 2VPXB 1F5CA 1DFDA 1F5BA 1KQGB 1DAXA 4AYBD 1Y5NB 1FD2A 3MMBB 2VPZB 3PNIA 3C8YA 1G3OA 1D3WA
chains in the Genus database with same CATH superfamily
1AXQA 3P8MC 4G1PA 1PGOA 3K2YA 5IOLA 1VQMP 5H9FJ 3OSPA 4K5RA 1NTZD 4ED8A 2QLJB 4H44D 2R7TA 1K05A 3LPEA 4P73A 4X84A 2HQDA 1MZ9A 4LR7A 3J81U 1TL3A 4E0DA 3C14A 3I6PA 1HWKA 5KJ7A 4OL8A 2PFXA 3H1LJ 1IKYA 3VP9A 4U3FE 3P49B 1QAJA 5CYJA 2V68A 5FD1A 5K20B 3QLHA 2Q3PA 1YJ9P 1X60A 2KXFA 2KL8A 2PA8D 4R4LA 3PY8A 3PJSK 3BQ2A 3BCCJ 1FE6A 5E7OB 1TP7A 2FTRA 2CNNB 1X7VA 4N6JA 4ANCA 5K14A 5C7PA 5IWAJ 3TJ9A 4C7NA 3H90A 2KN4A 3KHRA 2W6BA 1OVVA 3GMAA 2CPJA 4U3FD 3HE4A 5KFYA 3M2VA 1LTJB 5EGYA 3CX5I 2NZ4A 2FYNB 1ZR2A 3V81A 2Y3YA 4OZ1A 3Q8YA 1T3OA 1LT9C 4ECQA 3FQKA 1FC2C 3A13A 1FNMA 3VGVA 2XCPA 5BJRA 2E66A 2R7VA 4PXEA 2GV1A 1N73B 3SWKA 3H1IE 1VF5B 1O6XA 1NB7A 4PQUA 1Y47A 3LH2S 4O4RA 4U95A 3G71S 3MM9A 5TJHA 3A3YB 4A48A 3W9IA 3D2WA 3Q5PA 1GX6A 2NSBA 4I67A 1VBYA 1L0ND 1S9KD 1DQAA 3M9NB 1W5CE 2W27A 2XWYA 1RTHA 4OYIA 2N3OA 3ZZ0A 4HACB 1Y0HA 1KN6A 2CWXA 3MM5A 1EZVI 3W62A 1HMVA 1C0TB 1URQD 4FPRA 3M8PA 1T05B 2HVDA 2RVJA 3KLEA 1EDLA 3GMGA 3BBBA 2RU3A 3CI9A 1WG4A 1B0TA 2ROEA 2XMMA 3NCQA 1U0SA 1K04A 2RF2B 2BQRA 2Z2LA 4LVOP 2FXMA 4DSIA 1JLAB 5J1NA 1FX2A 1NU1E 1TUVA 1BUXA 2HPCA 4P52A 4QU6A 3R7BB 1HMVB 1BE4A 1XMQF 1YQ4C 2XDJA 2W25A 2WSEH 4KGKA 5DDPC 2IMWP 2IAJA 2DJWA 4DR2F 5J1EA 4ZVSB 4LLHA 1I94F 4DXLA 3PIOQ 5E41A 3TNUA 4YB5A 5FLXY 2WQYC 2F3JA 4KH0B 2ZBPA 2YKPA 3C16B 2OSQA 4DHVA 3OSNA 1PCAA 1FWPA 5AVQB 1WEZA 1XMOF 2XNXA 1HPZB 2CPZA 2B9YA 1N2DC 2E1AA 3G87A 1IM6A 3JQJA 1J5OA 3ILLA 3UR0A 2QG9B 3VV2B 3GV8B 2RH3A 4IRDA 3N01A 2BOAA 3H1HD 2HGLA 5DDQC 1LXJA 1RB0A 1YRTA 3DLEB 3Q22A 2JEFA 2P9EA 1K44A 2LFVA 3B5ND 3TGUE 3VCDA 3B82A 4KO0B 4HTIA 4Y00A 3E2EA 3FX0A 1RCXB 1MMNA 4IOAQ 4JI8J 4LRFA 4A8WA 3CDUA 2QJPB 4N8OA 3RB0A 4YR2A 5A0YA 2ZWPA 1G2CB 4TXSA 2DD8S 3MEKA 1S9FA 2HHXA 3LW5C 2WPQA 4DR5J 1YBKA 1B7FA 1GD2E 4NYPA 4PV1D 1CZQA 4YEAA 1SQPD 3G82B 3SDEA 2KIKA 4IQMA 4JI3F 4NCGB 4C8YA 1X0TA 3PFOA 2V67A 1E6VA 1IBLJ 4PG8A 3OFGA 2OPQB 1Y9OA 2XCAA 4Z7CA 4Q8FA 5AVXB 1LK7A 2XNDH 5H9EJ 2ZZMA 4KT0J 4QPXA 1RHRB 2GIFA 2WT7B 3NP5A 3EPGA 5ETMA 2FYNC 5H1SV 4Q44A 3W66A 3OXFA 2MQPA 1FDBA 3N6NA 1EKRA 1USEA 2AJ1A 1DLOA 4MMOA 4DPOA 4ECUA 2HMIB 5MLCV 1SPBP 2ZWOA 3HUSB 2GIQA 4C97A 5IM0B 1HI8A 2O1KA 2QC3A 1FTCA 4WFYA 3MMAA 2CADA 4QU7A 2DEJA 4HH2A 2FHKA 1EQ0A 5CMZA 3UNGC 1RH5B 5AW6B 5F8MA 3LP2B 3NKYA 4IH6A 4OZ2A 1W2EA 2Y9ZA 3JSMA 5J1PA 1QTMA 4NXMF 2PFFB 4K2JA 4U6PA 4FF3A 2CPIA 3DXSX 2X3GA 4ED3A 2WAQD 4IFMA 1N54B 3HP6A 3HTKA 1SVFA 2VA3A 3MEEB 4B02A 2L9NA 4USWA 4C98A 1RAGB 4Y99C 5CCHA 2CQ4A 3AOBA 1IZNB 3J7YU 4A8KA 5H9FK 1Q79A 1IWGA 4HT7A 1PYOB 2KNCA 1BCCE 1SQPE 2XLIA 3MURP 2KVIA 2IJFA 1M5KC 3RRKA 4RW9B 3FC9A 2BOPA 1BCCG 4OHZA 2ZYGA 2CQ2A 4GVBB 2Z56B 2C2ZB 1GW3A 4I68A 4ZLJA 1RAAB 4DDFA 3W2WA 1RBOB 5D4LA 3W67A 4U9RA 3B5NC 3CIMA 3RK3B 1BMQB 5DS7A 3Q89A 1RTDB 5G4DA 2HPCB 4R5PB 1NK6A 4NI2A 3SQGB 2HBRB 4IYQA 3PYGA 3K57A 1JLEB 4PYDA 2XYGB 1SQFA 2BANB 5KTBA 2FLLA 2ZC4A 3GHGB 3SDEB 2QEXP 2AD9A 3UDLA 4C6AA 4ZKPA 3WUTA 2CJAA 2MSTA 3GU0A 5H9EK 1LP1A 2KT2A 1RTIA 2Z8QA 2RDDA 4F50A 3BGUA 3D3BJ 1JLGA 3MZIA 2KOGA 3R5BA 2K7KA 3K17A 4LBHA 3DC2A 2W83C 5KAKA 2FHOB 2H1YA 2Y8WA 4HL9A 3DLKA 1WG5A 2GM4A 3E3XA 5KLVD 3LAKA 1DEBA 1RT1A 1R31A 2DY9A 1P84H 1LWUC 4XIUA 3KDNA 3L71E 2Q1KA 2KU7A 3C6TB 3CCJS 3LQVA 1KRPA 2XYPB 1VQNP 3L70G 4S0MA 4EYIB 1X9SA 5L8RJ 5FLXU 2J0QD 5KAIH 5BR8F 3PP5A 4OX7A 4QPTA 4X65J 5U47A 3M0AA 3GFZA 4IL6E 1O51A 4URQU 4ZITA 1S5LE 3KUEA 4LFBF 4FBUA 2H51B 2CNLB 3I9V9 1SL0A 1FEHA 1SC1B 4RR5A 4ANEA 3W68A 2B6AA 2J0XA 3AEAC 4BDPA 1U49A 2J7WA 1NDPA 2G8YA 1Q7YT 4EZ6A 2WSSH 2GQQA 3AJ2A 5F3TA 4ZCKA 3AE8C 4DR1J 4OYAA 4DI6A 1EQ7A 1VL2A 3VAHA 2HWIA 5AXKA 2W9BA 1X9VA 1JQGA 1T0TV 4CM2A 1JLEA 3OR2A 4YB1P 1U47A 1R89A 4FVMA 1PGPA 4JBZA 3FFIB 4C3MA 4K35A 2IYGA 3KHGA 5KFQA 3EMTA 1U1LA 3KK3A 5KAIE 1SQBK 4PJ0H 1NJIQ 2FLNA 4WY4D 5BVZA 2D74B 5HJXA 1GEHA 3T5LA 1IFIA 1V5VA 1QVGR 4RL1A 2K1AA 3V6HA 2YXQB 4OYZA 1M1KQ 4PWUA 3RL0C 3AXKA 3KMSA 1SJ1A 3ZTQA 2FB0A 2YWFA 1ZYQA 3GSIA 1K47A 3K7RA 1KYOH 2ASYA 4ZN3A 1HA1A 3IXQA 4IR9A 2FYUJ 3CJQA 5I42A 2E5LF 3HF5A 3T6BA 2ATCB 2RAQA 3AOAA 2AJ4A 4DPTA 3OL9A 1IKXB 2D3O1 3OHAA 2JFDA 1RJJA 1HTLC 4B3TJ 2VFVA 1KC8Q 5KOWA 4UUXA 2B4UA 3WC2A 3B71A 3V6KA 4J9VA 4MKYA 2MXYA 4ZVFA 1MN7A 5CD4A 5DGBA 2A10A 2GHVC 1L3VA 2DH9A 2L48A 4LSNB 4B3OA 2R5DA 3BRVB 2EG1A 1LQ9A 2M52A 1VGYA 2XMVA 5AXLA 3HFZB 3HSZA 1ZRTE 4C8MA 4LC1A 4DPYA 2K9JB 4EGLA 4K8RA 3UIAA 4LFCJ 3ZZTA 1RK8A 1GU4A 2KFYA 4UB8H 4AL7A 2B9XA 3HHDA 3DLJA 4WK3A 2V8GA 4PUOB 4NLVA 5HJYA 1JMTA 1S4XA 2HQFA 1KYOE 2QIWA 1SQVJ 3EE3A 3HZGA 3R7SB 4LSNA 3NCRA 4TU7A 3II6A 3LTOA 4BC9A 2MDAA 4ZVGA 3AD9C 4FXVA 1S1WA 4ECWA 4I2QB 1HWUA 4BXLA 2C2DA 5J2NA 2H8PD 4I4BA 2KZIA 3EFFK 1QSLA 1U09A 1DTTA 3D1OA 3M8YA 3QO9B 2E9TA 2O01C 4DFJA 2PAJA 4RNMA 2RUSA 2ASDA 5AE1A 1EC5A 1W2IA 1N34F 1J1DC 4U3FG 2NXCA 2Q1LA 4ZP9A 4DL4A 2GVDB 3OVAA 1XR5A 3FRYA 2PA3A 3EVWA 2GA7A 3PRVA 2Q79A 4YHHF 5KLIC 4P71A 3V6JA 1HHTP 2HIYA 4DUTA 4XO0A 4ICLA 4DV5J 3TNUB 2KZJA 1NOHA 4KFBA 4DX5A 1ZAVA 1U2RA 5BR8J 1A6LA 1OS5A 1UWBA 4Y0FA 2XLJA 4LF2A 1UIIA 1VQSA 1S7HA 2PSZA 1JCCA 1HWIA 3BQ1A 4HB1A 1BSNA 3TZYA 2XTJP 2G0IA 5H2FE 1VFJA 2CA9A 2AF6A 4P2MA 5ADZA 2UU9F 1Q0NA 4FS2A 3OQ2A 1B70B 3IWNC 1TKDA 5KFOA 4RUBA 3KZIH 3HT3A 3W61A 1SQQK 2B51A 1OX3A 1G3OA 4WFZA 3DLGB 1NK0A 3L70J 4FXWA 4AUKA 4WWSA 5B0GA 5M2UA 4P72A 2FFDC 4AE5A 2KO1A 4IL6X 1R6YA 4TQSA 2HNZA 1EQMA 2CXEA 5IC6B 1SQVG 1D09B 5AXMA 3IR7B 4PKDB 3V2RA 2I1RA 4RW4A 4NYOA 3CF5Q 2CUYA 3G82A 2GIRA 1PJ7A 2FHMA 1VQ5P 1YBAA 3G6XA 1N73A 1M1KT 4I2PB 2JLGA 5EX3A 2HAFA 1S79A 3H42A 1IUJA 1L3UA 3QATA 4F4ZA 4NLQA 4QR1A 1LW2B 5KT2A 3F5HA 3U1CA 1S5ZA 3C6UA 4RNOA 3Q8UA 2IVFB 1FX4A 4OH8B 1UZHA 5H2FH 1YJNP 4I1LA 2J7KA 3NBPA 3KJNB 2WOMB 2HHHJ 4KPCA 2FDNA 1T8EA 2EK1A 5CQGA 2JJ4D 4ZPWR 4JYAJ 3H25A 3J7Z5 3W64A 2XEXA 4L3KA 3BRTB 1H88A 1BE3E 3L75D 3L71G 8RUCA 1IJDB 3AH6A 2UXBF 2BJ9A 2CJQA 3H59A 3M9MB 2E76D 1XR7A 1VQYA 3T5HA 1DH3A 1XNRF 5ETOA 5IT9Y 3CWBE 5D4NA 2CJXB 3M8RA 1R0BG 2J9EA 1VQ9S 2W90A 2OEJA 2MQLA 4F7VA 4EMDA 2QTWA 2XGPA 3GJSB 3D0HE 2MZSA 4R4MA 3MEGB 1R7IA 2R7XA 2KM8C 1URRA 1K1SA 2MQOA 3M30A 4OJGA 2ZH4A 3BR9A 1JLQA 2ZJRQ 1SJQA 2XS2A 2ZOGA 5FDLB 1GMVA 3U1MA 4LFCF 2G0JA 4I6WA 3M7VA 1N5YB 4DR4F 1IN0A 3Q0AA 3J80U 4DV6J 1WC1A 2WVRA 3R7NB 4N77A 4DT0A 1BGYE 3B8HA 2FVSA 3TANA 4Q2LA 1RISA 1CG2A 2BCCG 3AD8C 4PD4E 1RT2B 2GVDA 3M9OB 4K4YA 4J9NA 1OQ3A 2Z5IA 3TEGA 4WYWA 1RF1B 1YTZT 1TZ0A 4RW7B 3QGGA 1GDTA 2DK2A 2FXOA 3CMEP 4WJBA 3OBIA 1SUQB 2ZKUA 3I5AA 2MQMA 2IM3A 4WP8A 4JI7F 3MR7A 1W25A 4DFMA 3W3SA 3VYIA 4OX9F 2L91A 5D77A 2E75C 1W2BR 3UVJB 2EW9A 2YNFA 2E75B 1DJ0A 1ROFA 2RNEA 3MM8B 3V4IA 2KJVA 2AV5A 4HT5A 1Q81T 2YKNB 5CBOA 2KXNB 1FWKA 2M8DB 4DQPA 2YNHA 2DB1A 4U3FJ 2BYCA 1IFNA 3FJ2A 2KYVA 1U1RA 3F89A 2ZBQA 1ZAWA 1U2FA 3HVTB 1T95A 1K73T 2FYUG 1SQVK 4Y2IA 2YKMB 4X4UA 2CDRB 1YTZI 1AJYA 1NSKL 3PTWA 1V6HA 3M9QA 4DL7A 5B08A 3GWCA 1MWYA 1R8PA 3U27A 3IRXB 1K0TA 2IM2A 3QIPA 3LGHA 2VOOA 1NKEA 3SFUA 4DX8H 4ZJQA 1G2EA 3Q8SB 4QR0A 1YJNS 1AA0A 5A8KB 5DQGA 2QA2A 3AE5C 3I0RB 2VV5A 2JC0A 1SC3B 2VPZB 5HVFA 2MHEA 4JYBA 3VP8A 3GW6A 2I38A 3GJTB 2IRXA 5LMUF 1UJ5A 1HHQA 1KLMA 4OZLA 5KFIA 5BXIA 3PCOB 4TY8B 1AUDA 4NXNJ 2R7RA 2FVPA 3GP9A 3CB4A 1WMKA 1UWBB 2EC0A 2JL9A 1S9GA 3TZZA 1K9MQ 2V2ZA 4GKKF 4F2SA 1VHFA 1T9WA 4DR5F 3Q8QB 3G8SA 4MIBA 4ASWA 4I64A 3DLLQ 3CJKB 4N7TA 2W9CA 5C25B 5D6GA 3RL0B 2Y1JA 3FBCA 2C3YA 3GPAA 1U02A 3K5MA 3THVA 1DTTB 4JI3J 4KV8A 2LQ5A 1FXDA 1WF2A 2XC9A 4YY3F 2R7SA 3W5XA 1PP9J 2X1BA 3PJ9A 3L3CA 1WWHA 3KLFA 4EWTA 1C1CA 3MEDB 4H0LB 2AEJA 3GLJA 4U96A 2Y0CA 2Y1LB 1X4EA 1X4GA 1Q78A 5CCLA 3MMCA 1KFMA 4O3PA 4TT3H 3N9UC 4GC7A 1YHQS 1RT3A 3CJSA 1S77D 2X51A 5LJ3Y 4DR2J 2XNRA 2PGDA 3G96A 1Q82Q 4R5PA 1XNQJ 1HR0F 3GJRB 2C42A 3TUJC 4EBEA 3BKUA 2QYGA 2V4JA 2E74D 2HWHA 1M57D 2E5HA 3W9JA 1YI2S 2FQQB 1RHJB 2O01H 3L7OA 2ZYAA 3D6ZA 3RJMB 4UY85 4I1TA 1IKVA 1GU5A 4L76A 4YB7A 2ZC3A 2ZT9B 4UY8T 3L75J 1RWUA 3H2UB 4UW2A 2W8ZA 1ZOTA 4M5IA 2QE7H 1X4DA 1P84D 1HNVB 4MK7A 4K4SA 2B43A 1DZ5A 2DHHA 2R7UA 4D6TG 5B66E 2HVHA 1U1PA 1EZVG 1HL6A 4ZJOA 2H48B 2FGCA 3S1KA 2I2YA 2KTQA 2IYIA 2AQ4A 1X79B 5KFDA 2ZITA 1KOOA 4KHPJ 3NL0A 1MMLA 2HEKA 1P1LA 4RPFA 3NMAA 5KG0A 1M1JC 3PW7A 1HIYA 3V4IB 3RRHA 2WWWA 1IKXA 2ASLA 4FF1A 3AE7C 3OT9A 2KG1A 3RAQA 2LXCB 2ZZTA 3CSKA 4JI6J 5DRKA 4DSKA 2QLXA 4OX9J 1JJ4A 1IR0A 2GAHC 2K3IA 3R5CA 2PMZD 3LPYA 3D0GE 4FF2A 3DI6B 2BEQD 1FFGB 1NTZJ 3S6EA 5AW7B 1F3FA 3VAMA 4GO5X 2CPSA 4EYYQ 1X4FA 1ZM9A 2VICA 1CW5A 3MUMP 1VRUB 1VQPP 3QIPB 2WMMA 3MZWB 4ZP6A 2V34A 2X7IA 1TK0A 2QX0A 3L72G 3QGIA 2BQUA 1WNEA 3G6YA 3WU2H 2FJBB 3OVSA 2V4HA 1Q95G 1X0FA 3SFGA 2ZBIA 1S0OA 3L71J 2OTLS 2OD4A 1KHWA 3PJXA 2ZJQQ 1I5OB 3LF0A 3MIWA 1IO4A 4K4XA 1U0HB 3MPYA 1NPPA 1RY3A 4ZVPB 2LDIA 1HBOA 5E33A 1JKHA 4F67A 3N0VA 1KN7A 2VZ9A 1M90Q 1HW8A 2N1TC 4GRSA 3F41A 3EX7B 2P7JA 2ZVSA 4YMEA 4ED6A 3DU6A 2V7QJ 4ATNA 5A6PA 2H5IB 2BA9A 2HFZA 4ZLNA 3NWRA 4OIXA 3M8PB 2AGOA 4B9MA 1Y7PA 2YWGA 3EDQB 4KO0A 3THPA 2KP8A 4AXJA 2JZ5A 4ZNCA 4Z37A 1H0HB 2DVIA 4Y99B 4HHJA 1WEYA 3QAUA 5E3CA 2ILZA 2M4MA 1FCAA 2B8QA 1NJXA 1KB9H 3EM1A 4Y6IA 3S1TA 3KLIA 1T9UA 2E7VA 3LUYA 3QYYA 1F5AA 4JV1A 2CK3H 2HNYB 2YMKA 5GTIH 2K1RB 3SQOP 2OP5A 2Z2YB 5ETPA 3WU2E 3ZO7A 1T9YA 3CC4S 3KK2A 3WIUA 1UVJA 4ZP8A 3VHQA 1JB0J 1RT7B 3QFHA 1G6BA 5B0AA 3CCSP 2OTKE 1QLED 3NRBA 3T1AA 3RR7A 1Y00A 3DRRA 1WD6A 1NPRA 5L46A 1KQSO 4AQRD 4R8UA 5EDWA 5KG6A 4Y2AA 2KYXA 5B09A 3BATA 2HLUA 5F0UA 2PDAA 4UT4A 5AVWB 2AGPA 1D0EA 1VDHA 4JQ0D 4JUZA 5GAHU 5B0FA 3J81j 3TP2A 2BABA 1IQTA 4NX9A 3HD7D 4MJKA 3A12A 1X0PA 2UUBJ 3R8YA 3CW2C 4ZS6A 2M2BA 3DRPB 3HM9A 3HHLD 2M3BA 1L3KA 3WZ0A 2N1TA 2HQ3A 2GUSA 1X8YA 4NCGA 3I55S 2DGQA 1QVGO 2A18A 4GKJJ 2IBZI 4ZVOB 4YOEA 2N3LA 1YJVA 1CJTB 3DRXA 3FRZA 2AX0A 1HHSA 3G3ZA 1S1CX 1YYCA 2N9BA 1MU2B 3PTZA 1NU1D 5AXNA 1QVFO 3FMBA 1SH3A 3UDVA 4E98A 2LU1A 2EXUA 3AJDA 3D66A 1XR6A 2BCCD 5C2GA 1TK5A 2LR2A 1R8HA 1NO4A 5JMNA 4DCOB 3M4XA 1YITS 2AYGA 4YXWH 3L73D 2QA1A 4QIVA 1KILB 4PR6A 2MLYA 3HUSA 5GAHI 3B6BA 2A6OA 1LWUB 2M7SA 2PI4A 4DUYF 4RJVA 2W2PP 3PW0A 4EU0A 1CQNA 1RWOB 2ACYA 2VIHA 2J5UA 4PYAA 3V2NA 5KFNA 1S1UA 2NUUG 1R0AB 1LK5A 1TKZB 1D1UA 1JY2N 2UUCF 4ED5A 2EKYA 1JXEA 3QFWA 1S4EA 4P74A 2BKPA 1XN9A 4N3YB 2HBYB 3QSYB 4RX6A 1NKZB 4KPYA 5KFEA 3D6MB 2WPVB 4E2FB 1DTQB 1JNMA 1BSHA 4CLKA 5KT7A 4R0JA 5KFXA 3MDFA 1OW8A 5K8NA 4WIIA 1GTHA 1EP4A 2HVEA 3VMZA 1OY8A 3Q5RA 1F2HA 3PZPA 2AXCA 2FLPA 2D3UA 1JLQB 1HARA 4O3QA 2C0WA 2D7SA 4OLOA 4IO1A 1SKRA 1HNXJ 3C1LA 2FYZA 4L73A 4XPCA 2ZE2A 1NHLA 2F4FA 1RAJA 2EVZA 2IVMA 4WKRA 2L9DA 3L09A 3U59A 1SL1A 4ZP7A 3D54A 1SQBE 1FRKA 3FGVA 2CIMA 1X8DA 3FXEA 4CLWA 2WVFA 3VZHA 3ZZZA 4R8UB 1M5SA 1GQEA 2QN6B 3SSQA 3PX6A 1WORA 2ACMA 2Y8YA 3OTCA 1WDTA 2HSEB 1SQBJ 3IN5A 2E5TA 2DNMA 1W2BO 1P84I 3TQ1A 2IBOA 5J2PA 1NH4A 2GMJA 3C9IA 2BJ1A 2YKNA 4I7ZC 4NPFX 5E79E 1RDRA 5GAGI 4Q0BA 2PP6A 1KV4A 3PW4A 3HHEA 1RAHB 3KDPB 1R27B 1VK8A 3OV7A 2LKMA 1UW4A 3K0JA 2HYNA 1JXVA 1OWXA 2M88A 3EWGA 2MKVA 2DXEA 4ED0A 2FHJA 2GS8A 1SH0A 4H13B 1KR4A 2FJEB 4K4VA 3L73J 4LR8A 1SQPK 5A6WA 3OL8A 3D0IE 3KJQB 2B5JB 1YVFA 4X64J 4HH0A 1Y5IB 4IFYA 4FYWB 2VL1A 2KM8B 2H54B 2HZCA 1QX8A 1RF1A 4OZNA 3HVTA 3WQPA 2IHR1 1RLCL 2Y9HA 1Y5LB 1D9AA 3UW1A 3T1HF 3V6DA 4WBFA 1YK9A 3C14B 4WF9Q 1KB9D 5ETSA 4B17A 3MCOA 1UKUA 5CCGC 3B8EB 4TLFA 2R2TA 3GTYX 3G9CA 2EI5A 5JVHQ 2DR9A 1DQ8A 3TEHB 4FNIA 2ZEJA 4Q5VA 1SJRA 1GK4A 2P5VA 3CMAS 4KFBB 4LF8J 4TU8A 2AKWB 2DGXA 3K5BA 3PEHA 2HPUA 1T9VA 4YDXA 4I6MC 1Q81Q 2GUVA 2VPXB 5GADU 3DFEA 3H1HG 2PRRA 1F60B 4RUAA 1NAYA 5ETKA 3PRBA 4DV6F 3IBCB 3FCWA 1FERA 2DH7A 1RA6A 4U7UK 1ZPWX 1MN9A 3GG2A 1ZN5A 3CWJA 3KLHA 3C19A 1EZZB 4CPGA 4L3NA 1L0LJ 4M3LA 1T7PA 2M8HA 2F9JA 2YNIB 2GJIA 3FQLA 2W9AA 3NY0A 3HMJG 1V3RA 2ZBRA 3OTBA 3MXHP 1Q4RA 1JJCB 4ZIVA 4USIA 3KOAA 2V0NA 1APSA 1C4AA 2DISA 3PYFA 1J2JB 4RU2A 1KC8T 3EFGA 3VGTA 1SP4A 4QYZK 2RE1A 1OXZA 2NPSA 1UJ4A 2F1FA 1Q86T 1RAIB 4JI7J 4JV0A 3K58A 3D71A 5KAFH 1REGX 1UVLA 3AT1B 2I5JB 1Q8KA 1F3VA 1NAQA 4NRUA 2LEBA 1S99A 3TRGA 3QRRA 2A06E 4NLOA 2FVRA 2HFSA 3UFCX 4WWIA 2XV5A 1SQGA 3OFEA 5AW0B 2YIUC 4WVZA 1YQHA 5D4PA 3TARA 3W2VB 2ZOMA 1VBKA 2ZVIA 4CLPA 5IXUA 2E5YA 1NMEB 2HS4A 2WSEJ 1B0PA 2C2NA 3CDBA 2L3MA 1UIXA 3BH7B 3T19A 4EUVA 2F40A 2YWEA 3BPSP 5IV3A 2HYIB 4M5HA 1N56A 2UVUA 1KYOI 4M5DA 4K2XA 2XLKA 4K0KJ 1J1DB 3QWUA 4ELUA 3V5BA 4C11B 2ADCA 2RQ4A 3A0BH 1T2KD 1X9MA 5IQQA 5IT4A 3PKMA 4W90B 5KLIB 2V8PA 3CCLS 3PHTA 3OL7A 2V94A 1V5IB 4KH1B 3ETMA 1GXTA 3CMAP 4LF9F 2JLEA 1KZUB 3CXHE 4ENOA 4NASA 1UW9A 1N5YA 2X1FA 3GILA 1SCJB 2K9JA 2GJ2A 2XBPA 5FDLA 1PL5A 2CPXA 4H4OA 2PD1A 5KFVA 3GLMA 5E0OA 3R2PA 1BQXA 4DLEA 1NSAA 1JLBB 3SEOA 3RK3C 1RQUA 2HNZB 2OFGX 1NBEB 1VRTA 1NUEA 3L70D 5AVZB 3OTOJ 1YSJA 3D6TB 1TAQA 3MP7B 3BCCD 1KTQA 3UWTA 2N7CA 5ETQA 4OI4A 5IQ6A 3H2VE 3DOKB 4H13D 1MNEA 4ZVUB 4U67Q 2VG7B 2ALYB 1S59A 4O23A 3H1KE 3JCUE 1X5PA 4NZ6A 4L75A 1RADB 3T1YF 1N4LA 4ZPAA 1LWXA 4O44B 3A0BE 1WHVA 5APSA 1S72S 2YX4A 1OZHA 2JEGA 4LR9A 1Q82T 5AW3B 3A2AA 1DD3A 1NXIA 3H1ID 2C1EB 2MJUA 5GAGU 3EVMA 3DYAB 3MAAB 5K8OA 3CXHH 3PACA 1UPMB 1AZSA 2Y0BB 4K4UA 1LWCA 1TFYA 4CTAA 2K7JA 1WC3A 3G8TA 3WUVA 5KFRA 4OQJA 4EIJA 5E3RA 3TGUJ 2D3OR 2OPRA 3ZNJ1 2KK7A 2W8LA 2O01J 2OELA 3CJKA 1TL1B 1URQA 3KK1B 1JIHA 4FBTA 1RWMB 1XBWA 1JB0C 4C7NB 4WZMA 1FJCA 3D68A 1SV5A 2QZ8A 3EDRB 2WVBA 1E79H 1T03B 3KNAA 1EB0A 2QA4S 2HVIA 4W98A 3RBZA 1JTHA 2OPSA 1N88A 2KRRA 3D9BA 4C8NA 1S9EB 2H4WB 2WOMA 2RHQB 3DLGA 2A06G 1Y3JA 3MHVA 2B6AB 2KHCA 1PBAA 2JRSA 4KJIA 1S1WB 1WC6A 1UVNA 3V6DB 3SYZA 5A2QY 1VQLS 3PJWA 1VQ4S 2UVVA 3ZZYA 2XO7A 1JWWA 2DRDA 5AW1B 4OLPA 1YZ6A 1PPJD 4C4WA 5AVVB 1YLXA 2Z58B 3D67A 2OYOA 4JI6F 4KE5A 1N7LA 5LXYA 3FSYA 4NLGA 2W9BB 4X4SA 2B8PA 4WXWA 1WC0A 3W63A 3MOZA 4EK2A 1Y9BA 2Y0EA 1RGVA 4W92B 1U7MA 4OHVA 1LGHB 1Q5YA 5KFMA 3FWLA 1RT1B 4OYBA 5TISE 1NZAA 3U1NA 1LOUA 5DDOC 3OD2A 2O01N 1VQKS 3JSBA 1ZH5A 4CRJA 1K1QA 5IC4B 4J9MA 3RAXA 4OWFA 2DITA 4WY4C 3HVRA 3C15B 4MIWA 1YDLA 2HWTA 1U8SA 5CA5A 4JI5F 2DKOB 3NLCA 3A3PB 2Y0SD 3JSYA 1LTJA 2AEFA 4TKTA 3WX8A 1NZ8A 3N4WA 4MN4C 3KLGA 2O3JA 1HKAA 2A45H 2BCCJ 2FKWB 1WHWA 1U1KA 5E79H 3E8OA 2HFNA 3HVAA 2PIIA 3KDOA 4RJTA 1NU1J 2GZOA 1YI2P 2GHPA 3L74E 5CZXA 1EJ7L 4ZCIA 3OLAA 2UXCF 1REVA 1FNXH 3CD0A 1IK9A 3E01B 1OIPA 4I7ZB 3VR1A 4CQ1A 2FZGB 3P5TL 4ES3A 1NCLA 2HG4A 3GFHA 2AJ0A 2HKEA 2KB2A 1RTDA 2R4FA 4J9SA 4ERDA 3FK4A 4UZCA 1SFCD 1J5OB 4PAAA 3QJPA 1J2VA 5JJBA 3QIDA 2QMXA 5TISH 1SJ4P 1H98A 5B5EE 4NA2A 4F04B 1N36J 1UVKA 2YPZA 4F3MA 3MI7X 1RUSA 2YVSA 1SIZA 2LQJA 4PD4I 5HAOA 2N4DA 2JH3A 2HQIA 3DLBA 1FRIA 1WOOA 2OJ3A 2R7OA 1SJ3P 1RAEB 4DU8A 2IVYA 4HDHA 3BF4A 2W2MP 3S4RA 1UFLA 2OMLA 3FUYA 1SQPJ 2XB2D 3BN4A 3MWBA 3VAJA 4YUDA 1FKAF 1UFKA 3H1HJ 4AL6A 3L36A 5CAAA 1IM4A 2CWKA 1N8RT 2UUAJ 2MTLA 2RSQA 2YPYA 3FBFA 3IN6A 4YFUA 1L4AC 2HMIA 2P6SA 1DQ9A 3DI6A 3MM7B 2FBWC 3DHWC 4IUFA 2CG8A 2OI2A 3ISZA 1U7JA 2O66A 2JEEA 5JUMA 1NTMG 1C0UB 5HVGA 3LIEA 4M94A 2C3UA 4EI2A 3BR8A 1L0LK 3HJVA 2QSFA 2FHJD 3K59A 1GXLA 4HYKA 1NTKK 3GYGA 2N4CA 2MKSA 2R32A 3WIVA 1RAOA 3KMQA 4O9BA 4ZMDA 2OIHA 1NU1K 2G4BA 3OTEA 4AT1B 3OFHA 2PN6A 2QV6A 3PVXA 3H1JJ 2I6WA 3GV7B 4RBUA 2JHEA 3G71P 1FDDA 3NNCA 3MTUE 3USSA 4RNNA 2H5EA 3WBZA 5CCGA 3L74G 3RZAA 2LVWA 1KD1T 1HBMA 5DM7Q 2FD2A 2LMIA 3NG8A 2HLTA 4I2QA 3BKFA 1YJUA 1TELA 4LIRA 4XK8C 3IMQJ 3QPIA 3H0PA 2DGUA 4FYDA 4JI4J 1KVIA 2CQIA 2B7BB 5DG9A 3FZ2A 3MMCB 3MUTP 3PYEA 4D6TJ 4IL6H 1KP6A 2B3TB 2NXEA 3F0NA 1CSJA 1NPKA 4LBPA 2J8AA 3SFEC 1QL2A 1S10A 4D3GA 1KKHA 1M5VC 4J9QA 5KKZC 2QJKB 4DV1J 2J76E 1R8AA 3CT9A 1TFWA 2VDHA 1TL3B 4EZ9A 2BMBA 1ULRA 2F8EX 4AQYF 2C0XA 5IWAF 1KILD 3HD1A 2KS1B 2NPIA 3CJ5A 1L5UA 2V6AA 1L0NJ 5C2CA 2FC9A 2DGWA 1JLGB 2KT3A 5DLGA 4DX7A 1LT9A 1GNKA 3UN2A 4WFBQ 4Q43A 3KLHB 2V9KA 3L7UA 3HD7A 4ZIWA 2HBZB 1KSPA 2H3EB 3NS5A 2J0SD 2VPWB 3R97A 3B4SA 2VC1A 2QM8A 4KGVB 2K8GA 1RT6A 2XY7A 2UXBJ 3UQSA 1VK3A 3Q2TC 3GV5B 3H5YA 1VOMA 3PG9A 2WT7A 3T9NA 3MR2A 2W4DA 1KWMA 3EICA 3O5TB 4BWJA 1H73A 5ETLA 3UN3A 1RWKB 3OPKA 4EYHB 2DYAA 4N78E 1S6OA 1GK6A 1ZZFA 1UAWA 1S49A 4ZPCA 3TAPA 1TQLA 3DCAA 2JEIA 4OV1A 3C2PA 4MKBA 4LSLB 1CULB 5THWA 5KFLA 3NCPA 1S1XA 1PYTA 3D6HB 3IAOA 1HYSB 1F9FA 3JQKA 2JNJA 3JCUH 4X66F 4M5KA 3G4SS 1LFWA 2KG0A 1PILA 3SCIE 5DDRC 1X4AA 4DUYJ 3T9ZA 2NPSB 2OYHA 4KKOA 2OEKA 2RS8A 4B9NA 4GT1A 1HQUB 4DOZA 2XNQA 1RT5B 2CYYA 3EQ2A 2HNDB 2WBMA 1PJ6A 1FJEB 3CUNA 1NEEA 4PXCA 1MWQA 3H1KG 3TWZA 4ECSA 5KT4A 3IRWP 2VFRA 2RQCA 1N73C 1KYOD 2DHSA 2W8KA 5B7WA 3AEFC 1UZDA 1H2VZ 2A3JA 1T05A 2Q6QA 4DV7F 1PV3A 5HANA 2JVOA 3L95X 4ZHRB 3OJSA 2ZH1A 5DG8A 1F5BA 5HROB 2XZTB 2YKQA 2G0CA 2G2YA 2PMHA 4DR7J 4YPCA 3BN7A 4LJMA 2CDQA 1SIWB 1PAEX 3R6GB 2QRRA 3CD5A 4J9UE 4NMXA 1HNVA 2JSXA 3CJ0A 1HWTC 4MTPA 4KY3A 1KNZA 4O3RA 3GZ7A 2F8HA 1Y4ZB 1TL5A 1R6VA 2IAJB 2P2CB 1I3OB 4ZMMA 2CVIA 2QA4P 1RTIB 1RKIA 1LWEB 4MYTA 1MFZA 4G1QB 3HHKA 2P1JA 5A0YB 1TU3F 1HLWA 1K8AQ 4O3SA 3DOMA 1W7WA 1NTKD 5KLVG 3BGLA 4OI3A 3OHBA 2QLFB 3P7KA 4RU9A 3D4JA 3EZUA 2HQCA 1X4BA 5KFPA 5CYMB 3DYAA 4M5DB 3I31A 2VC0A 5AVUB 3P5BP 4Y28J 4WY4A 4DV4F 1S12A 1BCCJ 5A76A 3PO5A 3RRGA 3P32A 4NPOA 4IRCA 1SQXG 1VC5A 1ZAXA 2G1DA 4P75A 1R8CA 2LA4A 3L72D 3G8QA 2MB0B 1P6TA 1Q90D 2Q5UA 2H88C 3AJ1A 4ID8A 2IYOA 4IG0B 3CCVS 1URQB 2HZVA 1R43A 2BR0A 2E5IA 2HW3A 3IG1A 3TJ8A 1ZM3A 4NPDA 2V2QA 4Z1MH 4MIAA 4NA1A 3AA9A 2YNHB 1LWUA 1HQUA 2VDIA 1EETB 3H5XA 1KFDA 5C25A 1RF0C 2WW4A 1S6QA 3LP2A 4J9RA 5E3QA 3VALA 1C1CB 2HS0A 2M5YA 4G1IA 1M1JA 1FI4A 1CS4B 3IG1B 2CPBA 2Y0DA 2MSSA 1VQ8S 3C8VA 4WU3A 2DPIA 1JNZB 1SQQJ 3P6YC 4OX8A 3LANA 4LF7F 3OLBA 1NTMJ 2QIFA 4GDOA 2OPPB 3DOLA 3I0SA 2BE7D 3A7OA 3I56P 1HR0J 5L8RC 4ZCLA 2VG5B 1LTIC 4NLUA 2MZQA 4QWEA 3K8WA 3H1JD 4HLBA 5KLVJ 1WSVA 2VPYB 2FZCB 2QLWA 1SFCA 2R2RA 4WU2A 3MGJA 3HHLC 1XIQA 1IKVB 1BXNA 2MZRA 3CCSS 3SV3A 3A0HH 4RWWA 4CIOA 3H32B 3AXMA 3K8VA 3PV8A 3FZBA 5GADI 2OH2A 2R42A 1RWVB 1PGJA 1BC6A 4DL3A 1AFJA 3N28A 4WFAQ 2P2UA 2XZWA 4WP3A 2NS1B 3NAHA 3T3FA 4QJVA 4G6VB 4UOCA 1IBMF 2JVRA 3E51A 3AQOA 3PEJA 3GR1A 2KFZA 2AMCB 2Z30B 2DXDA 1FJGF 1S1TA 2WSCH 5HLFB 1T3UA 2W2QP 4RKUC 1DBDA 2L9WA 4CLTA 2V50A 4O44A 1K9MT 2R3CA 3R1LA 1FA0A 2FY8A 3V4QA 1CBKA 1CSBA 1NHKL 5HBMA 2Z2ZA 4F3QA 3CCWA 3HLUA 4N56A 3CCLP 4AXIA 4KHPF 3C15A 5F3ZA 3GF3A 3HJFA 4UUWA 3OW2R 5KOXA 1ITPA 3CPWO 2JWNA 3DDNA 3R1HA 5APXA 4PUOA 5KLVK 3U1LA 4XA4A 4F2RA 3A0HE 2MLZA 5KFFA 3H7HB 2R7QA 1WF0A 1YKWA 1WOPA 4WZQA 3DXBA 2OYIC 1IKWA 1RYRA 1DIPA 3CCQS 3HX9A 2M8RA 5L1JA 2CJBA 2CQPA 1GMUA 2IMOA 3KYQA 1CJUA 1OPZA 2AJFE 2RMZA 5HVHA 2HURA 1AQ5A 5J2QA 3PW5A 1IFPA 1YBTA 3AE2C 1RHZB 4BRYB 1U0HA 1MUUA 2XGQA 1U1MA 1ZM2A 3M32B 2DW3A 5JVGQ 2MEWA 3CX5H 3JSRA 4USJC 1KQSR 4QZVB 3HI9A 1GK8A 1PKUA 2FFDB 3QJLA 5EFWB 3MF5A 3Q1MA 1P9QC 4ZPVR 1SLQA 2OKQA 2LXUA 4BBYA 2P9GA 1YJWS 2EWHA 1N33J 3NMDA 3BS9A 3MECB 4TN2A 2DTJA 1ZR4A 3MM6A 4B3RJ 2WSCJ 3DLKB 1CI6B 4CDIA 2RRAA 1N48A 4DX6A 1FKOA 1EX8A 3DKDA 5HROA 2HRYA 4Q8EA 2VOPA 1H6KX 2JJLA 5IT0A 1H0TA 5F8NA 3FEXB 1EDJA 3GCWP 3U02A 4EBDA 3Q83A 3CULA 2HVZA 4ED4A 2NRGA 1RT4B 3CCMP 1B3TA 2DGVA 3O6QB 2JX2A 1Q1KA 4ZLPA 4DR6F 1I1GA 4Q45A 5L9XA 1RT7A 1HQEB 1DURA 3CJTA 4XDDA 1H89A 2BANA 1T94A 1A9NB 3EWKA 3GE9A 5CJ4A 3T5JA 4P7VA 1PC5A 4NZ7A 4PG4A 4FF4A 2FUG9 1LP1B 2OSRA 3FKBA 4CH0S 2FJDB 4X4TA 3IR9A 2BM1A 3TO8A 3NS6A 1OW7A 3OJAB 1S6PA 3VGUA 4CNZA 4CO5A 4M8LA 2HIQA 4JI5J 5KFUA 3QH9A 1NJYA 1VQMS 4PRFA 2G2OA 3ULHA 2GC8A 3T6JA 4W7YA 1K0VA 3P3DA 2J5AA 4LIWA 1HNWF 4WPAA 5GAEU 4JV2A 2AXTE 2YWHA 4PJ0E 5F9LA 2BEZF 1N34J 4MH8A 3MD0A 3OUYB 4PG7A 1TL7A 2UUBF 2GGPB 4V1Ak 2J59M 3VGSA 5E3AA 3SI8A 4YP3A 2PT0A 2XMJA 4C11A 4DV5F 1IFJA 1FJ7A 4IOBA 4H13C 2G13A 4K59A 1IKWB 1VQ9P 4P10A 3C6TA 4ED2A 5T7LA 1M5HA 3VTIA 1LT1A 4C0BA 1SS1A 5L39A 2RQMA 3HO1A 1SB6A 1SQXJ 4H54A 5B66H 3WDOA 3OUYA 3ENAA 5KFWA 2ZH5A 1T3NA 4E8UA 1TAUA 3B5NA 4DPXA 1NB2A 3VWSA 3NWGA 2YMYA 4FKYA 4C8KA 3O2IA 1PAUB 2DEIA 1U2CA 4AUWA 1ZA1B 1S0VA 1WSRA 1FVSA 1T11A 1S6UA 3AE1C 1BGXT 2XI3A 4ILRA 2RB7A 1SQVE 4UOGA 2BRLA 2AGQA 5KG1A 2WPSA 2IA0A 2Q7CA 1FZCC 4UB8E 4GKGA 3LW5H 3TW0A 3UO0A 3RL0g 3Q8VA 1ZP0C 1E6YA 4B3OB 3KWMA 2Q9IA 4B9TA 1FK9B 1I51B 1NDLA 3O3LA 4C7QA 2WZ7A 3CO9A 1BY9A 3M0DC 1FZAA 3UR3C 4DV3F 4DFKA 2ZUGA 1QD1A 4O0IA 3N7NA 4H4MA 1HVVA 3G86A 3RU0A 3KKFA 2F63A 4M5LA 1T6AA 4ZHRA 4A46A 2GX8A 3V2UC 3IGNA 4DPWA 3H1LD 3BQ0A 2AEMA 1Q86Q 3W5ZA 4KB7A 2AP6A 4Q2MA 1FOSF 2HQGA 3PIPQ 2GA1A 1RZMA 2PO4A 4C48A 2VBZA 3MAAA 1JM0A 4AL5A 3PHLA 3GG1A 4QWCA 2UUTA 2W7OA 4URGA 1IBLF 4QW8A 3CJ3A 2M5AA 2D41A 1VRQC 2W6AA 2CAJA 4B9UA 3C46A 5HMXA 2X1GA 4ZVHA 2GO8A 2RD5C 1HYSA 3SCLE 1B4SA 2AU0A 3NGTA 1HJ0A 2QG4A 1QUVA 3CC2S 2B9BA 2BKOA 3AHPA 2COLA 2ZUAA 2Z0GA 2WSCC 5D8HB 1C1BA 4DV1F 2CNOB 3P96A 5GTIE 4OVNF 2DR8A 1A02F 2XYHB 3M32A 1S2EA 4LQ9A 2WTFA 5J2NB 3T97B 3KZIE 1GXUA 1S1XB 5K9FA 3HUSC 2OHDA 5F8IA 1KLMB 2GQCA 3RK2B 3PH0A 4DL0C 3FBBA 3KLIB 4LSZB 3L75G 1Y5NB 3MEGA 3L4BC 2K1RA 1NTMD 1QM9A 1UEVA 4J91A 1FZBA 1FRMA 1SKWA 4A4JA 4IO9Q 3A3OB 2LEPA 2XSJB 4N5SA 2BM0A 4NYZA 1VQOS 4WK1A 4PWWA 1VQ7P 1LW2A 3OR1B 4YDDB 2DNZA 2CQ0A 2C2KB 2AWZA 1FDMA 4I6AA 2W01A 1BQMB 1JMMA 5LJ5Y 2QL7B 3A8EA 2YXLA 4NXNF 2CPFA 2OAUA 2A2CA 1BE3D 1WDDA 4WYLA 3N79A 4ZJLA 1L3TA 1Q16B 3BSNA 1XEZA 1EZVE 3CX5D 2Q43A 2CPEA 2J8SA 3BPDA 4OJ3A 4ZDNA 3M2UA 2KS1A 3EGWB 2XY5A 2HRTA 1RAFB 1HUCA 1SKUB 2I0XA 5KG2A 4LRCA 4DQRA 2B56A 1LNQA 2ZBCA 5D78A 1B7YB 1RE3C 1CVJA 3CDWA 4ZKAA 1FFWB 4YS2A 4DJGA 2PEHA 5DGAA 3PX4A 2QJYC 3M05A 3IM8A 4IG3B 5J2PB 3ISNC 2KXHA 2C9NY 1LTGC 3G6EP 3RBDA 3S8SA 1U26A 2J6TA 1GX5A 1ZOYC 3IFEA 4NZ0A 3FVYA 5HLFA 1UEKA 2YO2A 2B4PA 3NGUA 5I3UA 2KZMA 3SQGA 5F41A 1HBNB 1C2PA 3UDEA 2Q6CA 3RK3E 2ZJPQ 4RW4B 2XS7A 2X1AA 1SQXD 2WZ1A 1PIEA 3QLHB 2OUGA 4H4KC 1UEUA 5A2QU 2MHNA 3EUNA 1SKSA 2H4YB 2WB1D 3H1LE 1WKJA 2E5JA 1OVRA 4DZ6A 2V8VA 3TYYA 3CE8A 1NTKG 2AHOB 4A8SA 2UXDF 1NGMB 3CTRA 3SIPB 4DL6A 3P8CD 1HH0A 1KQKA 3GHGC 4DV3J 2QJ3A 1VQ6S 4IH5A 2E1CA 1TKTA 2OFHX 3I4PA 4JV5J 1BQNA 2G9OA 3SWYA 5J2QB 1KDNA 3MTKA 5LSRA 5BU5A 2W4PA 1FRHA 2ZH9A 3K5NA 2ZH8A 3OVBA 1TV6B 3MPWA 2DBBA 3B5NB 4QWDA 2HNYA 5CABA 1IR2A 1TL4A 1JTHB 1S3JA 1FHTA 4F3OA 1VQLP 1NH7A 3RW7A 3NMRA 5GMKa 1ZRTD 1X5OA 1SVDA 2C2MB 4ZA1A 4DUZJ 4CLZA 2LXIA 1OSCA 1HJBA 2ALZA 4AYBD 1CC7A 3TX0A 5HO4A 4F4WA 4OYMA 4CT8A 2YQ0A 1C0TA 8ATCB 3AEGC 4LF6J 3BO4A 3BVHA 2WSFC 4X66J 4PV1C 3F44A 3R5AA 1VS3A 2ZHBA 4Y2CA 2IPPA 4F25A 2DO4A 3SSRA 2DT9A 1F1BB 2P9CA 5ETTA 1FWLA 4USKA 1H7XA 1NKBA 1NLKL 2FY1A 3R2CJ 1YRUA 1KOHA 3PR4A 3KLFB 3F56A 2RMLA 4LF9J 1ACMB 4C0OC 4KGXB 1U8WA 1JY2P 3FGAD 2C9LY 5CHCB 3MM9B 4ETXA 1TUGB 1N0UA 3VN0A 2RILA 2AYBA 2E42A 2OTJP 1W26A 4OYXA 3UD4P 1ZS6A 2P67A 2VASA 1XERA 3FDSA 5APYA 5HQMA 4OI0A 1FDIA 1M1JB 3LAMA 5D0EA 5KJ7D 1HI0P 1NTZG 3LWMA 2A6MA 1KVJA 2DNRA 2HODB 3TUIC 2HBQB 4DSLA 5E3PA 5B0DA 1DARA 2ZH6A 3FBEA 3D1QA 2R2SA 3HKZD 4DR7F 4TLRA 1QAYA 4M5GA 2KH9A 1HQ2A 2Y9YA 1D8ZA 3JTOA 1L0LD 3H5SA 2BBEA 4ZVRB 5L1IA 4Z2XA 1GW4A 2W6JH 2MQ8A 2AYMA 2JKVA 1NK9A 2KFNA 3SXLA 1Q2NA 1FAVA 1CC8A 3LP1B 1S1UB 4C8ZA 2JC1A 2BCCE 4YN3B 1ZBTA 3HE5A 1YJWP 2D3ZA 4OZ5A 1SL2A 4C9DA 1BGYG 3B54A 3BGOP 4ID5B 3C16A 3THTA 1HPZA 3H4BA 1FKOB 2GGPA 2EFPA 2EBEA 1Q53A 4U7CA 1LTJC 3RGIA 1IK7A 1N8RQ 1R8EA 4DV4J 2JOQA 2FVQA 2QL5B 3GIIA 1S6QB 2ROGA 1KONA 1YRXA 3NOCA 2WITA 1BD6A 1QAIA 4TU9A 1HWLA 3SWFA 2IPOB 3H1IJ 2YNFB 5I3PA 2B0GA 1M5PC 4IRKA 4ZLLA 2EC2A 2V5HG 1EDKA 4WIQA 3I82A 5F8LA 1L4AD 2Z57B 1X5TA 1FEEA 1MV8A 5BYSA 4F8RA 4X62J 1WOSA 3BM7A 5D3GA 4PXDA 3V2PA 5KFJA 1DD4A 2EG2A 1UETA 3DRYA 2NYIA 1GZLA 1TV6A 3M06A 2ZZNA 5CCGD 1QDUB 3IC1A 1WUUA 1Z4UA 2JFKA 5JXSA 1FKPA 2IY5B 4GKJF 1BWVA 1LW0A 2MGZA 5AVYB 3D3CJ 1JX4A 1RF0A 1SQEA 2ZFHA 2BASA 2Z2MA 1N52B 2OPSB 3HZEA 4RLEA 2VQEF 3MGNA 1V3SA 4NCAA 4P9SA 4FP9A 2E76B 3GCXP 2E74C 3SCJE 4WTOB 1KEKA 2OQQA 3AD7C 2ZH7A 1IBKF 4IFVA 4TLQA 3EXCX 3CC7S 2YNIA 4IG3A 2LU2A 4QMAA 2IDLA 5KFKA 1M1GA 1KTMA 3GYXB 4MYUA 1AB8A 1WT6A 5KAFE 3DM2A 3BSOA 1LWCB 3N6LA 5ETRA 3O1LA 5K5MA 1XJWB 3ONQA 3NS7B 2ZNZA 2OYHC 3KLGB 1JEKA 5CZVA 4I2LC 2BRKA 2CPDA 4D3HA 4DLGA 2HFUA 4CYUA 4ER8A 3TUPA 5ETVA 3VMXA 4WFNQ 2AZ3A 1P9YA 3AAWB 1WKLA 2LQBA 1RBLA 1OVUA 4J9LA 5CYQA 2J7UA 3B4MA 2QSIA 1AFOA 2IJNA 4LSLA 1L2PA 4DMZA 5AE2A 2RKLA 1NU1G 2ZE2B 4FPIA 3IAM9 4RESB 1IBMJ 5HQ8A 4HDGA 1X5SA 4KIAA 2MYFA 4NXMJ 1CJKB 4JYAF 4ELTA 2KVQE 2Q66A 5LM7E 3TSIA 2UXCJ 3R9LA 3HVWA 3BV8A 1N5TA 1RF1C 5D0GA 3MR5A 1EXJA 3IF4A 1V9OA 3AB2B 4K50A 3N5FA 2IYPA 2LDYA 4P2FA 1P27B 1XNRJ 5RUBA 3BBFA 1NDKA 4IFFA 3L74J 4H44B 2XMWA 2VUGA 4LRDA 2BX6A 3JSVC 2YX7A 4PG6A 1C1BB 1KB9E 3NNHA 4WXOA 2A0FB 3JYTA 1YZ7A 5CJ0A 3AQPA 2P6TA 4USUA 5LL6d 2GFFA 1NM2A 1YJ7A 2R3SA 3PKYA 2FYUD 3OW2O 3AE3C 3A4TA 2VODA 1PC4A 5C39A 3L75E 2J9DE 1BQNB 3JAMY 2QA4G 3LGMA 2NZ2A 3NBPB 4RNFA 4NLTA 2VFUA 2VBYA 4DQIA 3TZXA 1S5LX 3M8SA 2CVEA 3JYTB 1XMBA 4LUBA 2DR5A 3GSDA 4IDKA 3CD6S 2F9DA 5KTQA 3TA2A 4A8FA 4ANDA 3M9HA 4GO7X 2HR3A 3KK3B 4OI1A 2V9WA 1HNWJ 5FJ4A 1Y11A 3MUDA 2V63A 3ELHA 3A8KA 3W5YA 1HWJA 4ES1A 5HP1B 4G1QA 2EFVA 3SSUA 3ZTSA 4DL5A 2QEXS 4RW8B 2ZOFA 3TUZC 2MKKA 4KGZB 1KLNA 1EETA 3MR3A 3CCZA 3VMYA 2DCLA 2BJ8A 1MU2A 2B88A 2H89C 3I32A 1HBMB 3BDEA 1SJFA 3L37A 3V5RA 4A8XA 2R44A 3OA7A 1MW7A 4PPDA 1KMIZ 2K06A 2BACA 4ASVA 1RTZA 4KYZA 2C2RA 1NHVA 3E1IA 3D5MA 2C28A 4NI2B 2E74B 1SQQG 1O0PA 3DM2B 4GOEA 1RE3A 3MFIA 2J58A 2JEJA 3ZNUA 4ELVA 2C3OA 1XQIA 1VRTB 3RB3A 1IJFB 2NQPA 4DZDA 2YIUB 3TGUD 2ABYA 4YQWA 3CDEA 1VQ6P 4JI4F 4AQYJ 3PNIA 2RN0A 1ZTTA 1AYEA 1VMBA 3CMES 4IH7A 2BJEA 3K5OA 4DS5A 1GTEA 3X3UA 1QEXA 2F5GA 1RT3B 3CEDA 4B86A 4ED7A 1YGYA 1KFSA 2PFDA 3C66A 3MUDC 3J81Y 2IM0A 4JF7A 3M8QB 3AECC 2QL9B 1FRJA 5DM6Q 2JO1A 4R0EA 4DN0A 5EWGA 3ITHA 1SQXK 1HGVA 2PMWA 4HHHA 3KHUA 3ZTOA 4ZK7M 1VR6A 1MG7A 4MFBA 1VJWA 1JLAA 3ZFVA 3WUUA 1HFEL 4MK8A 1P1TA 2HG5D 1UVIA 1Q8BA 1RE4A 3MMBA 1L0NE 3W2VA 4LF4J 2XSJA 1KVKA 1N86A 1ZW0A 1U1QA 4RKUJ 3L70E 1WELA 3VQSA 2D2CD 4CLYA 5HMYA 3V4MA 1SBRA 2W4CA 4X4QA 2DNHA 2UVWA 1ICEB 1RT6B 1RTHB 4JPZB 3MHYA 3EPIA 1XTGB 3M9BA 1OY6A 1D7MA 4HACA 1U25A 4A8QA 3VOPA 2ZDOA 1NH8A 3NTNA 1F9EB 4NLDA 1H0TB 2LXBA 4DG1A 3NNAA 3IA0A 5C42B 3HDSA 4WB4A 1EARA 2N9YB 3EGZA 4HTJA 2YKMA 1SFCC 3POTB 1A02J 2FVCA 3KJFB 2E7XA 3D6YA 5AW5B 3Q86A 1CULA 1R0CB 3AFGA 3TAMB 4P2XA 4ZCMA 4JI1F 3KLVA 2POKA 4OHXA 3FSXA 4XTTA 3S9OA 1H8AA 1WEXA 4FVCA 1N32F 2ZHAA 2IZ1A 1N7SC 3RG6A 2FYXA 4DV7J 4DN9A 2F4VF 1KILE 2JWDA 2MZ1A 1ZXGA 5KT5A 2YQ3A 4ILLA 4BLGA 1X4CA 3KNGA 2LCWA 4ECYA 3I56S 1SQPG 2CRLA 1AT1B 2OARA 4Y3CA 3LIDA 4ECTA 3KPEA 3DRRB 4LBIA 2HS3A 1YHQP 3R5JB 1RT2A 3M2RB 1UCNA 2MQNA 3H40A 1RE4C 3JAMU 3C8YA 4QIFA 2LECA 2V4JB 1NTZE 1GH8A 3VZIA 1BDCA 4LFAF 1ZMEC 4HH1A 4NLXA 3ENQA 2RRBA 3W2WB 4F0HA 5KJ7C 1H74A 5J2MB 1XC9A 2R5BA 5FIIA 3BBCA 1T9XA 9ATCB 2DR6A 1FO1A 2B5JA 4EOTA 4B9LA 4IFYB 2OTJS 4G3IA 3AE6C 1NVOA 4HVZA 3E01A 3OR1A 1R5SA 5F9NA 1JLFB 4JP8A 3CXCR 2H7HA 4M5JA 3SCKE 3MMAB 2I9SA 1N7SA 3N4XA 3RR8A 2BE9B 4NLRA 1QGKB 4BHQA 1U1OA 3QT6A 1VIXA 1PZQA 5B0EA 1RTJB 6FDRA 4FDFA 3KHHA 5HL7Q 2J0WA 1UMJA 2E1PA 1FZGA 1OPIA 1FJPA 3AEEC 4JBCA 2J6SA 1OYEA 1S57A 3HPOA 2MY8A 2WSFH 5A8RA 1X9WA 2NXNA 3V81B 3BDPA 2UVRA 4EEYA 1DHMA 4ZPBA 1U6BA 2DNKA 4CZCA 1WC4A 1JJHA 3GFYA 2DIUA 2GHWA 3MCSA 3ITKA 5A8KA 5M2RA 5DZ7A 3TGUG 2MZTA 5K5GB 5AJ3F 4WTYA 1B99A 2MLXA 3QGHA 1NTKE 1KILC 1TMMA 3OXLA 2IX7C 4DCPB 1OQ6A 4PV1B 1RU2A 3IS9A 3ZTRA 4B08A 1NRKA 3H1LG 2BZ2A 1Z56A 1IKYB 4B3SJ 1RWPB 3NGKA 2EFQA 4K4WA 2IDEA 1RT4A 1HBWA 3H5UA 3HSJA 4QYRA 4U7UD 1G4CA 3W7BA 2QGFB 5HATA 3DOKA 3GG0A 3SBMA 4QCLA 1VQNS 1OY9A 4KV8B 5KKZB 3Q3DA 2A45I 2LXFA 2O3DA 2KLVA 5T7LB 3A5TA 3JQMA 4QWBA 2KT5A 2AJ2A 1SQBD 2N7YA 1FD2A 2OLWA 2VU5A 4IR1A 4UOHA 3J7ZT 2GNKA 4LF5F 1RYSA 1OMSA 3KG0A 4DF8A 2VHGA 2JP3A 2MY7A 5KFHA 3R5DA 3BJYA 4K7QA 1IVZA 1FRLA 1FJGJ 2N82B 4OGQD 4JB8B 1IFMA 2UXDJ 3CDAA 4RW6B 1GMWD 2XI2A 2W1BA 4PZVA 1RHKB 3A1YG 1OFCX 1S5LH 3H4DA 2QFIA 7FDRA 4JI8F 5A8WA 4X4VA 1CI6A 1SQVD 1PFIA 2C22A 2BVZA 2CQDA 1YBUA 4ZPTR 4WFXA 4JV5F 1WTBA 3DGPB 2D1CA 4U7JA 5AE3A 4X4RA 2KZZA 2J6UA 2V2KA 4K4ZA 2BE2A 1N6QB 5J2MA 4UB6H 1SXLA 3HHLB 4HI2A 3BH6B 1FKPB 2BEFA 3H1IG 1FVQA 3ILIA 3CL3D 1VRUA 3CJ8A 2RF2A 4ECXA 4QBUA 2YNGB 1WACA 4ECRA 3J7A1 3QZ8A 9RUBA 2QO3A 3LOUA 1AA1B 1S9GB 4F02A 5IZHA 3HD2A 2GO9A 4A47A 3M8WA 2A1BA 4X4PA 2XKMA 1U24A 3HHLA 2DNGA 3FNNA 2YNYA 3RW6A 4LF6F 5I4MA 1S1TB 2VH7A 4L74A 2Z5HA 3LALA 4AFFA 1EIYB 4NWBA 1FF2A 5D0HA 2Q6BA 3PX0A 1SV5B 2ZKTA 3TYTA 1S1VB 1GL2A 2FJVA 1Q7LB 1N33F 2FYUK 3DRSA 1QL1A 1F0XA 1RQVA 2OPRB 2NZCA 4OJ1A 4LMZA 1C4CA 5DJBA 2QJKC 1BQMA 1Y10A 4LRBA 1NK7A 1RU1A 1PP9D 5CBNA 1FFSB 2NREA 4X4OA 1Q5VA 2RH0A 3QO9A 3BSCA 4IDKB 1NWQA 1FZCB 2PI5A 2B9EA 1N5QA 4RBTA 2GMHA 1SUQA 3POTA 4DEZA 2KJWA 3ZTPA 4OHYA 3JTPA 5KFZA 2BW7A 2G3AA 3T5KA 5APTA 3M2UB 1S9EA 4FZVA 3DLHA 2K9YA 2ZD1A 2LQ9A 2BQ3A 1AFIA 2XHCA 2WRMA 5LMUJ 1HNXF 1NO8A 4OGQC 2NSCA 3RK2C 4PWDB 4LFBJ 2VBWA 2WBRA 2R2UA 2VQEJ 2CNKB 3IBFB 3UD5A 2HHSA 3FSIA 2K3RA 3G2XA 1QE1A 4CH7A 1YQ3C 4P7TA 2E44A 1O5JA 3KJVB 2ZXEB 2J9CA 1HBNA 4DR6J 4TNOA 4NLYA 4FKXA 5HK4A 4RUCA 4Y34A 2VQFF 1U48A 5IT9U 8AT1B 4ZPDA 2OYIA 4IFDK 3G9RA 3KUGA 4MK9A 1GTWA 4CO1A 3TJAA 3AOCA 1F9HA 3A8IA 4HYTB 2KHDA 2B87B 1SI9A 3TR5A 3M8QA 2R7WA 1ELOA 5K8PA 3DGVA 2O1PA 2V4QA 1UL3A 3CCUS 4FS1A 1WG1A 3N5BA 2YNGA 4OX6A 4J9KA 2IA6A 2IRUA 3QWPA 3HE5B 3TAQA 2CJYB 5DZ6A 2NPFA 1HNIA 1PGZA 4CH1A 5AT1B 1JY3P 1CS4A 4MKAA 4PD4D 5HMZA 4CTAB 3FEYB 4ECZA 2VJUA 1VI7A 2M3EA 3MCNA 1TTHB 2HGNA 5BYRA 1U7LA 5A8WB 1KS2A 1JLFA 2BJ7A 5KFSA 2DO0A 2K88A 3H6PA 4GODA 5SZTA 1KQFB 1ZETA 3CLQA 1VQ5S 2LA6A 1M56D 3CGIA 4WCEQ 1HW9A 4B3TF 5CCHD 3CCJP 2HK2A 1LT9B 3FWNA 2M9KA 1UTAA 2I5JA 1MROA 1LWFA 5EHHA 2GJFA 1HGZA 4LF8F 3HK2A 2W7PA 2WTYA 2XWXA 4B9VA 2A06D 2WK4A 1DLOB 2QFJA 2ZJSE 2NPSD 3Q5SA 3PW2A 3M91A 1XK8A 2XU6A 3L9ZA 3W8GA 5CYMA 3RK2D 1JO5A 3RGUA 2R3VA 4C7RA 4DU7A 3CC7P 2RJZA 1E6YB 3MUVP 1C0UA 1LWFB 2IIHA 2J9DA 1FZEA 4PABA 2VG5A 1WTFA 2E9ZA 3PXGa 1NKCA 3M6WA 4KC5A 3I0SB 3NOGA 2V2VA 1OIAA 3CC4P 1FXLA 2KNCB 3MR6A 5LXRA 3BO3A 2I1KA 5KG5A 3FCHA 3F73A 3MMJA 2GVZA 3O6QA 1UVMA 2LYVA 4I7FB 2DHXA 2KI7B 2Q3IA 5I3UB 4P2SA 2ZM6J 3K89A 2R9LA 4MKVA 3ZZPA 4FYVB 3QBCA 1EZVD 3CX5E 5GMEA 3MTJA 1USDA 2WHOA 3ITHB 3PFEA 2BV3A 1B64A 1HF9A 1TUWA 4GVLA 4V19X 2DNPA 3RAMA 4U8YA 2CQCA 5F8JA 3H1JE 2D69A 3R3TA 2NYHA 2A2DA 3CCUP 3M2RA 1S0NA 1WI6A 3VF0B 2E29A 2RIJA 3DRPA 3D1HA 2IFNA 2YXRB 2D2CC 2KDOA 2XMKA 4UQGA 5APVA 5EUHA 1L0LE 2B87A 2VA2A 3VQTA 3P4UB 3I4HX 4HI1A 1EP4B 1CPZA 2C3PA 2L5GB 1JNRB 5EN1A 2HHTA 1IR1A 1NTME 4JI2F 1AQTA 3A8JA 3JB9k 2YBVA 2FXPA 2CQ3A 3QQCD 3CVKA 3EGVA 3H20A 2RDJA 1UP1A 2VKRA 1LTSC 4B3MF 3IAS9 3KLEB 4OZJA 1FDAA 1IC2A 3AE9C 3PR5B 1TR0A 1F5CA 5LMNJ 3KXDA 4OJHA 3GIKA 3H8YA 3QT8A 3NFQA 2W2OP 1ZLLA 2K2PA 4G65A 4KHXA 4IOCQ 1TL1A 2E7WA 1WI8A 3RB6A 3AE4C 2IC3A 1YJRA 5APUA 4U8VA 1P8GA 3HFKA 3I87A 5F8GA 3NGRA 4Y28C 5AVTB 4LVNP 5DG7A 3CPWR 5G0RA 1M90T 3OL6A 3GIJA 4LF4F 1S72P 2CKWA 2FJXA 3GONA 3HXMA 2NUHA 2HAIA 3JSMB 2APOA 1M1HA 5C42A 2CFXA 1VCTA 2AXTH 4Z7YA 1RI7A 1PBUA 2CZ9A 4RBVA 2HHUA 1JK9B 1LV5A 2CZ4A 3W60A 1KORA 3BZQA 2WVCA 4NLPA 2DRBA 3JC22 3UI3A 2EFGA 3S7RA 4O3OA 3TOQA 3I96A 3TAMA 2POHA 1KFNA 4C46A 1AUSL 2UU9J 3DNCA 1WKKA 4UB6E 4F4AA 3AODA 4EO6A 3L4FA 4TYBA 5KFBA 3CCVP 5M2PA 2RHSB 4NLSA 4CO0A 1J1EB 2EBGA 5HN0A 2D9PA 1LJ2A 2CZVC 2ZNYA 1T02A 1TMJA 2FZKB 2UV8G 1PG5B 2B7CB 2MKIA 3P8CE 4FYXB 4TYAA 1WC5A 3BCCE 3MMBB 4TY9A 1R5LA 1XMQJ 1J5EJ 4KGMA 4DQQA 2NR0A 4H0LC 4JI1J 2BUNA 5DQHA 4ZKUA 1BLUA 2OMOA 3RTVA 1A0OB 4W4MA 2BE2B 1N6QA 3EYZA 4TVAB 2G1HA 3UDCA 4C0HA 1YTYA 3W1YC 1FE4A 2BW2A 3KUHA 3DGPA 1KHVA 4M5MA 1CJKA 3M6UA 1VPCA 3J80Y 1FDOA 1PGQA 1ZM4A 1VISA 2R8IA 3MEDA 4C8LA 1ZPVA 1OO0B 2I8DA 1RBAA 2YY3A 1QSYA 1NSQA 3QRQA 2A45G 1D8YA 3TX8A 2ATLA 3P45B 3QJJA 3TQEA 2P58A 2CQGA 4DV0F 7AT1B 4AD6A 1MKMA 1AZSB 2KSJA 3MM7A 2AJQA 1LXNA 3ENVA 3UCGA 4CNYA 4RW8A 3H1KJ 1GT8A 3M6XA 3L73E 1FD8A 1PP9E 5KFCA 3TVYA 4PEOA 5T41A 2UWJE 1EAYC 2OD6A 1SQXE 1JLCA 4A7PA 3IP0A 3GIMA 3AB4B 2W2NP 2KI2A 1AW0A 2IDBA 1WRGA 1QLNA 2V7QH 2IFXA 3DOMB 4M95A 4JI2J 2CQHA 4NEZA 3VVTA 4OYWA 4CM0A 1PPJE 2VKZG 2DGSA 1S7IA 1UJ6A 3G6VA 5AVSB 5KLVE 2PE8A 4I56A 2HRUA 1RHQB 1FBMA 3ENWA 4B3MJ 5DJUB 4KAIA 1LKZA 3HSGA 4D6TD 1H38A 5HQLA 1MROB 3EZOA 5K8MA 2LP4A 1PO6A 1U57A 4ECVA 2XULA 1CLFA 1N5VA 1KB9I 2U1AA 2D2CB 4NCBA 3D7SB 1AROP 2XQCA 3Q2YA 2ADBA 2ROPA 3DU5A 4B3RF 1DRZA 2ERRA 1L3SA 2W9CB 2FC8A 2MJNA 3HT0A 4Y2KA 2NPSC 5CCMA 1D9FA 2D9OA 2MKHA 3V2QA 1NK5A 3N6MA 1YJTA 1FNOA 2UV8A 1Z1ZA 3IWXA 4OI6A 1REVB 2R8JA 2ZFCA 2F7VA 2HLOA 3MEEA 2HHVA 1AVOA 5K14B 4X64F 4JI0F 4M63A 2UP1A 4USVA 5B0BA 3L71D 2W24A 1TKXA 2OGUA 1N7SB 4HJGH 2M3DA 2IBZE 2XMAA 3L7PA 1U1NA 3I5CA 1G1IA 1Y8AA 2HHWA 2KXPB 1QJHA 4B3SF 2HFVA 3FCVA 3W9HA 3BB5A 1QAXA 1AVYA 1UFWA 2XMTA 3D28A 1S76D 4A8YA 3IBWA 1VBXA 2Z4EA 2HFED 2E1MC 3BSAA 4J90A 2AIRB 4C2MA 2KRBA 3WMM0 3NGSA 4MFBB 1L4AA 4R25A 1K73Q 1NTMK 5KG4A 4CO3A 2Y1RI 6AT1B 2XY6A 1GL2C 4X62F 2WB4A 3DMJB 2IFMA 2O1JA 4MT1A 2DGOA 4NRTA 2XMUA 2JDJA 3TVZA 1KQLA 2XS5A 4DCKA 1PP9G 2MKJA 3L73G 2ITAA 2HODA 4L6V3 2ZAEB 4L72B 4QW9A 5KG7A 4P6QA 3Q2SC 4X65F 1S6PB 3IFMA 3PHEA 1Q8LA 2KKHA 2XZDB 4Q0BB 2VG6A 2CQBA 4CT9A 3MD1A 4WKYA 3CD7A 4PQUB 3EZ5A 2UZAA 5C24B 2R8KA 4WP9A 1XWLA 3ET6B 1HNZJ 4GKKJ 3L72J 2LEAA 1IBKJ 1NYHA 2OYHB 4KKOB 5CYQB 1GMWA 4I69A 3Q8PB 4LRAA 1RKJA 1JCDA 1BCCD 2B4VA 4IQXA 2AX1A 3HE4B 3OFFA 4IKAA 2QT7A 1M7LA 3SZ2A 4DV0J 2B9WA 2XSFA 4F4KA 4DSFA 2DPJA 5AW9B 5DETA 4CYUB 2OO4A 5G0RB 2ASJA 2PC6A 2NXUA 3ETOA 3K5LA 3BYRA 1RWNB 5GMDA 2WVEA 4NMLA 1D9DA 2RKIB 2FFDA 4EO8A 2CG4A 1H3DA 4DL2A 2EK6A 1TKXB 3TVKA 3H1HE 3MM5B 3NXSA 2WONB 4X2BA 1JY2O 4JYCA 3L74D 3M1VA 4DSEA 1IXKA 3MCMA 1IBCB 1PIXA 3KG4A 2V8DA 2E43A 1X31C 3FFIA 3LP0A 2QJYB 2DNQA 1HNIB 1G1XA 3CC2P 2DHAA 3TK1A 2QM7A 1VLOA 3LP1A 1OJ4A 4CP5A 4OGQB 4HKQA 2VFTA 1OMIA 2AYEA 4OI2A 4BWMA 1U6ZA 1HBUB 2EFOA 3ICLA 2N1TD 3BKTA 5F8HA 4N47A 3PM9A 3M1VB 2P8IA 2HHPA 4QQBA 5APWA 1NDCA 4EBCA 1LFPA 2CJKA 2LKZA 5D15A 3WHIA 4A8MP 3G4SP 2M0GB 2MQQA 3BEGB 3E1RA 2MPUA 2W7AA 3VMAA 3JTNA 3OTOF 2QMUB 4RW6A 3RUBL 4EDFA 3C6UB 1GMJA 4J5OA 5L9NA 3PLNA 2P10A 1NK8A 4KT0C 4H4MB 2VQFJ 1RA7A 5DO2A 5AW2B 5LSOA 3IWLA 2IC3B 2O67A 4CLFA 3T1YJ 1B0VA 4NPEA 2FJAB 4PD4H 2C2EA 2AZ1A 4KR0B 5CH7B 4DR3J 3IO1A 1LTAC 2IBZD 1V3ZA 4YB6A 4J9OA 1AV1A 3CCRP 4GC6A 2IRYA 3LO3A 2VJVA 2E75D 4DV2F 1DEEG 1RSCA 3NEKA 3T41A 3ADAC 1FU1A 1LW0B 5KT6A 1QSSA 3Q8RB 4NE9C 3ZZOA 4RNHA 4UQTA 3QMQA 4N41A 1N5SA 4H4OB 1JUNA 3HD7C 3TDKA 3H1KD 3ILOA 4BWNA 3M6VA 3W8PA 3QGPA 2Y1IA 2L08A 2DR7A 1SQBG 2KUBA 1YJ9S 2RKIA 4PCQA 2JWAA 5LOQA 3IS9B 4XAKA 1PYSB 2E9RX 4YR3A 2YKAA 3CJ2A 1FT8A 3UNYA 3FXDA 4J9PA 3H1JG 3BYPA 1NK4A 3W65A 3TA0A 3BGFA 4CLLA 1VF5D 2RUGA 2MKYA 3FMWA 1BHNA 1J27A 3RBXA 3RB4A 4M1KA 3KHLA 3K5PA 1FDNA 4ICLB 2ZT9C 4NEYA 5AW8B 2RRNA 4RZRA 1WF1A 1NNDA 3HKWA 4RO0A 2MMYA 2RT3A 3CO0P 4F36A 3BGRA 3TA1A 2M70A 4BCAA 3KTQA 2DGTA 4C3LA 2N1TB 1CEZA 2GVZB 3PRDA 3J7YI 1NU4A 1SC4B 3MPUB 2QJPC 4Q7AA 2SXLA 2CQ1A 2QSWA 3CNQP 2R8GA 3MM8A 4FN5A 4USHA 5IV4A 1EKSA 3V6IA 3B4DA 4LT6A 1SH2A 4DZOA 1TKTB 3SMZA 1BGYD 2UUCJ 2V8HA 1X4HA 2K3KA 3MD3A 1BDDA 5KT3A 1JJ2R 3UPFA 2AW0A 2VB6A 3DDKA 2VF3A 5APQA 1T3JA 5CHXA 3RK3D 3M30B 4KBIA 3CXHD 3KQGA 5DQIA 3O8ZA 3PRJA 4KJMA 4OHWA 5HI7A 5HSPA 3UCUP 1DX7A 1FOSE 1FTRA 2OPQA 3ET6A 1VIOA 3CCRS 2HFOA 3G6ES 3LWLA 1FRXA 4XPEA 3CD6P 1IJEB 1TU0B 2HHHF 4J7CA 3IR6B 4OZ0A 1H2TZ 1UA0A 4LF7J 4DQSA 4C8OA 4OFZA 1G1JA 1IFDA 1RHUB 3S01A 1T2KC 3NXZA 1D3WA 2RQKA 2HZAA 4ZOSA 4N8NA 5KFAA 1I6JA 3GIRA 1YIJP 1BGYJ 5BU8B 1G7CB 4I2PA 1RE1B 4N78D 4RUHA 2HNDA 3CCES 2HHQA 2WSEC 2WPRA 4F26A 4F4YA 2ZYDA 4CO4A 2FJWA 1XTCC 2XZRA 1I94J 4KHMA 5B0CA 5I42B 4XE5B 2CJ9A 1FZCA 3SV4A 3BASA 3E7KA 4DR3F 4DG1B 3D6FB 4F0KA 1FS0E 3DN9A 3EXYA 1SQQD 3R27A 4BRYA 2YH0A 1VF5C 4QYZJ 4ES2A 2UUAF 4BS2A 1WHXA 1VJQA 1ZV8A 2LQ8A 4DR4J 2IZ0A 1FK9A 2F4VJ 3LP0B 2V4RA 4IG0A 2AT1B 2YTCA 5GTHE 2L41A 2GCFA 2BXJA 1IQZA 2IBZG 2M0BA 1RQ0A 2DIVA 4CO2A 4O3NA 4XFJA 3OTDA 2ZM6F 2QLBB 2WSFJ 3CMQA 4I6YA 4PXBA 3R2DJ 3U7JA 4KHRA 2VFSA 3ZXWA 2YQ1A 2RS2A 1F2GA 5KG3A 1T9TA 1RABB 2IBKA 5IS2A 1SC6A 3R6LB 3CJ4A 2M5AB 3GYNA 1H72C 2VBXA 1NTZK 1EHWA 3VAKA 2ZH3A 5MAOA 3T1HJ 1RWWB 1FXRA 4O0NA 2GW8A 4Y2MA 1K8AT 4QWAA 2QVAA 1FESA 5BYQA 3CIZA 3HHNB 1JMBA 2WW8A 1NJZA 1S97A 3HD7B 4EFAC 3RYLA 3GFXA 5HBMB 2NXJA 3EGNA 4LFAJ 4UZBA 2CPYA 2JDIH 4DUZF 1VBZA 1M0SA 1HD0A 1S4FA 3BGRB 3CWBJ 2ZHOA 3U1AA 3DDIA 1L4AB 1HBUA 2OEMA 1XTZA 5GTHH 4DWIA 4K3AA 1QY7A 1LTBC 2BDPA 2H9ZA 3I9ZA 4DSJA 5I3QA 3T97A 1PPJG 3QWOC 5AW4B 1NKNA 4UOFA 3D70A 1BE3J 2VG6B 1URNA 1NJWA 2HK3A 3L72E 4DOJA 5C24A 1RTJA 1ZA2B 1VDFA 4JOUA 2KSEA 4H4KA 1DY3A 3HRNA 3EVOA 4ILMA 2IJRA 2DRAA 5L1KA 2KYZA 3R5GA 4OYOA 3HSDA 3I0RA 2YKOA 1R8BA 5LMNF 1FZFA 4DF4A 2GMLA 4IOIH 1F6TA 3IM9A 3DMJA 1H7WA 3JXOA 4WE1B 2ZVNB 3A3NB 4PG5A 3I5BA 5GAEI 4LF1A 3EJMA 4F4XA 2I1JA 2KB7P 3MAHA 1RXOB 4LREA 1VYAA 5EWFA 3MAQA 1L0NK 2QYCA 1NAFA 1S48A 4HHUA 2ZT9D 4A8OA 1JLCB 2DNYA 2FPHX 4MAKA 4CCHA 3ZDMA 4DFPA 4YXDC 1A7GE 3ISND 4FNHA 1U6FA 2XHWA 2E1RA 4YY3J 5DLFA 1HD1A 1YIJS 3HTKB 1PSDA 5A8RB 2JLFA 1S9KE 2GAGC 1KTVA 2MJZA 4UTGA 3US5A 3CCEP 5GVQA 4D6TE 6FD1A 2K37A 1YX2A 4GOFA 3TZWA 5AJ3J 2C2OB 2G2ZA 4DR1F 2IM1A 5KFTA 1CJUB 1JOCA 1T8ZA 3BO2A 1HQEA 1CJVA 1TVRA 5M1BA 4UF4A 5HP1A 3KG1A 3QRPA 4H0LD 4RW9A 1QVFR 4W7ZA 5E5NA 2VRSA 1Y3KA 3OJUA 3BCCG 4GVBA 5CD4H 3GR0A 3VVUA 5ETNA 1Z2ZA 3R4YA 1JXLA 1J5EF 3RL0D 4LF5J 2WVDA 2ZH2A 3IR5B 1XNQF 4WY4B 3MPVA 1RT5A 1LTTC 2LLZA 1R0AA 4QIEA 5T14A 3SSSA 1OSDA 1CJVB 1TVRB 3LW5J 1VC6A 3TF5A 4NOHA 3QZ7A 4TQRA 2YWWA 4O4GB 1T03A 2DXFA 3AEBC 3QT5A 1S0MA 3H98A 1HBOB 3GHGA 3ILJA 3KK1A 2QMWA 3IGVA 4OYPA 3TNVA 3B78A 2E5LJ 4NLWA 1UPPA 4HR2A 2B89A 4M5NA 1NSPA 2ZXXA 1YITP 4JI0J 3MOJB 4KTQA 1TL7B 1LWEA 2QE5A 2JR8A 1GAOA 1TK8A 1LEOA 2FIUA 2YX1A 4WBAA 2ZVOB 1MSWD 3Q23A 3Q24A 1YWXA 1JKHB 1H2UX 1G2CA 4ID5A 2EKNA 2WONA 4WE1A 2H5JB 2FGOA 3QT7A 2VONA 3DLEA 5HMWA 4ETZA 1IWAA 1J1EC 3ZZUA 3HFVA 4KRWA 1BWEA 4ITSA 4QIWD 3AEDC 3V4WA 4LQ3A 4RW7A 4QIGA 1RACB 2EEYA 3DRSB 2YWKA 1WJ9A 2UUWA 1GL2B 3I55P 2WCXA 4XDCA 3J7AN 4OMFG 2DNNA 5AVRB 1M5OC 3O8WA 1VQ8P 4K0KF 5SUHA 4HKZH 1JY3N 2FYUE 2MKCA 3CCTA 3OAKA 3P8BB 2H43A 4NA3A 3X1LB 2MZJA 2EFNA 4QR2A 2CPHA 3HULA 4RWXA 3UVJA 2Q3EA 1L0LG 2BJ3A 4F0MA 3O44A 3M0DA 3OR2B 4ZN1A 3CXHI 1EDIA 3MPDA 1NJIT 3LA0A 4OV6A 5CXTA 4DPUA 1S1VA 4ZVEA 5E2QA 4KSEB 4ALZA 2RU9A 2XG8A 3QSIA 1SFCB 1Z2LA 3H32A 5B5EH 4FYYB 3QNWB 4H44C 3OXGA 1EXIA 1GFWB 1KBRA 3PDNA 4URSA 2V69A 5IFMA 1QTNB 3PYDA 2MGZB 4USMA 3QAEA 1Q7YQ 3KK2B 4HEA9 3DOLB 2X3DA 3AY0A 4I0WA 2OPPA 3MM6B 4X4NA 5LSLA 1ZTWA 3GB0A 2OYIB 3AA8A 2BKNA 2Z4PA 4BC7A 2ZD1B 3LGNA 1JLBA 2XM3A 3GJQB 4Y65A 4K5SA 5D3GB 4GMKA 4YR0A 1MWZA 1KQGB 3L35A 1ZZNA 2VD3A 3FEZA 4PQAA 3H2LA 2H65B 4ZVTB 3BREA 4DJBA 3ABVC 4QOTA 1KD1Q 5D4OA 3WX4A 3HCXA 4K4TA 4AYCA 1E5WA 4USTA 1X22A 3RBEA 3VAIA 5L1LA 2PEBA 2RDIA 5EWEA 1FE0A 4PPZA 4PWDA 2EPIA 5EX0A 2DY1A 1VLYA 4B9SA 5KFGA 4CWBA 3ZC4A 1R3NA 2DHGA 2F8MA 3IRXA 3GQCA 3CWBD 3NAIA 1VQ4P 2DNLA 2R8HA 4LGDE 4CI0B 3M2VB 3CCQP 1CJTA 1UWAA 1E6VB 1RWXB 1NTKJ 3CWBG 1VQKP 4ED1A 3MECA 4W80A 3CJRA 1NHUA 1N7SD 2GQ2A 1OYDA 4J37A 2E76C 2NCKL 4ZVQB 4YHHJ 1OWAA 1VHIA 4DS4A 1BE3G 4FXDA 4OZ3A 1OW6A 1VQ7S 1U4BA 5L38A 3WC0A 1MFTA 1HNZF 4CLSA 4DBQA 4NL5A 1O8BA 2B4OA 1N36F 4N76A 2BJDA 3NGDA 3GF7A 4CLUA 3KJVA 1L0NG 5D0RA 2QRXA 1PJ5A 3VTPC