5AVQB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 0.75 min.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avqB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avqB02
4GKGA 3TYYA 3L37A 2Q5UA 4AQRD 1GTWA 2Z5HA 3L35A 1J2JB 1MUUA 1JNMA 4C7NB 5APVA 2P7JA 1IO4A 5AW1B 5AW2B 3VN0A 3NTNA 2YNYA 2WWWA 5AVWB 5AVYB 2C9LY 3NFQA 3HTKA 3M0AA 3M9HA 5AVRB 4C7NA 2IPPA 3UIAA 3M0DA 2WPQA 4I2LC 3KQGA 3P8MC 5AVXB 5AVSB 2C9NY 2Q7CA 2VRSA 3NMDA 4EOTA 1SLQA 5APWA 1H88A 2H7HA 2WPSA 1G2CB 4XE5B 1OXZA 5AVTB 1FOSE 3M91A 1HWTC 2R5BA 3TNUA 1HJBA 5AVVB 3VMXA 2Q3IA 5AVZB 2E43A 3HE5A 3MGNA 4JYBA 2XV5A 3M06A 1YYCA 2QM7A 3VMYA 1GZLA 1H8AA 2P67A 5AVQB 4C46A 2KP8A 2W6AA 4AUWA 4B86A 3TNUB 5APUA 1NWQA 3LIDA 2XU6A 2Z5IA 3V4QA 2XZRA 3HE5B 1HBWA 3OAKA 1MV8A 3VTPC 5AW7B 4HYTB 3L36A 3TK1A 4RESB 1KQLA 1T2KC 1T2KD 3O8ZA 2WPRA 4M3LA 3VYIA 3WGUB 2N9BA 5APTA 3V5BA 5APXA 1FOSF 3P32A 4I6MC 3A7OA 2JJLA 2YO3A 1GU4A 5AW6B 3I5CA 1FAVA 1OWAA 2R5DA 3KDPB 5APSA 1MFZA 5AW4B 1SP4A 1S9KD 1GU5A 1H89A 1A02J 3IR9A 1S9KE 2YO2A 2ZFCA 1GK6A 3LIEA 4LC1A 3A5TA 1A02F 5CMZA 5AVUB 2E42A 5APYA 5AW8B 3V4WA 2WT7A 3B8EB 1NAFA 4KHXA 3WGVB 3MD0A 1CI6B 3A2AA 3HE4A 2W27A 3M9BA 4GT1A 2QM8A 5AW0B 1HUCA 2P2UA 3VMZA 2BASA 3A3YB 1CZQA 1GD2E 1DH3A 1CSBA 5APQA 4AYCA 2WT7B 1JUNA 3SWFA 1GK4A 1CI6A 3P7KA 1X8YA 4JYCA 3HE4B 2ZXEB 5AW3B 4RETB 3NXSA 5AW5B 2R32A 2R3CA 4DZOA 2WTYA 5AW9B 3T97A
chains in the Genus database with same CATH superfamily
1LTSC 2JLLA 4NRXB 1B88A 4YDJA 3U46A 3TBCA 3CWBD 2NXYC 2OMWA 1TQBC 3QEHB 3NSDA 3QEUA 1CG9A 3MNMA 3CXHD 3QCTH 2ZXAA 1EJOL 1FZOB 1UM4H 1X5MA 3E3QC 4WY4A 1U36A 1WV7T 2CUHA 3DYMA 3JZ7A 3P02A 2WIMA 3H7BA 3PIQA 1DQTA 1QFUH 3H1JJ 2JCCB 3DSNB 3NMEA 5EDXA 3VM5A 2GJZA 3FFDB 5DHVH 1MRFH 5DO8A 5FV2A 2NXZD 2VDOB 1LEKA 2YXRB 3DX7A 4IDLA 2ATKB 4J6RL 4GAFB 1A4BA 2F58L 4JFDB 4JLRB 1A6PA 1B0RA 1F3DH 2AXCA 2YLKA 1VDFA 4N90E 1Q38A 1YA5A 4HU8A 3PHLA 1A4KB 1AS8A 3E8VA 3TBWB 4XI5D 3ILQC 2Y5TB 3LKRA 2MPAL 2HYMA 2XV5A 3OB0K 4CJ0A 3HR5B 4BXVA 1A02N 5K39B 5CKAA 4N68A 1CGSL 5KVFE 1DVTA 3UIZA 2P5EB 4I2XA 1NKGA 1WFMA 2OARA 1ETZB 4ASVA 4XP4L 2YD3A 1TYJA 5J9PA 2WINA 1H6FA 4PJBA 1OGAD 1NCWH 4L8SC 3K6OA 3RPIA 4Y4HB 3P54A 3QUYA 5GSVB 1MWAH 2A6DB 1KQLA 4OLXL 3O8ZA 1OCWH 1JCVA 5K9OB 2BIQA 3C09C 5T3ZH 3B9VA 1MWAB 3OKEB 3SPVA 3TBVA 4B9YA 3ZKXB 5C0GB 4P46B 5A2JH 1D6EB 4HXAL 4F58H 3KYAA 5C0AD 5I66A 1IGML 3N1QC 5KVEH 4NFBA 2R0LH 2BSSA 3ROLB 4JPIB 3VTTA 1PIGA 5FWQA 1JGDA 4XVUD 1EHAA 3TH2T 4OI7A 4ZG1A 1IGTA 4TSAL 1UM6H 3BIKB 1EMTH 1HT6A 3EJJX 4EDFA 2DBLL 3X11A 4K9EH 5J1SC 4QTHB 1ZANL 2AK4A 1QI3A 3HBQA 3CVIL 2JO1A 3AQDA 3CN4A 4P5MA 2PCFA 3ASWA 4XRCB 1SQBJ 1UASA 2NY0B 3I02B 3TONA 4L1LA 2H43A 3II3A 3LKNB 3OG6B 5DJ0A 1QRND 2TRHA 3JSVC 3WXVH 1I1RA 4TYUA 5FFOA 1QRNE 4AGNA 4W9LC 3SQBA 1K4CB 2BSBA 2ATPB 2XKNA 1S8DB 3ML9A 4J2QA 5C70A 4HJSA 1V55B 4XN4A 5I1LB 1RJZB 3FUDA 4OB5L 4OZGA 3HMWL 5IP4A 1ZT1A 3WU1A 5I8EB 1I9IH 4I18A 2A6KB 4L3EA 2V2XB 4NWTL 1UM5L 1P84K 2FJUB 1EFQA 4PRPA 5I82A 2JI1A 4ATTA 4P0DA 3OJDB 2DM3A 1E28A 2FHBA 3K0YA 1KZYA 5GGRA 5GRWA 2ALWA 5ITBL 4JFPB 5KW9L 1EZLA 1NU1K 2LLGA 4M6OL 1V7ML 2XACC 1VFOA 3K6DA 4JFED 3SPJA 3MUZ1 1TVHA 3QZWB 2UWEF 3PG2A 3GWJA 1QACA 3N06B 4MD5B 4IRZL 4MJID 1KFMA 4PJBE 4DOHE 5EEVA 3WLWC 1T1XA 2HFGH 2CHZA 1IM3A 4GW5A 3LIUA 4H1LA 5EORH 5AYUH 3ZKSD 2HN7A 4A04A 3NZHL 1TCMA 5CJOH 5G5DA 5KBPA 4Q6IC 3EYOA 4R26H 1YJDL 2RALA 4PRPD 3MXWL 3DOIA 5JMOC 2DWDB 3CFJA 4KKAD 2VDQH 5CP3A 4BEIA 2WP3T 4L3ED 1FRGL 1FFOA 4XWGL 1BBDL 3BKCL 1UXLA 3N55A 4XX1E 3FFOA 5D7JD 3G6JB 4XPHL 4Y89A 2ZNXA 3VFMB 1BM7A 2SEBB 2FECI 3MTUE 1A6WL 3Q06A 4LSUH 2XKUA 3PHOB 4YE4L 1IJDB 1RK7A 2QSQA 3VW3H 4I85A 4PREA 3ECBA 3LD8B 4JM2F 4E42B 2H0JA 2HPOA 1ZV5A 12E8H 1X5FA 3BIBX 4ALAC 1KYOI 3HE7B 3NN8A 4Q7DA 3LV3B 4X8JA 4ERSH 4WKZA 2VZTA 3FU3A 4IRJC 3MACH 3SQRA 4DCKA 5JHLH 5KLVE 2FT8A 2C0XA 3NFPA 4HXAH 4F58L 3H0TA 3VG0L 2VDMH 3I6SA 3LXUX 3N0AA 3QG6B 1HHJB 2EXYD 1A6ZA 4JK0D 1KY6A 1C12A 1MVYA 4GKLA 4KH9A 4N2MA 3C5XA 1VQ4P 2W80C 4B53A 4X7TA 1MWOA 4KNSA 3SO3C 1EC5A 1S3JA 2BCCD 2R2HB 4HGWB 4KFMA 2WKOA 1JRHI 4GQ9H 3RDTC 3VI4F 3PDGA 4DKAA 2WQWA 4EN3A 2QHRL 5C0RH 1MCBA 3THMH 1V27A 1NSNH 1PZ2A 4KJQD 2Y0CA 4D9QE 4H88L 2KUBA 3ARDB 3TV3L 3D33A 3X12A 2WKGA 3PWNB 1WGOA 3ZDXB 1ES0B 3ES6A 2H3KA 1ZRTE 3CMAP 3NZUA 4JKWA 4NHUB 1YNTA 1E50A 2W60B 2FCBA 4Y4FD 1WCBA 1LTJC 4OCYL 4AG4H 4O2FB 5DCCA 3EO0A 3KS0J 3T1WA 5ACMA 1J1XL 1YHPA 2WUBH 3W11D 1TLKA 1U92B 2V5MA 3ZL2A 2MQGA 1WZ1L 3I9AA 3QUHA 3JTTB 5I19H 3W37A 4M03A 5BS0E 5CU9A 2WNKA 1LL1A 4KKLC 4XP6L 3TV3H 4J7RA 1WWCA 4BQ6A 2H0FA 4AMXA 3KPSB 5IR1A 4RIRA 2BSEA 2OYHC 4F7EA 1AGBA 2R0KH 1QFOA 1UYWL 3VXTA 3SCMA 3GHPA 1B2YA 3JTBA 3K74B 4KO5A 5B39G 4OWFA 2E0PA 5SWZA 5CZVL 4OKVB 4P9ML 2IVFC 4TN9A 4Z7NE 1KJ2B 5CILL 1J0JA 2J55A 3DTUB 1FZOA 3AE9C 3OJVC 1BQ5A 3QR2A 5K1JA 3L3KB 2RD0A 2XWCA 1R5SA 2RMZA 1X9RA 4FNLH 4M5YH 3TBTB 4D0DA 3SN6N 1C8QA 5I26A 4I0PD 4XO3A 3F7VA 4MKTA 2O5ZH 1ITCA 1E4XL 4R97C 2OZ4A 3VAEA 3ECBB 3G5ZA 4LSRH 4B7LA 2BNQB 2BCKA 4P3CL 3B37A 3ORJA 3PABA 1IGCH 4JKKA 2Y2YA 1F3RB 3MRCA 3HNTH 4UMSA 5F3HB 3TYFA 1TDQA 2M3BA 1QZNA 2UWEB 5JW3L 3FUMA 3ZUCA 5MENE 5I1GH 4LQFL 4CN1A 4ZFGL 2F5BL 1URZA 2VUYA 3BUQA 3HR5A 4LSQH 1MAKA 5CJ4A 5KYWA 3S3DB 2ZAEB 1OM9A 4LNRA 1FRGH 2O6CA 4PJXA 5KLVJ 3QJSB 2TAAA 4Z0XB 4ES9A 2B5IB 3TA3C 2D2CB 1FO0L 5GGVL 3TLRA 5B5EE 1R3JB 2XWDA 2FIKB 3DMMD 2LFGA 2YXFA 1THCA 2M26A 2AEQL 1AZUA 5JUEH 5EUOA 3HLAB 2NLJA 2A9ML 2IV8A 2HFTA 5C0GA 3SPVB 3S6CA 1QTYT 3UTTA 1OAXH 3ZK0A 1XMEB 4A7SA 4TNWK 3H1HE 4HUWB 3BRDA 1OARH 2NT1A 1GL2B 2LV4A 2YN5A 3CCHA 4YPJA 5APYA 4MA7H 3CFNA 3TYGL 4PJDA 4BDVB 4IGBA 5D1XC 3SE8H 1WZAA 4RAVB 1M7DA 2DLGA 4I3SH 5FGCE 3A2AA 4M6OH 2GJ6D 2Y0SA 1RZFH 3IDJB 2BASA 3MKKA 5FEBA 1N0XH 3RFZC 1OB1B 4HIIA 4NNPH 5JIQA 2EECA 4BSVB 2XQYG 3AT9A 2R1YB 3QNXB 4L4VA 1DQLL 4GSDL 3NIGB 2HX9A 3E38A 4XMLH 4K3HA 1PAZA 1TSRA 5E95B 1HCVA 3D6ZA 3MNDA 1IL1B 3BZ4A 5E9DD 1IFPA 4K3EH 5FHAH 3QRLA 4LVOB 4MNQE 2PR4H 1JGEA 3H8NA 4C7NB 5KVDE 2GM4A 2MTPA 3SDXE 2X10A 4FP8H 5IHBA 3GEWB 2LT9A 4IHBA 3I50H 4YAQA 3BOVA 1HEZB 4WCYL 3KLQA 4YHKL 3W5NA 3L72J 2QDVA 4H0LD 3X13B 2ZKHL 1SM3L 5KZCB 1RZQA 2J72A 4QT5B 1W0WA 5CLXA 4K3GA 4Z7UF 4R3SA 1LO0H 4KHXH 4XCYB 3OAWA 3WMSA 4KRPC 3HZMA 6TAAA 1F41A 2DMKA 3HAEH 5LCVL 4CVXA 3BAYA 2ARJA 1AFOA 3D0VB 4FXKC 3H1LG 4ZO8A 4CADB 1TG8A 2XNDH 3WN5C 1N73A 1HWTC 2BW5A 2R5BA 2CK0L 4HWBA 3CFTA 1A0QH 3D1MC 1Y7VA 4MCMA 5E6ZA 3D39E 4K9JA 1RK0A 4AJWA 5GHWL 5GGTA 3VGBA 2GK2A 1G1KA 3KPQA 3ABVC 4MMXC 2DWDA 1EJ8A 1GVIA 3D25B 2AJXL 5JDSA 1IM9A 5B66H 2EKSA 2G60H 2XDHA 1BBJB 4M4RA 3MV8D 1SVBA 3ETBF 3VI3B 4DESA 5CD3A 4QHMB 1CJYA 2ENSA 4H1LG 2Q7YB 3SDDB 1XD1A 1WIUA 1RJLB 4PRDB 3E80A 1MCNA 1ZVHA 3T77B 2Q6QA 2BIMA 3B83A 3ZE1B 2BSRA 3VD0A 1OHQA 5GS2D 3T2NL 4R8WH 5KVFH 3MV8B 5KSBA 4PSRA 1G1YA 2YEVB 2FWLB 5C3IA 4ZOEA 2FYUJ 4X4YA 3VMNA 2RTTA 5C08E 1HGVA 2OYMA 3BFOA 4NO5A 4FKKA 4UIKL 4HCFA 3KR3H 3V6OE 2ZYDA 2QV2A 2ZG2A 3AG2B 3ILQD 1JI2A 2GB2A 2QHLA 4UWQB 5DURD 5MI0B 2IH1B 4G7SB 3VNZA 3HI6H 1ND0B 1SLUA 1CDHA 5T3ZE 5CCGC 4ELKB 3IT8D 1KCLA 2NXZB 1T0NB 2JVUA 2WK2A 3ZGIA 1NUGA 1NH6A 1ZLWK 3FRUB 1MFEH 5E0QA 4J6IA 4Q0XH 5C08B 3NVQA 3SZ6A 2UY6A 4U3SB 5CN1A 4OVUA 3ZTDC 1IL1A 2X2YA 1FFPB 3WY4A 1HZKA 3H54A 4GRWF 3NGBC 1GC1L 4YSUA 1BVNP 2ZYRA 2IG2L 3B7YA 3FDWA 2FL5A 1GGBL 2V5RA 5BMFH 4QRRB 3IGUA 1PGJA 4BFOA 4IBZA 3W11C 1BIIB 2NY5C 5ICZA 2WNXA 3DSFH 4NUQA 4AEHH 1OALA 4Q9QL 1I85A 4RFOH 1J2JB 4PRHE 3PWJA 5DO2D 2Y1ZA 5EUKB 3CL3D 1F00I 5CUSH 5D1QC 4D0BB 3GXUB 2ZT9B 3OPZL 4N0YL 4OCSL 1SQXJ 4ZMQA 4M5SA 1VEPA 1G87A 1VFAA 1FZAA 2WUCL 3GINA 4U1NB 3KBHE 3GGWA 4MMXA 1YAZA 3Q7JA 3UZVB 4EKJA 4G8EB 5C0CB 2VITA 2YUZA 3EXLA 4JZOB 1CCZA 4X5RA 2B5IC 2AEQH 4D7PA 1H8LA 2EDMA 3C9NB 3CVHL 2XV6B 4ZD3H 1EUUA 5D2NB 3S34H 5FO8B 1FO0H 2C1OB 2G4GA 3FXIC 3P11L 5GGVH 2CRMA 2QSTA 4KAQL 1W6WA 2IZ1A 1OP5H 3BUYB 2XBZA 1OZUA 2Y7QB 3B2UC 3OB8A 1HH9A 3CC4P 5CCGE 5T3XL 2GI0A 1QBML 4YO0B 4ZFGH 4F20A 2EIZA 4R7XA 3KGSA 1F4AA 2CKBL 2PTTB 4HWZA 4H25A 1XF4A 4PG9A 1MW3A 1O9VA 3FQRA 2WITA 1R8EA 2EDTA 5E2TH 4ZSOE 3O0LA 1UURA 4PJHE 4RDQF 2O61A 4XGZB 4P8QA 3V0DA 3TPKA 3H9HA 4TUOB 1KFAL 1ZOYC 1T0MA 1ZCRA 3A5VA 1INEL 1CGYA 1SFCB 3Q2YA 1WAAE 3L4ZA 4FZ8H 3DIDA 2D2CD 1E30A 1SQQJ 1BXXA 1SOQA 3F7LA 4MA1B 3HAEA 2ZXQA 4PJEA 1GKOA 2EE3A 2X4SB 2CO6A 4ODXA 4XP1L 3S36X 2YKLH 2YBGA 2ARJQ 3MX0B 5IUSA 2Z1PA 3Q2LA 4XNXL 3UIYA 3BSZL 3AEDC 5GJTL 4RX4A 5DD3H 3LPOA 3RIKA 5LVEA 1NUDA 4G9DB 4DFHA 3EGDA 1NTME 1XEDA 1ZPUA 5GS2H 3RGBA 1YO4A 2YGVA 4KKAC 5KAIE 3PFUA 3PPSA 3U4EA 4ZPVA 2HFED 1M1KQ 4LCWA 5FDYA 1FFTB 1YSOA 1S5IL 3VM7A 3CD4A 2X89D 4E9XA 1PZ5A 1F13A 3FQUB 4EUPH 2ETWA 4B9FA 4LBAA 2FFDC 2PPDA 2QSVA 3ETBJ 1MFMA 1E4WH 3ESOA 4C58B 1LP9A 2CR6A 3Q1EA 4FQHA 4KX8A 2CBPA 2R83A 4MDIB 5BQ7B 3ARFA 5KSBF 2K6YA 1SFCD 4OCXH 1P2CA 3GC3A 1H0DA 3DV6B 3RIAK 2GAZA 3CZKA 1J5DA 4D6TG 5F89B 1PLAA 1JHTA 1T6VN 4M43H 2Z65C 1MJUL 3CPLB 4HALA 5BZWA 3QNYB 2LLLA 3NK4A 1GY2A 4TSAH 4A2LA 1CXHA 3GLAA 4HOZA 3ELAT 1NCUA 5KG9A 1U21A 1FFNA 1UOVA 4IFMA 4M8QB 1NGMB 4M7KH 4MMXB 4BXSV 1IC4L 3FU7B 2HKFH 4L1TA 4JO1H 2VR7A 2OKMA 2X1PA 3KEDA 4MJ5B 5HJBA 5CBEA 2BOBB 4XO5A 3HJ0A 2ZP8A 5CN2A 5E79H 4JY6B 3H32B 2P1JA 2A5UA 1I8MA 1Q1JL 2FH8A 1YUKB 4ZYKB 2WAHA 2OJEA 1AHWB 2VLKD 4JM0A 2WW8A 1K6QL 2YIUB 4OJFL 3QWOC 4GKZB 3BQUB 3UTSD 4G6AC 5FCUL 2Q86A 2B2XL 1FZMB 1MCSA 2B1HH 4O2CA 4OCWL 5E4EC 1JJUA 3LSOA 3UYRH 2J7LA 2HJLA 3D5OF 3EJZC 3L4YA 4CNIA 3CSFA 1Z5HA 2X3BA 3TVMB 1YQ2A 1U4EA 3Q5YA 4WO4D 1CR9L 3ASNB 5D1XE 3SPGA 4XP9H 3BO8B 4H8VA 3V6ZA 5HGAB 4CU6A 4ICWA 1AYRA 1XGRA 2OZ4L 1JK8A 1FPTH 3CFDB 1SBBA 1AIZA 1PZSA 1T3FB 1U8JA 1KCBA 3V4QA 3CGTA 1QEWB 2BSTA 4PVLA 4XPHH 5KYXA 2MJWA 3ESUF 3DX8A 3W1ZA 5E2UH 2ZUQB 3U48A 1JNHB 1YY9C 4MMZB 2E9WA 4M8UA 1AGDA 1FVEB 4ZS6C 2HVJB 3GXMA 4ALAH 1GYAA 1QBMH 2YPLB 3CFCH 2EKSB 2AXGA 1EHLH 2O01H 2YD1A 2F5AL 2KLTA 2AQ1A 2PPFA 3FAWA 3DVIA 4DUVA 4NNYA 1S7TA 4PRID 5B7MA 5IJKC 4WSKA 1UD8A 3KCWA 3AEAC 5ADPL 3P69A 3K46A 5J6HA 4QHMA 5KN5B 3C5JB 5EBMB 3OAZK 3L6FA 1PJ9A 5F8QC 1EZVX 4OUUA 3VB9A 3V4UL 1DEBA 1IC5L 4HCRH 4JEGB 4IFFA 5A2IH 3D4YA 2BSRB 2VN3A 3C08L 5DQ9B 2X6AA 4IS6A 3NCJL 1RUMH 3K6IA 4MDJB 3L5WB 4ERSL 2WXMA 3HEIB 3B7TA 3LEVL 1EZVG 1K8AQ 2VDLH 1KILD 1DLFH 3BPOB 4G6FD 3IU4L 4HJJL 1C16B 3S4SG 3ECUA 2IQ9H 4NZRL 4JFFA 4N0YH 5BZWB 1N8OE 3NTCH 3PNWA 5EZPA 4J28A 5J11C 2OYIC 4R4LA 4PLJC 4EAEA 2V9TA 1PP9D 3L5IA 1GL2C 5F9OL 3U0TB 3CC7P 1HFUA 1I3UA 3PHSA 4HWUA 3ZT5A 3KPEA 4N26A 4OB5H 2Z91B 5AW3B 5EWIL 3TNNB 4M8QA 3EYQC 5A2LH 3ARPA 2P8LA 4JB9L 4PD4I 1BA9A 4AIEA 1P7BA 5KSAA 3PAUA 2KZBA 2VSDA 1VFUA 4OZ4B 3C2AL 5D6DC 1OGSA 4MJIA 1W8OA 3P8CD 5DD6B 2XG5A 4NGHL 4NQSA 5DRZA 1MRDL 3SKMB 3BPLC 3KGTA 4ZQKB 1WYJA 1M6OA 5HI5D 3VDCA 2YRZA 4HX1A 4KMQA 3BHBB 2A73B 2CR3A 4N87A 3OVUB 4FLOA 2PN5A 1D5MB 2UZYB 4G8IA 1YVLA 2YEZA 3CFBA 1OT4A 5DHDA 1B4JH 4P49A 5F97E 4GMSL 4UDTB 1LJ2A 1ZE3C 2PXYA 4X7SL 2WCPA 4AVIA 4OJFH 5DZNA 4ANXA 4IL6H 1B90A 3RTQA 2EO7A 3CSBA 3VA2C 1BGYJ 3EFFK 1BOYA 5MHSE 3EG9B 4O9HH 4OTXL 5IHUH 3IDNB 3L1OL 3RK2C 1T3FA 2EUZA 1ETZA 2DQCH 3K5RA 3I75B 4BK5A 3DVFA 3CVHA 2K1MA 3DX8B 4HF5L 4HKJA 4YGAB 4OM1L 2OBGA 2OS7A 3B4NA 2ADGA 5K9OA 2F54A 5KLIC 3B2XA 3BWZA 3OHXC 3WXVL 4Z7QE 3T08A 1LVEA 3CMOH 1MIML 5DR5L 5ANME 5HGHA 3TO2B 3MN8A 4JPQA 3LN9A 4GSRA 3C5JA 1MJUH 5EBMA 3MCLH 3MBEB 4PJ5B 2WPRA 1ASQA 3DROB 5DVOA 3SDAB 1A1MB 2DKSA 1T5WB 1RIUL 5T5FA 3FOLB 4KROC 4KTDH 1GDTA 3QXAA 3MGAA 4ZDHB 4OCXL 3O2DH 3L1OH 2FX7L 3FT2A 3Q1SH 2VQ1A 4RA3A 1E6OH 2QE7H 3QI9C 2W0LA 3ZX1A 4TOYH 3FXDA 2FBJL 5LNGA 4KZDL 4ZAKB 4ZUSA 3DPBA 2VABB 1EO7A 1FJ1A 1T80A 2BIHA 1J1EC 1V3MA 2ZXCA 5IG7A 5FUOL 1NGZB 2G5BB 4U3FE 1IAOB 2GBTA 1U9KA 2J8UA 3RB7A 4BIKA 3X1NA 3QIUC 1I3RB 3QARA 4JR9H 4MA1C 3EOBB 1KYUA 2D3JA 4PEEA 3LKPA 4BV1A 5B3JE 5GS0L 3PHAA 1HINL 2R39A 3P30L 1DCLA 4YGVB 1TTUA 4FNSA 5K9KA 1YEEL 3HE4B 2ERJC 2XG5B 4NQSB 1AJ7L 1ZVNA 2R4RH 1F42A 3SKUD 3UG5A 1PCSA 1WAAA 5AW5B 4FQHB 3UO1H 1FBMA 1M1XA 1KFAH 5DMGC 4P2QE 4ZX3A 4OIFA 5ID1A 3GXPA 1AY1H 1BGYG 2YD9A 5IFJA 3LZQA 4MD5A 5T5NG 2YKQA 4NNPL 2ZOUA 5C8JA 1G0YR 5FFGA 5CHNB 2CDFB 2HN7B 2ZJSE 3GXTA 1DN0A 4MB5A 1DJWA 3S5ZA 3BDYH 3WXWH 4AL8H 4YPGA 3D8MA 3SE8L 3TZVB 4K5MA 1QL2A 2OMWB 4FP8L 4N9GA 1G7JA 4XCFH 1JV5A 1N8ZA 4L0ZA 1F4WL 3AUVA 4A7QA 5IY5B 1L6XA 4XPFL 2IQAA 1L2PA 4X5WB 3CVHB 3STZB 2W9LA 1HILB 1UZ6E 4Z7VA 1SQVD 1SLXA 2R23A 3AAZA 3DPDA 3FUIA 5I1IL 2HFFA 4UV4L 3WAJA 3JV4A 2BNUA 1BZDA 2FATL 2Y25A 1HJBA 1NU1G 5HI4D 1FZCB 1DBKL 2ENYA 4UYPA 3WMM0 4YIQB 2HYNA 3IDIA 1U8KA 1N2RA 5CP3H 3H1IG 4GO9A 3EIFA 5DUBA 3PWPE 4AUWA 2XQ0A 1UWYA 4M3JA 5B1KA 3FX0A 4JN1L 2YMXH 2GYSA 3QQNA 1KACB 4KO7A 4RWHA 3HAEG 1T0OA 1GAFH 1I3GL 1RZFL 5GGSA 2E76D 4A7UA 1SGKA 3GPSA 1H5BA 1U6AH 2ZSWB 3QWOB 4OI9A 4PJFF 3TBBA 3BDXA 5ACZA 4I2XB 3F5WA 3FN9A 5EOQH 2GUVA 3GHGB 3TS8A 3DA0A 1GPOH 4RMWA 3CFUA 4QF1A 6FABL 1VRSA 4I6MC 4NAQA 4YK4B 5DJYA 2C4FU 2R0ZL 1MFEL 5KAFH 4QNPE 4WW2A 2VDMB 3I3EA 3MODL 4L8BB 3WUVA 1N7SD 1SJHA 2NW2B 2DLEA 2V2WA 3SBRA 4AZ8B 4YSOA 3KD4A 2E76C 3RFRA 4AV0A 3VYPA 4OM1H 5LO7A 2VO8A 1JPFA 1U8MB 3D18B 1OVRA 4LKCA 3RVTD 1PZDA 1MY5A 2F54D 1IGTB 1PP9E 4ETQB 3RY4A 1Q9OB 2R0KL 3HNSH 4QAWA 1ZJAA 1OK0A 2XPZA 1HWWA 5F7LB 7CGTA 3CX2A 4WO4B 4TOYL 3GF3A 1L3WA 3EDEA 4M7KL 1R5VA 2ZG3A 1B4JL 5ENWA 4H0LC 3SGDH 2AAAA 2X4NA 4RETB 3I9GL 1JHKH 2O72A 3IRCA 3EJZD 3D3VE 4EDXB 4JFYA 1HC1A 3E3QE 2WPVB 1RZPA 3F65A 1FLRL 3VCLB 4G6AD 3NCWA 4FEIA 4AZUA 1EDYA 5EB9A 5E6IB 1ACCA 4I9XA 4QPEA 3S35X 3DK2A 5T1KD 4WGKA 5AL8A 4NDMA 5IJBC 2Y7MA 2WLYA 3NJKA 4W7ZA 3LXCA 2CO3A 1KPRB 1BPLB 4QI3A 4D8OA 5IVNA 1A0QL 1ZDSA 2KUTA 1ZE3H 4AGPA 3O6FD 2C9LY 2CJUL 2Z92A 4PGEA 3L71J 2A4EA 1VENA 2GHWB 1OSPL 2R23B 3AAZB 3HCVA 1EAOA 1PJWA 3MJ9A 2Q2EB 1MLCA 5AVXB 4J3OH 1KORA 3KE0A 2ZOLA 5C0BB 1KXVC 4PRIB 1LO0L 2E5EA 3LRKA 5APWA 4KHXL 2FQEA 1HHIB 2KPWA 1FE8H 2BCKB 4G1MA 4PS8A 4FI8A 3L1EA 3IDGB 1WBZB 2VDPH 4W9CC 3OAUL 3VMXA 3EYVB 3FS9A 3A4DA 3E6HB 1L0NK 1H6EA 4QCIA 1N7MH 2YMOA 1A4CA 4LEXL 1KPUB 2VXUL 4DJGA 3H9SA 2HVBA 1F2QA 3MV8E 1SFCC 2C1PB 3IDXH 4AGLA 1IC0A 3LDBC 1VQLP 4G71B 4E2OA 3FQXA 5EU7E 2ED6A 2YD6A 4KI5F 5FR3A 5TPWL 5DJYB 5TGBB 4P23D 3V9EA 1IBZA 3IAGC 1FCGA 4L8CA 3RUGF 3TOPA 3STBA 3MOQA 4WUUA 4Z3EA 1MG2C 3OL2A 2N1TD 1JNLH 3E8UL 3V52H 2BRQA 5HD8D 1UXMA 2J12B 5BUAA 3MUHL 1D6VL 2KT6A 2NPSB 1JPTH 4C4KO 2FX8L 3MRFB 4AC2A 4KJYB 5F7AA 2R5DA 1A6UL 3UTZB 2VZUA 1DP0A 2NMSA 3IF1A 3O2DA 3V2NA 5T5FL 3FB7A 4JPVH 2WQVA 1IV8A 1XB8A 3NG5A 2F6AA 5DK0B 1S3RA 5FUCE 4U3FD 1BFTA 1J05A 2YAEA 4HIJA 4BKLA 4L0YA 3SSUA 3GRWH 1XH3B 3OKLA 1XIWA 3FB5B 4P05A 3UBXA 3CU1A 2H2SC 1MNUL 2W27A 1WCQA 4UV7H 1I7ZB 2K70A 4PJFB 3SOBL 2DQUH 1UH3A 2OR7A 1RULH 2R2EA 3TZVC 1MW1A 3WEXA 2WWKO 3MCYA 4XMXA 4WNSA 2NY5L 1JY3N 5FGSA 4OJEH 4EDXA 3MJ6A 4LO9A 1P84I 4D6TE 3V0GA 3OD3A 2PYEB 3ZKNC 4U7JA 4PJAF 4MZ3A 3TC9A 4FQIL 3K71A 2PTVA 5BV7B 3GK8H 1RZ7H 1YN6B 3E8UH 1U8NB 2ZPKH 2WSCJ 3V52L 1KN2L 4P4RB 3LKQB 4YGVA 5I0XA 1KYDA 1Z5LB 3H2PA 4B5ZA 1KB9J 4FQXD 4IRSB 1A3LL 4XP6H 3ZHDA 4BWWA 2JCCA 4PP1C 1IX2A 2AW2A 1JRHL 1THAA 4BZYA 1B4LA 4AL8C 4JHZA 4RJTA 5IB2B 4UZUA 5ID1B 4XAWH 2OSWA 3L71E 4Y19B 3P3SA 4YBHA 3HLKA 4H5SA 4DGWC 1FHNA 4XMKH 2Y9YA 4K2UH 4HKBA 3UIAA 3CXFA 5EOCH 4XMWA 2OJ1A 5J6SA 3WY1A 2XICA 5TDNB 3WE6A 1H88A 3MU3A 3LNFA 1GHFH 4ZO6A 5KUKA 1YMMD 5LWYH 4CN4A 1QWNA 4NKMB 4Y0GA 2BP0A 3FK3A 5TFSL 3OM3B 1QO3B 2DICA 4FG0A 1TOXA 5DLMH 3T2NH 2Z7WA 1NCAL 4WUKH 3AXLA 1XDTT 5HVGB 4ODVL 3GUFA 4PJ7A 3RK2B 5DMYA 2ZOKA 3HFMH 1FZFA 4JZJB 1ZN5A 1HEJC 1XTCC 4AE0A 1DLHA 1KV7A 1S5LX 1KYOH 1K8DA 2Q7YA 4FHJA 3WFHA 5IM7A 5JO5B 2NZIA 3N85H 4WU5A 1OO2A 3AC0A 3KPOB 4C4BA 1EK3A 1J1XH 3QW9A 4HPOH 3PABB 3P77B 5DFVD 1QAWA 2VDML 4HZLB 3RUGB 1P5UC 2B89A 1VACA 2CJ3A 2L7EA 2A74C 1OP9A 4KJYA 4QHLB 3TYFB 1PZBA 3V0IA 1FL3A 4FJZA 3G6DL 1E2ZA 4IRJD 4YWGL 3U30B 3N50A 1FNGB 4ZNEA 2N9BA 3OAYK 3RTQC 3BVNB 2RN0A 1CLYH 1SQVE 3ZDWA 1ZHLB 4L4TB 3H53A 2CIKA 3LD8C 2VDNL 3AQZA 1YECL 4MGXA 1DL7H 1GU5A 1QMUA 2IPKA 1DVSA 3ZKND 4LMQE 1QA9B 4V1DE 3TWCH 3D2UD 2TRYA 3NCEB 1SXBA 4IBTA 2UZXA 4RGMB 4U1SB 4LPUA 1F02I 2DQEH 2YPVA 3VG9C 2UY6B 4U3SA 4B6ZA 4O02L 5HYIA 3D4GA 3U4BH 3OG4B 2DRUA 4DPBX 3HE6A 2AJZB 5SWQA 1HYRC 4WWIA 4WO4C 5I8EA 2JJSC 3WNJA 2KYIA 3FU9A 2KMWA 2GIXA 3RVVD 3GYRA 5DJAA 3D0LA 5DYOA 2P46B 5D7LD 4P06A 1X5XA 1WICA 3D3VD 4P4KA 5AOZA 4WWKD 2GPZA 4JFPA 2GTZB 4LVHB 5CJXC 5DFTA 4LCUA 5H37G 5AAWC 2YPLE 3T3PE 1KF9B 5CCKL 3QI9A 1MVUA 4PRBB 4WNJA 1A6AA 2EDOA 1PEWA 2E6PA 4YUEL 3FUHA 5ECGA 4MAYC 3IU3A 1OAZL 3WHE1 3KLHD 4ZXBC 1LP9F 4JZOA 2VSMB 4AGMA 1LLAA 4JFYB 4JVUA 4ENED 3PAVA 2CBQA 2VQ4A 1QGKB 1L9QA 1W15A 2X6CA 4X4ZA 3F05A 3QHTC 4LCYB 1KNOB 4X0KA 1C5CL 2K4WA 1NDGA 4W6XB 2IGLA 1OE1A 1P53A 5DJXA 5L7XL 5HHOE 3C2AH 1OSZA 2WXLA 1WP6A 4KY1L 2XN9A 1UCTA 4WY4B 1BHGA 2CHNA 3LRHA 3DJSA 4PJCF 1VKXA 3CSYB 1QD0A 1VADA 2C4FT 1YTZT 1SRDA 2FEDD 1QWUA 1WHOA 1MI5A 5FA3A 3KH3A 2WXRA 2XFXA 4BZ2L 4NRYA 4ZMNA 2O4EA 1CB4A 4D9RE 4W9ZA 5E03A 2V7HA 3GDCA 1VACB 2VR3A 4HJ0D 4UQEA 3TBWA 2X4SA 1MPAH 2HKAA 2X88A 2Y24A 3G5XB 4YXDC 3L4VA 1L3NA 3IPBA 3QFDA 4HXBH 4WHYG 2F9BT 4NQQA 3K2MC 4FLHA 2ADIB 2BOCA 4WWKC 3B7RL 3HR6A 4ZBJA 3QPQD 2RR3A 4PB0L 4PJ8A 5B7FA 1Q82Q 3EGSB 3FQXB 2B08A 4NYLB 5L9DH 5MHSD 3U4EB 1UZ8A 2XZQH 3P9LB 4P23A 2X4PB 3L74E 4WHYH 5F0LB 3RVVC 1LGHB 4WB4A 3SGDI 5CBAA 4ZX6A 5SWSB 4UM9A 3LRLA 3RX5A 1IC4H 3CDFA 3H1IE 2VXQH 4P2AA 1NTZJ 4G5ZL 1JNNH 2OYHB 1XCWA 5E08L 4XMUA 4F33A 4F2MA 1EV2E 3MV7A 3PU7A 1H0TB 3V7AE 5I5RA 2I26N 1YJDC 3FQ2A 5DJAB 4YXLH 2DV6A 2MQ3A 4JDTH 3Q5SA 2GT9B 2QKIC 4LLMA 4APQB 2EDQA 3A3YB 1QFWL 4QRQA 4XN2A 3CX5H 1K3IA 1R19A 4Q9CA 3AXIA 2GTZA 5EEWA 1PGQA 2R9HD 4QYOA 1EHKB 5HHPB 5EU5A 1HH6A 5LLIC 1T0NA 4M7LL 1U3ZA 3WSQH 3TO4B 3OMAB 1T04B 2WJ7A 3KPSA 5EU3A 4ZNCD 4WGVB 2OXGA 4KTDL 3U82B 4H26A 1RZJL 3H2WA 4BUGA 2NQDA 1GJIA 3QORD 3SKNB 3VQ1C 1WC7B 4YXKH 3SCMB 2BRRH 1BGYE 2HKHL 1KJ3L 3HRZB 1I7TB 5DRWA 4I18B 4PJIA 4R2GC 1CGSH 3SDDC 3B34A 2DOCA 5AALA 1NANI 1KILE 1AP2B 1G4RA 5LGHH 3VD2A 3AE2C 3GM0A 4KTYA 1JWSB 1FI8C 1WRFA 5H37H 3ZMEA 4DW2H 5I1EH 2JK5A 4XMLL 1T0PB 4A7TA 3NFQA 5HGBB 3MO1A 4D0DB 3GXFA 4Q6KA 4Z9KB 2P47B 3PL6A 4I1PA 2VM4A 2XPGA 5JYMA 3NDZE 1T7ZA 1G7QB 2Y9ZA 2Q5BA 2OCCB 3JTSA 4HJGA 2AJ3A 2QT6A 2ICWI 3LIZL 4NO0B 2V4LA 1NC2B 2BRRL 3ARDD 3BN9C 4Y4KA 1L5GA 3MV11 1HQ4B 4RDQG 4BSWB 3S1KA 2WSDA 4NAMA 3BSZA 4IM8A 1FS0E 4JPWH 2J1XA 3ZDYB 2G8YA 3LS5H 3V0EA 5FO8A 4BK8A 4GYBA 4AUYA 1NTZG 5HDOA 3ZQ9A 2BOCB 4QY8B 5GZOD 1EFXB 2IZ0A 1ZMEC 1XAUA 2JTYA 4G6JH 5JUEL 5C1MB 3C5ZA 5IW6A 4XPFH 1WWBX 3PH0A 1OOWA 2R4SL 7FABL 4PWJA 4PUBL 2WZ7A 5J6HB 5FHAL 3FT4A 4OJDH 4YEFA 2Z35B 1FGNL 3QJFA 4HHGA 3UJJL 2DQMA 1YPZF 2ZIDA 2LTQC 1JF6A 1MCDA 5APTA 5IQ9A 3SQOH 1HCZA 2IH8A 2B1OA 2XN2A 1RURL 2UYLA 3QA3A 3CWBE 4OCSH 2JJLA 4XNXH 3HE7A 3ZE0F 2A77H 5J06A 2WP3O 4Z7IA 2ADJB 5EPMB 1KFNA 1J0IA 4NENB 2ZUXA 5SWSD 4PV1B 1JCKA 3FQWB 2QVIA 3NZHH 4K2UL 5CJOL 4Z3HA 3ZT7A 5L9DL 4NP4L 1F4XH 1F11A 1SMAA 5KVEE 2IDSA 2OTJP 3RZCC 4HC1A 1F6AA 3CUPB 4J3OG 4PB0H 1I8UA 4XBPB 4XXWC 5D4IA 1N6UA 1UB5A 3GSNH 1JVOA 3RU8H 4AE1A 4N2EA 1Q90A 3D2UA 1HNGA 1ZEAH 5AKRA 2G9KA 3R0MA 5J8OA 1KQGB 3UADA 3EXJA 4L37A 2P8PA 4BCXA 2XT1B 3CPUA 5LBSH 3TO4A 4LDEB 2MHAA 4GIFA 5IJVA 3O3UN 1PPJE 4WAFA 4PGZA 3QEGL 3VXUE 2LXCB 3DX9B 2CDEA 1OSYA 3O4LE 2N1TC 3EBAA 1EEZA 3FWLA 2G2PA 3DX6B 1JGEB 1NTDA 1RZKC 4HLZH 3TT3H 4Z0BL 3NJHA 1T21B 3W9EA 4OIAA 5SV4A 3G04B 1D7CA 4PG2A 3T97A 2PR9A 3CDGA 1A6TB 1EJFA 2FNWA 2HUEA 4NXKA 1ZVSA 2FR4A 3PJLA 5A43C 1AMYA 3AQXA 1UB6A 1VHPA 4IJ3C 3T6ZA 8PAZA 4QO1A 4MYPA 3HC0B 1A7NL 4PRBA 2G3AA 2KQMA 5IWLA 1DDTA 4FNPA 1EPFA 4I5BA 4DAGH 1KIQA 2WNGA 1RIUH 3DUUB 5JORB 1K5WA 1IGCL 3O6FC 2IPPA 2NR6C 1J0ZA 1D2OA 3LH2L 1YYLH 5FYJU 2OTWB 5HDBE 4RBPK 5HYSB 3C60A 3ZIMA 1RK1A 5FO9A 2H7HA 2NW3A 4P2RB 4WLCA 1U8OA 2G60L 4G1EB 2AVFA 2H7WA 1OXZA 2BH0A 2NY0C 3EH5B 3GBML 4L8SB 1PP9J 5JW4N 2XSKA 5E7BA 5BU8B 2IWEA 2X40A 2GJ6B 2DIBA 1C5DA 3HE6D 3VD9A 4X6FB 4UQ2A 3KJ4C 3HIZA 2AEOA 1FNEB 1Q1JH 1UKTA 3GMLB 3NAAH 4OFPA 5T1LD 2Q6WB 3NA9L 4BH7B 5LXGH 2VMCA 2OQQA 4G3YL 4P48A 4FZEL 1TFHA 4M93C 4L1HA 3M8OL 3MBEA 3CFKB 4KQ3H 3G9VA 4YVNA 1QASA 2FUTA 4LLUB 1N7ML 3ZTJG 3ME0B 4GEIA 3G6JE 4NKDA 4DZBA 1H3WM 4N2AA 8FABA 1NCJA 4S1DD 4UIKH 4RESB 4N0UE 5D9SA 2VDKH 4Z7UE 1Z3GL 4IRJA 5D2LE 4WTXA 5GZOA 1E43A 3U9WA 1FZBA 1T66D 3X1BA 1BIHA 3VFNB 4WHTB 1UA3A 2OMYA 3V8OA 2QGBA 4L0PB 1D5ZB 2HT2D 1HOEA 3BVUA 4HBCH 3CBJB 9PCYA 3VFTB 5APSA 4OZHA 3QXDA 1FNHA 2RIKA 2CRZA 1NBVL 3JWNH 4P46C 4IKNA 4XNMB 5F2FA 2E7BA 5IK3A 3ZDYF 3L54A 4JDTL 2MKVA 2NNAB 3LEXB 4KJWC 3U9UA 5CMZA 5TE4H 2EILB 3WELA 1KXQE 2AITA 3H2QA 3QDGA 3TIEB 5L2JA 2B59A 1NAFA 5TDOB 2XZZA 4H88H 4R7DB 3LOWA 1NQBA 1ZXGA 3UTTB 3WGVB 3H1LJ 3UCQA 4M7JH 3L48A 5EA0H 1SQXK 2FECL 1XMWA 4Z5RB 2EVJA 4P5KB 2Z8VC 4WW2F 2E8ZA 4WV1C 1PTZA 2XQYK 5GHWH 3AE1C 1PG7L 2Q76B 4RGNE 4RMVA 3K2IA 5JNYB 4OLWH 3JVGA 4ELME 4HS3B 4JL1A 2HFGL 4H8WL 3KNBB 2XCMC 1W2KT 4YHOH 4ZZFA 5LGJA 1PKQA 1F6FB 2JJUA 1A25A 2E27L 3L3JB 1CLOL 4BQ8A 1EDQA 1C5BH 5IVZB 4L4VB 4AUJA 4FZ8L 5GRXG 1LP1B 1RERA 2Z91A 1QG3A 2HG5A 4WEMB 4FDWA 2WHVA 5D93B 2CA4A 2LU3A 1GGYA 2YA2A 4UT7L 5GISH 1YUHB 2KLRA 1SY6A 3R8QA 3AT0A 3BZ4B 4FN0A 2E6QA 4PWIA 2VYRE 4IMLA 2I25N 2I85A 4P07A 2A99A 2DM4A 1OGTA 4PJIB 5JZ7D 1MFBH 2WOYA 3QHZH 3JV4B 4W70A 3KQGA 3H3KA 3DI2B 2V17H 4KDVA 1QVFO 1F5WA 2BO0A 1TZIA 2QEXP 4FJYA 4DGYH 4CJ1A 4U3CA 3DXAB 3LKOB 5I1GL 1N26A 1M53A 1U3HB 3GJEB 4FNUA 2YEZB 3CFBB 4U1LA 4FABL 4MXWL 1DDHB 3L3OC 1R33A 1WFJA 5DWPA 5GS3A 5IHWA 2VDRL 4C4KT 2AJ3B 3QEQE 4R97B 1T0MB 4UM9D 2IPTH 4M1GL 1IFJA 2NR6D 2XJLA 1BSIA 2BFGA 5DD1H 1XO8A 4L5FL 1NGPH 3ZE0B 3M17B 2CIIA 1F3JA 4X6CA 3RWIA 3L17A 4IU3B 2YR3A 3QZPA 3SGEI 1ZHKB 3S8GB 2HUHA 4EO5A 3MX0A 2KZJA 4UT9H 2XX0A 1CE6A 2EVFA 1N4XH 4OZGF 4PB9L 3FKUS 1A5FH 2FEEL 5T3ZL 1N3NB 3DMMB 2Y36H 5HHNB 3GKWL 3SHSA 4M7LT 3OXRB 5IBTH 4DCQB 3IJSB 4QOKE 3KLHC 1KB9I 4PV9A 4Z7VF 1A6UH 1NCOA 3GSVB 4FLRA 4R7DA 4L29A 3FQUA 1L4AA 5DVKA 3G9RA 3KHQA 1I8KB 4K23L 2M3EA 4W6YB 4ONGL 2E42A 3MRLA 2XXMB 2NT0A 4OF0A 3V4WA 1MQKH 2R56H 4HUVB 3VSTA 2LXBA 2VLRB 4C8XA 1CD1A 2WAQA 4YQXL 4YHPB 1KLUA 4NUJB 1D5BA 2Q3EA 4UTBH 3RFZA 4F91B 2HODB 1SJEB 5CEZE 1ND0A 2EICA 1GA2A 5IG7B 1NMBL 3WYRA 4AQ1B 4Q8BA 2CLRB 1Y18A 3A6BH 3FTYA 3M46A 4Y1TA 5EC2A 1ZT4B 5HJ3A 2X6VA 3QQ9C 3WD5H 3RB5A 3SKOA 5IQLA 3QAZC 1PY9A 3ULSB 4YSQA 2C7UA 5FX3A 4I3GA 4PJBF 5EO9B 4FFYL 2I8DA 3FRPG 5T1LA 3SFDC 1H3TA 3QCTL 1NUNB 2XXGA 1IZJA 2ZX5A 4Y16C 2CDEB 3PQYA 4N0CC 1JFQH 1DBAL 2AQ2A 4WI7A 4JBZA 3V5DB 5KVGL 2CCLA 1VQPP 1TPXC 3NA9H 1AHWA 3PS6A 2YD8A 5ADOH 3DX7B 4ZSOB 1MI5D 1O9WA 2NY3B 3KPMB 3PCYA 5KJ7C 5EG6C 3WJLA 3SYQA 3GDBA 3TA3A 4H0IA 5C7XL 2P44B 1U3HA 3GJEA 1FZMA 3O81A 1L0LE 2YZ1A 5IZ7A 4YNYB 3VDAA 1FO0A 2WBJD 4HMEA 2JV6A 3F6IA 4NQDE 4KXZH 4XODA 4ACPA 3FL7A 5ICYB 3EOAB 4KRLB 4XPAH 3QYMA 5EEUA 1VPOL 2JJTC 4KO6A 4BA0A 2HPCB 1FLRH 5JQ6L 3MYJB 1XHHA 3U2SB 1CDUA 1Z1WA 5AVVB 2CGZA 5DEJA 2VUKA 4MKMA 1IGJB 1T1ZA 2X89A 3I9GH 1BDYA 3GSQA 2A6IA 4N5ED 5GGVY 5C09A 3WDHA 3AROA 2BC4A 4NS0A 2OI9C 1SEQL 1G7HA 2J71A 3KL0A 5ESQB 3CZFB 3E1ZA 2BCCG 2KP8A 3LQZB 2GJ6A 2Q87A 4BZ1H 4N2DA 4YN3A 5FKAA 3EHBC 4PLJD 4YIQA 2V37A 2E75B 4HGMA 4PRHB 3ZRSA 1GH7A 2J6EL 5I18L 5J89A 3IJSA 4FNTA 1T2QL 4RISH 4LVOC 3LVTA 4Z3JA 4JFOB 1DSFL 3BEWA 4O9HL 2EYSB 1T7VA 3QDMA 2G30A 4BCYA 4PB9H 2ZYGA 1NBZB 4DP6X 1HHHA 4FHKA 2ZKXA 1MCIA 5D7SH 1ZWIB 2OW7A 3ILPA 1ZV8A 4LGPB 3ZE0E 1I85C 3RJDA 3L3DA 2A45G 3S5LG 5D1ZC 4MWFA 3UBXB 5C9JA 5C6WH 4GXVL 3KXFA 4UUJA 2IPTL 4JDZA 2W07A 4HJGH 1MF2L 3KBEA 1EDIA 1AXIB 3RFZB 3X17A 4BRJA 3U6XS 5E4AA 3DKHA 4HCGA 3HBGA 3LTVA 5EU6E 3U1CA 3L2LA 4GOSA 3NCMA 2IANA 2CKBH 5C0BD 2WXHA 1G6RH 3VXME 2JIXD 1GW0A 3S98A 2OV0A 1MJJB 3U4AA 1VESA 3VXMD 3LQAC 2RKLA 1NC2D 5EO9A 5AUMB 5GS1C 4CW1B 2X2HA 1M2VA 2IFMA 4H40A 3CHSA 3K6SB 2P80A 2XG4A 3L3HA 3PQYB 2Y7SA 4PY7A 1QLFA 2Y6SD 3QZBA 5IIEB 4GXFA 3AECC 3M9QA 4TVPD 1F8TL 1UGKA 1YEGH 4R96B 3KBFA 4ZTPL 3VXRA 3DBXB 1PD6A 3AREC 3MFFA 3U7YL 1P4IH 5DLLA 4M3HA 4KY1H 5F0PB 4HKBB 3NK3A 1OM3L 2VCOA 4YNYA 4PBXA 1UEYA 1MVFA 4IBLT 4MXQC 3UZEC 3VI3F 4LU5L 2C9XA 3AMLA 4ETYA 1IEHA 4HCRA 2LABA 1HCYA 3DIFA 1BCCE 1BSNA 3PNRB 1EXGA 1RUKH 1NGYB 1OL0A 4RGND 1U3HD 2Q9OA 3EBHA 1P4BL 1SHXA 1NGWB 4YHIA 5C0FA 2X70B 2FO4A 2KI6A 2ZVOB 2XYBA 4U6VH 4HHWA 1XIWD 3CN3A 2O1JA 5TF0A 1ED3B 1R5IA 2VERN 4GT0A 4AYBA 1I8MB 2BCCJ 2Z92B 1WLHA 4M7JL 1UD6A 3N9GH 2VLRD 4NQCA 3BESR 2UUDK 4ODHL 1KMIZ 3VFWB 1UACH 3H1HG 4GT7A 1GZHC 1ZRUA 4N78E 5LGHL 3PXLA 5B7EA 4YDNA 2DI9A 5KAQF 2CHWA 4CSTA 1HOCA 3VWKD 1YEEH 3EF7A 2P67A 3HE7D 4Y2OB 1XVSA 3IDXL 4O2CB 1XGZA 3P9MA 2BLFA 2HKHH 2QVFB 3I6GA 2AANA 3T65B 4BFIA 4E36A 3LKRB 1QI5A 3REWB 5EZLA 1IJNA 1Z9NA 5KSAD 4ENEC 1MW2A 2MJZA 1EQWA 1E4KC 4B50A 1IJ9A 4XBEL 4Q56A 2AJUL 5FO7B 3JQOB 1MG3C 4ISVA 3SPIA 5FDWA 2B3RA 3GZKA 2BPBA 4GAYA 1CS6A 4UT6A 5EN2B 1IBGH 4OD1H 3RPIB 4EZJA 3HVDA 1LO5B 3RI5F 2BP8B 3LIZH 2X05A 1L0NJ 2PP8A 3GSNA 5CEYB 3ZSTA 4OLZH 1HKLL 5CIPB 5HHNA 1YEHH 1L0ND 3U7WL 1G9MH 4LP5A 2JJSA 2EEFA 3G9AB 4FFWD 1KBGH 3CXDH 1EZSA 4XA4A 5HVHB 4E41D 4KXDA 4YX2H 1LT9A 4L29B 3IF1B 3H9ZA 5DVPA 3G6AA 4NQXB 4C7RA 1MFTA 4NPJA 1IFMA 3FJTA 5I75C 1PD1A 3QC5X 1W8EA 4YPCA 3IXAA 3BP7A 3LZFH 2ITFA 3QSKB 2WN3A 1YITP 1U92A 3L2MA 2KYVA 4W4OC 3L3IB 1GK4A 3BCCG 1I9JL 2FJGB 4DEPC 1KCRH 1HNYA 1DHKA 2PXYD 4KHTH 1CGWA 5C0IB 5FB8A 4F7CB 2A38A 1TTFA 3NXSA 3R06A 1OSEA 3BVXA 2WQSA 4IBUA 3BH8B 5FYLE 1FL6B 3NIFB 2D31A 3DMMC 1YYML 3NQKA 1HI6A 4YHYB 2P45B 3FSWA 2P43B 4ZUWB 4B9ZA 2KNCA 4I77L 1CW5A 5E8EB 1AYOA 1P4IL 3NABH 1XSIA 3ECVA 3K5BA 4AYDC 5TQ2H 5DJXB 3BLPX 5KLVD 5EO0B 4MB1A 5I8OL 3PRZA 5AG9A 3B2UD 1DBKH 4Y8DC 3GSXB 1ED3A 4B3EA 2HRGA 2YA0A 3A67L 4JRYB 3WUWB 1ASOA 2Q10A 2BNQE 2MQCA 2H1XA 4EXKA 1NKNA 2PFXA 3CQPA 4K3EL 4ONGH 5LAPA 2IPUK 3LN5B 2M1KA 4NGHH 4H5SB 1D5XB 3R2PA 4BGDA 5AD0B 4N22A 5H37A 4DK5A 4O2EB 5KSVA 1HF9A 4FJ6A 5TH2A 3RVXC 4P59L 1RHFA 3UH8A 3IFLL 4HUCA 4J1UA 5ICUA 4OFKA 4YHML 3E1F1 3FOMB 1EVTC 2H1PH 1S2EA 1G5GA 1YJWP 3IMVA 1A5FL 2Y22A 1JXGA 5HI4C 2AHIA 4AMWA 5GQBA 2YSSB 3DUSB 2ZWLT 3ZVVA 4TSCH 2OYIA 3UAJC 1VCBC 4P04A 4NKQB 4IBQA 2BVPB 1WFUA 5GZNA 5D1XB 3RNQA 2ODIA 4CILA 2X4PA 2XQYA 4HUNB 3TK1A 4EIUA 1DFBH 3FMGL 3TCXA 4L8BA 4U7KA 1LTTC 4AMKH 3GRWL 3U1PA 4KGJA 1SEBA 5DU7A 5EBGA 2A9MH 4AZ8A 5AB2A 3Q05A 3V5BA 4MSWA 4XNBA 3N43F 2BHZA 1CT8A 2P8MA 1D5IL 3N1GC 2DYPD 5C0AA 4JVPA 5DS8B 1FZKB 3LV3A 3INOA 1JZJA 2XPYA 4UDUB 4LVEA 4P99A 3CIAA 3N6YA 4Y4FC 1RMFH 1QR1A 3SE3A 4ES8A 2VXVH 4MD4B 5IROA 2XWJB 4JFQB 3DURB 5DZJA 1DVFA 4RVBA 1Q4NX 2E75C 2R1YA 4NOFA 2ITAA 4FG4A 4DP8X 5HHPA 3UJIL 1LO3H 1HZHH 2EIDA 2TSBA 3M9BA 4FF9A 3UTSE 1SQXG 3KXFB 1P84H 5FB8B 4K9EL 2XXFA 5E8DL 2VKWA 1BP3B 5FYJD 4NAJA 5IKCB 3MYZA 3QQDA 4F27A 1J8HE 5DD0H 1ZGLA 2Z4EA 1P7KA 2Q2LA 4X4KA 2AI0L 1NBVH 2I7SA 1XF1A 2GSIB 2FFDB 3STLA 5KS9E 1QL1A 5CINH 3RVWD 5E8EA 1I7TA 1AGCB 4OY9A 2WZPD 2R3CA 1KBBA 1ZS2A 3CX5E 3BJLA 4ZS7H 3AABA 3EO9L 1U2HA 1P1VA 1QABA 4UINH 5CILH 1XCQA 5DJCA 3HB3D 3S8WA 3Q2NA 3UROR 3OWRA 3B2VL 3HCVB 3EO0B 2APWA 1E4HA 3RQ3A 1N5YL 1Q72H 3H1KG 2NUPB 3FU6A 5C0BA 5DEGA 4AC4A 3C5SA 3C09B 5E9NA 1L0LD 3ZSSA 1JGVL 2VRQA 5F9JA 1YC8A 1GW4A 5HHXH 1X7TA 2WPQA 2VXQA 1YEDB 1JUFB 1NTMD 4JDEA 4JKPH 1WGVA 4XPBH 2VRSA 1W16A 3AM8C 3VXTB 5BOJA 2ESVA 2VDOH 5CZKA 2R1XA 4HH9A 5SWZB 3F2LA 4AQZA 4B0MB 2PWDA 3GMAA 3GBMH 1CFQB 3TZVA 2G2RB 4MLSA 1KJ2A 3S36H 3TNUA 5DQDL 5DA4A 1ZVYA 1C9SA 3U0PA 4M6MH 5IMKA 3KYKH 4PJBB 3ZTNL 2BJMH 3ZN6A 3G3ZA 2WSEH 1NCGA 4W9FC 1R9FA 1CUOA 2QEJA 4UT6L 3B9KC 1Y6KR 1ZLLA 4PJAB 4OM0L 1GSMA 4XPTH 2H26B 1AVOA 2VLJB 2GIYA 4G80A 4F9LA 3A6CL 5BO0D 5DJUB 1KN2H 1MKFA 1PG7W 2P24A 1QX8A 1PW3A 2NSXA 2V7QJ 4DN4L 3MVSA 5E23A 5F3HA 3U7YH 4A55A 1L7IL 5BVZA 2C9QA 3QXVA 4U6XB 1V10A 4HLJA 3UTOA 3BP6B 1AD9A 5D71L 1KGXA 4XOBA 4IKKA 5DK0A 1L4AD 3WTTA 3FFCD 3BKML 1PFIA 4ZAKD 4Y99B 1MEXL 2J8HA 3BW9A 4OV5B 2DQUL 2IFFH 4Z1PA 3Q2VA 2F53E 1WS8A 4UB0H 4NCC1 4A7GF 1EO8L 3DX3A 4XRCA 4B41A 4PP2B 4FQ1L 2ZFCA 1AS6A 4QF1B 1R3JA 5EOCL 1TEFA 3MLZH 3CMEP 1KB9K 4GUCA 1HIML 2EKJA 1U8PA 3MNZB 4DETA 2XC8A 1G9HA 4FULA 4X42A 3KPRE 1P1ZB 3FO2A 3TA3D 3X14A 3GZQA 2FB4L 3L08A 3BXNB 3GSNB 4HSAC 3OJ2C 3RX7A 1A7RH 2N1TA 2IF7A 1DQML 3K5SA 3DUHA 3SDYH 1FLTX 1OHZA 3LKQA 1M7DB 4ODWB 4QOKD 4QGTA 3MTRA 3RWEB 5IBUG 2Z9TA 1E7VA 2H3NA 4H0HB 4MB4A 5KSUB 1F1DA 3ZR6A 1A9BA 1AACA 1CFTA 2BM3A 1U93A 3G7TA 4G9FD 4KOCA 4UB8H 3VH8G 2NUPA 4QXWA 4A38A 1FYHB 3QXUA 2EXTA 4WY7L 5C07A 2JWDA 2FJGA 3J7HA 5M1BA 5F1IA 5AYUL 1HSAA 5I8OH 2ZUQC 4X6BA 1BDDA 3E7KA 4MQSB 4DUWA 1Y47A 1T1XB 2VITB 1U95A 2D31B 3GMPA 4H26B 2EEAA 3EUUA 4HAFA 1PLGL 2FZ3B 5I1CL 5A2BA 4N2NA 1RZIA 4U1IA 4WTWA 5LGKA 1BG1A 2WMPB 4XMTA 5G5DB 1HXYB 3BDYL 1G9EA 1IAIM 1KMGA 3U46B 4AEIH 4R0LC 1WG3A 2QV4A 1M3IA 4OFQA 1MFDL 5D8JL 4M48L 1NCWL 3RTQD 9CGTA 3GBNL 5C7ZA 2ZZUT 2N4IA 3GIVA 3GMLA 3BDBA 1CFSB 3NT0A 1SUJA 4QXGH 2Q6WA 1BM3L 4XB7A 3IKCB 1SQPE 5T1KA 2VUOA 5JO5A 1M56B 4HIHA 1AH1A 4NM8L 1M05B 3AVEA 2AK4D 5B3JF 1A9EB 2JJWA 1KXTB 1WIPA 2GCYB 2GG1A 2HKFL 4HZLA 3RUGA 1AZNA 2AQRA 4EEEA 2RHEA 3U9PH 2CO7A 1RKRA 5EFWB 3UPRA 2BK8A 4JO8A 5BXFA 1YECH 1MKMA 4D0CA 2AXTE 3VOPA 4W80A 5IW1B 2K9FB 3EDJA 1XFPA 5AW7B 4L4TA 5IROC 2VDKB 5AOMA 2CIKB 3EYUL 5FLUA 3FUFA 4LSTL 5J1AA 4Z7WE 2BERA 2C1PA 4MN4C 5C0JB 5ID0A 1VF5C 3D3VB 4PJGE 4PP2A 3Q44A 5D1ZA 1RZJH 5MEQB 3HC3L 3P32A 5GRVL 3ULAB 4NM4L 5IWLC 3DARA 1FC2C 4Y4HA 3EJQA 4GJTB 4EVNA 5IFAH 4AGOA 2Y06H 3H6PA 1P1ZA 3FO2B 3ATAA 5TDOA 1U3JA 1MCOL 4KROB 1FE8L 4TUJB 2EIEA 5C0DB 1D6EA 3N40F 3HUSA 3LAFA 3F5HA 5HDQH 2D7TL 5JPNB 2YARA 3BWUC 2UYLB 4OGXH 5SX5K 2H5UA 2JB5L 1FE6A 3O9WB 4HDIB 4LBEB 5EFIA 1NAYA 3REVA 2Q76A 1JGDB 3MCG1 4NHUA 1IKOP 1F3DJ 3LPFA 4Q58C 1WCBB 3W2DL 3DV4B 1WZ1H 3GXDA 4OIIL 1WTLA 2ITCA 2PCYA 5E2WL 5APQA 1DVFB 4OD2A 5J12B 5CR1A 4F8TA 4LPCA 3ZZLA 3G5YB 3ZRFC 3KZIE 2BINA 2WVSA 5C07B 4P3WA 2ZUWA 4YXKL 5AYQA 2D7PA 4PJFA 2LGNA 1TEGA 4ABUA 1NGQH 3MR9A 1MRCL 2NYYD 1RIHH 1BZEA 1IEAA 1ROCA 4TULH 5JIHA 2G3NA 1QFPA 1PL3A 3NOIA 5I5IA 3PRJA 3APDA 4QWWC 2ROYA 4ACTA 1GTWA 4TNEA 4UOW1 3ITKA 4PJGF 3P2DA 3BMVA 4X0KB 5CJQH 5F88A 4MA8H 1NSNL 3CFIC 3WTYA 2UVEA 5CCHE 4PJ0E 1NAML 4RFNC 1NCNA 1EJOH 4TNVF 2HLFD 4CA4A 3PJNA 2VXTH 4X4XB 1H6TA 1FNAA 3QJVB 1O6VA 1M6UA 4XCCL 4OSUH 3VXUD 2VWEE 1YC7A 2RAMA 4RO0A 2P42B 2WGXA 1SBSH 4HUXA 5HD8C 3CH8A 4FERA 4Z78A 5LDUA 1JTTA 4RSYA 3G5ZB 4NNXB 2PP7A 3V4PH 1XV8A 1VIWA 3DUUA 5JORA 4IK7A 3GGWB 2B3IA 2WZ0A 4ONHA 3T0XA 4NHCH 2DQ6A 2EYTB 1W5CE 2JIXB 3OC5A 5LXVA 1WJ3A 2RQEA 2UWEA 4YSSA 4JDEB 5BXFB 2PF6A 5AZUA 3TGXA 5HYSA 3PWLA 1QEWA 5DZ9A 4LASH 4LLDA 3FU5A 2R1XB 4HH9B 3W9DB 1RE3A 1XR8A 5D2NA 3N9GL 1RF1A 1X4ZA 3AE3C 1TQWA 2G2RA 3AY4A 5M94B 3BFQG 1U8CA 2BWDA 1HIMH 3IWVA 5GRJL 1RE4A 2XZRA 5JMRA 4N8PA 5GISL 2JJVA 4LRNH 4XR8C 4EE2A 2EIJB 1DLHB 1CYWA 3H4FA 3UJTL 4Z77A 3BH9A 4FI6A 3CC5A 4J3OF 3VYIA 1IK9A 1RFDL 2VLRE 2Z31A 5LQBH 3GUTA 4IJ3B 1NIFA 1M7UA 4GFTB 5HHOB 3BYYA 3BJ91 3NEXA 4FG2A 4XT1C 1XGQA 1ZLWH 3IXTB 3RL0C 3QUZC 5HHVH 3QAQA 3EGXA 4LDCA 4NN6B 1EEUA 3B6SA 2F61A 5L7XH 2K1AA 2NNRA 2UXGA 2VDQB 1OKEA 2YN3A 4UAOB 4ZUTB 3SYOA 3CH1B 3FONB 4WEBH 3MRQA 1XEUA 3ZYZA 4KVNL 4X7TB 2LVEA 3QIUB 4MB3A 3ZTJH 5I76A 4KK8D 4DEPB 2CK2A 2Z64C 1ETA1 3FW6A 3SKOB 5M95B 4Z1MH 1E4JA 3L9RA 4AVHA 3QDGB 4X4MA 1COBA 3P4OB 3QUMB 4NX0A 3U36B 4XO8A 1FJPA 2MEJB 1CVRA 1UXWB 4TSBH 3RWJA 5F7UA 2RJMA 4Y9EA 1X9QA 3FFCE 1BAWA 3LH8A 2OW6A 5TF1L 2WJ5A 3PE9A 1E3XA 1SXSA 3GJFB 3P2BA 2F8XC 5BQ7A 1MJ8L 4NZFA 3T2PA 4BH8A 2JTDA 2HWZL 3KHUA 4JY4B 3RYMA 5FUZH 4NO2A 2IYOA 2RCSH 3PUCA 1HQRA 1KIRB 4ANWA 3RWEA 4X4XA 2R2CA 3H3PL 4NQUA 2IAAC 4OF6A 3EFOA 3SD5A 5D7IA 2GITB 4UI2A 4Z7QB 5L0QC 2W8ZA 3ZU8A 2BNRE 2J8UF 4A66A 5BRPA 3KR3L 2DQCL 2LKMA 4GMTH 1OP5K 2VXTL 1LK2A 3A0BH 4UIMB 4PCYA 2NY2B 3BGFC 3FU7A 4TS6A 4RIRB 3AE4C 5CEXA 1HSBA 1VF5B 2GY5A 3NCBB 4R7VA 2BOBA 4TUKH 5IVXE 5IFAL 1LEGA 1ZTXH 1T8ZA 4XP5H 1RZIB 4U1IB 4JY6A 2XKSA 5AVTB 1Z3RA 2RB8A 5L2KE 2CG9X 5I19L 1XF2A 3HI1B 3AACA 3WDIA 2ADGB 4OLXH 1F6LL 4N0FB 3QQ3A 1DZ0A 4OUOA 1R24A 5EIVA 4JE0A 2NZ2A 4IIQA 3H6JA 4GG8B 5F71A 3UBFA 2LOEA 1OX3A 3FT4B 3TFKD 4E41A 2AJXH 1E0OB 3BT2H 1ADQL 4JPKH 3QIWB 4NZJA 3TF4A 1X44A 3PDOB 2FJFB 3N85L 2ICWJ 4CPGA 1QPKA 2OTUA 5E9DE 2WYZA 1T5XA 4ZFOL 4IOSD 1F4HA 5KBLA 1KXTA 3RK3D 1CQKA 1KEML 2A06D 3ARBA 5BVJB 3IETA 4M61B 4TLKA 4WTZA 4HW6A 5C9JB 5CHXA 5KJRH 4H44C 1FYTD 5I0DA 2ENJA 1ZHKA 4HMCA 4GW1B 4R0LB 2CNYA 4GSXA 2NY4D 4QRTB 3RA7L 2DH3A 1IIIA 1TETL 4I7ZB 4HAKA 4PP1D 1WT5A 3HC4H 1IIKA 2YMXL 3OZ9L 1JV2B 3I5CA 3VXSB 2EDXA 3HMXA 4L23A 2FBWC 5EZIL 3HFFA 1NC4B 4UT9L 3IR9A 3KYNA 5KYYA 4JHUA 4U0QB 1S7TB 1J1OL 4AQAA 2J25A 5KBMA 2H8PA 3B3IA 4H0GA 2PWHA 5CNHA 1DCEA 2EUVA 2ZAGA 3HKFA 2PR4L 5I74B 3RBXA 3WIIL 3L9BA 3RGUA 3WIAA 1Y0LB 2VQTA 4OD3L 4S2SB 4WUUD 2VOTA 3MV7B 4QXUL 3T1FA 4EOWH 2XWBA 1MRDH 5E6UB 1EAQA 2A1WH 4GS7C 2I9TA 1QSFE 1JEKA 4R4BB 1KIRA 5GIRB 1A6TA 1NAMA 4AL8L 2MQ0A 3DV4A 3OHMB 4GI9A 4XMPL 3SE9L 3GI9H 2PYEE 5ERWA 4CSPA 5GTHH 5C8JB 1LNQA 2VXVL 3BAIA 5JDJA 3HS0C 3HC0A 3LY6A 5C3TA 3W57A 2CDFA 3HBZA 2O5NA 5CSBA 3NCCB 1DQVA 1HH6B 2SODB 5A2AA 2IMNA 5IVXF 3LNEA 5DTFA 3QUZA 1J10A 3I85A 1OVZA 4I3SL 4JRXB 5DSCB 4JRYD 4QRRE 1K73Q 3F12A 1QHQA 5TQ2L 1HAUA 2DS4A 4UV7L 1NGWA 4OD3H 2M2DA 1F58L 1ZIAA 1XF5A 5LAXA 1U42A 1NCHA 2A74A 2NYYC 2VLKA 3VXUB 2DI7A 2DJMA 3LS5L 2DTMH 4L4JA 4C7NA 1HDMA 3JCUH 3FUJA 4O00A 3RI5K 3SKJL 3PGFL 3KGRA 1G0XA 1I7RA 3P73B 2NX5E 2BVUA 4PYHA 3T4YB 4IMKA 1G2CB 1RE4C 4DZ8B 2PP9A 3PJSB 3Q3GA 1N7SA 2W0PA 4G2AA 4QDGA 3RWDA 1T2JA 3NRPA 4H25B 4OFVA 4DH2A 1S7VB 1BQHG 1FO0B 1LXMA 4K94C 3PWVA 1W0WB 2VLMD 4NI3A 3FT3A 5IF0A 3IFOB 4Z78B 1XGUB 1G7QA 2ZXGA 4P5SA 5ALBL 4KXZI 3RTQB 5IB1A 1FAIH 3B71A 3LRSB 2DJSA 2KZ1B 4FI7A 2DY2A 3SGEH 8FABB 3MRDA 1PLBA 1H5BB 2UZPA 1LWUB 3FCGA 5GRVK 3WOVA 4D7BA 2VXSH 1YCSA 3U6RB 4Q0XL 1KN4H 4NQDD 2EH7L 1R3IL 1DBJL 3Q9PA 5BCAA 2OA9A 4OAWB 4O02A 2EDKA 4JAMB 1S9YB 5B3SB 1J12A 2OMYB 5ES4B 1RLWA 1TJGH 1KB9H 1RQUA 4TQHA 5I0WA 1N12A 4QJ3B 1AJYA 1ZANH 5DJ8B 4LLAA 3OTTA 1I3VA 4XPAL 1CFVH 1J1DC 3ULUH 3UYRL 3X1FA 1UKSA 2Q3ZA 3FCSA 1ZLUH 3WSQL 2LR2A 5GZOC 1FU1A 1E4WL 4YAQB 5FKPA 1NBZA 4NQXA 3QXAB 3CLEL 2Z31B 4GRWH 3AS3A 1NU1E 1IFNA 2ILLA 4RX4D 5I0VA 3O3DA 1N86A 4ZOAA 5G4NA 4KZEH 3OQ3B 1L7IH 1PSKL 5D5ME 4UNVA 1XGQB 1EUTA 4BZ2A 1E5AA 3TEUA 3KH4A 4NQDB 1RU9L 5B38A 3B6SB 4JKLA 3VP9A 4BHUA 1OPGH 2NY2C 4BE5A 5EEYA 4WVRA 4RSVA 3ARTA 1G7PB 3HN8A 5ILTL 3O6LH 3PFQA 4FQLH 2MKLC 3WIHH 4YSDA 2RCSL 3G5WA 1SMOA 3GNMH 3QORC 4LLQB 2I7OA 3RWCB 1BGXL 2P8PB 3TL5A 4C59B 3IGAA 3SGJA 5J0BA 1IKFL 3UBXG 3KVDD 3U7WH 3LKPB 12E8L 4Z7WF 1DX7A 1WQVT 4R2GD 3K80A 1WWAX 3QK0A 3PY9A 3QUML 3EJYD 3IN2A 3B1TA 32C2A 1SQ2N 4PJ9C 2VDOL 5F0MB 4XVOA 5ESAB 2WLLA 3W9EB 3GS0A 1TQVA 1NGXB 3IAQA 1ZD6A 1KCSL 3L1GA 3DO7B 5I6XB 3AWGA 1FF5A 2OMTA 4K7FA 4ZD3L 2AF2A 1EXJA 2W9EL 1FHGA 3N41F 2C3WA 3ZHKA 2HT2C 5FF6A 1CGXA 1UB6B 1OAJA 1GOGA 5DJZA 4XNDA 5C2BL 1M4KA 1L6ZA 4CMMB 5D7EA 3UGUA 1NYHA 2ED7A 4W9IC 3V6ZB 5KYNA 2G3XA 3T09A 1LWUA 4JM4H 2CIIB 2OYIB 3MRJA 3CFDA 2DQIL 2XQBL 4ORZC 4DVBB 3KXDA 1QWHA 3GD1C 4OCMC 4S11A 1RJYB 4G43B 4UYQA 1FG9C 1KGJA 2W92A 2Q9IA 3BPOC 3NIFF 1KG0B 3ETSA 1L9NA 1GZLA 1PKOA 3C8HA 2QKIA 3WFZA 5KVMC 1O7VA 2FE0A 3MUDA 1Q0XL 3I56P 1AKJA 4HSCX 2I1KA 5AAMA 1NOLA 2DKMA 5PCYA 2L3BA 5ITFA 2EZ0D 2B15A 5I1KL 1WA0X 1JPEA 1D9KB 5DQJB 3BAEH 1WVZA 2EIZB 2NPSD 2X5PA 3FQ1A 2JXMA 4OGZA 3UJIH 2XOTA 4I1LA 1OB0A 4ALAL 3BE1H 4Y4FA 1ZDQA 4TT3H 5TDPA 5HYJD 1L4AB 2DLTA 3E0GA 4W9KC 5KJ7A 2A1WL 2LTQB 2DQIH 2XQBH 1KB9D 3BCCD 3C8KA 1GC1C 2JB6A 5B1JC 4OF3A 2XWXA 3J07A 1XH3A 4GKNA 4XN5A 1YMMA 1JCCA 1SHSA 2ZAHA 4GAGH 2BWIA 3P3YA 4JKMA 4LOUD 5DFWH 3HN3A 4FYQA 1T20A 2WNWA 3A0HE 3B5HA 4KX7A 4LHUA 4HFUH 4YHYC 3MD0A 2PWFA 5HJ3B 1X9LA 3T3MF 2PCPB 2JSFA 3GHEL 4TVPL 4P9HL 4ZXBD 2GTQA 3V2RA 2P5WB 1KJVB 4MNQD 2WBJB 3H1ID 3TIEA 5L2JB 3TWCL 1NEPA 1SN5A 2N56A 5AOIA 3DWTA 2EC8A 1QUPA 2A9DA 3PUUA 1HHKA 1AOZA 3OLIA 3ZMNA 1I4FA 4Z5RA 5I75B 5I1JL 2F8VA 1E3ZA 2B87A 1L9PA 2KIKA 3BLKA 2R32A 5I15L 1WE5A 3M1BA 1FNSL 3L3IA 4KK6D 2R0WH 2GAZB 4FQCH 3AS1A 4JFZH 4OLYH 3SDAC 3VQ2C 2VN5A 2RFXA 3TCLB 4OCLC 4F7CA 2HT4C 2QADC 1IZNB 3D6GA 2APVA 4G8IB 1YPZE 3JXAA 5E2WH 4ZMAT 4ZTOL 4UDTA 4XOAA 3DO3A 3RZCD 3IS0X 2EABA 2NX5B 3ARYA 1YMHB 1FGNH 3UJJH 2YIHA 1BW8A 2QJKB 3EOAA 1R46A 2QJPB 3QIBA 3WS6A 4BWUA 4JRXA 5DSCA 3EFGA 3H1HD 1NKRA 4WTZG 3QH3B 1RF0A 4YXHL 1CG9B 1MFVA 3T0WA 1L7TH 1RHHA 1C08B 1FH5L 2DIEA 4OFYA 4DVBA 5B39A 5MEPA 3AXLB 2A74B 2DQTH 1MCJA 4XZUB 1USEA 3DSNA 3QORA 1I1AA 2J88L 4Y2LA 1SF3A 1K8DB 2L7JA 2F54B 2Z6FA 4XBEH 3A47A 2BEQD 3L8QA 1CL7L 2EEXA 1LO2L 4PRIA 3V6FB 1W0VA 4PBWD 1Q72L 3KJ4B 3H6AA 4XMKL 3WHXA 1I1FA 4YHZL 3KYOB 4K5LA 4U1LB 4Y1AE 3BEWB 1U91B 2IAMD 1FZJA 3C87A 1QPPA 4L4TE 1JZ3A 1DDHA 3CMOL 5D2LB 4JQXA 1CBVH 4HWEL 4ZZKA 2W0FA 3RJQB 5F6IB 4JUSA 1BF8A 3BUTA 3F7PC 4AQ8C 3CXDL 1FDMA 3A4FA 3RY6C 2AJSH 4XVSL 1ULVA 4P5TD 4NERA 2R1WB 2R2HA 4DT0A 4HGWA 4A2MA 2QL1A 2WLIA 4OLZL 1G5AA 4IGBD 2OSLA 2QVKA 1N4XL 1JNHA 4PGDB 3KPNA 1N0XL 2AMGA 2ENQA 3IDYB 3SSGA 2G5BA 2GUSA 4EI2A 1GGCL 4WVZA 4Q4EA 4X9YA 4NNYB 4DP5X 3NSCA 2VW7A 4PJ8C 4PJ8D 1UM4L 2R8SL 3V9FA 5JOEA 4L73A 1FVDA 3FCSB 3GSWB 3LVEA 5C0AB 1KJVA 3HMXL 1MCEA 4R5TA 3QWQB 3WI9A 3T5WA 3JWNE 4FKEA 1M57D 2AXJA 1ORSB 1B6UA 4K71C 3CVHH 3V8CA 3MRLB 1MFCH 2YZ8A 3HNVH 4X5QA 4Z76A 5I73B 4XC1L 3IVKA 2JCCF 5CBNA 1Q1PA 4HUKB 3CTTA 4LIQH 4XCFL 3RDTD 1CF1A 3VXRB 3VX1A 2WVRA 4RMBA 5IQMA 1KLUB 2W5PA 4NUGL 3FN3A 3JV0A 2WO2B 1OTSD 2AS5M 4B7IA 3VYOA 4ZX5A 3LJ3A 4FFZA 4K23H 1NTZK 3ASOB 1UA7A 4LSQL 1JPGB 1V7NL 5EC2B 5C92A 1UXSA 1ZT4A 5DWUH 4XNYL 5FA4A 1CN4A 1NCTA 3QUYC 3QIBB 1NJIQ 1NDGB 1G7JB 4MFHA 2K88A 5IOKA 1JF5A 3BKJL 3VB8A 4P4RA 4OZ4A 5INDA 4JFHD 3OKMB 4FQJL 1OSZB 4YHMH 1HHGA 1J5OH 1F4YH 4PV8B 1CFSA 2VO5A 4ZS6D 1IE4A 3D85A 4HK3J 3M0AA 1OCOB 2HJFA 4LFHD 4KRMB 1T03L 4TRPH 4LCWD 2IH3A 4BXLA 4UF7C 1M6OB 1MPAL 2KC0A 3GRWA 1OVUA 1W0VB 4IOFC 4RQQB 3C5SB 3ARGD 1U8KB 5I1HL 4W9EC 7PCYA 3MLWL 4XOCA 3V0WL 3KYOA 2E4TA 4PSPA 4U0RB 3EQ2A 1OTTD 4M4PA 3MOBH 2W6JH 5IQNA 4FFWC 2X2IA 4HIXL 4IK6A 2CLVA 4OQTH 2CGYA 2O1AA 2CJUH 2LU7A 4M02A 1DBMH 4QRPD 3T04D 3QJQB 1JZFA 5D7LE 4YL9A 4Y4KC 5IESH 1EAPA 3B2PA 3JWOC 5CMAB 4YSAA 3O3AA 4NQEB 3ZW3A 5KEZA 2IH9A 3LN4A 5F21B 5IREA 1P6AB 4JQVA 3WEBA 4YXHH 2BDNL 1IBBA 1NLBL 1NPNA 2DQDH 4PJ5D 3SDAD 1WUNT 5FKAB 2DD8H 1BLNA 4WU5B 4A2EA 3IE9A 4G5AA 2R29A 4DNLA 4F33B 2FYYB 3V0HA 2OX5A 2YO3A 3H85A 4Y5XB 3TO2A 1JMMA 1Q9KB 4PV1C 4EN3D 4H4NA 2HFEA 1L4IA 2EYSA 1CE1H 2X28A 3LZPA 3QDMB 5ALCH 2D0HA 4ZAKC 3U9PL 5F7FA 4ZDHA 1FV1A 1IT9L 3H0TB 1DEEG 4APQA 4AI7A 3SJVA 3O4OC 2VL4A 2H3XC 2QHRH 5C0RL 1UIIA 3GMRA 2V9QA 4BSVA 1R0AH 4OV5A 2QJDA 3QRBA 1R5VB 3UACA 1OAYL 4RISL 1UH4A 4AKOA 4P2OD 1Y9BA 3MJ9L 1KJ3H 3FQNA 3V4VL 1NCIA 1W6LA 1GL4B 3MNZA 4HWBL 2QBWA 3QJRB 4U1SA 1E5YA 2J20A 15C8L 1WZKA 1JUNA 2LVCA 3HUJA 1FG2A 3ARDA 1LTJA 4ASWA 2YKOA 2I69A 4TNWF 4Y4KD 1GW6A 3AT8A 3BUBA 1JZHA 1G9NC 2R0ZH 5IFHH 1LEIA 3ZLQC 2M5AB 4OKDA 4N86A 2VL5A 2WTYA 4ABWA 4KDTC 1JWUA 5KTBA 3C2SA 3Q0HA 2XG4B 4Q97A 3VGFA 3V79C 2QTEA 2X3AA 3UYPA 1A64A 3CVBA 3PV6A 4Y16B 5KSUA 4UTAL 4IKLA 3BWUF 3MO1B 3O3EA 5APVA 3FFDA 4R96A 3FHAA 3N04A 2P7JA 5C9KA 3Q43A 2X4TA 2P26A 4YLBA 2VNCA 1OFCX 3MUGA 4P57A 4AKQA 3EJPA 4NNXA 4ZODA 4NO0A 1BVKB 1HTLC 2L7UA 4XMPH 1YTZI 2X4UA 2OL3A 1MY7A 1U8LB 2I32A 5AB0A 4OZIB 4HEMA 2FHFA 3OGOE 4TLFA 5J56B 1SQBD 3QJHB 5D5MF 3NMDA 5A16B 1ZSDA 3FRPB 4QXUH 4XE5B 5TK4A 4G8GB 3FO0H 2D7NA 3V4PB 4M9OA 4HJJH 4HH2A 1IAIL 1FVCB 1UQSB 5C0AE 1U8CB 5C0NC 2A2QT 5B39B 4LU5H 4N1EA 2Q8AH 3MRBB 7PAZA 1A2YA 1TTAA 3LN4B 3BEVA 3NIFE 4BGLA 1J1OH 3M88A 1B4TA 1UOWA 1PV3A 1JPSL 2A6DA 3EW3B 3ML8A 3O2WL 3E1RA 1CXKA 3T0EE 1EA9C 4JFFD 3CCUP 2WSFJ 5BZDB 3B2DC 4G6ML 1A9EA 4CBZA 4KJWD 3S35L 4E9VA 3V5HB 4AEHL 4N2BA 5A7EA 3TF5A 4PV1D 3SB3A 4JCMA 1K4DB 3HRPA 1QZ1A 3F64A 3CAFA 4BKSC 3C6LB 4ZUTA 2ZVNB 1G43A 1UFUA 3KCPB 4LNRB 3US9A 3S9OA 3GMRB 3WNOA 1T7YA 2WWNA 3HHMA 3MQIA 1XIWB 3FB5A 2IJ0C 4MQ7A 4P5MB 4ELKA 4OZIE 1GS6X 4N1HB 4PJ8B 4POUB 5D1ZB 2EVIA 2FB4H 4GG6E 2PP6A 5DJ0B 4LGDE 4D2NA 1PGRB 4GAYB 4EZMA 3QVAA 3TBSA 1CFBA 1IQDA 5IW3A 3TT3L 2MHAB 4X2UA 4ZW7A 1CF8L 5ABAA 4MZRA 1U58A 3WY2A 1IKFH 3NSFA 3MUDC 1WZLA 3WHE0 4GQRA 1HWHB 3STLB 2IOMA 3II6A 3F7YA 3DJTA 3P4NA 4HK0A 1OPOA 3N91A 3VXQB 1JPSH 2OR9H 3MRNB 4CU7A 2CU9A 3MIWA 4PRHD 1MEXH 4R90H 5KJ4A 4BWTA 1TVBB 3EFDH 3L75E 1RF1C 2BP3A 2CHXA 3MP7B 4IBWA 2DW5A 3VFRB 1KGCD 5LKNA 4H8WH 1NIDA 1KJMB 4XBGB 1Q9OA 2WXJA 5I8KL 1MAMH 4FAAB 3T8XA 2GW5A 5KYUB 4HEME 1RIHL 1WAAF 5IJKA 3QUKB 1YJNP 2WXOA 4QO1B 3NJJA 4BUHA 1J18A 4BRYB 1IT9H 3TYYA 5D6CB 2DM7A 4JG0H 1BVKA 2NY3C 1M7LA 2H2SD