5AVQB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 0.75 min.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avqB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avqB02
1FOSE 3P32A 2JJLA 3O8ZA 3TYYA 4KHXA 5AW3B 2ZXEB 2R32A 1T2KC 5APYA 1H88A 2KP8A 1CI6B 4AYCA 3LIDA 4LC1A 1NWQA 1OWAA 4JYBA 3VN0A 1MUUA 3L37A 1JUNA 3TK1A 1J2JB 5AVWB 3L36A 3M0DA 4AUWA 3IR9A 3M9HA 3A5TA 4C7NB 2R3CA 3NTNA 3V5BA 3A3YB 3NFQA 4C7NA 2WPRA 5AW1B 4C46A 5AVUB 1GU4A 3HTKA 2WWWA 2VRSA 3KQGA 2WT7B 4M3LA 3L35A 1JNMA 2C9NY 3HE5A 3OAKA 1IO4A 4RETB 5APVA 4EOTA 1H8AA 3NXSA 2YO3A 1HJBA 2WT7A 5AVYB 1FOSF 5AVZB 3NMDA 3M91A 2P7JA 1HUCA 3I5CA 1SLQA 1CI6A 5AW4B 3VYIA 3WGUB 1X8YA 2WPSA 5CMZA 5APSA 1A02J 3MD0A 1H89A 1GZLA 2Q3IA 4XE5B 3VMXA 2P67A 4GT1A 2Z5HA 1S9KD 1FAVA 5AVSB 1SP4A 1CZQA 2BASA 2R5BA 3TNUB 3VMYA 3LIEA 1NAFA 5AW6B 4AQRD 4GKGA 1A02F 1YYCA 2N9BA 2XZRA 5AW9B 3P7KA 3VTPC 1GK4A 1GU5A 5AW8B 1DH3A 2QM8A 1HBWA 2Q5UA 3M06A 3TNUA 2E43A 5APTA 4B86A 2P2UA 2XU6A 5AW0B 5AW7B 5APQA 3M0AA 1OXZA 3P8MC 1S9KE 3HE4B 1GD2E 2H7HA 2Z5IA 5APUA 2XV5A 1CSBA 2W6AA 1GK6A 1GTWA 5AVQB 3V4WA 3M9BA 5AVTB 3UIAA 3V4QA 3A2AA 3HE4A 1MFZA 5APWA 2W27A 2Q7CA 2YNYA 2YO2A 2ZFCA 3T97A 4JYCA 2IPPA 3A7OA 3KDPB 5AVXB 5APXA 4DZOA 1T2KD 1KQLA 3VMZA 1HWTC 2QM7A 1MV8A 4HYTB 3B8EB 5AVVB 2E42A 5AW2B 4I2LC 5AW5B 4RESB 3SWFA 1G2CB 2WPQA 3MGNA 3HE5B 2C9LY 4I6MC 5AVRB 3WGVB 2R5DA 2WTYA
chains in the Genus database with same CATH superfamily
2BCCJ 2XWBA 1L4AD 4JFDB 3X14A 1WT5A 4P4RB 5CMAA 3P0VH 4AGOA 4RWYL 3FMGH 2KP8A 1X7QB 2OTLP 1S7WB 3HTLX 3QWRD 4HAFA 5CD5D 4D0BA 3CXHJ 5BUAA 4OF3A 4NZTL 1PGJA 1ZXGA 2BNQD 4PJBB 2X0UA 4M1DL 4UM9B 1W6LA 1ZR2A 2HLFC 1NEPA 3CDZA 3L5IA 3DV4A 4GRLB 1N7MH 4BYHA 4ONGH 3WTVA 5E6YA 1VGEL 1MRCH 2AFNA 3V10A 3IFOB 2FY8A 5FO2A 5FYJE 2H6PB 2E56A 4NRZA 2EE9A 2EO1A 2EVGA 3JWOL 4JPQA 2W6JH 3KCWA 1R5WB 3Q6FA 4NGHH 4RGNB 3GUTB 1QBLH 4O58H 4ZI8A 3VD2A 2DEXX 4LQ1A 3BWZA 4L1TA 4FQJL 3PRJA 5FLUA 3A0BH 4FQQB 2X88A 5F7YC 4Y5YA 3BP5A 4FADA 3UYRL 4FQ1H 3AE2C 3ESOA 3WNLA 1S9VA 3ZE0E 1SLUA 1HEZB 1RY3A 5CSZB 3G04A 4HQQH 4MJ6B 1IAOA 5EF0A 3LQMA 3GJFA 5ETUA 3BKCL 3RWDA 1JHKH 2GCYA 1Y1UA 3LKPA 3Q3GB 3QG7L 4GRMB 1VQ8P 4D2NA 5I76B 2OTWA 2VXUL 4YUEL 4Y1AD 4DVRH 1WZMA 3D70A 3L70G 1QBBA 3HE7D 3T6WA 1EHAA 5HHPA 3MV9A 4X5WA 2CPCA 3X1BA 1F1DA 2IFNA 2FX8L 4X9FA 4ZW6A 1DCLA 1I8KB 2PXYD 4PRHD 3RK3D 1OL0A 3CXHH 5A16A 2G3MA 3KXFB 5E2WH 2X4QA 3ELQA 2EYRB 35C8L 4PV1C 3FZUC 3K46A 1T2JA 2APSA 2NY4D 1RH8A 5KJ4A 1CS6A 1QLFB 1TOXA 5TDPB 1M56B 2F8IA 5FYKU 3VWKD 4BV1A 3N9GH 2W8ZA 1FHNA 3ELAT 3H3BC 3HE4B 1GD2E 3EH2A 4IDJL 2AANA 4JKWA 4QRTA 5A2KH 2EYSB 2Q86B 2J59M 1KILA 1CT8A 3DURA 5FDYA 3LXBA 4LKXA 1R24B 2YUXA 4MDRA 3ZTNL 2IBBA 1WCBA 4U1LA 3B9AA 5DFAA 2PO6A 1XGZA 2WVSA 3CN3A 3KJ6H 5GTIE 3O4LA 5LAXB 4QOKD 3QWOA 3TASA 4IK7A 4K23H 4OFKA 4D9QE 4ZAKD 5GRUH 1KNOA 2E42A 1C08A 1I1CA 4KWUA 1A1OB 4G2AA 2GBTA 4JFSA 1FZGA 1DX7A 2A38A 3D2UA 3HIZA 1P69B 2KZIA 1IILE 3V6ZA 5HPOA 4ABUA 4N1CA 3WIFB 1JXFA 6PCYA 1TTUA 5JHLA 3ARFD 1G4RA 2J71A 2L7UA 3VSQA 3LIDA 4BWWA 1OM3H 1IV8A 2OR9L 3LZRA 3S9DB 3BO8B 5GPRA 1NDMA 2MJZA 4OQTL 4Z76B 4AYEC 2FYUD 5AZ2H 4Y2OA 3MN8A 3L45A 2L7JA 1X6LA 1AVAA 2UVEA 3APNA 5IROC 1BXXA 5E94B 4I5BA 3O0LA 4QF1A 3MLPA 5IVXB 1SY6A 1NMCB 4JG1H 1U8LB 4BFBD 2BP3A 1AQ5A 8FABA 5J11C 2NXYC 2F08A 3MUGA 4PJXA 2ZP8A 1IAKA 2ZKHL 5FO7A 3RNKB 3WEOA 2OCCB 3D3VD 2FIKA 3LEXB 4YBHA 5KSBB 5IWLA 2OK0L 4L23A 4DK5A 5B38G 1X5JA 1C16B 4N78E 4L8SB 3V0VA 1CGSL 2FJUB 4HAKA 1P84I 2EDNA 3LIZH 2OSLB 2CHZA 2NZ1A 4PP1D 3GBML 1NIEA 3T2NH 1N2RA 1X5HA 3MFFB 4OZIA 2W90A 1C1EH 5C0IA 3EFDL 3FSAA 2YN3A 3S37L 1VJSA 2ZNWA 3SD5A 3WSQL 4JX0A 1P2CA 3L3GB 2DQCH 4BA8A 2WBXA 1IFHL 4Y8DC 1BJMA 4G72B 4J4PC 3SDCC 1C5DA 3HRPA 3RURA 1XD0A 4B50A 4BWUA 2YPLD 4JY5L 4GXVL 2YQBA 5M7QA 4IIQC 1DFBL 1ZRUA 4PJHE 2JLPA 3PFUA 4TUOB 5BRZE 5IHBA 1L7TH 1V7ML 3ZMEA 2ADYA 1A02F 5IEKB 3BDBA 4MJIA 1NC2B 1UG9A 3A0HE 1HSAA 1GJUA 1KIRA 1JZHA 1RUAL 3K2MC 1S7TA 5GGQH 4BK5A 5FWRA 4ZO9A 4OJYA 1DE4B 3UTTD 2WBWB 5FF6A 2D3JA 3PIQA 3LD8C 3U0PA 1DQTA 3CZFA 4OZGF 4OGQB 2EIZA 2ZXBA 5M95B 1NAMB 1TENA 3OPUA 1DVFB 2QDWA 1BD2B 3H9SD 4R2GC 1JPFA 1WAAA 2VDOB 1UZ8A 2CDEA 2Q7NA 1PY4A 1KXQA 2R29H 4OSUH 4CVXB 4BKTC 2YD8A 3LQAL 3OSVA 4N0CC 4UYQA 1ZLEA 1FO0B 4D0CA 5I2IB 2W0FA 3L4YA 2VMDA 1S5IH 1BMGA 1KQLA 1GGCH 3S34L 3H1HE 1FRGL 1YEWA 2XIDA 3MRJB 4ORZC 2VE6A 1XR8B 1G9EA 4YGVB 3MV11 4FYTA 5EN2A 1GC1L 4IMLA 3HZMB 4KI5E 2IG2H 1FZKA 3UTPE 2AV1B 2WB7A 4UT9H 3CX5I 5EUOA 2CMRL 2FATH 3EH5B 3E9UA 4DH2A 2AK1L 2G9KA 4R7LA 5HDLA 3H6AA 1AYOA 1D5IH 4YBQC 5DTFA 3ISRA 2OMXA 4NHCH 4ZS7H 1NWQA 5ESVA 4U6YA 3L9RB 5D2LA 3FFOA 1A6WL 1JY2P 3MRBA 3V7MA 4CBPA 5FKPA 2L3BA 5HVGB 4KGLA 4MMZB 5LHDA 1RZ8B 2O5YL 3O81A 4YSAA 3FF7A 2VZ1A 3IRCA 1MFNA 1UWGL 4UQ9A 5EA0L 3PWPA 1HNGA 2R0WL 1JGVH 3WEXA 1CQKA 1VGEH 2QPSA 4KI5C 3LHAA 3AM8C 2Y1YA 2Y7QA 2GJ6B 4UNIA 1R5VA 3K8MA 4WWNA 1E4WH 3ZN6A 5I1LA 1CO1A 5DMYA 3S5ZA 4AIZB 4QXTB 2JB6B 3GXIA 4PJEF 4QTIL 1OAUL 4N2KA 4PP2A 2VR7A 3EYVA 2M5AA 4AW7A 5KYWB 4U0RC 4HUVB 1T1YB 3RTQA 3H2PA 4FQJH 4U1MB 1TQTA 2V5RA 1CI6A 3SCMB 3W39B 4G83A 2ZIDA 2DMCA 3WIIL 2BVEA 3C5XA 1GZLA 1BAWA 3GK8H 1BEXA 4U1KA 3UAJA 2Z31B 5DJYA 3L5WB 4NT6B 3TEYA 4GI9A 4WWID 1BWWA 3CFBA 5D1ZA 2IMNA 3CDCA 4XRCB 4HIEA 1H6UA 4EI5D 4JPZB 3HAEA 2ZZUT 1E2ZA 3BLBA 1VSCA 4AOFA 4MCYA 4K7FA 3SBWA 3QIWC 1DQQB 5SWQA 2EDKA 3QXAB 4AV5A 1JL8A 1GK4A 3P3YA 3US1A 3LRMA 3V4VL 4Z7IA 3GM8A 2Y2TA 1DTUA 2VLKB 3Q43A 2FBRA 2IGLA 2R0KL 4GW1A 4N2IA 1IEAB 3L75E 1JZDC 3Q2WA 5DRXB 3RX8A 1KG0A 4HCRA 1Q94B 2IANE 1XIWD 2OJ1A 2H89C 3FUHA 1L4IA 4PJ9D 4QHKI 1QEWB 3NJKA 4R4BB 2HCZX 3T04D 2J1KA 2ZT9D 3D85B 2CRMA 3BQUD 5HDOA 3TNMB 5KSVB 3CJJA 4X0NA 2J2ZB 4B27A 4QNPE 2BSEA 3L3OB 4JFOA 1LP9B 3MV8B 1SF5A 4HBQA 3D25A 4R26H 3ZTNH 2FK9A 1Z1WA 4POZC 1U8PB 3EO0B 4R3SB 1S7XB 3CBKB 1NPNA 4BBWA 3BZFA 3N1PC 1MDAA 3HC4L 3FXEA 1DVQA 1XZWA 5TE6L 2WSCJ 1N59B 4D7BA 3EUDA 3OJDB 2FSEA 4PI2A 3QRGL 2V7NB 4JRXE 3DX4A 1TTBA 2CIKA 2NPSC 4M7LH 1SQQD 3MNZA 2G0KA 3F7PC 3QJOA 5E9DE 2NYYC 1AIFA 2V9TA 5ACLA 3GHBL 1NU1E 2V3DA 2F7OA 4FHBD 1SJMA 5CEZL 12E8L 3GSVB 1ET5A 3TIEB 4Y9CA 1XDTT 3DKHA 4G59C 4G7YH 3KBFA 3T5WA 5SX5H 4CKVX 3KH3A 2JE8A 1ZP0C 3AY4C 1TVBA 1YDPA 4Z9KB 4NQED 5EZIL 3V7AG 3VYOA 2CK0L 3A5TA 2IADA 2OR9H 4GEJA 1T66D 3ECQA 4GW4A 2R3CA 4Q8BA 4UQDA 3AT8A 3S8GB 3ME0B 1I7RA 5I1CL 1A3LL 4UM8B 1I1AC 5KAFH 4XOAA 2QE7H 1NCDL 5D1QA 5FGBC 4Y9EA 4G8EA 5DJ0B 5BOPA 1RZGB 2MHAA 3FL7A 2SEBA 4FI8A 3RGVB 3BKJL 1S7QA 3NCJL 5AAWC 1U57A 4FL4C 1CURA 2ZVNB 2LKMA 5F6IB 2VXTL 3I6LE 3TBBA 2YAPA 4PY8I 1BCCE 3ML8A 1U3HD 1MEXH 2ZKHH 3K5RA 4XVTL 1ZGLP 2F53D 2FXPA 5IK3B 2OK0H 3WIHA 3F7YA 1TVHB 2R7EB 2WSCH 1KGWA 2VLME 4HX1B 4C4UA 4F9LA 1CGSH 3ULUE 1KXTA 4M6OL 4PI0A 1OWWA 3QCVL 1PS3A 2NY3D 1UXSA 1Y6KR 3GBMH 5JW5A 1IC1A 3PABB 2QGBA 2WCGA 2XG4A 3EKCA 4FDWA 4M5SA 4WWKA 4C4KO 1AKJD 1SZNA 3EFDH 4NC2B 4OQ1A 5BZWA 3S37H 4F3FA 3C9NB 1YEKL 4N8VB 1AE6L 5HHVL 2WN3A 2ZD0A 3WSQH 1OOAA 3RA7L 4S1DC 3NGBB 2Q6QA 4PD4D 1IFHH 4JFZH 1SJXA 4NO0D 1XEDA 1TZGH 4JRYD 4UAOB 1UJ3B 3GW6A 2VZVA 4JY5H 4GXVH 2HPCB 5IMMB 4OFYA 3GT6A 3WUUA 1MXGA 1P5UC 2Z4TA 4Y4HC 5EC2B 4QO1B 3WTWA 2NTSP 3PL6B 4NO5B 1BM7A 4QRSB 5JIMA 3TZVB 1BBJA 4EEEA 4EKXA 1CI3M 2NMSA 4LSDA 4PCKA 4C83A 1MJJB 3SDDB 3ULUC 1P4BL 4BQBA 4CRPA 3NACH 2PR4L 1KJMA 1ID2A 4GQ9L 4QTFA 2BNRB 5B5EE 2F1BA 4XN1A 5TH2A 3TIDA 5KYYB 2UUDH 1KTDA 1H3PL 2FYNC 3ZDYF 3OKKA 3DSNB 4DZOA 2IXQA 2KYIA 5HYSA 3VWJD 1P4UA 3EFFK 3WU2E 3QEHA 1M1XB 4GG6B 3ABGA 3LQAH 1ZLVH 4O2CB 3BLPX 3F84A 5K9QI 3D0LB 2Y6TE 1AG0A 1TNMA 1TTGA 3PJLA 1BVNT 1KJ3L 2O1JA 3LZOA 2MQGA 2FXOA 3L73J 2CXKA 4JM2D 2VDPB 4JDVB 5E5MB 5HYJE 1GC1H 2H26A 2WSEJ 1RPQA 4PWIA 3B34A 3BP4A 4PW4A 1IGIL 3CXDL 3HPJB 4AQEA 3TH4T 3GSNA 5FYKL 2V5TA 4YDLC 5A3ID 1SOQA 1DQML 5DJCB 4LC1A 1LO5B 5HDRA 4WEUD 3HHSB 5FUCE 1XH1A 2D7PA 3MCKB 2GAZB 3C6LB 4HOXA 1X4YA 2FJGB 4LSRL 2DYPA 2WQUA 4JG5A 2GVYA 1GZPB 4WUUA 4X99A 2DICA 1OSEA 3RZCC 1A6WH 3TL5A 2ITFA 5I71B 3BZDA 3QFDB 3CC7P 4XTRD 1BX2B 5FDWB 3DC0A 2ESVB 2X70A 2UX7A 3TN0C 4JFFB 2AJXL 2AZUA 2NSMA 4F8LA 1NEZG 3FYEB 4JHZA 1G9NL 2EVHA 3BC9A 4OLUH 2GC7C 1TMQA 3EJQA 1CMOA 3IPEA 1OAYL 4MJ4A 5T1DH 5CEZD 2BPBA 4K3EH 3VACA 1TMCB 1OT2A 2XKSA 4WY4A 3V0WL 2FR4A 2I1JA 4KX9A 1QZ1A 3H1KE 2QJKB 1Z3RA 4V1DE 4Z7UB 4AUYA 1SLQA 2J5LB 3HUJE 2E9GA 3FHAA 4UZUA 4M8QB 4QTIH 5D5MF 5F7WC 5FUCC 4ALAL 3FT3A 4D3CL 1TG8A 1UXMA 4X6CF 4YXLL 4NKQB 2JFCA 3K3QA 5FM5M 4E41B 1DBKL 3O11A 2EZ0D 1FZCB 2A0LC 2WSEH 4NO3B 3WIIH 2FECL 1WE5A 4ODTH 5JXEA 4PJCA 3NCYP 4WHTB 2KSJA 3TGUJ 1NTKG 2CLVA 5AENA 4TSBH 2B20A 1EFQA 2F74A 2HR3A 1C5CL 4K71C 2FIRT 4U49A 4Y2DC 2I60L 1G4MA 3KR3L 1B90A 4Y19B 4PJEA 3IYLW 2BLFA 1W0WA 3MLYL 4NN5C 4F1SA 4G43B 1QO3B 3KDMA 5BS0A 2DWDA 1NKOA 3MR9A 3L08A 4MXWL 3QK0A 3LV3A 4KK5C 1KN4H 2ZUUA 5IB4A 5LCVL 2XWCA 5BZDA 1LE5B 1FORH 2W5PA 2ZYIA 3V4VH 1K8IA 3W2DL 2YSSA 2B1HH 4XAKD 4GAAA 4HZ1A 1Y8AA 2GITA 3TVMD 1SQVK 3W0WD 5I26A 2DZEA 1TSHA 4P5TC 4R4FL 5HGHA 5ERWB 4HWNA 2M26A 4FQ2L 3PF2A 1N64L 4LCUB 3FN3A 2IPPA 5K5GB 3MACL 3PJSB 1JGUH 2NY6B 1FG2B 3TSIA 3ZKQD 3A47A 3LKQB 4WK4B 4F2ME 3LXUX 1XCQB 3QA3B 4BZ1L 2W0KA 1YQ3C 3GM0A 1YMME 1OV8A 5ABZA 2XWJA 5LXGL 3Q5PA 5AW5B 2BNUA 2RFXB 1BCIA 2QFPA 5INCA 4DO4A 2Y7SA 4QRBA 1TQVA 5EO1A 2XY1A 2Y7LA 5HHNA 5CAYB 1AFOA 2JDIH 1NTMK 3DWTA 1FDOA 3HC4H 2H32B 5LG1A 3TT1L 3DRTB 3T65B 3H0TB 3AAZA 2IZ0A 2G2RB 1BE3J 3NG5A 4PLOB 3BGFB 4M1GL 1OVRA 1T22A 2UZXA 3VXUB 1JPGA 1X9UA 5H37H 4ABVA 1D5ZB 4K8RL 1FNLA 5CEZH 1N73C 4HUNB 4Z78A 4MXQD 4G9FE 4MQ7A 2ZYRA 3OXSB 5KVFL 1MCRA 2VLJE 3TO4B 3QCTL 3HTKB 3AWFA 3PWVA 2N1TB 1B6DA 1WS8A 2PCPB 2XRAL 3NIFE 4KO6A 2FQFA 3U6XS 3VM7A 4A2GA 5IP4A 1PZQA 4P2AA 3GJEA 1IM3A 1A3LH 1MW0A 1NDTA 1YEGH 1NCDH 4O2EA 1I7TB 4OB5L 3S4SG 2ENQA 5D7JA 1KY7A 4Z3EA 3L3IB 1LM8V 1JVOA 4BFNA 1EZVE 3GG2A 3PNWB 3UIZA 2XN9E 2CG9X 2FNBA 2IQAA 1RPKA 4AT6A 3O9WD 4PBDA 4WV1A 2VXTH 5I8KL 1CD8A 3RQ3A 4Z23A 1K6QL 1SY6L 1JF1A 2F5AL 5D93C 4YO0B 2H7WA 4XVTH 4C56A 3IKCA 5I1JH 1VZHA 3QUYC 1IC7L 4YOKA 2A6IB 2J6EH 1J10A 1IM9A 4M6OH 2F7IA 4DN4H 3VFWA 2E74D 1L9TA 2R5BA 3WN5C 3IDIA 4PB0L 1TZAA 4GY4A 4IDLA 1IBBA 1CK0L 1AE6H 4XBGB 1RQ5A 4XVUC 1MW3A 3RA7H 2BS9A 2TAAA 1ZTXL 1D6VH 4GXFA 4NZ8A 3FB7B 2XKMA 4GP5B 1Q8MA 4UV7H 3FFCD 4X7DC 3ES6B 4AYDC 1S9KE 4AJWA 4CSTA 2A4CA 1EXUA 2RALA 4NYLB 2PYEA 5C0EB 5KVEL 4WI2A 1E79H 3A2AA 1X9VA 2PLTA 2YEQA 3EGSA 1WT6A 4W9CC 1EEYA 4U1NB 4JL1A 2VQTA 4G6JL 1E8YA 1P4BH 1PEZA 3R19A 4N68A 3PAZA 4Q56A 5L0QB 2XNAB 5DUJA 1PGQA 3LRSA 4GQ9H 5AB0A 1W72L 1T2KD 1C5BH 4ODSL 1IVTA 3PWLB 2CUHA 3SQRA 4IOIB 3K1DA 1ZT7A 2P5WA 4PJGB 5DZLA 2OSYA 2E75B 1XF3B 2H2SD 3C8DA 4EO5A 3CMOL 2AK4B 3QDGE 3S36X 4YHOL 4OZHF 3AMLA 4KRMB 4YR6B 5AVRB 1S3JA 3UJJL 1S9KC 2BOBA 2R1YA 1KYAA 3MV9D 3SGDH 2VSMB 2HTKC 3WNOA 1A4KA 4TNEA 1JZ7A 4JPVL 1HKLH 2F0CA 1I3VA 2GTWA 5HHOD 4Z7NF 4IRSB 1T21B 2ICEC 3ARGB 5I6OA 5T1KB 3KYMB 1PMYA 1M7DB 2MJWA 1I9RL 2MRYA 4IOSD 1C9SA 4N5EC 5H2FE 5SWSE 1MFCL 1NZRA 3MRMB 3BATA 5FYKH 1M6OA 4AX3A 1PG7L 3S3JA 1P1ZB 3H9YA 4NO2B 2HT4C 4RSVA 1WBYA 3L3HB 1INEH 3AREB 3FAXA 3U25A 3P30L 1WK0A 1MVUB 1YYLH 2DY2A 2DTML 4LSRH 5LQBL 3M46A 4K7PX 5CGBA 1PVHA 5JOEA 4OF0A 3C5ZD 3ALPA 4JLRA 1CYXA 4KI1A 1H5BB 2HH0L 4L4TE 3UDWC 4J3OG 4M03A 3TS8A 4M5ZL 2E7DA 2PO6D 2AJXH 2DQTH 4J3BA 4GS7C 4YSQA 1OO2A 1QQDB 2JELL 3WTSA 1GHFL 4LLAA 1Z6JT 2WT7A 2JKJA 1S5LX 3O4LD 2IDQA 4YPGA 5L2KA 1INQA 1WVZA 3L74D 4Q58C 3FO9B 5E8PA 2A73B 3HE6D 1DO6A 3V0WH 4Y4FA 3MA9L 4FYQA 3AY2A 4AGPA 5ID1B 1IZNB 1PAZA 4WF7A 5DF0A 1PZSA 1ZK9A 2GFBA 4ZK8A 3JQOB 4ALAH 1FIEA 4QRRB 4DKDC 5MEOA 4LSVL 4Q4EA 4X4MA 4DVBA 4GSXA 1DBKH 5GGRY 4RRPG 2C7UA 4MAYA 3GIVA 2C1OA 1RFDL 2VDMB 2APTA 1ZCRA 4AQRD 4UB8E 2M3EA 1JJUA 3L4UA 4H8PA 4ADJA 4N22A 1YEDB 2WD0A 1E5YA 3M6DA 1DQKA 4MMXC 1D5BB 2Y2YA 3DJRA 5GGSA 1M1KQ 1MCWM 2I60H 3PHSA 1YVLA 1BQHA 2OQQA 2NY5L 3BVTA 3P4MB 5B8CA 5D5MA 5MHSE 3DV6A 4ANWA 4N6QA 3RL2B 4X6CA 3UL4A 3I56P 4DOHB 5KJ7A 4X7EC 2V33A 4Q6KA 3GJFH 4AKPA 2YRLA 5CJXA 4GRWB 1BOGB 3L74J 4N8UA 1CGUA 4YHZH 3O45B 2WPVB 4MXWH 4MAZA 5AVTB 2FBJL 3HNSL 1M7IB 4LGSB 4P5RA 4DGYL 1MLCB 4WSGA 4YDMA 1BDCA 3CFQA 2A83A 1CXEA 2CUIA 2QPDB 3D39A 1YCSA 4NRXB 3ZDXE 2H4EA 5T33H 5I23A 1R4XA 1CDJA 5E6SB 4KOCA 2GA1A 4A7PA 1N64H 2A74C 4OH2A 1DJYA 1KBBA 3GXUB 5IIEA 1XF4A 3FO2B 2R2HB 4HCRL 1R3JA 4FN0A 3S36L 3QZNA 2BSRA 1NFDF 4AQZA 2QZ5A 3NAAL 3WG7B 2IH3B 3CVHB 1MI5A 1URZA 4NQDE 2VZUA 4BH8A 3G7TA 1G7QA 4KGJA 3TBVB 3VXNB 4AYFA 5A2JH 5F7HA 5I8OL 4JW3A 4K9EC 4RAHA 4PY7B 5E2VL 3V9CA 4L8DB 4Y5XB 1FFNA 1GOGA 4XO8A 2IYOA 1JNLL 5D9SB 1RJLA 1DVTA 5DO2C 2WXMA 3MOAH 4MJID 5E6IA 3TT1H 3DX3A 4I0CC 4CBZA 1BDDA 1T1ZB 3VD4A 4PV1D 3C8VA 2A9CA 3VI3A 3WS3B 5LWYL 2H0PA 3ZTCC 2C3XA 2HN7A 1Y0LB 4K8RH 1VL2A 3SQBB 3H2WA 3NEXA 1A14L 4TQEL 5DD1L 5KVFH 2HWZH 3G6AA 1ZT1B 4I0PB 1HU8A 3B9DA 4PWEA 1RERA 3VE0B 5LGHL 1M1JB 5CCGE 3QO1B 5SV3A 1DDHA 1J0JA 4NN7C 2XRAH 3HE5A 2CU9A 2VDLL 3MBWA 4JKKA 5D7LE 1QG3A 3UGEA 3AROA 1HHGA 2FDBP 3CFDA 2H8PB 3CFMA 5JHLH 2Y9YA 4U3FG 1HHIA 4G70B 3DX8B 3CWBE 4LNVA 5EBLA 3VDCA 4EJ1C 4OB5H 1TJGL 1MCDA 4R96B 2PWHA 1G7MB 4ATWA 1WD9A 4PPTA 1E6OL 4G6AC 1GGYA 1VAHA 3ATBA 3HA0A 2VH5H 25C8L 4DQAA 4G6KL 5HXMA 5D2NE 3L2MA 5I8KH 4F37K 4LKCB 1K6QH 1SY6H 2F5AH 1O9ZA 1JWMB 2C3VA 3Q48A 1SUHA 2F61A 3MRKB 4HKZB 4E9RA 1HWHB 1ZS8B 1IC7H 3ARZA 1BVLB 1FLTX 4NN6B 5CCGC 4PS8A 4GKGA 3UPRA 4F33B 4ZMZA 3N41B 3P7KA 3WIHL 2WWKT 4PJ8B 3WBDA 4AMKH 4M43L 1IB5A 3CH1B 1H0DA 3AB0B 4YPJA 4M3HA 4QY8A 4ZXBB 2XU6A 2WTOA 1AQTA 1RF1A 3VXPB 1CK0H 2WITA 4O02A 2WMPA 1ZTXH 1OCWH 4M62L 1M4KA 2J21A 2VN7A 1RVFH 2VL4A 3ZDZB 3U46A 5IROD 4D9QD 3M9BA 1E7UA 4MD5A 1ZDQA 5KW9H 1OAQH 1EDYA 5D2NC 3MHVA 5DEJA 3ROOA 3MMEB 4UOW1 2FLBT 4LCCB 5B4MD 1PLGL 3O6FC 3BFWA 4YZWA 4N2NA 2APXA 3N04A 1N6QH 2BM3A 1RK1A 1WHOA 2W0LA 4MFHA 2QM7A 2A6DB 4J8QA 4YK4B 1PGOA 4GMSL 1YHQP 4A38A 1CDGA 3FULA 4PJAF 7FABL 2Q6WA 4P3DB 3V0FA 2V7QJ 3MV7B 3PWJA 4ODSH 3HUSA 4ZFOL 3UAJD 2SPZA 4I6MC 3HPLA 2NNRA 2FYUK 2D2CB 4DKAA 4WVZA 3G5ZA 1BZ7B 3CMOH 3QFJA 4L9LC 5GRWA 2ZOLA 1G2CA 43CAA 2GSGB 3RWIB 1N12A 1OPGL 4YHOH 1VQ6P 5ADPH 1R46A 4ASVA 4J4PD 2R3SA 1CU4L 3SDCD 5D7HA 4WI9A 3UJJH 3EWKA 1JMMA 3DMMB 4JPVH 1FCCA 3FPYA 4H1LA 1UQSA 3TURA 4QWWD 1G6RA 1U4EA 2ZQKA 5CD3A 4DP6X 2KHAA 2VXVL 4A2HA 4ZNEE 1LLAA 3O8XC 1OAZL 1NMBH 3PUUA 1T7YA 2NNCA 4N78D 2WVTA 5BOZG 2MKVA 2E76B 1X79B 4NKMA 4OZHA 1XSIA 1RQUA 4OM0L 4ZPVA 4RMWA 1WWCA 2I27N 1BFTA 4JPIA 2P5EE 3DX6A 5LQBH 1FGNL 3SO3B 4E9QA 3BDXA 4WW2B 5H8DA 3WUWG 2QPEB 3ZJAA 3VXRA 4WLCA 4H0GA 2TSBA 5TF1H 2HH0H 3VRJA 3KYOA 3TLRA 4N0CD 3BVNA 1M1SA 2Z7UA 3AZUA 4M5ZH 2V7QH 5K69A 2XLLA 5KAIH 4E2OA 2JELH 5BRZD 4LSPH 3VGDA 3BHBB 3AG4B 2JKTM 2C4XA 3EJYC 4P2RE 3RWJB 1C8QA 2VR4A 1N67A 5F88B 3TC9A 3FBKA 3CBRA 4DGVH 2EC9U 4WTXA 1F11A 2D0GA 3ZTJG 3MBEB 4I4WB 5FO8B 2VITA 1GS8A 5GISL 1P4LA 4KZDL 4C4KT 4F2EA 2J8HA 5TE7L 2DMBA 4X2UA 2JLLA 3NFNA 3OLIA 1H3VA 1X5MA 5DEGA 3QUMA 4JJ5A 3NCCB 2HG5B 4YBQD 2H1LM 1RFDH 3HB3B 3U9PL 5FIEA 2VXSL 5FYLL 4WTZA 2P1JA 1XMEB 1G1CA 4MB1A 3W9EB 3B5NC 5LBSL 5J57B 3II6A 2PP6A 3ECWA 5CR1A 5IREA 2EACA 1XAKA 4MAUL 2ADIB 1JZ5A 5J3HC 3H1HD 1ADWA 4E68A 4DJMA 3QQNA 2YQ2A 5SWZA 1FAKT 3PHAA 4Z3FA 2ZWLT 3OVUB 4Z0XB 4KI5D 3UTPD 3RUGB 5D7SH 2B5IB 3HNSH 3ZE2F 5ESAA 3DX9B 3HAEH 1ADQL 1NGPL 5I6XB 3DIFB 5EU5B 1AQMA 4DGYH 2YIHA 1EEQA 3ESUF 3C09C 1RURL 4Q6IC 2FD6L 3VI4F 4JFQB 1OTSC 3E1F1 3FQTA 5GJSH 5DD3L 3US9A 3BSGA 5IJKA 3CCEP 1ZPUA 3ZMNA 3E80A 5LUMA 1GOFA 4R84A 5LGYA 3ZIMA 5L8JB 5KBMA 2YUVA 3PAYA 1JNHB 3DPBB 1U8QA 3GMPB 2X3AA 3VMPA 1NDGA 3E6FA 4MVBD 4WWKD 3V7AE 4MZ3A 4Q9QL 3LSOA 3G9RA 2VB5A 4PJ5E 5F8QC 1DBBL 2DTSA 3ECBA 4OKVA 4UF7C 4UZSA 2ZSWA 1CTNA 3D2TA 3OC5A 4XT1C 4NBYB 4I18B 3S36H 1H88A 3DXAE 5DLMH 5FV2A 2WO3B 2WY3B 1KB5A 4Y16C 2O61B 2ETWA 2YBGA 3B6SA 4P59H 4S1SL 4Y1SA 5I8OH 1E27A 3DO4A 3M9QA 3D6ZA 3QIWD 4TPRL 5DRWA 5E2VH 5E6UB 4ZUTB 2DQMA 3RFZA 1FFOA 1JNLH 1A7BA 5ACZA 1MNNA 4R7DB 5I24A 3PE9A 5IM7A 4B9JA 4GUQA 4HPHA 3H32A 4F7TB 1O0VA 4APQC 2B9BA 3U6RB 4IEFA 5LWYH 4JO4H 2J5UA 2PW1B 5KLVG 2ZYGA 1NFDA 4FAAB 3LHPL 1AD9A 4MLIA 4AC2A 3OLDA 4Z0BH 1FNSH 4F93B 1HZHL 4GIOA 5DSCB 3BRDA 3WTUA 2OTPA 3IEAA 1SYVA 2NUTA 4AQ1B 1HJBA 2IGFL 2YD1A 5C0AB 1Z9SA 5LGHH 3GI9L 2WXNA 5ILTH 4NAQA 1FL3B 2VDLH 4GMTH 1URQB 1FZMA 3JZ7A 3LRLA 3QI9B 4GYBA 1E3FA 5KG9B 2VWEE 1DQVA 1QSFA 5EH1A 1OP4A 1QRNA 5E2UH 4FXKA 1M05A 3PHQA 4PSRA 1ZLWH 4PGCB 1LILA 1TJGH 1J1OL 1YEHH 3T97B 1L9QA 4U0QB 3RY6A 1E6OH 4FQIL 1LD9A 4H44B 2AS5M 25C8H 3F6IA 3WXWL 4G6KH 2NPSD 3L75D 4IGBC 4P5KA 2UVFA 5CJ5A 4W7YA 5CZKA 4PR5B 2JQAA 3CSPA 4MCNA 1AXSB 5I73B 3HS9A 3S0PA 2E3VA 1K4DB 1W6WA 4YHIB 3RBZA 4LNRA 4P57B 3VG9C 3PP4H 1R6VA 3HR5B 2OP4L 3ZDWA 3D71A 5BV7C 5AW7B 1FH5H 1B3IA 3QE5A 1OP9A 3WIHH 2OL3A 6PAZA 4JB9L 3FPXA 4M43H 2VWEC 3ARDC 1CGTA 3BN3B 1DYZA 4HJEA 3US0A 1V05A 3ATDA 2X40A 5E8DH 4YZFE 4XZUA 4D6TE 3QORC 3V2QA 1BM3H 1E4JA 3C8HA 4YH6A 4YXHH 1NPJA 1A25A 4JRXD 4EUPG 5DZNA 4E36A 2OQJA 3EJZC 1SQQK 4PRIA 5E9DD 1B4TA 1R5SA 2B4CC 2ALAA 1NU1D 1W5CE 2GJJA 3L4WA 3QQDA 2ED9A 4FXGB 1S9XA 3FCGA 4MNGE 3CFEA 1XEUA 1QLRB 1ZHNB 1K3IA 1PY9A 4BSVA 1NCGA 4XX1G 1ZLVK 1AZVA 7FABH 5D1XB 3RILA 5KLIB 4DZ8B 3D07A 2QQLL 4ELDA 3ALWA 4X42A 5DT1H 1CFTA 1NTKE 3HS0C 1M7LA 3CSBA 3DO7B 3VUAA 1VHPA 5IMKA 3D4GA 1IFJA 5I5RA 4HK0B 5I6PA 5ISZB 2W91A 4UOZA 3JWDH 4S1DD 3S3DB 1Z9MA 4I85A 5IVOA 3X12B 1CU4H 3DBXB 1NGXA 2NCMA 1XV8A 3BAWA 5HJ3A 4HIIB 3KPPA 5I8EB 1HH0A 3P73A 3U36A 4Y4HD 4MB5A 3RGUA 1IAII 2FQEA 3I6LD 1BCCD 3CSYB 5C0NC 1I3UA 1GL2C 3OLEA 1AGFB 1N8OE 2DQUL 2WCPA 5GS0L 2MNUA 3RWEA 1Q0YH 5L8RJ 4QRPB 2KIKA 2VLMD 1TZIB 3ULUD 3FRPA 4TMPA 2PUQT 2OYIC 1RU9H 3PGDB 4YHPA 5C08E 4APXA 3KPOB 3VFTA 3U0WL 4M29A 3VSUA 2JWDA 2BFGA 3QJRB 3GSNH 4HC1A 1O6SA 2VMFA 4LLWA 3IPFA 2P7JA 1I9IL 3HLAB 4GKNB 5C86A 2E7LA 3BEWA 3ABKB 3KPTA 3TCLB 3WGUB 2WPSA 4PD4K 2JCCA 3SDAD 3P9WB 3NFSL 5AB1A 4FOMA 4DCQB 1JCVA 4JQIA 4M4RA 2ZKXA 4EQ3A 1L5GA 4PS3A 2VMEA 4PWJA 3KPSE 5K9JL 4LEBA 1ZN5A 2OI9B 4L3AA 4EDXB 1BCCJ 2Z9TA 1JBJA 4OLWH 2XKUA 2XCMC 1DDTA 3T0EC 1G0DA 4AL8C 3P9LB 2H47C 5B39B 1MY7A 4MD4A 1RK7A 5TK4A 1GU5A 5KYXA 4UQBA 2XZAH 3PQYB 1BIHA 1N0LA 5TE7H 1UD6A 5ICYB 4WKZB 4LESA 3O6QA 2ZOWA 3AS2A 3B1UA 2XV2A 4P23A 5AW0B 3H1IE 2O1AA 3M1BA 1F56A 2NUPA 4YDZA 5JHDA 1VKXB 2BHYA 1LNQA 3U9PH 4XP9H 2EICA 4JFDE 4NNXA 2VXSH 5DD5L 5FYLH 2O4EA 1OGSA 1F3JB 4R4NC 5CFHA 2VDKH 1L7IL 2BC4B 4IM8A 4MWFB 1YUKB 5DJAB 4JHAL 4LPWA 3ZW3A 3TN0D 1ZOXA 1IC4L 2OTJP 1WC7B 3TBYA 2QVMA 5D7JD 3JT2A 4G80B 4PJBE 4XBEH 5HYJD 3PYCA 5JQIB 3IDGB 3ITKA 1I4FA 3V4PA 3I55P 1S9WA 3UG4A 3B8EB 3UJIL 1NGPH 1DBAH 1ZJAA 4NRYB 3T4AC 2DKSA 4YE4H 4IRJB 2ARWA 3KPRB 4C56D 4NSKB 3QIBC 2FD6H 1AD0A 4G6FB 2Q7YB 5F1NA 2Q8BL 2C26A 4HIPA 1PNDA 2DMKA 4IU2A 2PPCA 1IM9D 2GK0A 1H0TB 9CGTA 2A0LD 4MD0A 1N8RQ 4R97C 1KIUB 5L88H 3VVVA 4IMKA 2H2PC 4BM7A 1A4CA 2I07A 4TSAH 4LCWA 1PSKL 4Q9QH 2ICES 4CU6A 4JAMB 4A2FA 3Q5RA 2GTZB 4Y2DD 5EWIL 4L8CA 4Q2ZB 2V9UA 4Z7VA 2XFXA 4CW1A 2UY6A 3AE7C 1QZNA 3CSFA 4FYSA 4DKTA 3QDJA 1EQWA 1K4CB 1ZHKA 3G4SP 5DJXB 3TXAA 2KB7P 2K9YA 4PJHF 5E8OB 3FU6A 4HIHA 4AK2A 1KLFA 2XWTB 5BQDA 1HI6A 2BO0A 4GIAA 5DC4B 4DCKA 4TPRH 4NPFX 1NIBA 4HHAB 5F2FA 5I5JA 4KK5D 3H1KD 2P43B 2UWEB 2XWRA 3FOMB 4V1DD 4X7TA 5CSBA 5KYUA 2ADGB 1IFRA 4NPDA 4XB7A 3TH3T 3QAQA 2G5BB 2NNAA 3MJWA 2K8QA 1T5XA 4D0DB 1A4AA 2X12A 1OT4A 4NWUL 4P5TD 2H3XC 3LHPH 2DM2A 2IAMD 5C0GB 1FDLH 1LWUC 2NR6A 4GG8B 5A2FA 3LEYH 2F8OA 2CE6A 2IZ1A 5CMZA 2APVA 3GI9H 2J8UE 3CX5H 5HDQL 2ENJA 3FU0A 2I25N 3UTSE 2POHA 4XE5B 2QSCL 2Y69B 3OR6A 2LU3A 2AHIA 3K2UH 4HBCL 2YLHA 2EUVA 1F4WL 1OGTB 4XMPL 5GS0D 3INUL 1NCBL 1X7SA 1J1OH 4GP8B 1UB5A 4EIGB 4K4KA 4NZDA 1YPZA 1FJ1B 1XR9B 2X4PA 1XGRB 4PJDB 4FQIH 5I1HL 1AR1B 4FI7A 1FHGA 2OYLA 5FGCE 1MXDA 3UXFA 4TLSA 3OZKA 4F7CA 4F7MA 2XZRA 3U59A 3WXWH 1ZTMA 2VRQA 2C8NA 1HL8A 3MCLH 5HP5A 1MKMA 5APQA 2OYHA 3VXOA 4FQXC 2AJ3A 5DU7A 5IJVA 4S2SB 3BIBX 5BRQA 3SJVB 4EN2A 3UZEA 4XWOD 4FYRA 1SHMA 1YQ2A 1ODUA 1GTWA 1IFIA 1F2XK 1DEBA 3B43A 1YMMD 1E5BA 3AQYA 3ATEA 2TSAA 2Y06L 4QHKJ 4KQ3L 4JB9H 4X5QA 3Q8AA 1G1OA 2QKIB 1DQJA 3L3DB 3TA3A 2I7OA 4JZNA 5C0BD 5E56A 4LF3A 4OFQA 4L4VA 1NBZA 2W88A 4U1HA 1TU3F 2P48B 3WUVA 2BVPA 3KMDA 4OU3A 1LTSC 3PH0A 1JN6B 1SJEA 1L2PA 3T9WA 4FTVE 3LAFA 4JFEE 4U6XB 4Y4FD 4XH2A 1LK2B 5FFOA 1WYJA 2FZ3A 3ARVA 3P77B 4GBXA 1NCTA 5AAPA 5GS1A 1XXFC 4G8IA 2HVKB 1UM5L 4HWZA 3N43B 3FB5A 3LCYA 4G9FD 4F7KA 1KYUA 2APWA 4JO3H 5FOJA 1PKQE 1VQMP 3FT2A 3QUYD 2ITEA 4MAYD 5DVLA 1IGJB 5I0DA 3R4RA 3NJGA 4K35A 1UM6L 5IHUH 1CFSA 3KZ8A 1I3GH 2QQLH 2W6BA 2MQ0A 4K15A 4N2EA 2YFNA 4J3OC 1FN4B 1FVCB 3E38A 3ARBB 3FHEA 1X7QA 2VW6A 1S7WA 5CUSH 43C9A 3DVNB 3IAPA 4NQSB 3BCCJ 2WSDA 2Q7AA 5B3JE 1L0LD 4KDTA 1EZVD 2BSDA 3U4EB 2WBJC 1PL5A 2XN9D 4GRLA 4MYPA 3HG1B 1NCWH 5KVDE 4LLUB 5AVUB 2G8YA 2QBWA 3SKOB 3KQGA 2C9NY 3CFJA 4CC4C 1SQVG 1IO4A 5EULV 1R5WA 2DQUH 3KM2A 3GUTA 1KIPB 1YN6B 2VDQL 32C2B 5AVZB 1CR9L 2YEZB 4HFUL 3I5CA 1MG3C 3GSQB 4UM9A 5TPWL 2YD7A 4N85A 4UMSA 1IFMA 2CR3A 1ID5I 4QNPF 1T7ZA 4EN3B 3TJHC 3MBXH 2Q76B 3PXHA 3ASOB 1U6AL 1HEZA 2ZYSA 5CSZA 3ESMA 5I0ZA 3QJFB 1YZZA 5CGTA 3QDME 5DC2A 1A8ZA 2CDFB 4DETA 4XP6L 5MEQA 3Q3GA 4GRMA 3NFSH 2XFGB 3QHZL 4FNQA 4XNMB 5A2IH 3O3EB 1L0LJ 1NTMG 2YPVA 1S9KD 1K04A 2HTKD 2LQRA 5BQ7B 3RK2B 5F6HI 3FW6A 3APFA 3WNJA 4Z7OE 4UTBA 3PU7A 1RKRA 1GGBH 2VL5B 1EBPA 1I8KA 3N44B 1J0ZA 1TTRA 1XAUA 3C60B 3VYPA 3KXFA 3OPZL 1ZT4A 2EYRA 4EBQL 4UTAH 3IF1A 5CR8A 1I85A 1I31A 2PW2B 1NCAL 1X5LA 1SQXJ 2VSDA 5TDPA 1PTZA 1QLFA 2HT4D 2OYKA 3FC8A 5DYOB 1ZHLB 1SQPE 2JJTA 3GJFK 2ILLA 3HNTL 3HE4A 4HG4J 4RSYA 4XCNB 4A1RA 1VF5B 2AZAA 2EYSA 2WQYC 2Q86A 4KKQA 4HZLB 3MODH 1R33A 3G71P 3QUML 5INDB 3TV3L 1L7IH 4HKXB 1UVQA 2M2DA 3RJQB 3UYOD 4U3FE 1YIJP 2JKWA 3DYOA 4JHAH 1CICB 3S1KA 1J8HB 5IMOB 2EIDA 2R4SL 3OAWA 2XX0A 3H7LA 3KLQA 1J88A 3IDNB 4A2LA 3H6PA 4S10A 5LAXA 1VESA 3CSGA 5E9AA 3L72J 5AWNL 4KQ0A 3ZL4L 1I7ZB 5SWSD 3VH8B 1NFIA 3UJIH 1E3ZA 4QJ4B 4DSYA 1A1OA 5D6DC 2ZAIA 1XGTB 4AM0B 3ULUF 2P4AB 2N56A 3CD4A 3B7SA 3N42F 5FA4A 5HHMB 2R83A 4FFWC 1AQ8A 1R3KB 1WP6A 4ONFL 1ZLDA 3F83A 4PRAB 5JTWA 1QASA 4HIJB 1AYRA 1GZHC 4L4TD 4IIQA 5FKAA 1RJZB 2HT2D 3B8SA 3OHXC 1PFOA 3GXTA 4FI6A 4MMZC 5EWIH 3BO8A 4XVJL 4ZNCD 2MPAH 4Z76A 2C9UA 2QADB 5TISE 5DI8B 3QUZA 4FCHA 4Y5VC 2YXVA 3GTNA 3PHLA 5IVXA 4M3LA 3EJPA 5B3NA 5IB3B 4BHUI 4JPSA 1AHWC 2D2OA 1WUZA 1J11A 2CKBA 4NM4L 4QAWA 1OLZA 4AJYV 1B0GB 2Q20A 1II4E 3LIUA 2COQA 2V17L 4XPFL 3BISA 3DECA 3QYMA 1GYWA 3LEXA 3BIKB 5KSBA 4ZFFB 1HE8A 3MNVB 4L8SA 2ROYA 4HFWB 4OAWB 4EXKA 2YMXH 4R6UA 1BZQK 2GHWB 1KV3A 4HLZG 3GMNB 4EZKA 2WSKA 3EAKA 4LZKA 2XC8A 2CHDA 1D5MA 4ZMYA 1P5VB 3L3GA 2QSCH 4TNWK 4R4MA 1X0TA 4XNYL 1TIUA 5E79H 3BQVA 4HBCH 1F4WH 3KLKA 3INUH 3MUJA 1KEMH 1GSMA 3HZKB 3VD1A 4NS0A 3O41B 4TUOA 5I1HH 3TONA 2MPVA 2Q0ZX 5IEKA 2BHUA 1PZ2A 2CQVA 5FCUL 5JXAL 1ZGLB 2J8OA 4W70A 2H7HA 1E90A 2M3BA 1TU2B 5DR5H 2Z35B 2R69H 4RCAA 3EBIA 4OR1A 4YL9A 4MA1B 4LFHD 1DE4A 1HT6A 1JGLH 5LXVA 3O2DA 2ATPB 2KC0A 4GPVA 1NAMA 4M5YL 1BD2A 4KXBA 1UWFA 5D4QA 3L3OC 2CNYA 1GDTA 4NQDD 1QLED 1P7QD 3TX4A 1FDMA 1LO3L 5EFIA 3BVXA 1DLFH 3EO9L 3MCYA 4I7ZB 1EHKB 1D9KC 1KB9E 4NHUB 5I2IA 2NX5B 3QO0B 3MRJA 3F7VB 2WIMA 1XR8A 2KPNA 4G6AD 4O02H 2QJYC 5IEHB 3HZYA 3HUJF 1LEGA 5E24E 2AV1A 1W91A 1LGHB 3TBWB 2BCCG 1UM5H 3LEVL 2JK5B 5C9JB 2Z65C 4JY6B 1ZANL 4H0LB 4K5MA 3SHSA 4HA1A 4FE9A 2PPFA 3A4DA 2EDOA 3TK1A 3QYCA 1N2DC 2Z8SA 3W67A 2RQEA 5ANMB 1UM6H 2KUTA 2UZYA 3C6SB 4IRZA 5J6HB 3L9RA 2IDFA 3ILPB 1VCBC 4UUJB 3H3PL 5C0CB 3BPCB 5AOKA 2DQGL 1OSZB 5BVZA 4Z7WB 3CWBD 2X2JA 2BIMA 2VN6A 2QG4A 1H8NA 1RZ8A 3NIGB 2BJMH 1L3NA 1T5WB 2W9EL 2FT6A 3H55A 4WAFA 2ATKB 1QSVA 3OAUL 5SWZD 4ATTA 5FECB 3KLDA 1WSST 2WZPD 4R0LA 3G6JE 4RAUB 3GPSA 1S7RA 1JDAA 2Q2LA 3SY0A 2GJ6A 3DRQB 4F92B 3O6LL 1TFHA 3O6FD 1P7BA 4GEIA 2HRPL 4H8HA 4ZKUA 2IFMA 4QXTA 2JB6A 3W56A 4H1LH 1RHFA 2E9IA 5JLZB 3ARYA 5KYWA 4HUVA 2VDQH 1G6RH 1PP9D 4Z3IA 4HFUH 5C3TA 5TPWH 3SCMA 5KTEL 2G3AA 2GI0A 3FQRB 4A7QA 1ZSHA 1YYMH 2WW8A 4AKOA 2BNRE 2P42B 4Y99B 1JHTB 4UV4L 1GJIA 2W81C 2Z31A 2CO6B 3NJXA 3GEFA 4XRCA 4LIQL 2IPKB 2OMWB 4U7JA 1CGVA 4K3JL 5EMYA 2K1MA 2FYYA 5FA3B 3L2NA 5GHWL 3HG2A 3SKNB 1NBYB 2LAAA 3E3QE 1K8DA 3N6YA 3QXAA 3K5BA 1UD4A 2CGZA 5CMAB 3T2PA 5F7EL 3CFCL 3CK0L 4A2DA 3AY4A 2K7QA 3OAYH 3FQWA 3O8XD 4EBQH 1XVSA 2VLKA 1CFNA 3SDDC 1NBVL 5KLVE 1IEAA 1PP9J 1I1AA 5F3BA 5DRXA 1RCYA 3MDJA 4IL6H 4UT6A 5CP3A 4BCYA 3RHWK 3Q5OA 5HD8C 4R4BA 4KRNA 1QEWA 4O51A 4TUUA 4YHNA 2QEJA 2O6PA 3L95B 5KSVA 5AAWA 2J2ZA 2YRPA 1WBZB 1WO2A 2N4IA 3QUMH 1G7JA 3QEQB 1LP9A 3MV8A 4KAQL 5HBBA 5IB2B 3L48A 1V3JA 2BERA 1TQSA 2G5UA 4WHDA 1QRND 2ESVE 4TKWA 3EO0A 4R3SA 1S7XA 3E3QC 2R4SH 3G5VB 4V2BA 1ZLSL 2R5DA 4MN4C 3ISYA 3BP5B 4ONHB 4MQSB 4U7KA 1X4XA 4DEWA 3HC0B 2EVFA 3EO1A 3VDAA 4B7IA 1E4KA 3R0NA 1VQLP 1N59A 5DZPA 3OJDA 1GCYA 3ZL4H 3G04B 2VKXA 4JQVA 2YAFA 5ES4B 4JKPL 3GEWB 1YN7B 3LKPB 3CFNA 1NICA 5CINL 5TDNB 3V4PL 5HYFA 2VQUA 2OTWB 4WFEE 3GSVA 3TIEA 4F1ZA 2P5ED 3NCBB 4PWGA 3FBQA 2QGCA 2JP3A 1FCGA 3W9DB 1F4YH 3CBJB 3VMOA 3ESPA 5E5LA 2RMZA 4AUJA 2FHCA 3RDTB 5HI4C 4M7ZC 5FR3A 3N40F 1OT1A 1FNFA 2HPTA 2X4QB 3TF5A 3O4OB 1RZKC 5L4MA 2D03L 2QVKA 2IPTH 3ME0A 5HJDA 3U83A 2CA3A 4LDEB 5GZNA 3WJJA 2AQ3A 2YAHA 3LKSB 3UAAA 2RR3A 1EDQA 2Q87A 1E4XI 3SDXF 1OW8A 1LTIC 3BN9C 3VFPB 2YMOA 5DJ0A 1RZGA 3AC0A 2EVJA 4RX4A 3RGVA 1G43A 2VZSA 1U8JA 2J12B 2RQ8A 1KB5H 1KT2B 3EZ8A 3KVPA 1KILB 2HFEB 4KZCA 5EEZA 2QJKC 5EU6B 3V0JA 4PG2C 1EJ6A 2J5LC 4A7GA 1GGIL 4XPFH 1WA2X 3OKOB 3PAUA 3FOLB 1YMHB 4XX1E 5IK3A 3KH4A 2OYPA 1AIZA 2AEPL 1PX8A 3DDFA 2D4DA 3HS8A 2AEWA 4HX1A 4X6DB 4JZJB 3BP6A 2OTKE 3Q13A 2JF1A 2P26A 2CPBA 3T71A 1DIPA 5KSAB 5T3ZL 1A7QL 3APMA 1C08B 2A06D 3C9NA 4N8VA 1KBWA 1MFUA 1OZUA 1S5HB 2HYMA 4Y16D 4KZEH 5E6ZA 1MHCA 4C4BA 2DBJA 2HKAA 2NW2B 3L4FA 2X4RA 3F2LA 5I1EL 1WTGT 5I0VA 3QDHA 1UJ3A 2E27L 2HPCA 1FBIH 4L29B 4HULB 5FM5O 5IMMA 2XA3A 3K6NA 4LHUB 1ODAA 5EC2A 4AE1A 4QO1A 2V6HA 4GQQA 4Z7QF 3CFKB 5HVWA 5I1AB 5AAMC 2VN5A 4QRSA 3TZVA 5FCUH 5JXAH 1KEGL 2HT3C 2ITCB 5I18L 4APQD 2RGSA 2Q7CA 1PL3A 1UM4L 3Q5TA 4FABL 2ZWKA 3BUQA 5C6WH 5AZUA 1PJ9A 3MJ9A 1AGDB 1YSOA 4I5BB 2Y22A 1KN7A 4PJ5D 2OTUA 1PFCA 4JZOA 3H1JE 2ADFH 3LNDA 3W68A 5KYYA 4M5YH 3DXAD 4MB4A 3HMXA 4D9RE 2A45H 1EFXD 2FKWB 2R23A 3S97C 1NUFA 4N2DA 4PIRF 4P2YA 1M1XA 1XL4A 2B1AL 4KPHL 4F57L 1NUNB 4GG6A 1LO3H 2H3KA 2NY1C 3EO9H 3HI6H 2OL3H 4OCRL 4P48A 5JPNB 1PPJG 3S35X 4L18A 4KKBC 3NZ8B 1K73Q 2W59A 2XNXA 4JDVA 5E5MA 3WO4C 4OZIB 3T3PE 1TETH 4IGBD 3HPJA 5C0CA 4RFOL 3K81A 5DJCA 1LO5A 4NJAL 4NJ9L 1EXHA 2ODHA 3HHSA 3MTRA 5JUEL 4ZG1A 3HG0A 4GP4B 3UO1L 1JE6A 2GAZA 1FFTB 3C6LA 4Z1PA 1I7UB 5JR1L 3HVNA 2EEBA 5KN5B 4R4LA 4LLVA 5J06A 1GZPA 1CL7I 3T77B 3MRLA 1DCEA 2F19L 3QFDA 5IB1B 1GU4A 1UCBL 1BECA 1BX2A 4H8WC 5FDWA 3IF4A 2VXQL 3GZOA 1HSAB 1F4HA 1NH6A 3L5XH 4JFFA 4KK8C 2WKOF 2EYTB 2K37A 3IT8D 1IGFL 1KQFB 3GNML 1A22B 1Y6MR 3QORD 3U0PB 3CZFB 4I2XB 2X0WA 3U6XA 3IMSA 1JPFB 2XTJD 3O6LH 4L3EA 2WQRA 1UZ8B 2OBGA 5IQLA 2F54B 4N6RA 4Z7UA 5KBLA 2KERA 1OE2A 3ZDXF 2VLRB 3EDJA 4OLEA 4M8QA 4BHUA 4X9HA 4AQAB 4PJ7E 5B22A 4E41A 4FFYA 2NY2C 3B9KB 3X3GL 4D0CB 4ELMB 4GRWF 1FZCA 1SP4A 4NO3A 3K6DA 2QQNL 5HJBA 2AGJL 4WHTA 1YA5A 4WGKA 5C09B 5AOZA 2D7TL 3Q8FA 5T3XE 3EDDA 3RU8H 1MFTA 1FZKB 1HEJC 4Y19A 2B88A 4D6TD 3FK3A 4HC1H 3SGKA 5I1GH 1KMIZ 1KF9B 3KEHA 3S96B 2WZ6A 1JOCA 3WUTA 5KKZB 1F6AB 1T20B 4IKKA 4K3JH 4G43A 1QO3A 3EFFB 5GHWH 4CJ0A 5E08H 5ESVB 3P4LA 4HEPG 4U6YB 4JQIH 1NU1K 4ODBD 4K94L 3V4QA 1A6ZB 1WFJA 2B1OA 2YPVL 5F7EH 1FJKA 1THAA 3CFCH 3CK0H 1A6TA 3LVEA 3MRBB 4LCVA 4PGBB 5C0ND 5F9JB 5JOFB 1LE5A 1UWXK 3AEFC 3U1CA 2BSBA 1YEFL 1JK8B 5DCCA 2YAMA 3KJ4C 5H94A 1HFUA 5L0QC 5F1SA 3OMZA 4HH9B 1NTKD 5E51A 1IBDA 5JIKA 4LCUA 4KKAC 1CIDA 2FB4L 4P49A 4WFFE 3PJSA 4YBLB 3WEXB 3PPSA 1LTJB 2AW2A 2DKMA 2Q9OA 3VMAA 3QQ4A 4DP5X 2GYSA 5DHYA 1XCQA 4X50A 3QPKA 1OANA 4KC3B 5HI3D 3CNKA 1XMWA 3QZWG 1LO4L 2RFXA 3TCTA 5IQMA 3WL9B 5EF1A 1ACYH 3RTQB 1KCVL 1WFMA 5EO9B 4IRSC 1CI6B 2IBZE 3O2WL 1MIML 3BPNB 4FMKA 3KZIH 3DRTA 2E47A 4FS0A 1HYRC 1Q72L 2G2RA 3J07A 4U1KB 2XN2A 2JH2A 4JKPH 4WZ9A 3QUXB 5C08D 3VXUA 2ZXGA 4ZOBA 1D5ZA 3V4PH 4BE5A 4QRRE 4H13B 3HAEB 4ZBJA 3B2XA 4K7FB 4PEEA 2CLZB 1RUML 4U1GB 2A77H 5E4AA 5SWQB 3CN1A 3SPVA 3TO4A 3HTKA 2AABH 1T89C 3GXFA 2X3CA 4KV5F 3H42L 1JUFA 4NBXB 2N1TA 2PCPA 3ML9A 4R4ND 3SPHA 1ONQA 4LXFA 5BO1H 4G7RB 4RETB 5APVA 1VFUA 1R3IH 4PM1A 3UGXA 3AU1B 3KPSD 1LT9C 4L4VD 4LRIA 1ILSA 4X4YB 5KANG 4RA0C 5I9QC 1SRDA 1Y1DA 4KJMA 3L3IA 1SXAA 4OV6F 5EPMB 5MI0B 4X4YA 1JCDA 1ASPA 5A6LA 3IJHA 3PNWA 3FQ2A 4GBXD 1A66A 2A6JA 4FQHB 1GGIH 3VXMA 3DX0A 4GI6A 3QIBD 4YO0A 5D6CB 3H1ID 1MJ7L 3FQXB 4P46B 4L1SA 5F8RC 1GIGL 2DLGA 3GB7B 2VJXA 4QTHB 3UCRA 2A6IA 3SDXA 4JFDD 1SQMA 3FH8A 5AEAA 3VGEA 3MRGA 1MF2L 1MKFA 2H2PD 4WUKL 1M42A 1WWBX 3RWFB 2VZ3A 3RRQA 2P47B 5ELIA 3F12A 5T3ZH 3ZHNA 1MCCA 1Q90D 1A7QH 1CXHA 1KGCE 3L1OH 5MERB 2CIKB 4XXCA 3MNZB 3OJAB 1B2WL 4XBGA 1JZ8A 4PGZA 1X5KA 1QSEE 3FB7A 4GRLD 5JW4Q 3L9EA 2WSFH 1WGOA 2EABA 4NYLA 4AYSA 3F6JA 4LOVA 5C0EA 5BCAA 1J9CT 5KVDL 3WD5L 1UWEL 1E9OB 1QYGL 3H1IJ 5I18H 2X89D 5ICXB 3UBXG 1JZ4A 1M3JA 4U1NA 3PV7A 1RK0B 1YNKL 2VISB 4G8EB 2Y0DA 4Z8FL 3E7JA 3GBNH 4PH8A 2SEBB 2BEQD 1R5LA 4YSDA 3PWLA 1HF9A 2ROXA 5MEPB 4PJGA 3MJ7B 1XF3A 1AV1A 2EDWA 2AK4A 3MLRL 4LPXA 4FJ6A 5DURD 5DVPA 4AEEA 4KPHH 4F57H 4DUXA 1NAML 5DDHB 2BXZA 5CZVL 3L81A 1P4IL 2VDOL 4DP2X 1KXVC 2VZOA 1KXTB 1T21A 1KTMA 3IMRA 1G7HB 4RMRA 1FO0L 4OBRA 5KOMC 3ARGA 5I30L 5IBTH 5T1KA 3KYMA 1X3DA 3M9HA 3U7YL 4WNQB 3HRZC 4F3FB 2UYLB 3MRMA 4RFOH 3NDYE 2KT6A 3SWYA 4FQXD 1M56D 4FLQA 4NJAH 4LDCA 4NO2A 3L3HA 1WITA 1Q0XH 3AREA 3V6OE 3UO1H 2ZJSH 1MVUA 4JGMA 2EXSA 2I9TB 1EVTC 1JXDA 3UTSD 5CBOA 1JRHL 2F19H 3TA4D 4M93C 1H5BA 4Q9RH 1UCBH 5A7EA 3BUIA 1LO0L 4QI3A 5FYJH 1FC2D 1E30A 1LQSR 2JNZA 3HG4A 3MLTA 4KKRA 4KVCH 1PD0A 1PEWA 1NCCL 1QQDA 1IGFH 3HLKA 3DYMA 4OI7A 3VGGA 5E4EB 1CTOA 3PLYA 5K1JA 1JO5A 1BGYJ 3FO9A 2KH2B 2A73A 1GZQB 2MMXA 4KUZH 3W5MA 3OKKB 5ID1A 2PPEA 2CBPA 4UQ3B 5HDBE 5HYSB 1QL2A 3U2JA 4PRDA 2XJLA 3TNUB 3RI5K 3V6OC 3TGUG 1H8LA 4N8CL 4IFDK 2BZCA 4AYBA 3AE4C 2SODB 2WKOA 3X3GH 2OPCA 1E2WA 2A3TA 5I1DB 2H5UA 1KBGL 2X05A 1M53A 3A5VA 2YD9A 4OZGB 2AGJH 4YGAB 4BDVA 2D7TH 1YEDA 4BFRA 3BP4B 4LCIH 2V9QA 1D5BA 2IIJA 1MDTA 2G0LA 3N4XA 1BYPA 3GSNB 5FM4A 3VGFA 1S3KL 5FHAH 3P4MA 1IBYA 3HD7C 1AQHA 3UEQA 2WBJD 3UACA 2L0DA 2WXRA 4NI6A 4E42A 2DYPB 3O45A 1MH5A 5KUKA 4K94H 2YPVH 5L6YL 3ULVL 2XVBA 3Q3DA 1HILB 1MLCA 1NWPA 5C07B 4UTBH 1YEFH 4LB8A 3L4ZA 2B59B 4F27A 3FONA 4AVJA 5CN1A 4OJDH 3GSWA 2BCKB 1L9RA 3AUVA 4YC2C 3OXRA 2FB4H 1KYOE 4LVNB 4EPSA 1A9VA 2HVJA 4F8OA 1G1IA 3IRZA 2R2HA 5GTIH 4U6TA 3LKOB 3EGDB 4KY1L 1L0LK 3HFMH 4U1IA 1N5YL 1LO4H 2E5EA 5CEYB 2IH3A 1SN0A 3CVHA 4YNYB 5IFHH 1BE3G 2LAGB 3VXSE 3D8MA 3VXNA 5GRJH 2VDKB 1IFPA 4AUWA 3U1QA 2KLRA 5DUPL 1G1YA 4L8DA 4OM1L 4Y5XA 4FNSA 4JFYB 1KGJA 3B9VA 4EDFA 4JM0A 1NC2D 1Q72H 3C2SA 2A99A 3G5WA 4JFHE 1TQBB 4F9PA 4IFFA 3ILQD 2F74B 3UTQA 1T1ZA 4JJOA 2Z8WC 1SQBE 2HAZA 2NSXA 4CDGC 1A7NL 3WS3A 2EUWA 3UPAA 2QLVB 1OAKL 1Y0LA 3QW9A 3FU3A 1W0WB 2E7BA 2EDBA 3L35A 3KW7A 3PP3K 4ZPTB 3AWGA 5BS0B 1TJHL 1JV5B 3GI8H 4OGQD 4XO3A 1VZGA 4OGZA 5K59F 4I0PA 1DVFD 3L3JB 1L9PA 3QDMD 3LV3B 1NM4A 3RX7A 1M1JA 5DVMA 3VE0A 3QO1A 2ZXXA 5L7XL 3MRNB 5CKAA 1HNFA 1TSRA 4YDKL 2FO4A 3TM6A 1Z66A 2BX5A 2UXGA 1VACA 5DQJB 3A0BE 4P2QE 4YZFF 4A37A 3LMJH 2XWXA 1QBML 3GSRA 2QHLA 4GOEA 4NQCB 4X6FB 2C7FA 4R96A 1G7MA 2H0FA 2YQ3A 4GAJL 1BEYH 4POUB 2YA1A 5HVHC 4O9BA 2GI7A 4U3SB 3FN0H 5KSUB 2BCCE 1QFWI 2VSKB 2YQGA 1OCOB 2XWJB 4LKCA 3LN5B 1MJ7H 1JWMA 2XN0A 4PS4L 2QGEA 1SQPD 5INCB 1TZOA 1DH3A 1U9KA 3MYZA 3O6ML 4FFWD 1ZS8A 2CKBH 1U92B 3CXHE 1BVLA 1W2KT 4KVNH 5TQ0L 1ZMEC 1UURA 3IMUA 1ETB1 1OD7A 1CZ8L 1MF2H 4GH7B 2F1AA 3E6HA 2QR0B 1L4AB 4U3FD 3AAZB 2B08A 3CH1A 4N0UE 2UXFA 5GGTL 4H40A 4ZXBA 1RE3C 3VXPA 2UZXB 1IJDB 1JPGB 4EZMA 2AAVA 4K5PA 3UBFA 1PG7W 4YEEA 4KJQC 2MKLC 5DHEA 5F7FA 2XWDA 5AVXB 2IWFA 1LK3L 3Q7JA 4JGJA 2Z0BA 1R0AL 2LVCA 3MMEA 2Y7OA 3WD5H 4BUQA 3KL3A 1QYGH 1JPEA 1RLBA 3BMVA 5T5FA 3WELA 4DZBB 4CVWA 3BH8A 1IM3B 1MRDL 1YEIL 3R1GL 3T0WA 5MENE 3Q06A 2A6DA 2VIRB 5D7KE 3F5WB 5AALA 5IZ7A 2WLYA 3UP1A 3AEDC 4P3DA 1OHQA 3MV7A 4C54A 5C6TL 1DL7L 4XB8A 3F00A 2R32A 2IQAB 2Z31D 3BFQG 3LVTA 4LL1A 5I15L 1DJSA 3O2DH 3ZUCA 1BQLH 2O01N 3MJ9L 1BZ7A 5JIQA 5GTHH 4FRWA 5T1MA 1JF1B 3RWIA 4UTCA 1NAMH 3ULVD 2OMUB 2YXMA 3BCFA 1E67A 3NA9H 4IK6A 3HMXL 4WEEA 3ZE1E 4N3YB 3A24A 4Z18A 1FBMA 4MCZA 1O75A 2OMZB 1UCTA 2BFVL 1JWUB 3CFUA 2AQNA 4HD9A 4PRHB 5IKCA 4H8QA 2WPRA 1P6FA 5EB9A 1JNMA 2VDPL 3NH7L 2GUOB 1MRFH 1BV8A 4RFNB 2NY4B 2OJZL 1W15A 4Y1AE 3D85D 3VWKB 1EXUB 3TEWA 3V6FB 3DYPA 4HDIB 4WW2A 1DEEB 1J0KA 3EYOA 3WJMB 5HHXH 1T1WB 3QI9C 3EYSL 3RK3E 4XPGL 1H89A 3VFMB 2XUWA 3EGSB 4IRZH 1DVUA 1LO0H 3CC4P 3MTXA 4HEMA 4Q6IA 4O4YL 5DMIL 1NCCH 2VDNB 2AQ2A 3BHBA 3RL0B 2ZICA 3NQIA 4ZZKA 3ROLB 3RWJA 1F3RB 4NAJA 3WNPA 5F88A 4C47A 4NQXB 3U9WA 1G5AA 4QOKB 3ZZQA 2P5WB 4W9IC 6FABH 3NT0A 5F7KC 4BFFA 3RVXD 3MBEA 4I4WA 2LTQC 4ZTPH 5TF0A 5I17A 3KNBB 2OR7A 3CU1A 4N8CH 6TAAA 1BMWA 2HJFA 3KLHC 4ZX5A 3PAVA 3S7GA 2HG5A 5D1XE 1HIML 1KBGH 3WHE0 3WLWD 5GZOA 1MNUL 3RK3C 1HCFX 3BEVB 4HZAA 4NOBA 3W9EA 1IX2A 5TE4L 3ZDYB 4A6YA 3L74G 1KB9D 3VTTA 5ISZE 2BIOA 2RHEA 2ADIA 1M6OB 1ZV2A 4QRAA 5E1HB 3V5KB 1NGYB 1S3KH 1IKFL 3AGVA 5C2BL 2WP3O 1SN5A 2QJPB 5DWUL 4ZMVA 4X83A 3DK2A 1BZ9B 3S98A 1JSYA 2VABB 3RUGA 1DZBA 1NMAL 4A66A 1RXLA 4ZSOE 3DX9A 3V0AC 4N0RA 4FXGC 2FXMA 3U4AA 4WWOA 5EU5A 1KLUB 4S1RH 2QKSA 4IKNA 4V2CB 2J88L 3QFGA 4TTDD 3VRLE 4AY0A 5KLIC 5DA0B 3VD0A 1EGJL 1KCLA 2WOBA 4ETQB 2YWZA 3IDMB 4EOWH 4XMTA 3L7EB 3B2DC 4FQLL 1JNHA 2Y0EA 3DPBA 3GMPA 5FFLA 1INQB 2FEEL 2J8UF 3H4FA 1FGVL 3F8UB 4J6RL 4N2MA 4ZAKC 2E9JA 4UT6H 3BWUC 1SFCB 5CP3H 1JUNA 1KB9J 1S6NA 4I18A 1OCRB 2GFBB 1TQCC 4KY1H 2UZIL 1VDFA 3AW5A 3EUUA 2O61A 4DVBB 4YN3A 1J5HA 1WIUA 3M45A 5CKGA 2FO8A 5DUPH 4LP8A 3TESA 4NZUH 1OSPL 2YPLB 2CGRL 3Q8BA 3RIFF 2ZKYA 3PL6D 3FT4B 1CLZH 1T8ZA 1HINH 4NQVA 3TZVD 1AY1L 4E0RB 2GJPA 3LNIA 2AXJA 1A1MA 4F7TA 1BWMA 3SDDD 4ZUWA 1AO7B 1WIOA 1WZKA 4FCAA 4NUMA 3U6RA 2QVFB 1BQHB 2HRGA 2PW1A 3D7PA 5DJ2B 5D5MB 1OAKH 1EAPB 2FHBA 3P9MB 2BNRD 3PXJA 4RZKA 4TOYL 2F58H 5ABAA 3ZHDA 3LS5H 5C8JA 1TJHH 1FFRA 2K7PA 5DSCA 3ZYIA 4F5CA 1KWGA 4J3OF 1I8UA 4AQ1A 3NCXA 1A2YB 5IMLB 2P8PA 3VAEA 2GEQA 5C0AA 2R56H 4MGXA 5L7XH 4NAMA 1FL3A 3H9SB 1A1NB 1OGPA 1URQA 5IBUG 5IVZA 3U9UB 2A83B 1QBMH 3FTGB 4J27A 3VFNB 4M6ML 2LU4A 2C34A 5DFTA 4JN1L 5E8EB 1PPJE 3D39B 1S7UA 5C3IA 3QJVB 3J8F7 4PGCA 1UGKA 5IOPB 1WHPA 2XQ0A 2IF7A 3EIFA 3OGCB 2OI9C 2HLAA 3C5JB 4GAJH 1DUZB 4ENEC 1XF4B 1QOKA 2I9LB 3A6OA 3V0GA 5KLVD 4KHTH 1R3JB 1WUNT 2WXLA 4PR5A 4H5SA 2IVFC 3SO5A 1AXSA 3KPRE 3WEBA 1MI5B 3SPCA 5IHHA 1K4DA 3O6MH 4GAFB 4YHIA 4D8OA 2KZBA 3CC5B 3HOGA 5TQ0H 2WVUA 4RQQA 3FCUB 3V4WA 3CTTA 4FLSA 2PWFA 4UDUB 2RAMA 5HI4D 4KTEH 5E6IB 3F6LA 2ESVD 1U3NA 2N59A 4XODA 3N40P 3CPLA 4HMCA 5I75C 3MNDA 1HGZA 2AITA 2R39A 4XN5A 4F2FA 4Y4KA 3GHGC 1PCXA 2WGXA 1MLBB 1P9MC 4TVSa 1WZ1L 3G6AB 2JTYA 4X4ZA 2DPKA 1LK3H 1ND0B 1DDHB 1B4JL 4MKMA 5DZOA 3HE5B 5ESQB 3D87B 3MBWB 4WFED 3WDJA 1GXEA 5JO5A 4ADGA 3EGXB 3QEUB 1QLRA 2F2HA 2YR3A 1HHIB 1ORQB 5EBLB 2MQ3A 1VQKP 1UXWB 1PAMA 2JQZA 4OIFA 4DZ8A 4GB9A 3X11B 4DERA 4Q52A 3IAOA 3CHRA 1GKEA 5DK0B 2IOIA 5C6TH 4D9LH 4Q97A 1I8AA 3DO7A 1IQWH 4LSUL 4NUQA 2LXCB 4JGUA 4NQTA 3QT2A 4HK0A 1BLNB 3MJ9H 2JKRM 3T0EA 3BAXA 3VW3H 1TYJA 1GY1A 4HOWA 3GIZL 3DBXA 3GRWA 3D4YA 1L0ND 3HMXH 4HIIA 4EI5B 4YJZL 4P06A 5H35A 4NIYE 4PLKC 3UPRB 3VD3A 5JW3L 4AV4A 2OZ4A 2WXJA 3ZT5A 3MXVL 4DWHA 2P80A 3CSYA 5KAFE 2ZPKL 4PJDE 3DK0A 4JN2A 4HS6B 1FSKC 2DAVA 4QY8B 4QRPA 4HWBA 1TZIA 4O02B 2G75A 2Y5QA 2VDPH 3NH7H 4UNTA 1A21A 1PBYA 5DO8A 3PGDA 4B5EA 3KPOA 1PPIA 2C5DC 5TFSL 3U46B 2OJZH 4U3HA 5TJWK 5FK9B 3NSJA 4PJ9B 4Y89A 3W57A 3DUHA 1S7VB 2XYCA 4GKNA 3KPNB 2E6JA 3BQUB 4LEOB 4CN6A 5I0WA 4LSSL 1EJOL 4Y9BA 2HG0A 4XPGH 1MJUL 1RIHL 2NXZC 1T3UA 3P8CE 2NY1D 3EJCA 3P1VA 3T0BA 5I16A 1L0NJ 2PP7A 1NAFA 3IMVA 4E5XB 3KHQA 1AR1C 1XD1A 3LW5H 4XWGL 4EDXA 3HUSB 2XXCB 3LZLA 4ZTOH 3N55A 1ZGLM 3MGOB 3UGUA 5APTA 3P9LA 3BUTA 4A55A 3G5ZB 4OCYL 3LDBC 4BQ8A 2ICWI 3PQYA 4XA4A 4ES8A 1AXTH 5ICYA 4WKZA 4RVBA 3H1JD 2VMCA 5AB9A 1W80A 3WMSA 2R2EA 3TO4D 3OX8A 4CVZB 4D9RD 1U91B 1G6RB 5DUML 2ISDA 4FFYH 4TS6A 5CD3B 4BQCA 5L9DL 2BC4A 2HJKB 3SY6A 3BSHA 3NEEA 2VDML 2YEVB 3B5GA 5DJAA 3GHPA 5GGVL 4OGXL 1WC7A 4AJVA 3AACA 1EO5A 1CFMA 3ZDMA 1ZV5A 4G80A 4FULA 4OZHB 4PWFA 5C2BH 1Q2NA 1D5RA 3CUPB 3IDGA 7TAAA 2HYNA 4R5VA 5A2LH 3DX6B 4MB3A 5EORL 4Z7NB 3HG1E 5I1KH 1NMAH 3IU3A 4JGNA 1U33A 1JFQL 3IWVA 3SBQA 4QMEA 4IRJA 4OFVA 1OVVA 4NSKA 3BVNB 2FJHB 2Q7YA 4YSUA 3ZKSD 3IDJA 3UC0L 4M6NL 4JFUA 3E1RA 2NY2D 1WA1X 3JBG7 2YD6A 1J1DC 2L7EA 5IG7A 2CA4A 1S9YA 2M0BA 3HG5A 2LW3A 4OI9A 2TRHA 4HOZA 3BJ91 2PWGA 1KIUA 3H1HG 4FQLH 4XPAL 2ENSA 1JZGA 2NY3B 1GS6X 4JAMA 2GTZA 2VM9A 3MOQA 4Q2ZA 4OT1H 2DQFB 3QIUC 1AKJB 5FGSA 3VG0L 1JS4A 5GGSY 2V2TA 1P4LB 2UZIH 1K4CA 3I2CL 5F93C 1RJCA 3WKML 2MOQA 1BPVA 4B3EA 2F53E 2XWTA 4NO0B 1EZVY 2QVIA 5DJDB 3LQAC 4HHAA 4JRYB 4QGTA 3CVHL 2UWEA 1TJXA 2XQBL 1E0OB 3EYQC 1FVDB 1XSJA 2Y3NA 3FOMA 4PIBA 3QP3A 3RVUD 2YO3A 4UZGA 3CZGA 3DJ9A 2DQJL 2WINB 1T66C 5CFAA 3E1IA 2N0MA 4AEIH 2G5BA 1UT1A 1WFIA 1GC1C 5JIPA 2LABA 5CS7A 5DUBA 4GLRI 5C0GA 1YLBB 4J3WA 5T3XD 4RWYH 2K70A 3MRDB 1PZUB 1VADB 4WIQA 4XNAA 5ESAB 4DTGH 5D7IE 4FXLA 4WY7H 3L73E 5EOTB 2OS7A 3TEUA 2YBRB 4RGMB 1U3HC 3VWJB 1QTYT 4ZMOA 5AW6B 4JN1H 4XX5A 3RK2C 1NKGA 1D7BA 1OGTA 2KK7A 5J1SC 4IRSD 5C1MB 1FYTE 2ATAA 1IK7A 3T6XA 1AQDB 1FJ1A 1OARL 3ARGD 1XGRA 5F7DB 3OJ2C 4WVRA 3IFLH 5C8JB 3FFDA 1GCFA 3L70J 4H20L 1HCZA 3IAQA 2VJ0A 1AP2A 2Z8RA 1NTKK 4LVOB 4YHYC 4PCSA 1KB5B 3B6SB 1WISA 3ARED 1YQVL 2ZG3A 4WI5A 3RWHB 3SJVA 2KS0A 2W27A 1S7SA 5IGXL 4FTVA 1JTHA 2E0PA 1FP5A 1HZKA 1KBPA 4L5FH 1NOHA 5ACZB 2EDFA 3FF8A 4YTPC 4F7EA 4MJ5B 2KZWA 2QKIA 2ZXWB 4X5XA 3L3DA 4OCWH 1UFGA 4G7VL 4RRPA 1HKFA 1TITA 1XGPB 3EOTL 1QR1B 2IBZD 1DN2A 1T1XB 1AD9B 4FZ8L 4NP9A 2JIXD 1NIFA 1JV2A 1NL0L 2AXGB 3KLAB 3MKGA 3SZ6A 1JN6A 2F5BL 4LGRB 1SYVB 1LK2A 2NUTB 3CCLP 1Z9SB 4KHXA 4XNZB 2Y1AA 4W9JC 5GRZA 3ABLB 1WRGA 2AJVL 4L37B 4QRRD 3TGUE 4RMTA 4LCYA 3VN0A 1MUUA 2KQNA 2P44B 2A9DA 1U3YA 1Z5HA 2MNJB 1KXHA 2OMYA 4XAWH 2IH9A 4X5RA 5T5FL 4PVLA 3HJ0A 3RIAK 3MLVL 4N2CA 2FEDD 4DHLA 1G87A 1FN4A 1T0PB 2BY3A 4K5NA 1HDMB 3TTYA 1Z9LA 5CEZE 3PTZA 2CIIB 4NQSA 3SOTA 3IVKB 3GSXB 4XO9A 5A3IC 4L0PB 3RPIA 3WY1A 1NU1G 2D7QA 4O9HL 2A1WL 3LH2H 1FE6A 3U4EA 4BRJA 2IFGA 2CJTA 4JANB 4KFZC 3GBDA 4GJTB 4CA4A 1NM9A 1DQDL 1OVZA 1WLHA 4LLUA 5JW3H 3RX9A 3CH8A 3MXVH 2OL3B 3MLUL 2DQIL 4ZW7A 1LEKB 2FGWH 4OLYL 2Z93B 4CSZA 4KQ4H 1KIPA 1YN6A 32C2A 4X8JB 3QGVA 5E5RB 5I19H 1Y18A 3GSQA 3TVMB 2D3NA 4WJKB 2EE6A 5MP6L 3I9AA 3VTMA 4EN3A 1I1YB 4JDZB 2Q76A 2E7MA 1KGCD 3RYMA 2OQJB 1NTZJ 2CWRA 2YLKA 1H3UA 1DO5A 3KD4A 4FLHA 4PRIB 3OKNB 1NCUA 2J6WA 3QQDB 3REWB 2CDFA 1EJOH 1NVOA 4XNMA 1FV1B 1MFVA 1BCCG 1BE3E 3O3EA 1RIHH 4BSVB 3CCVP 2DJUA 1TTAA 3WLBB 3OF6A 4JHWL 4DEPB 3MLWH 4CADB 3HBPA 2WQ8A 1MCSA 5DK3A 3JTTB 4XCEB 2VL5A 1E9QA 4QHNB 3VA2C 1BSIA 2Y7MA 3MV01 5F96L 3U2IA 5J8OA 3C60A 1EV2E 4FLOA 3DUSA 1AA0A 1J48A 5JPMB 3VFVA 2G2NA 2XV3A 3P0YH 1H3TA 4UB8H 2XIBA 4MA1C 2BW4A 4LGPB 1OGAE 1KCSH 4CKQA 5G55A 4ONGL 2R1XB 3KPPB 5I8CB 1ZHLA 3BVVA 1MRCL 2IH1B 4I0PD 4PJAB 4AIXA 4XCNA 4E9TA 3TEZA 3U36B 3ZR5A 4HZLA 1BZ8A 5DUMH 3A6BH 5KVGH 1SOKA 5INDA 4IHOB 2IO5A 3EYFA 1N7SA 5L9DH 2AEOA 4HKXA 2H8PD 5BUGA 3GBLA 1QBLL 2VDMH 3P4NB 3H9HB 1J8HA 1JD9A 4Z7WE 5LB1A 3CZNA 2IPUG 4P2OC 4OGXH 5GGVH 4OTXH 2DL2A 4APXB 3KWVA 4WJG3 5EBGA 4P07A 1WJ3A 2Z0UA 2WTYA 1N5AB 1IKNC 3B7YA 3AS3A 4FQ1L 1O6SB 1NGWA 2W07A 1UH3A 4OJAA 2P10A 2IDBA 4HQQL 2ORBL 3TPUA 3BUBA 4FA7B 1RMFL 1JFQH 1JHKL 3O9WB 4GRWH 1XGTA 3TGXA 4PJFB 2ZWSA 3UAFA 1USEA 4M4RB 2ZXCA 3UC0H 5IB5B 4KUCD 4WK2B 1R3KA 1S8DB 5DRZB 1UOKA 4ODHH 4PRAA 2QA4P 3G08A 3M1CA 4J6IA 1W2BO 4HIJA 4PJ8D 2KLVA 2KSEA 2NOYA 5FYKE 1ORSA 1RJZA 4KROB 1KJ2B 3GMMB 5KZCB 2GIMA 3ZZLA 5T1LB 4MASA 2BZDA 3K2KA 4FHJA 1R3HB 1VPOH 3WKMH 3O6QB 3HD7D 5HPMA 4LL9A 2CPSA 4FP8H 3M1BB 3N9GL 4PRBA 4I89A 4P4KB 3M91A 3FFCB 1F6FB 1EIBA 2X4TB 5EU3B 3HZVB 3CVHH 3MQIA 1J1EB 1KYFA 1GVIA 1MCIA 3WDHA 1T6AA 1B0GA 3WHXB 3IXTA 1N19A 5AOMA 1OF2B 2FWUA 3WFDH 4XN9A 2O6FA 3VXTB 3BIKA 5A7BA 3F58L 3MRIB 3FKUS 4NUGL 4ZFFA 7PAZA 3MNVA 1URIA 4OAWA 3KJ6L 3GMNA 4I13B 1SXNA 3AQZA 1N10A 4Y99C 1NEUA 3AE6C 3JV4A 3NVQA 5GRUL 3OL2A 3VP8A 1BAGA 3WS6A 3LKNB 3QZLA 4QUOA 5M94B 2XDJA 4JO5A 3H1KG 3X1NA 1AD0B 4FZEL 1E5CA 3BWAB 4W9DC 1GOHA 3DMMD 2ENPA 1TO4A 2KI6A 1CL7H 3T3PF 1WT5C 3HZKA 5APUA 2V2WA 2WZ5A 4LPUA 1OARH 2IALB 3H4HA