5AVQB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 0.75 min.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avqB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avqB02
2YO3A 5AW8B 2YO2A 1MV8A 2KP8A 3I5CA 5AVSB 5APUA 3VMYA 2E43A 2R3CA 3KDPB 3MD0A 5AVUB 1HUCA 4LC1A 4AQRD 3P32A 2XU6A 1GU4A 3HTKA 3VN0A 5AVXB 1FOSE 2WPRA 3NXSA 3VYIA 1H89A 3M0AA 2P67A 3HE4A 2WT7A 1X8YA 3O8ZA 4KHXA 1HJBA 1H88A 5AVWB 2P2UA 1GZLA 1GK4A 5APQA 3IR9A 3B8EB 3NTNA 4DZOA 3NMDA 3WGUB 3M9BA 5AW7B 1G2CB 4GT1A 1GTWA 5AW1B 2VRSA 2ZFCA 4GKGA 4C7NA 3SWFA 4JYBA 3HE5A 5AVRB 1HWTC 4XE5B 3T97A 1A02F 1IO4A 5APWA 3P8MC 1H8AA 5AVTB 3M91A 2P7JA 3M0DA 1S9KD 1T2KC 5APXA 1A02J 1MFZA 3V4QA 3WGVB 4EOTA 5AVQB 3OAKA 3V4WA 5AW5B 1YYCA 2QM8A 3TNUA 3VMZA 3HE4B 2WT7B 3TNUB 1J2JB 5APTA 2Q3IA 3M06A 1OWAA 5APSA 2XV5A 5AVZB 2C9NY 2WPSA 2R5BA 1NAFA 5AW3B 1GD2E 3NFQA 1NWQA 5AW2B 1FOSF 2E42A 3VTPC 1CZQA 4C7NB 3LIDA 2ZXEB 2N9BA 2IPPA 3HE5B 1KQLA 3LIEA 3M9HA 1CSBA 2Q5UA 5APVA 2Z5HA 4RESB 5AVVB 3L36A 2YNYA 1JUNA 4C46A 2WTYA 2W6AA 1SLQA 5AW6B 2Z5IA 3KQGA 1T2KD 5CMZA 2Q7CA 2XZRA 1MUUA 4RETB 4AYCA 4I6MC 1S9KE 4AUWA 3VMXA 1OXZA 5AW0B 2H7HA 3TYYA 1CI6A 3MGNA 3A2AA 1CI6B 5AVYB 4HYTB 4B86A 2WWWA 5APYA 2BASA 3P7KA 2WPQA 3V5BA 3A3YB 4JYCA 3A5TA 1HBWA 3A7OA 1JNMA 2C9LY 3TK1A 1GU5A 2R32A 2W27A 4I2LC 3L35A 1DH3A 2JJLA 4M3LA 3UIAA 1GK6A 1FAVA 5AW4B 3L37A 2QM7A 2R5DA 5AW9B 1SP4A
chains in the Genus database with same CATH superfamily
2OCFD 2JB6A 1MW0A 4OCLC 3K1DA 5EU3A 3R1GH 3MZTA 1F8TH 1W72H 2CCWA 4X5WA 2KT6A 3VAEA 2NY2C 4PLKD 1QR1B 4ZT1A 1F1GA 3NRQA 2JIXB 1Z7JA 1NGMB 3ME0A 3VXPA 3WIFA 3ZHNA 1FOSE 2CIIA 1F90H 2CU9A 3AS3A 4LT7A 5L88L 3HG2A 3PHSA 3S96A 2P5WE 4IL6E 3CU1A 3IJEA 3I6LD 2F5AH 3OJDA 2FECL 3UL4A 1EHXA 3P9MA 2GSIA 3MV9B 2MOGA 2D7PA 2AEIT 3IWVA 3NCEB 3FSZA 1ZHBB 4ADJA 4YWGL 4AG4H 4OJYA 1UZ8A 4JK0D 4LXFA 3L71J 4JQXC 3BSHA 4KQ4H 4LKCB 5GZND 3KE0A 3R0MA 1LGHB 4W6WB 3U2SB 1S9VA 2JWDA 2HWZH 3U6RA 3G3ZA 2XXMB 4XMVA 4AX3A 1D9KA 2R0KH 4DPRA 4F57H 1HC1A 2XUWA 3F5WB 3GMLB 4QMAA 1FYTB 4LEBA 1EEZB 5IOPB 1AG6A 5M94B 1S7VB 3OAKA 4N2AA 2F7IA 4HAFA 4EIJA 1SVFA 3X1BA 1GRWA 3QI9D 3UC0L 1NGZB 2ZOLA 3FH5A 2KPNA 4RX4D 2YRZA 4TQEL 3VXSB 1FDMA 4JFDA 4MJ6B 4ELME 5F7BA 3ZHFA 4NO0B 5KZCD 1JVLA 2GI0A 4U0RB 1MJJB 1XT5A 2OX5B 2IDUA 2DQJL 2VXTL 4DN4H 4Y88A 3DVIA 1IGYB 1AHKA 4B6ZA 4Z0XB 4IRSC 4ODTH 2A4CA 2WWOA 5I23A 2YZ1A 1HINH 2DIBA 3MYZA 5E2TL 3VFTA 5I1JH 1DBMH 5GRVL 1O9ZA 2HLFD 1YUKB 5DFAA 3IU3A 5E03A 5CCKL 3VGFA 3QQXA 1JNNL 3S2AA 1KIPB 4U3FG 2XOTA 1D6VH 3OZKA 1XIWC 3LRMA 4TNGA 2PCFA 3U0PB 2UXGA 4R5XA 4X98A 2C9QA 2R2BA 1JF1A 2WANA 3MLXH 4X5PA 4Y5YC 4Z9KB 5JW3H 4ZFOB 2W9DL 5H2BA 3O6KL 4HUMB 1NDMB 2BFVL 2FYUK 3A4AA 4OSUH 5DJAB 3C5ZC 2HKHL 2ZXWB 3EJQA 4DP4X 3QIBB 2PW1A 3M7OA 4U3FD 3MYJA 4NUJB 1HWWA 1QZNA 4ESKA 1ACYH 1IKFH 4YS4A 3MRBA 3C9IA 2JIXD 3NIFB 2Q7NA 4PB0H 3D05A 3ROOA 5ICXB 3KYKH 3N43F 2HFGL 1P84K 4WCYL 1XBRA 3UBFA 3IGAA 4WBAA 6FABL 1URIA 2Q3EA 2WLIA 2V9UA 1PLBA 1JZ8A 1V7MH 4Z7OF 2Z4QB 2GFBA 1FFRA 4NRYA 1CW5A 5C86A 2OR8A 2EDWA 1LWUC 3LKOB 4FJZA 2QE7H 5BV7B 3BLPX 3GSQB 3GDCA 4DVBA 5CJ8A 2DTMH 4ONGL 3KXDA 4QOKD 1B9ZA 3CJJA 4M9OA 5TTRA 1ZLEA 1FYTD 1UURA 3ZTDC 1DYZA 4PIBA 4U1LA 3ZX1A 2G75B 1UGNA 3VDAA 3WBDA 4AQ1A 2B3RA 4GKSB 4YBQC 1B9KA 5E8NA 2DWXA 1D2OA 4FTVA 1LTJB 3NTNA 4M7JL 4WO4A 5DC9B 3UBHA 3VXSD 1Q0EA 5KUMA 4YSDA 1BLNA 1PY4A 4FNUA 4YWGH 1WTLA 4JO4L 5AB2A 1GIGL 4URTB 4BWNA 3A4EA 4FERA 3AQDA 5B38G 3VJ6B 1NBCA 2JJSC 3LEVH 5I1DB 3VRIA 1BW8A 2NXZB 4TXVB 4BFIB 3HBZA 1CN4A 3BGMB 1IAOA 3P4OB 4BSWA 4HKXA 2DBLL 3UERA 2WSCJ 1NJIQ 4YNYA 4I4WB 1Y07A 4DW2L 1FVCB 4D9RE 2AQ1A 3GBDA 3KPSB 3NFSL 5H35A 1D5IL 2QPEB 1P69B 4NLAA 4WKZA 4ZD3L 5DJDA 4HJGA 1ZMYA 5E99H 4WV1B 3AS2A 2ZSVB 4I1PA 1QTPA 4A55A 4OF3A 5IGXL 4G7QB 1FNGA 5E2VL 1QLFA 2ZF8A 4XP9L 3VE0B 3QIBD 3HG1B 1YC7A 2J1KA 1TJIH 3B71A 5KBPA 5GGQL 5EBLA 5KVGH 2D2CB 1CYGA 4DQOH 4R4BA 4WI0A 2QJPB 3DVNB 5ESQB 1YY9C 3CFNA 4OJCA 4DO5A 3BVTA 2WXPA 4JQIL 4DUVA 5IJKC 3TJEH 1Z6JT 4QJ4B 5BZDA 2X53A 3DUUA 4O02B 3V0FA 3FPYA 4ZK8A 1CC3A 3P4LA 2E76D 1H3PL 1WZ1L 3P3SA 2CHZA 1CGTA 2K7PA 4AMKH 5A1AA 2F58H 5CWSA 2HKHH 3JVFC 3UJTL 3TBYA 5MI0C 3V6IA 4K07A 5JHMA 2XBZA 5I6OA 1GMJA 3L9BA 2R32A 1UIXA 2YMXH 1L0QA 1DH3A 4WCYH 1RD6A 3W82A 1PY9A 1A6PA 3O4OB 4TQIA 1FFTB 5L4IA 5JHAA 4KH9A 4FE9A 2ZYIA 2WXMA 3U6XA 4JPZB 4IIQA 5DSCB 4XO5A 1HXYB 3LMJL 5E9AA 1S9YB 4OGAC 2CM5A 1NU1E 4BUGA 2BCKA 5CP7A 3P4NA 4BCZA 4DVRH 1BZ7A 1IGCL 1DQJA 1A1MB 1LO5B 1OW0A 3QEGL 4HPOL 1DUZA 3VXUB 3WFEH 3FB8A 5E4OA 3C09C 5GRUH 5CZXC 3O3EB 5J3HC 1U3HA 4M1DL 3TBSB 2HH0L 3RWGB 3VI4F 3MUGB 4HC1A 2Y6SD 3BZFB 3LQAL 1YQVH 5F1OB 3HE7B 4LNRA 1EBPA 3OGCB 4F9LA 5F9JB 1N0LB 2AEQL 2AHIA 1JY3P 2B39A 4LPTA 1U8LA 2XA3A 1AKJD 3GXNA 4NC2B 3NFNB 2K3TA 4RJTA 1ESOA 2GI7A 4MQ7B 3VWKC 3MV7A 3U1CA 4HKBB 4K5NA 4EDWH 3FQTA 3SYCA 3ILDA 3P3TA 5CN3A 3BQUB 2YKQA 1GIGH 2AC0A 2IJ0C 4M8RA 4L4TD 1DR9A 1JTPA 2XN1A 2DWDA 3ZE2F 4JY4A 1XL4A 3RURA 1MZ9A 3HG1D 1IU1A 1NEPA 2ZUSA 3P0YH 4E9XA 1XDTT 4RFEA 3S34L 1P9MA 4DT0A 2K9JA 1AXSB 2D2CD 4TRPL 1RUML 3R4YA 1MXGA 3PF2A 4HT1H 3ITKA 3KYOA 2KYVA 1IVTA 2BIHA 4G6AC 4NRZB 3BN9C 1BXUA 3NFSH 3CDCA 1D5IH 2NR6D 3V4PB 3MLTA 3W2DH 5EPMA 2QHRL 4ZD3H 2Q3IA 4N2KA 1NCTA 4HLJA 4WF7A 4HH8A 4JPWL 4LSDA 1E4HA 4QEGA 1NBVL 2JB5H 2ZUQC 1NC2B 3FKUS 2X6VA 5IGXH 4QXTB 1P2CA 1TZHB 1U30A 5E2VH 4XAWH 9CGTA 5AALA 2GY7B 2HG5A 2FZ3B 4XP9H 4IRJA 2IGLA 3N1MC 1I8KA 35C8L 4WAFA 3VRJB 3E1F1 5L2KB 4MXWH 3GBEA 2AXHA 3VGGA 1BOGA 2J4WH 4N20A 4GB9A 5IB4A 4FTVE 2MKVA 3PWLA 3FUJA 4JQIH 2JVUA 2CO1A 2ZAIA 3J2PA 4J3XA 2Q87A 4BKSC 4XODA 2IDBA 1N68A 3ARFA 3KQGA 3M45A 4PJAE 1M7XA 1FL3A 5ICUA 2JCCA 2DV6A 2X4SA 1RJZB 2VZ3A 1E50A 4U3XA 3MRKB 5K1JA 4MD0B 2H2PD 3ECWA 3VXMB 4BH8A 5HI5C 4NB7A 4RKUJ 1KTMA 3DX7A 1Z56A 5KSAA 3FBKA 4KX9A 1QO3B 5G2NA 2X4QA 2CJUL 3L54A 3FC8A 3CXHH 4J6IA 1GGTA 2NPSA 5HGDA 5MEOA 4EIGB 1BXVA 2BW4A 2EXYC 4NQCA 4RMRA 4YHKL 3FUNA 3ZUNC 2VAJA 5TDOB 5CEXB 1CLYL 5AW9B 3EW3B 2AJ3B 3NABL 2NW2B 5D2NE 1KGJA 3BVUA 3MRPB 3QUXC 3AE2C 3G5YB 1PW3A 4KZCA 3P4MB 3VFOB 2PRRA 3QA3A 1C9SA 4I7ZC 1IGCH 4NNPL 2ZYDA 3FXDA 1VQLP 3N42B 4QIRA 4H8HA 2ZZUT 2GQHA 1Z5LA 2BIIA 4XC1L 2R0LL 1AI1L 2HH0H 4KXCA 2CQVA 2BM3A 4ENZA 2DMBA 1AQ5A 1VJSA 2MHAB 5D7JD 2WBJA 4NPKA 2AEQH 1KJ2L 5EC1A 3MRCA 1DBAL 3ZDZF 2JE8A 5JDSB 1YMHB 4QRRB 1D7MA 3JQOB 3QE5A 5E00B 1QWUA 2XN0A 3NIGF 3OMZA 1DJGA 4ZMOA 5IFHL 4M8VA 4D7PA 3QG6A 4GW4B 1FJPA 1NC2D 1G1YA 1XF3A 2OL3B 3B37A 2P48B 5L2JA 1X9RA 1L7TH 3IDIA 1FNEB 1SJMA 2O1KA 4AZUA 1NOFA 4TRPH 3GS7A 1RUMH 4NP4H 2ORBH 4QRPA 3IMSA 3EOTL 5L2KD 4HS6A 5AKTA 5TDPB 4PAZA 4KGLA 3VACA 4KMTL 1FCGA 2GTWA 1G4MA 4QRFA 5DRXA 5C0FB 1EAJA 2QHRH 3KWXA 2E56A 2W5PA 3QJQB 4P5TC 2Q7AA 5HVGB 5KOMC 1KULA 1MFEH 5BRZD 4Y28J 1KB9J 1F2XK 4N8VB 2A45I 1E2WA 4Z3FA 4HUXA 3K3QA 4JLRB 4X4ME 3Q2WA 5I16A 2BP0A 3O0LA 2IOMA 3BJ91 2BOCA 3JV4A 4NKMB 5D55A 3PAVA 3VXMD 3Q06A 1MFVA 1I1CA 4HK0B 2HA1A 2Y72A 1E6JH 4OZIF 2XFXA 3RQ3A 1U3YA 2OMUA 3GK8L 4K55A 1XD1A 2XNDH 5CMAB 5FHBL 3BP6A 4A7SA 2HT2C 4M5ZH 3MV7E 4OLXL 5CCJA 1F3DH 1NMCC 1M6OB 1EANA 4IU2A 3ALXA 4NQQA 4Y4KD 1A3QA 3OLIA 3OKEB 5I71B 1NWPA 2WVVB 5DTFA 2PXYC 3OKNB 2BNRE 4O2EA 2DYRB 3MNWB 4X6FA 1DE4B 4HUKB 2IMNA 1YNKH 5TF0A 2BVTA 3LPFA 5B8CC 1FL6A 3TH2T 1FJ1B 2ZYRA 3JVGA 4WFHE 4CSPA 4NLHA 1XGPB 5IG7B 3MREA 3UADA 3GSRB 3LY6A 4ZW3A 4GIOA 2E7LA 4ZNCD 5A2CA 4P2QA 4ZX6A 1KLGB 2YRLA 1SDYA 4YHKH 5ADOH 4XCCL 3V6OC 4EI6A 3G9AB 1VLXA 1IGTB 5CFHA 2R29H 1NTZJ 1D5ZB 4H8PA 2DIAA 2XXGA 1ZXGA 1N0XL 2R83A 1JK9A 1B4RA 2A9BA 3IKKA 1FDOA 3O3BA 1K73Q 1UGKA 3KDPB 3MD0A 2GJ6D 4N0CC 1JMBA 2IPUG 1SQBK 2LR2A 2KDGA 2V5SA 2YFOA 2FUQA 3GLMA 4KJQD 1KILA 3D39B 1FC2C 3GMQB 3GGWA 2WPVB 4XC1H 3QR2A 2FYYA 1KY6A 5IOKA 1A6VL 3P9LA 3WMPA 3II2A 1U57A 4BBWA 3VXRD 4RIRB 3FUEA 1MCPH 3HLAB 2VZTA 5I8OL 1S5HB 1JJUA 2XQYK 3MBWA 1MW3A 3M9BA 4HHGA 3HMWH 2E27L 5IFHH 3FT0A 5AOJA 3IK2A 2JDIH 1K8DA 4KC3B 3L3HA 2AXWA 2YRPA 4GW1A 3T97A 4XN4A 4LCCB 3BT2H 3K4AA 3OV6A 1GOGA 2BJMH 4W9GC 2XCMC 3B7RL 4HUUA 4YH6A 1L4AA 4G72B 1XGYH 4NQCE 4ATTA 4BKLB 4YZFF 4I5BB 3K6FA 2YJLA 3VD4A 1I4FA 1QACA 4Z95H 4YXHL 2HN7B 1PQZB 2ZCLH 3BIBX 1NANI 3L75E 2CAKA 4MA1C 4XH2A 5IQ9A 4DUXA 1VQ8P 1FFOB 4N0FA 1A7PH 1MFCL 2ZAHA 2ESVB 1MAKA 4M43H 3OX8B 3WN5B 5AFAA 1MLCB 1GW4A 2A7BA 5FO2A 1E5AA 3GC3A 5FGBA 3CVHL 4X7EC 5EEZA 4IEFB 3TURA 1HKFA 2ZCKL 3BAXA 3BFOA 4WUKH 3ZSSA 3BRDA 3BPCA 3C6EA 1HCFX 3GK8H 3NACH 4XVJL 2WQUA 4HIEB 4LVHC 2G5BA 1F18A 2UZYB 2FEEL 1N7SA 3QEUB 1OZUA 5JOFA 2VQ1A 3L5WA 1MUUA 1XSJA 3KS0H 3NJJA 4IHOB 2P5WB 2BEQD 4DO6A 1K4DA 4MD4B 3V0JA 3QI9C 3H1HG 4YPGA 4F91B 2OYIA 5EZIL 2B1AL 5I6LA 5GIRA 2HMID 1K5WA 1BZ8A 4QRPE 3WXWL 5EOTA 2H26A 4PP1D 1HXMA 2CCLA 3A7OA 1F6AA 1D6EA 2LQRA 2VDRB 3G7TA 3DHPA 3IXAB 4YX2L 4HKZA 4PJ8C 3SCMA 4Z7NB 2QPSA 4A7GF 1AXIB 4ORZC 3D6GA 3H1HD 1AR1B 1FLRH 4G6FB 3JV5A 1T5WA 1M1JA 4DERA 1ZRUA 4J3OG 4E0RB 4F7MA 4N6RB 2FH8A 5ALBH 2ENPA 2BSDA 1KT2B 3GWJA 4ZS7L 1QLED 3T8VA 5IEHB 3FOLA 1N0XH 4CSZA 3BSZH 3D6ZA 1S7UA 1DO6A 3DX2A 4J3OD 1IC7H 1KYUA 4LLMB 1FG9C 1OOAA 3QYCA 2N01B 1MFBH 4IL6H 3FB6B 1L6XA 4WY7L 3TO4B 5EEWA 1J1OL 4IBTA 3ILPA 3X1NA 2UX6A 2WPRA 4GBXB 4OZ4B 2Q3ZA 3T2QA 1AO7E 5EWIH 3RVXC 1BWMA 5DZAA 4P04A 3CXHI 4X8GA 3BH9A 5J13C 5B1JC 2ICEC 4I3RL 3I85A 5J1TC 2P8LB 4YDKL 1QFWL 3RY6A 1SQXJ 1AQDA 5AD0B 3GJFK 1CE6B 1H15B 1CDIA 3QWQB 1A4JB 2G5UA 5HHOE 5JMOC 4OUUB 3P11L 3MLYL 4Z7AA 2YGQA 1OVUA 2C1OB 1OSEA 4JFED 3L71G 1HU8A 2ESVD 3U4BH 2W8ZA 4HGWA 5CGTA 2OYHA 3QDMA 4C8XA 1WCBB 3CC5A 3IGKA 3O2VH 1OPGH 3BKCH 5ICYA 4H7VA 1BVLB 4H25B 3FT4A 3EH2A 4W9IC 3KD4A 2QVMA 3M8OL 2Q9OA 1EZVE 2Q8BH 3EHBC 4GI8A 3CFCL 1FLTX 3KVPA 4MCZB 4MWFB 2A9NH 4XWGH 4IOIA 5EZOH 2R27A 4P2QE 3VX0A 3ZKXC 2KZIA 3L71D 5CCHC 3AG3B 4HXBH 3EJJX 3VQMA 5KVDE 2Z1PA 1RK0B 3BEVB 4UB6E 3RIKA 1TNMA 4CAGA 4DP8X 2IDSA 1NGXB 3RJQB 5J1AB 5B39B 1AZVA 3GSVB 1GSKA 3B6SA 5K9OA 5DJ6B 4QRSB 5H37G 3NFQA 2K6WA 4IOSA 1RHFA 3BVNA 2DQTH 3CVHH 1QA9A 3S4SA 3WKML 2V2TA 3WTUA 5FYKL 1U8JA 4GFTB 3FZUD 3NSFA 1K85A 3MV11 1RJLA 4IHBA 4J7RA 1KG0A 3W37A 2ODHA 2IWEA 4HWBH 5IVZA 1AR1D 2I7SA 4G6FD 2CDFA 2C7FA 1Z3RA 2EECA 5LAPA 1QBLL 1UM6L 4ASVA 2QGDA 4NWTL 5DHDA 3U4AA 3IDJB 4NO3A 3EG9B 4GRMB 3RGUA 4RETB 1EXUA 3DPBA 4R8WL 2YMOA 1ZA3A 1G87A 4JM2C 1LNUA 3CQQA 2EO1A 2NY1D 4H1LA 2EYSA 1SQVE 2BVOB 3HLKA 3PH0A 2NUTB 3L4FA 1HJ0A 5GGVY 3WXWH 5K9KA 1N19A 1A7NL 2JWAA 1VQPP 5DD6A 1Z66A 2B2XL 3UTSD 3ZE2E 2W27A 4IGBD 4NQED 2L0DA 1Z3GH 2IPTH 4GBXD 4ZTPH 1X44A 3TO2A 3UIYA 2YEQA 5DUML 1DVFD 5DXWA 3MO1B 2FT8A 4M03A 5BJTB 3AQYA 3OTTA 4JFQA 4M7KL 1CGUA 1U41A 4LEOA 1I8UA 5IQNA 2HB0A 1TNNA 3HTKA 2APWA 1KOAA 4LFHG 2B9BA 1Y8AA 1MAJA 2E76C 2UYLA 4WY7H 1UD6A 3WIFB 5BZWB 1YJDH 4H2AA 3VYIA 3KPEA 5LN8A 2M3BA 3O8ZA 2DY2A 1T5XB 1UXMA 1YN6B 1HOCB 3Q9QA 4YIQB 4M4RA 3S96B 5EEVA 4LFHD 1SJXA 5E2WH 4ZFFB 1JCKA 4QWWD 5FYJU 4FNRA 3PUUA 4GRLD 1ET8A 3D2UA 1RV6X 3BD4A 3CCUP 5IQOA 2OJEA 3VD0A 1ZR2A 1PPJE 4R2GC 5DUBA 4K3DH 1I7ZB 3HBPA 1KWGA 3WNMA 1QNZL 1BQHG 1MCEA 5D7HA 1U4FA 3WKQA 2ADGB 2YKPA 1JHTA 1U33A 3ARGA 5C0DA 3HBQA 3QNZB 5CCGC 1C5DA 1MRFH 5TF1L 5TQ2L 2X1PA 4N86A 4XVSH 2BVYA 3OB0H 2FT6A 2AF2A 4WUUD 4I13B 4N1EA 3TZVC 2IH3A 3B5TA 1IM3A 1FDLH 4U1IA 5K9QI 5GS0H 4EIBA 4IBSA 3BKYH 1CLOL 3JWNC 1G9NC 1AOZA 1LO0L 4GQZA 5DFVD 1X5HA 3E6HB 3M1CA 5FFGA 2WZAA 3FONB 2FYVA 2LR4A 5D1ZB 2O61A 1UH3A 5LBVA 5F7DA 1U9KA 2E5EA 2YXMA 3N3EA 4PRID 3F62A 3NA4A 4XXDA 1KZYA 3KHUA 3KCWA 5JHLH 2K9YA 1QBLH 3NCXA 1X5YA 1V54B 4YK4B 3A67L 1G6RB 2IQ9L 1SVBA 2WLNA 3QDME 5EOCJ 1I7RB 3IE9A 1JF1B 3ZDZE 2FEJA 3RK3B 3HHRB 4R83A 4OV5A 5DJZA 2HPCA 5H2BB 1TOXA 2A6KA 4XE0A 3V0GA 4DJGA 4MX7B 3IJSB 3PREA 3NIGE 4IKJA 4PG2A 1E9QB 1E8XA 2PW1B 4A2MA 5EB9A 2QVIA 1A7NH 1JS4A 3GIZH 2DZEA 4BRYA 1CFVL 2VW7A 3JWOC 5HDWA 1NJ9B 3ROOB 1NDGA 2O4EA 2E75B 3GMPB 4K8RD 3IU4L 4YDJB 3OQ3B 1SHMA 1PGOA 4LCVA 3UO1H 1D5BA 2ZG2A 4RRPM 3LXCA 1EDIA 4X4YB 4K71C 4F3FA 4ZMYA 2BP3A 1HHGA 5LGHH 4A7GA 4JZNA 3M0DC 3Q1MA 3L9EA 4PV9A 4X99B 4P9HL 5F88B 3FU8A 5D6DA 4PV1C 5AEAA 3SPIA 2YAMA 4M48L 3WSQL 3S8GB 3WTSA 3OXRA 3WTYA 2PCPA 5DQJB 1NBZA 3O9WA 4L2LA 3IDNB 3H1KJ 3GXIA 1BF2A 2VDKL 1LT9A 1AR2A 5G5DA 1QRND 1UXLA 3BUDA 5CSZB 1G6VK 4OZIE 5T3ZD 3AZUA 4PLJD 5DD3L 4WDIA 3ZY7A 5F7MC 1QKZH 1XCQB 3CBJB 4YHYC 5GGVL 3C5SA 3EOBA 3CK0L 5JA9A 4L9LB 1BLNB 1J1DC 1R3LA 1T83C 2YKKA 4C7NA 1LE9B 4PJAB 4E42A 1WRFA 3EJRA 4YFLI 3SO3B 3QPXL 1WEJH 1W80A 4AGOA 3T2NL 2CA3A 3DX6B 3V4UH 3VYPA 2JLPA 1KXQE 4P46B 4BJLA 4ABVA 3BP4B 4NHUB 3U7WH 3ZU8A 2BSSB 3T5WA 5D1ZD 3K8MA 3RVVC 3CHQA 1ZOYC 4E5XG 1VPOH 1E4WL 3TFKD 2BNUB 2FX7L 2YARA 5TQ2H 1GCFA 3VXQB 2ITEA 1H3UA 4DKEL 1U8MB 4TVPE 4HC1L 2IWKA 2WMPB 3LEYL 3WDHA 2BMKA 1L0YA 3ARXA 2FVNA 1A6WL 4RRPA 3RK3D 3WEAA 3CZJA 3IJYA 1KELH 1CBVL 2OTJP 2WXJA 4RSVA 3D71A 4Z23A 1DQDH 1WIUA 3Q01A 4EI5B 5D2NB 1MF2L 1X9QA 4FA8A 1CLOH 2YKOA 1NAMA 3Q6FB 3JTSA 2L4OA 3DROA 4UTAA 2X12A 5EU4A 3I9GH 2NT0A 4HFWA 5KTEH 2E75D 1NGPH 3G5ZA 1ACXA 1DQVA 5BMFH 3PNWB 4NM8L 4NN6B 4EZJA 3KNBA 5J6GB 2HUEA 2X05A 2VDNB 4NP9A 4RAUB 2C1PB 5FYLE 4XNUH 2Q2EB 3B9KB 1MFAH 5F0MB 1PBYA 2HVJB 3H3BC 4JE4B 3HW7A 3HRZA 4KJWD 2YUXA 3NTCL 5CS7A 4B50A 3UTOA 4F7CB 2Y7QB 4LESA 2VXVL 3ULUC 3REWB 4ZXBD 5CLXA 2FEDD 3MUHL 5D1QA 1CFVH 1E4JA 4PJCB 1KC8Q 1XXFC 3VFRA 2RFXB 2VC2B 2ROYA 4OLYL 3MLWL 3LDBC 4C4UA 1ZA6A 3IMVA 2QLYA 3GEFA 3QUYC 1B0GA 4XPAH 1ZTXE 2Y2YA 4YZFE 3V4VA 2FATH 3HE6C 3QWOC 2A1WH 2FGWL 1X5IA 4ANWA 1BJ1J 1IL1B 1MXDA 1KEGL 3AY2A 3FTSA 2H89C 2Y69B 4DH2A 3IRZA 1TZIA 3V7MA 2EZ0C 3LKSA 1DUYA 3E6FB 3MROB 3TIEA 4OCYH 1RULH 4LLWB 5E2UH 2VDNH 1KTKE 4Y4KC 1BJ8A 4QRQA 3MNZA 4P46D 1SLVA 3F64A 4MNQE 3QEQA 4AENA 3TOPA 1RERA 2OMTB 1S3KH 2R7EB 4TMPA 5E9DA 5DD3H 1WD9A 3MRNB 3WI9A 3H9SB 4GUCA 3HA0A 2Q10A 3CK0H 5PAZA 2P8MA 2VC2H 4EKJA 2C3GA 2F1AA 1ZANH 4UZSA 2CR3A 2FL5A 4G8EA 3ZHKA 2DYPB 1SFCA 1XCTA 5JQHC 2RBLA 4PWEA 1CDYA 1JXFA 1V3JA 1HAWA 4KO6A 4YJZL 3C5XA 3L3OB 5FGRA 1CURA 1V05A 4NZUH 1NVOA 1KIQB 4HQQH 4JM4H 1QI3A 1OAXH 2BNRB 2ZKWA 3R7QA 4JMXA 4M7LL 1VPCA 3SGEH 4WTZA 3LNGA 1I8LA 2B0SL 4ODSL 4Q97A 5HY9B 1I1AB 1HH0A 3RWIB 1YI2P 1MCSA 1XMEB 5HYJA 1OVRA 4R7VA 4NQUA 1NKNA 4DKEH 4PRDB 3X3FH 4HC1H 5TQ0H 4B9JA 4MCYB 4GT7A 3RK2D 4DCKA 3F58L 5DEFA 3HB3B 4IRZH 4KKAC 3WFDL 3B9KD 3FTYA 1G7IA 3DX4A 3IXTB 2OQJA 5AKSA 4Z0BL 5BZXA 3AEGC 3G6AA 3G08B 3MCKA 1I8KB 4IU3A 4JFPB 4Z7QF 5SWZA 2HUHA 5A2KH 1NTKK 2BY2A 4RA0C 4JFTA 4XNYL 3B4SA 1KB9D 3BWAA 4APQB 1YNTA 4OD2B 5ENWA 4E9WA 2MOQA 1L3NA 3QRLA 4JKWA 4UT9A 2IPKA 5D93B 1ZLUK 3DURA 5FUZH 3K46A 3TWCL 5CD3A 5LGKA 4JO1H 2RACA 2B7DT 4NM8H 2Z8SA 2MCPH 2XN9B 2ZONA 4UOQA 3EWKA 1MQKL 1KPRA 2G4EA 2XPZA 1FL3B 4WWPA 1YEWA 5DZPA 2HSIA 2X4SB 1ZT4B 4XMPH 1I9IH 4IM8A 4L8CA 3STLB 4ZZFA 2DQMA 5GJTL 1RUKL 3NTCH 4MSWA 1YITP 4YPJA 3C6SA 3CH1B 4X6DF 3RZCA 4MQSB 1NCJA 4PI0A 3T6WA 3JCUE 3M88A 3K71A 4W9KC 3MODL 3CN2A 1R5SA 1N2RA 3T77B 1IGIL 3QJHA 1WBXA 3BKMH 1F4XL 2XPGA 3H54A 1JMXA 3TBCA 2P10A 4WI8A 1O5PA 3D9AH 1T0PB 4CBPA 3UYPB 4LLAA 1ZLVH 4X7TA 5JZ7D 3L3DB 3QO0B 4PVMA 4KJMA 4R90H 4W81A 1AHWA 1KEGH 1NTZG 2NSXA 3N43B 4OGZA 4R7NB 5FF6A 3GNML 4Z7VF 5F1IA 1RIUH 1ZE3C 1Q4NX 2DYPD 4PREA 4BK5A 3AT8A 2F61A 5C39A 4P5KB 1IBZA 4ZRGA 5F71A 1O6TA 4Z7OB 2IALA 3JTTA 1N6VA 4RFNB 1JFQL 1NTZD 4P4KB 1DSFH 4YLCA 3KPQA 3N91A 1LL1A 2H6PA 3MRRB 1JZFA 3U0WL 1YEGL 1HJBA 4PGBA 3VGDA 3N0AA 2HXAA 4YC2C 1BFVL 1YMMA 3PHOB 4KDWA 5IB5B 4PP1C 5CEYA 4ATWA 3WTWA 4JUSA 5DHVA 1TPXC 4Y1TA 3FTXA 2Z4EA 4J3UA 2X0UA 4JL2A 4LVNB 1YEIH 4ORGA 1UJ3A 3ARQA 5D1ZI 5TPWL 5I73B 1P4IL 5FUOH 3DHMA 1PZSA 2X6MA 1ZHNB 4KTGA 3TIDA 1EV2E 2QV2A 1XFPA 1I8IB 1IO4A 5D1QE 1H5BB 1H6FA 3FT3A 3CDYA 1GL4B 1A9BA 2VXUL 2FB4L 5ABDE 4OCXL 4N68A 4RISH 1ADQA 5F9WC 4HLEA 3RWJA 3FOMA 4QRPB 1HOEA 5I1EL 4UYQA 4MS8C 3ATAA 4R5TA 2QRXA 2QA4P 4J3OC 1MSPA 5H4YA 2GG1A 3T0EE 3APDA 1BZOA 1X7TA 2Y4SA 4GAGL 1G9EA 4PW4A 3RAJL 1JPTH 3OJVC 2Z8VC 2XN9D 1JPSH 1TENA 2JCWA 2ICWJ 4HCFA 4JJOA 4UIMB 2AQQA 1Q72L 2HX7A 4KDVA 1JI2A 4ZMWA 4S1SL 3PTZA 1BE3E 2BZ7A 5JUEL 1QSEA 4FQ2H 4DGYH 1RF1B 3QEQE 4OFQA 5E5UB 1DLHA 3FFCE 4L8BB 4BXSV 4HULB 1TZAA 2CPBA 2HFEB 2O30A 2WBKA 5KYUB 1TR7A 1HNFA 3QCUL 1SXBA 4NCC1 4EPSA 4P57B 3K91A 2IX7C 2FY8A 2OZNA 3I6SA 1TVDA 2J2ZA 4F7PA 1O75A 5LBSH 3WNKA 1AO7B 3M1OA 4KJYA 4U49A 3GBLA 3MMEB 4GKZB 2VDOB 1QBML 1NPNA 1A6UH 2RJMA 2N0KA 2OMVA 2HVKA 4JKMA 5HHOB 4NYLA 3SD5A 4U1GC 1N3NA 3P7KA 2Y06H 1TITA 2AJZB 5ESVB 1WICA 4X6FB 3UH8A 2XY1A 1NFAA 3M07A 4WU7A 1AACA 3MODH 4P4KD 5HYJE 5MP6H 3BP5B 1INEL 4CGUB 3MREB 2EUWA 1FVEA 2QT6A 4J4PA 2Z65C 4KRPB 3DIVA 4P2CG 5AZEH 1FFQA 1CDUA 4LLDB 2R2EB 1J0HA 1JF6A 2WNKA 2WLZA 3NZHH 5IHUH 1S9KC 1UQSA 3QK0A 4EI6B 3O2DA 1J1PL 5J12B 4WWNA 3LEXA 3GTVA 2JR8A 4ZSOA 4TSBH 1HEZB 2WAHA 1ROWA 4KUZL 4M62L 4UB0H 3G4SP 1DQTA 4XAKE 5SWZE 4AQRD 4NFDA 4K94C 5DD0L 2X0WA 1HCYA 1OP9A 4K9EH 3S5LG 3QZBA 4JJ5A 3MJGX 4L4VB 4OCRL 2FYYB 3MHZA 3Q1EA 2NY1C 1W2EA 2BOBA 4MQTB 1RZKC 3HG3A 4F15B 5A2JH 3VFNB 3A6BL 2WZ5A 4ZQTA 4NT6B 3FO1B 1C7TA 2FX9L 4KI5D 4NQDB 1M56B 4DHLA 4ZMTA 1SQXG 4LPXA 1J8HA 4RMWA 1G7PB 5ELIA 4IGBC 3VI4B 5JLZA 2O6DA 3BSGA 1LWRA 4E41B 3VMOA 1QFOA 1CK0L 1DVFC 2OMYB 3G6JF 3PGDA 1SDDA 4UOW0 5D8JL 5EBWA 2CA4A 2JFCA 4XE5B 1S7SA 3GMOB 1LEIB 1BM3H 2CDGB 3CDZA 3P2DA 5JHDE 3T97B 5KVDH 1SQXD 4QRTB 2C9RA 5FOBA 3CFJA 2O5ZH 4UB6H 3W67A 1FV1B 1SMDA 3S3SA 4A37A 4PS4H 5D72H 1OSPL 3WY1A 1N6UA 2Q2LA 2E7HA 1TJHH 4MMXA 3S97C 2YFNA 3SDAC 1AQTA 5MENE 2XQBH 3WEXA 3D3VA 3DDGA 1KY7A 5GGSB 3QZWB 5JIHA 5CCHA 1GW3A 5EUOF 4OZHF 5DT1H 2ITCA 4H13D 1T89C 1U2CA 1MEXL 1U91B 3O11A 3MA9H 2MNWA 4L5FL 2RB8A 1ZGLM 4S1SH 4CU8A 3OAZH 4LKXB 5EIVA 3ZTJH 3SKNA 2G5RA 4I77L 5CFAA 5AOKA 3ZTCC 3AUWB 4NN5B 3EGDB 4QRUA 1LEKB 1Y1DA 1B0WA 4GRLC 4GG6A 4WU5A 1YMME 1U8PB 2XKSA 3DX8B 3KLDA 3EDFA 3SGEI 1S46A 1E2VA 5AW6B 3ASOB 1EDYA 4HCGA 4Y8AA 1KGYE 1S7QA 3ROLA 3ENEA 1LO2H 4DOJA 2O6PA 4WHYH 1QBMH 1W8EA 4ONFH 4PCKA 3EADA 3LVEA 4IJTA 1KGUA 3TN0A 5E6SB 5IMOA 1F6AB 3GLDA 4L4VD 3FWLA 2Z6FA 4GXUM 4KY1H 2PPCA 3CG8A 3IETB 4NKQB 1T1YB 3ULVF 1E67A 2P42B 3RTQB 5DYOB 5I24A 4NQDD 2JKWA 1M56D 4F7MB 4O2CB 1U95A 1OGAD 2BSRB 3TF7C 3O6MH 2NNRA 3ECBB 1SYSA 4NUPA 3TLRA 4A68A 1QSEE 4E41D 3BKJL 5E95B 3CZFA 4BGLA 1P5UB 2CO7B 5CGYC 3E80A 4G80A 1ZGLA 1NBQA 3AACA 4YN3A 4OCRH 2WD0A 1RE4C 4ZUSA 2XKUA 2B59A 1KLFA 3V9EA 1HQRB 2UXVA 2ZCHL 3EYFA 3UG3A 2G3XA 4EEEA 3US1A 4X7CC 3RB5A 2WXFA 4I3SL 2FX9H 4RMVA 1AGFA 1FHNA 4MMZC 2OXGB 4BXLA 1QL2A 3F7YB 4HKZH 1BVKB 2W65A 2W80C 3QULB 4JO2H 1FUNA 1AGCB 4O58H 5IY5B 4NZTH 5LWYH 1SQMA 3ESUF 3QBTB 5HYSA 1J05A 5D8JH 5BS0A 3QDMB 4M56A 3IWUA 1T03H 3GYRA 4YO0A 3OJ2C 3ZDZB 4TULL 2X9XA 1T2QL 1BYPA 2XETA 3FT4B 1UOVA 4UINL 2Y07L 4D8PA 3HS8A 1LD9B 1CICD 3BT0A 3WENA 3OHXA 3JT2A 3GG2A 3CFKB 1SN2A 1X6LA 3MOBL 2DQGH 3GMRA 4NQXB 4U0QB 4X8JA 1EA9C 4TVPL 4EUPA 2PO6D 4BZ2A 1Q90D 1EFQA 4LASL 1K6QL 2P24A 1UOLA 5EOCH 4ZSOE 3WDJA 3GSNB 1F4HA 4OIBA 2MWCA 3GO1L 1HGZA 1CD1A 4U6VL 5FO8A 3KGRA 3OD3A 4MLSA 2BSEA 5DJCB 4JFHD 2CRMA 4MA8H 2OSLA 4JPSA 3CPLA 4NFBA 3SYOA 1FZAA 1DDTA 2R9HD 4JG1L 2KS1B 5ES4B 1RPUA 2WPGA 3H7BA 1AE6H 4UNVA 4LCUA 1IC2A 4MN4C 4JBSA 4PLJC 1AJ7L 1NC4A 3UTTD 3GBNL 4CVXA 3VNYA 1NEZA 4OGQB 2EC9T 1CVSC 2BVQB 2XRAL 3NCMA 2ZWSA 4LLHA 2WHVA 3CX5J 3C6LA 2VNCA 3CHSA 5I75C 2EDJA 2OP4L 2YPLA 1NFDB 4TM9A 1J8HE 4GJTB 1QVGO 2NY4C 3KVDD 2ZX9A 3UOAB 2G9HB 2CUHA 1L0NK 2NXYC 3EO0B 3HD7A 1BQRA 4BINA 1JCCA 1BFTA 1CXLA 4OZIB 3FO2A 1CZ8H 1Q0YL 4A7VA 3FCUB 4I0PB 4JQVC 3AJ7A 1DVQA 2M2DA 3AG4B 3T4AB 1PJ9A 1OO2A 1HH6A 3GSNH 3SBQA 5DVNA 1EVTC 2QKIB 1KIUA 1JGEA 1URQD 1T7WA 5DD6B 2FH6A 1PYWA 3S5YA 2XTJB 3D3VE 3O8XC 4NJ9L 1ZTXL 4YHNA 3IJHB 4UQ2A 3PAUA 3WLWC 1ZPLA 2CE6A 5CZRA 1ZMEC 2YGOA 1PGJA 5KJ7C 4HISA 1H3XA 4XPTL 1KTJA 1U8CA 3KAAA 2X6AA 2QJKB 2AQTA 1GZQA 5FDWA 3BKJH 3RWDA 1YYLH 1EDHA 1YY8A 2CHNA 4LDCA 2EIDA 2OTWA 3GB7B 5KLVE 3ZTNH 1S5LE 4AUUA 3EKCA 4BZYA 3HAEG 1U58B 3H1KG 2DLFL 3QFJB 3WEBA 3B5NB 3T6VA 5A40E 1IZKA 3PUCA 4WHTB 1JV5A 3M0AA 3OPZH 5IUSA 2IF7A 1YTZT 1MFNA 3A22A 2W60A 5HGAA 2DDQL 5DRNA 4Z7QE 2FXOA 5K93A 2GTZB 3SQBB 5T3XE 4HSAC 3MBXL 4PJ0E 4ZXBC 3BCDA 5JIQA 3TBTA 3H1KD 2MQGA 1UCBH 4XNMA 1NGWB 3NZUA 5GGRB 5LUMA 5AW1B 3UMNA 3PL6A 2FHCA 3CMOH 4A38A 3D2UB 5IFAH 3QHZH 3OA7A 1A02F 2B1OA 1YPZF 2L7EA 3HPLB 1EJ8A 4Q4EA 2ZP0T 2KLSA 4PG9A 4HUWA 5C0AA 4JG0H 5CILL 4ZAKA 2YOCA 3TV3L 4YXWH 3FWNA 4K35A 1FZKA 4TVPH 5C0DB 3ZKMD 1A3RL 5F6IC 3EO1A 4H5SA 1K6QH 4JL1A 5C9KA 3MRHA 2GIMA 4LSRL 3CWGA 3MX0A 1MUJB 2Y9RT 2YK1L 3FU7A 1EZVI 1IAIM 2PW2B 1MCOH 5EZJA 4HKJA 3SDXB 1ID5I 1JVKA 3DOHA 4LLYB 1ZLSH 4YMPA 1S6NA 4D6TJ 5IQMA 2N1KA 2C3VA 3GBNH 1QEXA 2VRKA 3FBQA 4Z7VE 5F7WC 3ZIMA 1SQQJ 3J07A 4HPHA 2VW6A 4LSUL 1E42A 2XTJD 3C9NA 2MQCA 2OP4H 2X4OB 4KVNH 4N8PA 2ZOOA 2GJJA 1S8DA 5FYLH 3OKLB 2AQ2A 1N5AB 1HHKA 1YEKL 1SMAA 4ILDA 2VZ1A 1UUNA 4MNQB 2X7LB 5B7MA 5BS0E 1SQPK 4FMVA 5J9PA 1I7TB 1TKWA 4PI2A 3V5HA 1G1KA 2VAAB 1Q0YH 3J8F7 1S7RA 2VLKA 4PJ9B 4F8PA 4OV5B 2FWSA 2R2HA 3MI6A 1IGML 2EYTA 2UUDH 1HHJB 5IHWA 4B86A 3VTAA 4JGJA 5FWRA 3HKZA 4YXLL 3FTUA 4P2RD 3DGCR 5E0FA 2IPUK 2WXLA 4MJJA 4O9HL 4X2UA 4X6BA 4NHCH 3RK2C 3QFJD 1IEBA 4GNKB 4Z78B 1CG9B 3VFVB 4YQXH 1X5FA 3D51A 2AV7A 2ZXQA 5DO2D 2A9CA 3VTTA 4LBEB 2B4CH 2LU3A 4CKVX 3FS9A 4ZPVA 5I1IH 3SDCC 4B7LA 3HVDA 4R7DB 1HF9A 4KVPA 3ZZSA 3V5DB 4KDTA 4MDIB 4NRXA 3KL3A 1K8IA 3GTNA 4IBUA 5SWQA 3S8FB 5I1KL 4M7ZC 1WZAA 5CZVL 3LD8C 2O93L 4PJXB 3O9WB 4KTEH 5H2FE 5KJRH 4P07A 3VI3F 1YEDB 1QFPA 4HF5H 5JR1L 4DN3L 4YSSA 2NY3D 2L04A 5ITFB 2FXPA 1OM3L 4OH2A 2P1JA 5GS1B 1R5VA 4M1CC 1KXVC 4WWKA 5I0XA 3FXIC 4N3UA 3O45A 4ONOA 3TVMD 3ML8A 3CHOA 1E4XI 2QZ5A 1Q86Q 1OCRB 4X5XA 1P7QB 4FQ1H 3HE5A 4U6XA 2D7OA 4S0SD 5LVEA 3H85A 5F70A 3V4VL 3KW8A 3MUZ1 2V37A 2UV3A 1MJ8L 2E9BA 3ULAB 4ODHH 2MKLC 3OF6A 3KWUA 5IVXF 5PCYA 1AA0A 5KSVA 3IDYC 4FRWA 3EYSL 3CSYA 1SUJA 2NY0C 4F37K 5J1SC 1YC8A 5F6HI 3ILQC 4M3HA 3V9FA 2YPKA 5C9JA 4WFFD 3TGUE 3BUYA 4LRIA 4S1QL 2OMXB 4TUJB 1R9FA 1ZK9A 1U6AL 2BHYA 3DPDA 1AY1H 4FG4A 4KKBD 3A6CH 4N2HA 4Y4HA 1G1JA 5BU5A 1KMIZ 3QRGL 5C07E 2WWNA 3KLHC 4DT2A 3TU6A 4L3AA 1NCCH 2A77H 3MACH 3RBSA 2K7QA 4TYUA 4Y2DA 3JC22 5IWLA 3JTSB 4XZUA 1YRKA 2QFPA 1F41A 1M05A 3B9EA 4HEPA 4FEMA 3U25A 1JHLL 4J3TA 2WIMA 1NBYB 5CJXA 2FYUJ 1YEKH 2Z5IA 1LO3L 4N4YB 4TSAL 5KVEL 1MJ7L 1OLZA 3LCYA 5EFIB 3V9CA 3T6QC 2AERT 1IAKA 4Y8DC 4ZQKB 1MVUB 5FUCC 4F20A 1IGMH 3A4FA 1ZVSA 2OR9H 4LBAA 3JCUH 1HDMB 3QORD 1P7KA 4QXGL 5DR5H 5BQDA 5C0AE 4G3YL 1DD4A 4GIAA 3V5KA 3KXFA 1T1ZB 3G6JE 2H3NA 1N73C 4H8UA 2JJUA 3MUJA 1N12A 4LU5H 4O9HH 1TTCA 2ICWB 3HHSB 1JYXA 3U9UA 1JERA 1KJ3L 4LRNL 3VFRB 1L0NE 4KK8C 1RF0A 1LM8V 1LTTC 2QGCA 5AW4B 1LP1B 3H56A 2F9BT 1NAMH 1KPVB 2X3AA 4TLSA 1X7QB 1R3HB 5I8CA 5TH2B 4UTAH 2BDNL 4LEEA 2XKNB 3LN9A 1HHIB 2IADA 5EUOE 4OZHE 3T0EB 3SJVD 3TCTA 2JMRA 1JIBA 1P7QD 4UIKL 1RZIA 4WY4A 2YSSB 2ALAA 1TZIB 3KYAA 3MOQA 4J23A 5D7IF 2V5MA 3S35H 3T0VA 1NLDL 2ED7A 3H3PL 4IS6A 1DLFH 4J3VA 1ES0B 3MCYA 2WT7A 2R1XB 2ZP9A 4L3CA 5K59F 5JR1H 4OFYD 2ZWKA 3FFCB 4NQSA 3X14A 2VLKE 2X4UB 3CBRA 4AEIL 1FQ9C 4AVHA 5TJHA 4DP0X 3IPEA 3RUGF 5AYUH 1JSYA 3NJIA 5F72S 5FW8A 5FECA 4RQQB 3CE1A 4QY8A 4J6RL 4KK5D 1JEKA 4LSSH 5JPNA 5E6IA 3OBAA 1OT1A 2ED9A 3QO1A 4KU1A 1KJ2B 1MCRA 4U3CA 4GQ9L 2G2NA 2IVFC 3JYBA 4N5ED 4D7BA 5T1DL 2I9LA 1LDPL 4C83B 1F5WA 4L1SA 5D5MF 1XO8A 1ZOXA 4FTDA 3EOAB 1YPZA 4K3JL 4BRVA 1P4LB 2V3EA 1IGJA 2J8OA 4ODVH 5HYJB 3ULVE 3SZKC 3NVQA 1CL7L 4YHIB 3Q43A 5I74C 4ELKA 3DJRA 4NENB 5DEFB 2FD6H 2GVYA 5I30L 3QQDA 4RMQA 4KI5C 2A06G 4FXGA 4OZGB 1O7DC 3WNPA 1RZJC 3I56P 4X9HA 2GBUA 3GZOA 1SEBA 3B2XA 1PG7L 3FUDA 2WXQA 4M6OH 2AXCA 1FZCB 4WJ5B 2A06D 2F8XC 1G0DA 2FIRT 5T1KB 3MTXA 4TSAH 5CZKA 1GVIA 3ZL4H 1DEEB 3AY4C 1MJ7H 2YKLH 2EUVA 4Z3JA 1CWVA 1O0VA 1Y7VA 4HIQA 1MHEB 4TNWF 5EBGA 4CUCA 1PD6A 2J1YA 4X8XA 3PS6A 4AV4A 5FM5M 5JXAL 4EI2A 2W0FA 4JDVA 1TMQA 3KPMA 4JRYE 4JQ0D 4QXGH 3VM7A 2KL6A 1MQ8A 4P23D 4H13C 1PS3A 5HD8D 1FH5H 5CAYB 2V2XB 2W91A 3VWJC 4L8SC 1Q82Q 1TQCB 1UATA 3WS3B 2C3XA 5JHDB 3SYQA 5SWSA 3WFHA 3MRMA 3VD2A 2XQ0A 3LZLA 2NY5C 5AOLA 4XMLL 3OQRA 1UACL 2FJGA 4G9FD 2JI3A 1TEGA 4ZUUB 5FK9B 4P3WA 5CBEA 4ZMLA 4X6CA 4M93B 1LTSC 2BDNH 2R5DA 2W88A 4GAYB 5MENB 1IARB 4A2HA 3SDDC 4BIKA 1F3RB 1PD1A 4G8GA 1VZGA 3Q5RA 2Q6QA 4IMKC 4UT9H 2X1OA 2WZ7A 1EK3A 1F6LL 4MDJA 5T5NG 5CP3H 3U1SH 2HYNA 3V0VA 4H8WL 4WI3A 3HBGA 5BU8B 4LIQL 1W2KT 1SBSL 1WFUA 4HLZG 4OKVA 2WJ7A 4V1DE 4OCNC 4ANXA 3N6YA 1T4WA 1AGEB 3QXTA 5DWUL 5CR1A 3R0NA 3P30L 2FLRT 3H2QA 3RWEA 4KXBA 4AIOA 4FI7A 2Q5BA 4PGBB 5A16A 3V2PA 3ARDA 2EDLA 2FIKA 1GAFL 3W9EB 3WS6A 4WO0A 5DQ9A 1GH7A 2X2UA 4C47A 1UJ3B 3IPFA 4G6ML 3PDOA 3FTVA 4JANB 4NXKA 1Z0MA 1ODUA 4DF9A 5GJSL 4UILL 1JTHA 1AQKH 3GZKA 3JV6A 4YGVB 5EDSA 1H8AA 3NJMA 1JNHB 3PQYD 4R0LA 4ZYKA 1UVQA 1G7LB 3MXWL 2R56H 1JUFB 4JDEB 4HWEH 2GEQA 5HYIA 2V2WA 5DMGD 1DBKL 1B6DA 5KEZA 3GTTA 1BFOA 2H6OA 3HE4B 3Q1SL 2FNWA 3CVBA 2WZPD 2VRAA 2FJHB 4HFUL 4XPBL 3QXDA 5T1KD 1KGCD 5EZPA 1UASA 1WT5C 4N2BA 3TA3B 3DC0A 2R5BA 5BW7A 2BP8A 3BWUC 1RU9L 3EJUA 5E8EA 3SKJL 1JPFA 3ZYJA 1FFNA 1AD0A 3MNVA 5IVXA 1AOHA 3MC0A 1DBJL 6CGTA 4MXVE 3EAKA 5DHVH 4HUCA 3LKPB 4OQ1A 3ABVC 2BEZF 3L4CA 2JTYA 5CO1A 2LTQC 3P3UA 3PP4L 3WFCL 1G7MA 4XO3A 5FM8A 3RWFB 3EFOA 2AS5M 3N44B 3L3KA 5IEKA 1FZJA 4ZDHA 2FBOJ 1PDKA 4Y4FD 1JD9A 3BAEL 3L1OL 1CICC 2XFGB 3GI9L 2K6ZA 1ADQH 2J5LC 3HUJB 1ET7A 5IFJB 4KJYB 3N55A 3IGLA 2VMJA 1X5KA 4M6ML 1A9VA 1I3RB 2PO6C 1A1OB 4LQFL 4EDFA 2HVKB 3H32A 2OJZL 4UMGA 3FGAD 2H4EA 4WVRA 2Z92B 5C0RH 1F2QA 2IANB 2F6AA 5FYJL 3QC6X 3MBEA 5I9QB 1S3RA 4JRXD 1LP9A 1KXTB 1YPZE 4KKLC 1RH8A 1GJIA 3UG5A 3C08L 3K6SB 3H1JJ 3O6FC 4PJEB 3C5JB 3TONA 2I9TA 1FAVA 2W9EH 2ZSWA 4ZUVA 2YAPA 3WAKA 3CC1A 1SYVB 3DHJA 2ATKB 4JHAH 5IJCC 3ATDA 4CVUA 4PTTA 4FQQB 4LSPH 5I1GL 4JO8A 3MCLL 2B88A 5E0QA 4RGMC 4X4XB 1F00I 3RP1A 4ZMXA 1MFUA 3KBFA 2E59A 3I6KB 3VA6A 4GI9A 1T6VN 2WXIA 5AL0A 2IBZG 3IFPB 4QHNA 2J3SA 3GSOB 2E9GA 1U8NB 1SBSH 3CWBE 2L7JA 5I6XC 2J55A 4OF7A 3QQ3B 4FKKA 3TPUB 2XWXA 2IXQA 2DAVA 5D7IA 1UYWL 3BIKB 5AVWB 5B3JF 1RE4A 2O1JA 5KTBA 1GC1L 4R5VA 1KBBA 2FX8H 5KANI 1JY2N 2IBZD 4DKAA 1URQC 4F5CA 5D2LA 3F3HA 3TT3H 2KK7A 1NSNH 1IRAY 4UU9A 2XG5B 1KTLB 1TJMA 5BRQA 4LOUC 3BYTA 3C60B 2IQAA 3T1FA 4JFZL 3L72E 4NPFX 1MIML 3CX5H 3CDZB 3K2IA 3DYOA 1VGEL 4DK3A 3V4QA 3O2DH 5ESAB 2PTVA 3IEAA 3DMMA 5SWSE 4Q6KA 4OUOA 2A6JB 4AL8H 5A3IC 1UXSB 3DBXB 1RUPH 4ZFGL 2ZT9D 1KB5L 3BISA 2APXA 5GHWH 3ZGHA 1TVHA 3I6GB 2JQZA 2W07A 1XGUB 5D6CA 4YSCA 1YECL 2K70A 1OTTD 4PRBB 4HFUH 2AABL 5IBTL 3A47A 4PGZA 4DKFL 4KROD 1BXXA 2K88A 4ODXA 3OKDB 1J10A 1ZTMA 1RU9H 3DXAE 3O3DB 5KAQF 3SKJH 4PWKA 4CW1A 1QHOA 1IC1A 5HYQB 4LVOB 2XNXA 2D4DA 4YSOA 5C09A 3HI5L 1CFNB 1OT4A 3CFBA 3G9VA 3POCA 2IAND 1YN7A 1RZ8B 5EORL 4MA3A 1T21A 3VVWA 2IOIA 3UTQA 2ETWA 3SKMB 3HUSA 4F58H 3S36H 3UZQA 1F45A 1JN6A 2VDMH 2CALA 5EIIG 3BAEH 3VI3E 2ERJC 3A6OA 1V55B 2WQ8A 3CX5D 4L8DA 5CU9A 4O5LH 5DUPL 2WLMA 1FAIL 5GZOD 2IGFL 3WMQA 4BZ2L 2WP3T 1VENA 4HK3N 3IF1B 3AU0A 1HBWA 1LTJC 3V4LA 2P43B 2PCXA 4BHUA 5CBAB 5D7LB 1NKRA 2GITB 3C08H 3OB8A 3STZB 5G4OA 2AITA 2P80A 5CR8A 4KWUA 1ZHKA 3SHSA 1IFIA 2C9PA 3C2AL 2AJSL 3O8XA 2NXZC 1ID2A 4QRBA 3EGSA 3AVEA 2EDFA 4KHTH 4X6DB 3D18A 4TTDD 3CCSP 5IVXE 1SQBJ 2CK3H 1LYQA 4EBQL 1JOCA 4N6QA 1G9NL 4C58B 3OWEA 5I1GH 1SYSB 1S5LH 5D7KE 2UY6A 4QNPF 5E1AA 1XH2A 1RIVL 1UM4H 2IAMB 5H94B 4EYYQ 4LAJH 2ZQKA 2XVBA 3O41B 1KDJA 4JJHA 4BH7A 1YEJH 2CH8A 1A9EA 2A9AA 3QH3B 4EN3A 5T3XH 1OPOA 3CXDL 2D8KA 5TE7H 2DIEA 4PJ0H 3U36A 1OP4A 1KLFB 3GD1C 3K2MC 1UYWH 4Y5XB 4Z7VB 1AYOA 3OHMB 5LAXA 5CKAA 3WL9A 1KN4L 5JORA 1USEA 3LKNA 3NQIA 3FX0A 2JJTC 3OKMA 4IJ3C 4NZDA 1NGQL 1SM3H 4YHZL 4FQLL 4N90D 2A73A 4YSEA 5HHXH 4PRHB 3FT2A 1IQWH 4KX8A 4ABUA 2V6HA 3RL1B 5ADPL 4CGTA 5EC2B 4G83A 2QQNL 1E8YA 4UM8B 1YUHA 4D0DA 5IMKB 4RAHA 3RPBA 3AUVA 4G7YH 3NCFB 5AZ2L 2WWMD 3MLUL 4FLSA 2GHZA 2PYEB 5DJ2B 3JUZA 5CLWA 5MEPB 4U6YA 1MHHA 3DJTA 3MJ8B 3I50H 2YAOA 3UABA 5IB2B 3H9HB 2E74B 1EO8H 2JSFA 4PWFA 4X8JB 43CAA 3OL2A 5IMLB 1BEYL 3L1FA 2QM8A 2KSJA 4N2GA 3K2KA 4EUPB 2HKAA 1ZPUA 2CHXA 4XTRC 3O3AA 3G04B 2YMKA 5DHXB 4PSPA 5DS8A 3RDJA 2OPCA 1L9NA 3APFA 3RWHB 2H1PH 4A6YA 5FYKD 4JAMA 1XB3A 2OSLB 1THAA 4B27A 3B2UD 1NCHA 1ORSB 3CMGA 4LPUA 4Y19B 2YD1A 2NY3C 4S1DD 1JPEA 3O4OC 4D6TG 2F54A 3WUTA 3KPNB 2LVEA 3HI5H 5LNEA 3WJMB 4HHAA 1EGJL 2FQFA 5D7IE 3TVMC 1T04B 4PD4K 5EZLA 3H1IJ 4BA8A 3MUUA 4POZD 4GSRA 1D9KD 3L1GA 4MAYA 4DPBX 4Q9QH 4NPDA 2W95A 5D7LD 3UDWC 1VEMA 1RZGB 3RFZB 2HRHA 3LQZB 5A2FA 3LQMA 4D6TD 1BX2B 1T4KA 4TNVF 5K59E 2EDOA 1XF4A 1R46A 3L7EA 4GKNA 4PV8B 3VDBA 3MP7B 3NJKA 4LGDE 1Z0NA 2I1JA 3K2UH 4HWZB 4JFDD 4MNGB 4XN7A 1AQHA 2XNAA 4L37A 1MLBB 3DSNA 1MNUL 1N59B 4PB9L 1XF5B 2IGFH 5GSVB 4M1GL 4EUPH 5J11C 2BASA 2IAMD 1IGFL 2JKVA 2UY7A 3PU7A 3CFDB 5B7EA 2VL5A 4IYKA 2EVIA 4G9DA 1RH5B 3OKOB 4N2LA 3D85A 3WJJC 4KVCH 1F58L 3ZKND 5KOVC 5ICZB 2NT1A 5LGJB 4NQVB 1MRDL 1PYWB 2WTPA 1LQBC 2VDPB 1P6FA 1T20A 3BQUC 5IROD 3D0LA 2XDJA 2DWSA 1SJEB 3L37A 4PSRA 5D5ME 2OMZA 1FGVH 1WE5A 2AV1B 4AQ8A 1O6SA 2CGZA 3NH7L 4EBQH 3QFGA 4DCQB 4PS7A 4FXKB 2QQLL 4YDVA 1LO4L 4B0MB 3VMYA 5JOPE 5C09E 2IZ0A 5FDWB 2LAAA 5H2FH 2AJXL 3U2JA 4JF7A 2YUWA 1BMGA 5CXPA 5ECJE 2IDQA 1RLBA 3PP3H 1D7DA 2PYED 4X9FA 3REVB 1DZBA 3D07A 2EE0A 1R47A 5FC9A 5C07B 3ZLQC 4XNQA 1U2YA 1CXKA 4KZEH 3NPSB 1Q9OA 3AMLA 3QUZA 5TE4H 3MZGB 3TBVA 3ZRSA 2FJFA 2PP7A 4YHZH 1BBJB 1ZRTE 1SQ2N 3FCSA 3LS4L 2VDPH 5ADPH 3SPVA 2ZFCA 1Y47A 3ULUL 4N0YH 3NSXA 4X7SL 4Y19D 2MPAH 4E2OA 1L0LK 1E5WA 3NJGA 4PJFF 3L74J 3BVWA 4G43B 5AZ2H 4FABH 4Q89A 4OJFL 3KR3H 3AEAC 5JA8B 5C0AB 1KYOE 2R23A 1LGVA 3TNMA 3QIUC 5D71L 2XV6B 3G6JB 3LQAC 3CDGA 3WIIH 3SGJA 2DJSA 4YGAB 2X70B 4ZTEA 4XNXH 1IAIL 3EO1B 4XP5H 4QO1A 1G9ML 1CU4L 4OFKA 5L0QB 3AMKA 3EXJA 4BWWA 1R0AL 3N85H 3AREA 2J59M 4WO4D 1BYOA 3ZQ9A 3JSSA 4DAGH 4HMDA 4Y1AB 2LXCB 3TBWA 4OCWL 4PJIF 1G4RA 3HC4L 4PJDB 4FZ8L 1H3WM 3MLVH 1ZK5A 2GHWB 3CX5I 5BCAA 5EUOB 4OZHB 5C2BL 3KPRA 3RWCA 4G2AA 4GXFA 3TEWA 1HL9A 2MMXA 5A7EA 4Y5VC 4X0KB 1L9SA 3WE6A 3VG9B 3GSUA 3GMAA 1AZBA 4KXZH 1G1CA 2F7PA 2XSKA 3KZIE 4P48A 2JLLA 1IEAA 1S8DB 2FYUG 4PRNA 1Q2NA 3B2VL 4XGZB 4XPHH 3OKKB 2DTSA 4KITB 4XCEA 3MLSL 5IJBC 4JPKH 1LE5A 1HVVA 1UOKA 5EN2B 1TKWB 4NC0B 5AVYB 1CGSL 4PBWD 2VLKB 1MAML 4XN9A 1UWGL 1QFUL 2CLZB 3BEWA 3FTWA 3MGTB 4Q4IA 3RKDD 2FYUD 1JXKA 2CMRH 2YD2A 3LS5H 1TZGL 3CC4P 2EE9A 3WUWB 1ZWIB 1VFMA 1TLMA 1BZQK 1HZKA 2D73A 1UB5B 1ED3A 3SSUA 4GOFA 3E2HC 4XX1E 1A14H 4U1NB 1C5CH 3RX5A 2V7HB 5A2IH 1P84D 5EFWB 4AOFA 2Z31B 3Q8FA 3NH7H 3IDMA 4GQQA 4ZPVB 2F74B 2B87A 2F54E 4M5YH 2BVEA 4AK1A 3MHVA 1U8KB 3AWFA 2AXFB 3E7JA 3MXVH 1NHLA 5TFSH 2ED6A 3KEDA 4KRLB 1L9TA 4UAOB 5AYQA 2C3WA 3X3GL 1NWOA 5DZVA 4AVIA 3HS0B 2FO1A 1TTUA 3CSGA 2J88L 3LIZH 1L4IA 2Y24A 4M61B 2AK1L 3MUY1 1UD5A 3QS2A 4P23C 4MNHB 5DGQA 3SKOA 5HD8C 4E9YA 3EH5B 1ZSDB 3I02A 5DURB 3EYOB 12E8L 2YIHA 4N78D 2AJUH 4WWKB 3S36X 2FFDC 1CBJA 2D31A 2OMWA 5IW3A 3DTXA 1MFDL 2BO0A 2FWLB 2G2PA 4P5SA 4W7YA 2A0LC 3O6LH 1JDCA 3ABGA 3PGFL 2P8PA 4Y1AD 4K15A 1K4CB 3PWVB 5AAWC 1IM9A 2D2OA 2KI7B 1D5MA 3GXMA 1IFHL 4GRWB 4GIFA 4N6JA 2EUZA 5DMIL 2FAUA 1RVFH 2QHLA 2TRHA 2J6WA 4JRYB 4EZLA 3UAJC 5I71C 3ULVH 3G9RA 2V7QH 1WF5A 4ZI8A 4M6NH 4X80H 1TU2A 1F3JB 2PTTA 3HZVB 1FCCA 3NIFF 4U6HA 1A6AA 5JOFB 3RL0B 1IAIH 4AH2B 4HIJB 5AKVA 4FNLH 4PY8J 4C56E 3DK0A 4Q6IA 2A9DA 5L7XH 1R0AH 1GL2A 5DFWH 5HGGS 3TC9A 3WUWG 2NY7L 1FS0E 1R17A 5BUGA 2AZUA 3BUYB 3G3LA 3IKCB 3UMTA 5IKCB 5CJQH 4PJ5A 4WW2F 2O01N 3H1LE 1HFUA 3L4YA 3QQ4B 1S5LX 4XO8A 4Z7UF 3WNOA 3TEUA 5I0WA 3KMDA 3TESA 2ZXXA 1I85C 2YNYA 1MI5B 4NAMA 3FFDB 1FZMA 3KLQA 4Y9GA 4V1DB 4NO2B 2WYHA 4JFVA 2ITDA 3MN8A 5AUMA 4CILA 5B3JE 3I9PA 1HQ4B 3HC3H 1VFBB 4R4ND 5K5GB 3MCG1 5CF3A 1CGSH 1R5WB 3VDCA 1MAMH 2G60L 2QJYC 1NMBL 1IBFA 3L6FA 5F3BA 3QDJA 1XH3B 1LTIC 4HA1A 4O2FA 4OLUL 3NSJA 4P3CL 5BO1L 5L4FA 3TFBA 3HI1B 2QPDB 4RZKA 2R1WA 3Q5PA 2Y23A 4P5MB 3L3IB 4XHJD 1J8SA 5D1XB 3LZPA 2WINA 2KLUA 1RKRA 5MHSE 3CAFA 2QM7A 1WAAF 2A74C 4M02A 4Z1MH 5INCA 5CEZE 5DURD 4LCCC 5I8CB 1NM4A 4G59C 3ARFD 1MRCH 4EDXB 3EDDA 2J8HA 5ETUA 1M8OB 2MKWA 5KYWA 1TIUA 2YN5A 4ZOAA 3L70J 2ZKYA 3KPRE 3ASWA 2WCGA 3EGXA 5DHYA 1JRHH 2BCCJ 3G6DL 2ADFL 3NCJL 4AITA 3DOSA 4GUPA 2K8QA 1NCAH 1ZSHA 3IMWA 4S10A 5BOZG 1TO4A 3GRWA 2NNXA 2EACA 4JR9H 3DO3A 3V6ZA 3B1TA 1C12A 2AK1H 1KYAA 3H3KA 3LV3A 1EHKB 4YE4L 3L75G 3RL0D 3LZFL 4FFWD 5GZNA 12E8H 4XXWC 4Z3GA 2Z91A 2X4RB 3F7VA 5JPMB 4RMTA 4UT6A 1RK1A 2VITB 3E3QC 3FQXA 1KYFA 2EICA 3D12B 5JW4Q 3L75D 1DL7L 5DMIH 5LNDA 3WGVB 4AYGA 1Z9MA 2XN2A 2CO6B 4WEBH 5IHHA 3GUTB 3D69B 4CKQA 3B9DA 1ASQA 4K2UH 5FPIA 4XB8A 1TQSA 4DSYA 3NZ8A 1MI5D 3ZSTA 1A25A 1UD8A 2EYRA 2P52A 2N1TD 2V17L 4PBXA 2WBJD 1NCDH 4YAQA 4FFYH 5EU6B 1GZPA 1L3WA 2DLGA 4JUTA 7PCYA 5HYEA 3LOWA 2N0MA 2AI0H 1EPFA 3GHEH 3KYMB 4M00A 4MYPA 4QHKJ 4R96B 3DETC 3TASA 5IF0B 4FXGB 1RK7A 4DGVL 1DBBH 1CI3M 4QNPE 5I15L 1MHCA 3K72A 3DWTA 3RRQA 2E5TA 3OJMB 2XA8L 1JPST 5AVVB 1SEBB 1YDPA 2Z7ZA 4JRFA 5D1XD 5I5JA 2ZYHA 2EDRA 3R06A 2F7QA 2XZAH 3BATA 4WNQB 3VNZA 1MW1A 1J5HA 3DX9A 2FBJH 3FMGL 4G1MB 4LSQL 3CCLP 3TYYA 2ATPB 4D3CH 3LRSB 3S8WA 1QR1A 2JF1A 3KLSA 3GXTA 4CU6A 3I74A 2JIXA 1FA4A 2WPQA 1XTMA 4R4LA 3JYCA 1NMBH 5DLMH 4ASWA 3DLQR 4KROC 5M1BA 4FFVD 1BGXL 4MAZA 3FT9A 1KN2L 5HHVH 4Y16C 2DM3A 5BO1H 2K9UA 1EVUA 2OW7A 1KTBA 4FQHB 2R4RL 4KXZI 3H1JG 2OS7A 2UXFA 3MV9A 1AKPA 3SDYH 4JHVA 1ZHBA 3UZEA 1WVZA 1OD7A 4LKCA 2MNUA 4RA3A 1JGDB 2QDWA 3L45A 5CINL 2KLVA 4RH4A 4P2OB 1QSFE 4N2OA 4PJ5E 1NCUA 2GUOB 3TNNB 5T33H 3U2SA 3W38A 1M71A 1OFCX 1W8OA 1PIXA 3H1JD 2AKRB 3ARBB 1Z32X 3QIWB 4HXAH 2YD8A 3BUTA 1WFMA 3F5WA 2FO4B 3GMLA 4J12A 4UV4H 1FYTA 4X9IA 3VXTB 5IOPA 3DXAB 4MDJB 3BW9A 5IM7B 1S7VA 2Y9ZA 4X83A 3V0VB 5FB8B 2OK0H 1PSKH 4HH2A 2A6DB 2DD8L 5GZOC 3VXSA 3CN3A 4MJ6A 3HG0A 2HJFB 3PAZA 1MJJA 2OX5A 1ZJBA 4HZAA 2MCAA 2H32B 5GRVK 1PGQA 1IGYA 1QAWA 4Z0XA 5EU6D 1S5IH 1OAJA 4DOHE 4DNLA 3P73B 5DRZB 3VI3B 3OG4B 3QDJE 4JZJC 1NDTA 4NZRL 3G5VB 1ZS2A 3U1PA 3BUQA 3FSWA 2Y5QA 5EH1A 4YHMH 3V10A 3DV6B 4PCYA 4RGNE 4ZYKB 1JNJA 1L0XA 3AEEC 4GG8B 1KILD 1KIPA 3I3DA 2NSQA 3FDWA 4PPTA 2OXHB 3RGVB 3U0PA 3L3JB 5DI8B 3ISYA 2XTSA 2DYSB 1BFOB 3MAWA 1C16B 1NDMA 4GT0A 4PH8A 5C0CB 4ES8A 5C0IB 1JY2O 3RDTC 5DJAA 4F2EA 1YEFL 3FRPG 3QIBA 2XWZA 4NUJA 1SN5A 5D7SH 2E9JA 1NTKJ 1RZPA 3MNVB 4I9XA 4QYAA 3RZWA 4C4KO 4Z8FL 3I6LE 5ICXA 1VF5C 1E2ZA 2XIIA 1C5BH 3B7YA 5I15H 5L9DL 2A3TA 1OGPA 3QISA 1ZV8A 1OF0A 1VKXB 4IOFC 2EE3A 2ZPKH 1G7MB 2NY2B 3EJPA 2KLTA 1L9QA 1L4AD 1FZJB 1IAII 2Z4QA 4WW2A 2WWMC 2RHEA 2XZCL 4BYHA 2NCEA 4GO6B 4WIQA 2C9VA 4LSQH 4TF4A 4OLEA 1LQSR 3LKOA 1ZY9A 3U46A 4OLVL 3GSQA 3ARBD 4IDLA 1FO0B 4XT1C 4CMHC 1P4BH 4I0CC 4O9BA 1W6LA 5B1BB 3VX1A 4ZS6C 4TQPA 3K6NA 1ROCA 4HD5A 4I18A 4KRNA 1KN2H 3VRLF 3GHBH 3AQXA 1PY0A 1QFHA 2WXKA 3MBEB 4KQ3L 5HGHB 4GKSA 4PJFE 3CIAA 3B2UC 4B9CA 1RURH 1H6TA 3O4LB 3VFGH 4PVBA 4Z76B 4V2BA 2NNAA 4NC1C 4JDTL 4A2LA 4R9HA 2H1XA 1A2YB 1N7SD 3VJ6A 4F2MB 4AGMA 5HPMB 5I1DA 4POZC 1D9KC 4BFIA 1NCIA 4P9MH 3TXAA 3W81A 1USZA 3BGMA 3P4OA 5B4MD 2F19L 3CUPB 1DQIA 2VSCA 4L9DA 2N7AA 4AUJA 2X6BA 4ES9A 1ZLWH 3EXLA 4I4WA 1RQUA 4PJIE 3RVWD 5GTHE 1SQBD 2FQGA 4QKXB 1XH0A 1ORQB 3KPSA 1KIRB 1AKJA 3D87B 5DC4B 2XQYG 3MGOB 1FO0H 5ILTH 3RGVD 4HGMA 2P26A 2WLLB 3V0WL 4WV1A 3WO4C 5D7IB 2ZSVA 4HBCL 2HT3C 2I85A 1VRSA 3D33A 2X89A 3QB7C 5DC0A 5C0CD 1NM9A 3DVGB 4KAQL 2XZQH 5ERWB 2V4HA 3VE0A 3HG1A 1J5OH 4EKXA 3L4TA 1KLUB 4NCDA 4QHMA 2GM4A 1XIWB 2XWJB 4XNAA 3U1AA 4Y5YB 3S3BB 2IQAB 3DVNA 5ESQA 1JRHI 4XCFL 1PIGA 3VFUB 1NTMK 3RUGB 2NR6A 3O6QB 3C5ZB 4RCAA 4UWQB 4O02A 4AJYV 4U3FJ 2LLNA 5HVWA 2VABB 2NY2D 3QSKB 4N5UA 1E9OB 2CKBB 3NGBC 4HX1B 2Q8AH 4L23A 1UH2A 2CPCA 4XBEL 2NW3A 3HPJA 1MWAB 1U21A 1BM7A 1TEYA 3OM3B 1OE2A 1QTYT 4D9LL 3PHQB 4QOKE 3JT0A 2APTA 3CXHK 1FYTE 2GBTA 5D5MB 1GGBL 3L5HA 5DJXA 4FADA 2A83B 4BFFA 3HNTH 2XT1B 3GRBA 4FQXB 5DDHB 2XIDA 3VXSE 3M9HA 1T6BX 5FA3B 3OGOE 5I0ZA 2D0FA 2RMZA 3HN3A 3H1IG 4S2SB 4J8RB 3AXHA 2WSFH 1LWUB 3RY5A 1DDHB 1QBBA 3O4LD 2DI8A 1KCVH 5KBLA 5DSCA 5C6TL 1KC5H 2WAQA 1HXYA 4TOYL 1QVFO 3HVNA 1DANT 3KJ4C 3S4SG 3UP6A 1CF8H 1LO5A 3T0AA 3H1ID 1A1MA 3RI5K 5CLTA 1MVYA 3V95A 4WZ9A 1NEUA 2CKBH 1L7IH 1FIGH 2Q20A 3F7RA 4KHXH 3TBSA 1T2XA 1MWAH 3RWGA 4KOCA 3MUGA 3BZFA 3FUIA 3V52L 2DWEB 2WXRA 3ZRFC 4AQ1C 5A6IA 4ZOCA 4F24A 5KS9F 4IOSD 4DGIH 1LEGB 2AGJL 3HE7A 1L0PA 4WO4C 3OGCA 4WEEA 5F9JA 1N0LA 4AW4A 5HXMA 3HJEA 2WSEH 1A7OH 2VZUA 1UCTA 4Y2LA 4A6YL 3PPSA 1XSKA 5I5RA 1XCWA 4IRSD 4AQZA 4J3OF 4ZMQA 1H0TB 2AEPH 1EDQA 3NFNA 3L5XL 4CJ1A 1KBGH 2M1KA 4B3VA 4H1LG 2VXQH 1Q9KB 3BQUA 3NAAH 1YAIA 2RALA 3NIFE 5AOIA 1ZLDA 2WO4A 1C1EH 1E8ZA 2CLVB 2BY1A 4JHBA 3WKYA 1XIWD 3WFBL 1WDAA 2UXTA 5D7JA 1M90Q 1X3DA 1PIFA 1SXCA 5GRZA 4D9QD 3TT1L 4PJHF 3V4PA 2X41A 3C5ZD 3QXWA 3RHWK 4Z7UE 4HV8B 1H88A 1MDAA 3RKDC 2VIRB 4RVBA 3V0WH 1QOKA 2AEOA 1JO5A 4JKLA 4NKOB 2JV6A 1BQLL 5D2NC 1NC2A 4GYBA 4FQPA 1IJDB 1ZXKA 4QXTA 1TZHA 4HZ1A 5GISH 4KAQH 5EDXA 4OR1A 2FZ3A 1TTGA 3LKRB 3VRJA 2N56A 5L2KA 2B3IA 4P9HC 1KYOH 4HCRH 4FQCL 2X2HA 1NUGA 3L74G 4JFYB 4AYBA 5BQ7B 1V3KA 1J1XL 4RZCB 1J0JA 3HKFA 3BMWA 1T5KA 5AW5B 5FFOA 4I1RA 5MI0B 2I5YL 5EN3A 1S72P 5BRZA 1JHKL 3L74D 4JX0A 4Z7NF 5HYFA 3IS1X 2XHNA 3LNHA 4XP4L 1WAAE 1CQYA 4FMKA 3MRKA 1FZOB 3VXMA 4YBQD 2VDLL 2ZXEB 4W4OA 3EFFK 1SDAB 2DQEL 4WFGD 4Q9RL 5IBUB 5C08B 4CSSA 1QO3A 4HJ1A 5EOQL 3KZIH 5FR3A 1AZRA 2VLRB 4HHAB 4F7TB 4U33A 1SUHA 4N0UE 4FKHA 1A3LL 3OJAB 5KAFE 1FORH 4IIQC 4L4TE 5IQLA 5LQBL 1W0VB 2UZXB 3C09B 5TDOA 4QTIL 4TPRL 2AJ3A 2NW2A 5C6TH 3ES6A 2FHBA 1OW0C 3HG1E 3MRPA 2KDYA 3P0VH 3WG7B 3G5YA 3P4MA 3VFOA 2H7HA 1EZLA 5EO1B 3B1UA 1U3HC 1N18A 4BZ1A 2V5RA 3CFEB 3LSOB 3UJIL 3F5HA 3WYRA 4F9LC 2AEWA 1IM3D 3VWKB 1TQBC 3OR6B 1FP5A 2VL5B 3IFNL 2MHAA 1NL0H 2G0KA 4KXDA 4ZNCA 3QUHA 2FT7A 4NN7C 4I89A 5J7CC 3QUMB 3ELAT 5K9JL 2EC8A 2VN3A 3APMA 5E00A 4JPQA 5FGCE 1NIAA 4G42B 3BAYA 4H20L 4GW4A 5GGTH 2FYZA 5DZ9A 3L9YA 2OL3A 1YY9D 3UBGA 1JYWA 1P9MC 3B43A 2R3CA 1VSCA 3Q8EA 1FNEA 3CCMP 1PLGH 3PJSB 1HYSC 4LC1A 3FQRB 4C56B 3DSFH 1WC7B 3EH1A 4JMNA 2DPKA 4DPAX 4KH2A 5TDPA 3PXHA 4NQTA 1BGYJ 2ZUQB 4XPGL 3UGUA 5KYYB 4N24A 4J39A 4HDIB 3PXJA 1UA3A 5KLIC 3L4VA 3FHAA 4RMSA 1KCSH 5C0FA 2TSAA 2AJVL 5EMYA 3LPPA 3W0WD 2EIZB 5IMMB 2FUTA 4PBDA 3BGAA 4NUGH 4WWOA 5IT2H 5DJYB 3T71A 5D9SB 2X1QA 5HSFA 5DJ8B 4IRJC 1P7HL 2BS9A 2WBWB 4JLRA 1G5AA 4CU7A 1NUDA 1J5IA 3SE8H 1N86A 1BOYA 3HC0A 4HS8H 4NKMA 4XHJC 4R84A 1PGPA 2X9ZA 2PABA 1PEZA 4UTBL 4Z18A 4HK0A 2EE6A 1KCUH 3T65B 4FQCH 4XNZC 5KW9H 5J57B 2VLLB 5C08D 1YEHH 3EFDH 1S4IA 2PGDA 2W6JH 5CMAA 4EOTA 3ARFC 3V6BR 1M6OA 2R23B 1NAYA 4WI5A 1VCAA 5EUKB 3VG0H 2Y7MA 2QVKA 4YHLL 1E6OL 5CZXD 1E9PA 5J3HD 1WJ3A 1JHKH 1DVSA 3OKEA 2GTQA 3O0RL 1OAUL 3QARA 4K9JA 2XV5A 4R7LA 3L1EA 5C8JB 2WVVA 3B34A 3KWVA 1BMWA 1SF3A 3OKNA 4IBQA 4PJ6A 1ZS8B 4PU2A 5CNHA 1XCXA 2IFFL 3MOAL 5HJDA 5KSAC 2PFXA 1DE4A 2R69A 1A0QH 3WFZA 2E42A 5E5LA 1HHHB 1EHAA 4M6AA 2Z1KA 3OZ9L 1GDTA 2ZOUA 4FFWC 4Q9RH 1FJ1A 4XPFH 5I18L 2NPSC 4A2EA 2WB7A 1XGPA 3O2WH 4R4FL 5IG7A 3GSRA 4XBGB 3RGBA 3QUXB 1T3FB 3S6CA 4DGUA 5F96L 4MBRA 1B2WH 2OKMA 4Z3HA 4QTFA 1R3IH 4I7ZB 3QNXB 1KLGA 3AWEA 3WHE0 1PZUB 4UNUA 5JIIA 4RRPG 3PABB 2K6YA 3D30A 4QTIH 4L75A 2GJPA 1D5ZA 1IEAB 5E1HB 1VQ7P 1F56A 3AABA 5I1CL 5M95B 3BDYL 2ZOTA 1N8OE 3CFUA 5L2KE 1HVXA 1T7XA 5KVFE 4DQAA 1LE5B 3BN9D 2EADA 3D39A 3P8CE 5APYA 1QPXA 2CK2A 1JE6A 2FWOB 2DJUA 2ZG3A 3GMQA 2A6IB 2DOCA 2WBJC 3GKWH 4XMKL 5J6SA 1OAQL 3IFNH 4RIRA 3HLAA 5H4ZA 5CEZH 5BRZE 1S5HA 3RA7H 3OWRA 5E1IA 1MREL 4XVTH 5DLLA 3BE1L 1G1OA 3VXME 2E86A 4YSPA 3A0BE 5I1HL 3IDMB 1BECA 2VR9A 3STBA 5SV3A 2E4TA 4FLQA 2MSPA 4NI3A 1SEQL 4P5TB 3CCQP 1GU4A 5K39B 3F84A 4H44D 4XPGH 4BKLA 5EO9B 3NXSA 3TX4A 2VO8A 1N6QL 3EOYG 3EQ2A 3ABLB 3KDMB 3ZDYF 4DZBB 1JYVA 3KGSA 5BUPA 2UZIH 2DQIH 4J3SA 3RBZA 2HN7A 1PQZA 5F1SA 5HI5D 3X13B 2O6CA 1FFOA 1FE6A 2IH9A 1F11B 2ESVA 2BCCD 3OX8A 3WN5A 1EC5A 1MLCA 2WQWA 5D4HA 5LO7A 4PJHA 1N26A 3SE4C 3VH8B 1TT6A 2MTAA 4IEFA 4AK2A 5KSUA 3QNYB 1NMCB 4PQXA 2EXYD 1W16A 2WSKA 4XMWA 4YHPB 1PCXA 1NTDA 3ARPA 3SWYA 3L2LA 4ZX4A 4WSKA 1GJWA 4GI6A 4IBYA 3EIFA 4LSTH 3QYNA 4KTDL 1UZGA 2UZYA 4K9EC 4X6EB 5IK3B 1A1NB 1WP6A 3QEUA 2WYZA 4OIIH 1VFOA 3VRLE 1C8PA 2RH0A 2WUCL 4IHOA 1SGKA 1E6OH 1UWEL 2P5WA 4JDZB 3QHFH 4NKDB 4YDMA 5B8CB 2O1AA 3ESPA 4MD4A 3BP7B 3V7AG 3SWKA 1KBPA 4JO3L 5E9DD 2O5YL 1O6VA 4FNTA 4BHUI 4OIFA 3GRWL 3RVUC 2NZIA 1X9LA 3VXRE 3JVGC 4OT1H 4H40A 1HKLH 4WB4A 1KYOI 3IXAA 1PZAA 2WIIB 4MMYB 1QSFB 3ZXAC 2E7LC 4WTZG 3RL2B 1IFNA 4Y7OC 1GGIL 1FNSL 3POHA 4U1JB 2Z93B 4OLWH 4E0RA 4K23H 1TUPA 4N6RA 4UT6L 5DVOA 1SQPJ 1YVLA 4A2DA 4R4MA 2E5YA 5TDNB 4ZTOL 1KT2A 2Y0EA 5IEHA 2OYOA 3LKQB 3B83A 3SKUD 2AQRA 5FDYA 3ZT6A 3U4EB 1KILC 2DKMA 3CHPA 3R1GL 2J71A 4I2XB 1F8TL 1W72L 4EXPX 4Q0XL