5AVQB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 0.75 min.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avqB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avqB02
1FOSE 3HTKA 1OWAA 4I2LC 5AVVB 1CI6B 2W6AA 1FAVA 1NWQA 1CZQA 3HE4A 1J2JB 5AW1B 3M9BA 5AW6B 3M0DA 4HYTB 3TYYA 3MGNA 5AW7B 4LC1A 3SWFA 3V4WA 3M06A 3OAKA 3VMZA 1FOSF 3NTNA 2WT7A 1MUUA 1GK6A 4XE5B 2Q5UA 3VMXA 1H89A 5AVTB 4JYCA 1H88A 3KQGA 3LIDA 3HE5B 2XV5A 1H8AA 1CSBA 1HUCA 2WPRA 3V5BA 1OXZA 3VYIA 2W27A 5APXA 3M9HA 1A02J 1X8YA 5AVSB 1YYCA 2WPQA 5CMZA 3VTPC 1DH3A 2JJLA 3NFQA 3WGUB 3WGVB 2R3CA 3HE5A 2YNYA 4M3LA 5APVA 3L36A 4JYBA 2YO3A 3LIEA 5AVQB 4C7NA 2Z5IA 1GD2E 1GTWA 3B8EB 2QM8A 5AVUB 2YO2A 5AVYB 1MV8A 5AVZB 5AW9B 3VMYA 2E42A 1HBWA 4RETB 3P8MC 5APQA 4C7NB 4B86A 3M91A 3P7KA 5AW8B 3O8ZA 1IO4A 2E43A 2XZRA 3P32A 1A02F 3NMDA 5AW3B 2KP8A 3V4QA 3NXSA 3MD0A 3KDPB 3T97A 1S9KD 2R32A 3A5TA 5AW2B 4GT1A 2BASA 2P7JA 2WWWA 1HWTC 5APSA 2WTYA 2R5BA 2XU6A 1GU4A 3L37A 2ZFCA 4GKGA 4AYCA 3A3YB 3IR9A 2IPPA 1T2KD 4I6MC 4DZOA 1T2KC 5AW5B 1GK4A 3TNUB 5AVWB 4KHXA 3HE4B 1GU5A 2WT7B 1GZLA 1SLQA 2Z5HA 1HJBA 1S9KE 2H7HA 3VN0A 5APTA 5AVXB 2C9LY 3TNUA 1KQLA 1SP4A 2N9BA 2P67A 3A7OA 2P2UA 2WPSA 1MFZA 5APWA 3M0AA 2C9NY 4AUWA 1CI6A 2R5DA 1NAFA 3TK1A 5AW4B 2VRSA 4RESB 1JUNA 4AQRD 2Q7CA 5AVRB 1JNMA 4C46A 3A2AA 3I5CA 2Q3IA 5AW0B 1G2CB 5APYA 5APUA 2ZXEB 2QM7A 4EOTA 3UIAA 3L35A
chains in the Genus database with same CATH superfamily
5JDSB 1MFAL 2A2QT 2DD8H 3M7OA 3ARZA 2QQQA 4LRIA 3IK2A 1E4KC 4OZHB 4P46A 5KTBA 2PTTA 4JKKA 5C09E 4IHOB 1AZVA 2MQGA 3CUPB 1FH5L 3FFCE 3MNDA 5EZJA 5F7BA 2VISA 1F90L 1BSHA 4UB6H 1EWHA 2NXYD 4FG2A 4WDIB 5F7FA 2VDPL 1ZVNA 1L7TL 1N12A 1RMFL 1M90Q 2VQTA 4JX0A 1FOSF 3VFTB 1OPOA 2L7EA 3U4BL 4WO4B 3VE0A 2ATKB 4OIFA 2Q6WA 3O4LA 1HI6A 3JV6B 2K9YA 2JI2A 2NCEA 3WEOA 3KS0J 3RK2B 2GJJA 4DO5A 3PWLB 3U30B 4FQQB 3RJQB 2NZIA 4QHUA 3FQTB 3OKNA 1DN0A 1KJ2L 4EN3D 1K9MQ 2FK9A 2RQEA 3O0RL 4I0PA 1NCAL 4EE2A 2Y9ZA 3DV6A 1BECA 1TZAA 4YDZA 1PGPA 1C16A 2WHVA 5T3XD 5LQBH 2F7RA 5IZ7A 5E2VH 5ELIA 2ZXAA 2QKIC 3ULUD 1YJNP 1DCLA 3OX8B 2LU3A 2GVYA 4E9TA 3NCWA 3HUSB 2X44D 5HHQB 5CLWA 4PJEA 4Y4KA 5GGSB 1DVSA 1AAJA 1EEZA 1JD7A 3DRTB 3MHZA 4DCKA 2H9GB 2DM7A 1T66D 1H0TB 1FYTE 4Q7DA 4YOKA 2VTFA 3H55A 3MTXA 4QHKI 2IDUA 3UYRL 4PMEA 4FG6D 5A2CA 3MCG1 3GBML 1ITCA 5EUOF 5EU5B 1F86A 3JQOB 2X28A 1KN2L 5KBMA 3KXFE 3MQIA 1T1XB 2GPZA 5ANMA 2Z91A 1T0MA 3ZT5A 1AC0A 1UM4L 3VMOA 1H5BB 2AXGA 4UB0H 5E1HB 5KSBF 5FECB 2J43A 4YHML 1RZKH 1TNNA 5SWZA 1A7PL 3E6HB 1VQPP 1MAKA 3VFWB 2HG5D 5IP4A 5IW1B 2MPVA 3AC0A 1JL8A 2P5WB 4QRBA 3F65A 4HWNA 3WDIA 1IT9H 1F4XH 4UF7C 2WSFH 2K88A 3NA9L 1SXAA 1CF1A 3GF3A 1ZVSB 4P04A 5A40E 1L0ND 1RUPH 4J3VA 3ETBF 5KSUB 3IFOA 1S5LH 3D39D 5AL8A 4XVUC 1MH5B 2H8PA 3NYKA 4P57B 4PTTA 1NTMG 1PP9D 5A2LH 3GSWA 4N0UB 4PJXE 4YPGA 3GWJA 1NCUA 4L4VA 4GRWF 1R5IB 3KNBA 4FQ2L 2PYED 5DFVD 1S4XA 1UXMA 3BWAB 4KTDH 4HCRA 1KCVH 5CN1A 1YNTA 4KX7A 1NCBH 2EEXA 3HFML 3UG5A 4IK6A 4YHOH 3P9MA 3PREA 3KZ8A 2XY1A 2WSFJ 4MMYA 2XBZA 5DJAB 1FFOB 1NJ9B 3PWUA 1BSNA 2CDEB 4OZ4A 1AD0B 3N44B 4ANXA 5C0CA 1QZ1A 2E5EA 2FECL 3PJLA 4Q0XL 3SODB 3U0TB 5AVVB 1MREL 5J06A 4YLQT 1VQMP 5C0FA 5IFAL 1HH0A 3UOAB 2APSA 4XI5D 2LKMA 3MRBB 2DKSA 2Q7AA 4MMXC 5ISZA 2Z93A 3KBFA 2ENQA 1IU1A 1BJ1H 1QAWA 2L3BA 5L2KE 2C1PA 2FEDD 4MQTB 1CT8B 3L3KB 2WVVB 1XDTT 2A38A 3HE5B 3DOIA 1ODUA 1DIPA 5F7DB 3JC22 4H2CA 1KB5H 1SDAB 4OH8B 2QLYA 1QBBA 1MJ7L 3MRRA 4S2SA 4Z78B 2J72A 1UGNA 2GAZA 3HA0A 4P5RA 1CYGA 1R3KB 3ZHFA 3NCEB 2HJKA 3MRQB 5KTEL 3H7BA 2QEXP 1QSFA 1SQ2N 1OANA 5L4IA 3SBWC 3VMNA 2EXSA 1DQTA 1JNJA 1M1SA 2ATPB 1TG8A 3INUH 2AEOA 3KL3A 1AQDB 4HGMA 2Y3AA 1QHOA 5CZVH 1XH0A 3B7TA 3G6EP 5EOTA 3THMH 4RISL 5JW3L 3G6AA 4UM9B 3QR0A 2QQKH 2QT6A 3BPLB 4M6ML 5I74C 3UAJD 1H3VA 1U93A 4PW3A 1PLAA 3S34L 3L4YA 4OTXH 2GSGA 3SGKC 5I0DA 3V4QA 5KWYC 2KBGA 3FTWA 5L8LB 4KNSA 4HSQA 5BOZG 1NYHA 1UB5B 1XB6A 4OUUB 3V2AR 3FULA 4LKCA 3W0WB 3ESOA 5I1JH 1BIIB 4XVOA 5MI0C 5E94B 4OVNF 3BRTB 2VQUA 1NTMK 3AEGC 3D70A 2DIAA 4YUEH 3UADA 3F5HA 4NERA 1FO0B 4HP5A 3MCYA 5EC1A 4PJGA 1EC5A 2VXTH 4DZOA 3FZUD 3LN4A 3QORD 5TPWL 4MJ4A 3F7YA 3KR3L 4Y88A 3KPNA 5C0FB 1S1CX 5C2UB 5ITBH 1JNLL 2IBZY 3FQNB 1WBZA 1EQWA 3MNZB 4YSTA 3W2DH 1RERA 2HLFD 1ZWIA 5D1ZD 5DJXB 3RK3C 4ZXBD 3QFDA 3OWEA 4L29B 2IFNA 4B9IA 1JP5A 1M6OA 5DRXB 1BWWA 5GRYA 2ZXXA 4P5TA 1PAMA 3RDTC 5I76A 4HFUL 5JPNA 3D0LA 3ABKB 4KKNA 5T3ZL 3KYOB 4KUCF 2PXYA 1KD1Q 1COBA 5FCUH 5FB8A 1E9OB 2G9KA 3RVVD 3Q6GL 4JN1H 5D1QA 4DOHE 2AEFA 4FXTA 1RF1B 2ICWB 1OW7A 3RVWD 3AECC 1ETJA 4Y99C 4MDJB 1AE6H 2RJMA 4KJQD 2X2YA 3PWNA 5D70L 4U6YA 2D9CA 4PJHF 4BXSV 1NC4D 5H37G 1ZVSA 2LV4A 3EXJA 3GO1L 4HMCA 4HQQL 3VXRA 4I3GA 2NPSC 4TPRH 3JWDL 4CNIB 3E0GA 4XPHH 2CIKB 2H6PB 1WT5A 1LTJC 3PL6D 1OP3H 4ZOCA 4YHLH 3NJJA 1NFDB 2EE6A 2QEJA 5DHVH 3RUGE 2N01B 4QOKB 1I1FA 4AV4A 1T1XA 5GS1A 2YMXH 1AS6A 3QRBA 5I30H 2J6EL 4K3JH 1YYCA 2KMWA 3FB6A 4AJVA 4G7VL 4PWGA 1WAAA 2AXTE 2VH5H 3M88A 4UM9A 4HK0B 3MLWL 3HD7B 2H3NB 3FCSA 1CG9A 1RP9A 2PPEA 1Y6NR 4HUXA 2NSMA 4JQVA 3FB5B 2FYUJ 4NKDA 3PL6C 5K33A 1G7JA 1NTZK 1W0VB 1BQUA 2H3KA 3TFBA 5DO2D 3AUVA 4XMPL 5E2WL 1XT5A 4KHXH 2WBJA 5GGTH 4DW2L 1C16B 3CIQA 3MRLB 1V10A 3VFVB 5D2LA 4NUMA 2Y7QA 4FZEL 3OM3B 1JF5A 2FYUE 3ARFD 2PCPB 3H4HA 2FYUK 1A7QL 3CXHE 3MREB 1OZUA 1X4ZA 1NKGA 1J5IA 1K5WA 4BUQA 2ADIB 3WKML 1RIUL 3C6LB 4LLWA 3WUWG 1HHIB 2A9ML 4UV4L 5E08H 1RHHB 1RZFL 4N24A 4O9BA 1DR9A 2QSCL 2UY6B 3FTSA 1JFQH 3PV6B 5SX5K 3QK0A 1P7QD 1QI5A 5LO7A 2XWJB 1Y1DA 4PRHE 4QHLA 4OCYH 1GK4A 5DJ6B 1XF4B 4PG9B 5H4YA 1ET8A 1KGIA 4FFZL 1FP5A 4KNUA 4WCYH 3P73B 5DI8B 4YL4A 1KILB 3U2IA 3NAAL 1E5BA 1KXVC 2P8LA 3ESUF 3ILQC 5INCA 3W11D 5T1KD 1TJXA 4P99A 3BGFC 5EULV 5DJZB 5FYLL 4JO3L 4ZOAA 1RUKL 3RVTC 4U6YB 1R3JA 5SWSA 3PNRB 2R0ZH 1CE6B 2BIPA 1J8KA 2J1XA 1DBAL 2J73A 4D9RD 1HAWA 1OK0A 1PPJG 2YFOA 1NFIA 5CJXA 3V8OA 3IJHA 2PCFA 2Q7YB 4MCZA 5MENA 2MCPL 2PMZA 1HNFA 3MLTB 4Q6IA 1OV8A 2O01N 4TULL 4G2AA 5D93B 1OWAA 1ACXA 2OX5B 1MI5B 2DM3A 3FHEA 4LNRB 1M8OB 4KZCA 3NESA 2YEZB 2K6WA 3OC8A 5DJ2B 5SWZD 1LEIB 1URQD 4QTHB 2ZX5A 5KSAB 4HJGH 3OGOE 4NN6B 4UDUB 1INEL 2DQMA 3MOAL 5I17B 1P4BH 5L6YL 1PY0A 3OKEA 5I6PA 4ZO9A 1T0MB 4GUPA 2ZUSA 4D0BB 5KBNC 1AKJA 3EBAA 3WFCL 3IU3A 4OI8A 4G6KH 3US1A 3LS5H 5E00B 3B37A 3IDGA 4F2MB 2IH1A 4DVRL 3AG1B 2YZ1A 3GSVB 4Z0XA 2B1HH 3CX5D 1MWAB 2A4EA 3U46A 4X6FB 3MLRL 2WQYC 2BX5A 4GFXA 4NPFX 4NN6C 5FGCE 1T4KA 4PGDA 1N6QL 4G3YL 3K5SA 1G0YR 2DLGA 1NIDA 3GBNL 1EXUB 3VXUA 1RVFH 4LSRH 4M6OL 1Z56A 1GD2E 3KD4A 3L81A 1ZHKB 3H9YA 3EJZD 2CO4A 2HRGA 5E4EB 5I9QC 3FQYA 4OZIE 2HN7B 5D7HA 2JLLA 3V4VH 3BO8A 2C3VA 4QYAA 5IY5B 1FE8L 5ITFB 3KLSA 4PRDA 4WFFD 3S2AA 4MNHA 5E1AB 1IB5A 3ARDC 4HJ0C 5C8JB 2L7JA 5DYFA 1KTBA 1DUZA 5FKPB 4UDTB 2O5XL 3CMAP 2Q87A 3G9AB 1OOWA 1HTYA 1J0IA 1S8DA 2NR6D 2VZ3A 2OTUB 2G60L 3MRGB 2D7NA 5A2KH 4WLCA 2IH1B 3MLXL 4I77L 4QRFA 2Y69B 4K8RH 1CQKA 5DVOA 1L9MA 3QJFA 1VQKP 5IBLD 2C26A 1N73A 4JUSA 1BZEA 1OM9A 2H45A 2WGXA 4IGBC 2DDQL 3LW5H 1MCBA 4LLDA 4QY8A 1BD2D 3F04A 2J20A 4H1LB 2E76D 5IJKA 5B66E 1J7VR 1SFCB 3BASA 3CMOH 3H2WA 3GB7B 5DU7A 4FYRA 5EUOB 3KYKL 1GXEA 1U7MA 4D8OA 2EH7L 2D2CB 2IPTL 4M8QA 4ZX6A 1OVRA 3IPEA 3H1IE 3MLTA 2W90A 4XRCA 1EHAA 1YEIL 2Z34A 3FYIB 2QADD 4G9DB 5DVNA 3IJHB 1D6VH 4Z1MH 1HZHH 2JK5B 5KVEL 1NAFA 1Q94A 2YZ8A 3MJ8A 2BHUA 4LIQH 3T3PF 1MFMA 2AK1L 2VRQA 3D0VB 3GUTB 2NXZD 2UZIH 1E5YA 1EBAA 4Y28J 2YRLA 5APYA 4LBAA 1R3JB 5SWSB 4ORGA 2V17L 3U7AA 2VLRA 3G5XA 3ZE1E 1QVOB 2PR4L 1N0XL 2W0FB 3OGCA 4GKSA 4ZS6C 4M4RA 1CDBA 5AZUA 3LAFA 3VTAA 1NA8A 4GAFB 2A74B 2A77L 4JY4A 1MFEH 3KNBB 1IGYA 4NX0A 2WLJA 3VVWA 4OM1L 2JKSA 4M48H 4IU2A 4LCYB 4DESA 2ZKXA 3X17A 2Z31A 2BEQD 2HYNA 5K93A 1CGSH 1RKRA 2KLTA 4NQSB 1J5OH 3M6DA 3NJNA 4CVWA 5F21B 1JSYA 2LHAA 2UXTA 1J05A 5I0WA 5CMAB 3MDJA 1MNUL 3MFFB 4JFOB 5GGSY 4JJ5A 5F1KC 2WUCL 5FO8A 2YMYA 1QWHA 1ADQH 2E27H 1F1GA 1IZKA 4PJXA 2Z31B 2Q8AH 1AXIB 5IW1A 5L9DH 1QRNE 3GDCA 2WZ0A 3BCFA 1RZGB 4IBZA 2CKBA 2PYFA 1IM3B 3SDDB 3B4SA 3ARBA 2DI7A 3RTQD 1ECZA 3OGCB 1MFTA 2WBJB 5F7KC 1INDL 1M6UA 5EU5A 2Y7NA 4GXUN 5FGBA 1O9ZA 1FNEA 4PJ5A 1F0LA 2V3FA 3FO0H 2DWSA 3ERXA 3U1SL 4KVNH 1YA5A 1NGXA 1BP3B 4HG4K 5F96L 4FHKA 4Y7MA 4ALAH 4H5SA 4MLIA 3HLKA 4E0RA 4UNIA 4PJEB 2QPEB 1JPGA 5D7JB 1FJ1A 2XNDH 4ZMAT 5CUSL 2F61A 4L8DA 3TV3L 3VRLF 3NJHA 5EN3A 4DAGL 3MLSL 3MX0A 4X2UA 2YK1H 2B8OT 1OQOA 3K6IA 5KJ7C 2YAFA 2P3YA 3IXTA 1Z9NA 4QOKA 1U0QA 1BFOA 1ZHLB 2EDHA 5IMOA 1R5WB 3UJJL 1FG2A 4JQIA 3ESMA 3O41B 4P23C 1JN6B 4R7NB 4UILL 4ZMDA 3LZOA 4N2HA 2IAMB 3W9EA 3HUJF 1QSFE 4P2YA 4HUUB 3B9KC 1JVLA 1QRKA 4ZFGL 5BVJB 2VLJB 3FUMA 2NT0A 3KYAA 2AABL 2G5BB 4PJBE 5BXFA 5EU6E 1J0ZA 5J6HA 4HIJB 3TC9A 3M1BB 3ZE2F 5MI0B 3KZIH 3N1MC 2ALAA 5FM5M 4ZFFA 5I8OL 1JZ6A 3F2LA 1AOZA 1FFTB 4YBQC 4PWJA 1LTJA 5KYWB 1PLGH 5E1AA 3WSQL 5CF3A 1RUQH 4ZAKA 4NQVA 2B14A 1HJ0A 2BSEA 5JHLA 5B22A 5DGQA 2PTTB 5FOJA 3GGWA 4LCCC 4OZHA 4PJ8D 1D2OA 2VC2L 5IJBC 4X0KA 1Z9MA 5C0DA 3EO9H 3EH2A 1VDFA 2C4FU 2VQ1B 2F54E 1XGRB 2F53A 4Y5YA 3KVPA 2BCCE 5BU5A 2ILLA 2RACA 1XVSA 4PD4I 4X7TA 2Z31D 1HEZA 1NOHA 1FAVA 1FZJA 2FYYA 2OMZA 3HJ0A 3QEUA 4GSXA 1H9DA 2YQ2A 3MRMA 5JHDE 3O8XB 1O7DE 3ZKXB 3VWKB 1UEMA 4U3CA 5FGSA 2DMGA 3I6GB 1E28B 5DUPH 4PUBH 2NYKA 1PLBA 3HMXH 5KYXA 4YHZL 2HFTA 2NY4C 2C4XA 4OJCA 2FX7L 5CEZH 5KZCD 4DQOL 2ITDB 1SFCD 3DVNA 4PJFA 2WVRA 1ETA1 2N7AA 2OZ4L 3R7RA 2W9LA 3DSNB 5F93C 5J8OA 3Q1MA 1PNCA 5APXA 1URQB 2IG2L 3H1HE 2DQFA 2VXVH 3CSPA 3GKWH 3LKPA 1MRDH 5E8NB 4YDKH 1Z7JA 3BI9X 5BOJA 1U2CA 3QJZA 5DLLA 3C2AH 3IDXH 3J8F7 4FYQA 1YZZA 1QQDB 3P0YL 1HX0A 1QFPA 3CIAA 3U48A 1A8ZA 1Y6MR 4K8RD 4MWFB 4MJ6B 4XWOD 4ZMVA 2F54A 3DHUA 4G59C 4K2UH 1AFVH 4J28A 4YSOA 3B2PA 3RA7H 2JJTA 4IOIH 2LOEA 5T3XL 1FNGB 3FUIA 3RX7A 1SVBA 5F71A 1TYEB 2IZ1A 1NU1G 2X4OB 3FO2A 2OTLP 1AQDA 4DP8X 3FPXA 4EUPB 1AY1H 3GBDA 4PJHE 1M57D 2DN7A 5ECGA 2OXHB 5T33L 1JVOA 3LYRA 3IVKA 3NXSA 5E8OB 3F6JA 3BAXA 1Q0YL 3PWVA 2R29L 4MXWL 2F7IA 5BMFH 1SQPG 5AW2B 1ZE3H 5AAWC 3CQQA 4YXHL 3ULUE 3AE7C 2AJYL 1L0LG 1UUNA 2CO2A 3SN6N 2E6JA 3VFSB 3JWOL 4FQPA 1XF4A 5I66A 2Y24A 3MV7B 1WQVT 3SJVD 5F3BB 3VU2A 2CRYA 3CCSP 4Z7UE 4JJHA 4FNLL 1ET5A 3IFLH 4IBYA 1A6VL 3CFUA 4BWWA 2GEEA 4GSRA 3MKKA 1IM9D 2TRHA 5B21A 1YJDH 3D52A 1CBVH 2ADIA 3WFEL 3I84A 3U1QA 1KGWA 4LMQE 1W8NA 3CDZA 3DMMA 3U0PA 2AAAA 1HK6A 3UMTA 2YPKA 1I85A 1IBZA 1SZNA 1A1OB 1FQ9C 1JG9A 3U79A 1LMKA 1OAQL 3A6OA 4MXQC 5GZND 4FG6C 5KVFE 1FFOA 3PWUB 4P48A 3MACH 1EZVX 3LQZB 4FEIA 3PWVB 4YE0A 2E75D 2Y0EA 1F2XK 3OKDA 3RL2B 2OTUA 1J1PL 2XU9A 5B38B 1U92A 4DVBB 3SZ6A 4QJ5B 5KJ7D 2O1AA 1U91A 3BP5A 4O51A 3L54A 5DT1H 4JL2A 3T1WA 4DPCX 1GYCA 4HIHA 4FD0A 1JYNA 3FOLB 1M42A 3CVHB 1KTDA 4QI3A 1JHKH 1OAYH 4R0LA 1QHPA 3CHSA 4MA1B 5FHBL 3U83A 3DPBB 5JXEA 3EOAB 3KPRB 3WFHB 2Y7LA 1KWGA 1XZ0A 1IJ9A 4YC2B 2JKNA 2OYLA 5E8DL 1EXUA 3NZSA 4Y9BA 1Q1JL 2QR0B 4E9LA 3QIBA 4JFSA 4FDWA 1MF2L 1T4KB 4PGDB 3LZPA 4M6NL 3X1GA 3BZ5A 2ZKHH 2WVSA 4HB1A 2NX5E 4TV3A 3LNDA 5HDBF 2WCSA 3TCLA 1C9SA 2HMIC 5KLIB 2WPQA 4YHKH 2Z4EA 4K0OA 5E79E 4ESKA 1NCWH 2A06D 2W0LA 2BY2A 2H0EA 3GSNB 2QHLA 1B90A 2DL9A 1HHHA 1EAPA 3DDFA 3HZ3A 1R9FA 3IWVA 3TVMA 1HL5A 3I9AA 2ADJA 4WFED 2F68X 4JREB 4WEBL 4L0YA 2CSPA 2M8RA 1J12A 4AGPA 1WFIA 1MKMA 4BFEA 4PJBA 1ZV8A 3WTUA 5KG9B 4PGEB 3VFRB 5DVLA 3K6OA 3B3IA 1AGDA 1G6RL 5DUMH 3WS3B 3CXHK 2JJVA 3KDMB 3C60A 1BFSA 1ERNA 1YMME 4LSUL 3AREA 4WWNA 5F7WC 4IBSA 3WE1A 1V8HA 4OD1L 4D0DB 1CVSC 4WSGA 1R5SA 3GPEA 5DHYB 2APFA 3IEAA 3IKCB 5LB1A 1ZY9A 3LB6D 3L4FA 3F5WB 2V3DA 4YDLC 3ZT7A 4ZMXA 1C7SA 5DJZA 4EOWH 4U7SA 1V54B 4XXDB 3RKDC 3C6EA 1SLWA 1TQCB 4GBXC 1DQIA 3D34A 2VXUH 1ZLDA 3SHSA 3N42F 3T3ME 3N3EA 2WLIB 2OTKE 4U1MA 2E46A 3EUUA 3Q1EA 2HRHA 3CVHH 1P5VA 1ZK9A 1JEKA 5CKGA 5CFAA 2V7HA 4LSDA 3VOPA 1G7HB 1U2YA 1KB9K 4FTVA 3COOA 4OLUL 3SYQA 1XF1A 5JLZA 1FIGH 4BKTC 1XAKA 1MHPH 3P30L 1CR9L 4KROB 1WIPA 2VSKB 2VRSA 1RP8A 2XBTA 2YLKA 3BEWA 4X4YB 4LL4A 1ASQA 3UCQA 4YNYB 3C6LA 2BVEA 4XZUA 4WW1B 5D6CB 4Y19E 2YMOA 2J1ZA 4PWEA 4AQ1B 1E27B 1BX2B 2FXOA 1I4FB 2NY1B 1JPFB 3QJRB 2B4CH 5B3SB 4P4RB 3HMWL 3RGVC 2NZ2A 1YN6B 1DQQA 4J3OC 5BW7A 4JE0A 4D8PA 5I75B 3LV3B 1VQOP 3V6ZB 5K9OB 3A4EA 1EHKB 4JO1L 4BXLA 4Z7OE 1JK9A 1WZ1H 4KRNA 3F58H 3RWHB 1A6ZB 1HSAB 2H26A 4LC1A 4TNWF 3CCRP 2X4RB 4NUJA 3TIEB 2J6WA 2AK4A 3VM5A 5AG9A 5BQ7B 5C70A 5TE4L 1ZDQA 2WT7A 1UURA 4HIXH 4KMTH 3DJ9A 2FL5B 3O11B 4F33B 5PCYA 3PP5A 4PJIA 5CBNA 1LEGA 4P49A 3SKMB 4HK0A 3KGUA 4ZMQA 2YUVA 4OT1H 1D5XB 1E79H 4M43L 3RAJL 3WJJA 3WDJA 4JR9H 3ZN6A 2BSTA 4AQOA 3ULSA 1ACYH 5D96C 5IKCA 4W80A 4I1RA 2WBKA 3AXLA 4NPKA 4X5XB 1BLIA 3DYOA 3IFNL 3NRQA 3HG1B 4KKQA 2QQLL 3NIGF 4ZXBA 1AGCA 3LPGA 2XLLA 1FVEA 2OBGA 3RZWA 1YEEH 2AFNA 1Y0LA 2VRAA 5KVGH 3EYVB 1ID5I 5AVYB 4ETYA 2E3VA 4GKOA 4ZUTA 3I56P 1T0PB 3AG4B 1YO4A 3QS3A 5I71B 2KPNA 5D2LF 3I6LE 3ZX1A 1RFDL 5HD8D 1BE3E 4U3SB 2AXHA 2OMUB 5C0EA 4E2OA 3HPJA 3RX9A 4L4VB 1U3YA 4RH4A 2XVGA 3D4YA 3O9WB 3MLZL 4PJEF 5I1CH 1CDCA 3H3PH 1VLXA 2NXYC 5CR8A 1BSIA 3L3DB 1OT1A 4G7YH 4AG4L 3NJGA 3BPNB 4LESA 5T8IA 3ELAT 1IQWL 1ZLSH 3NSYA 1FV1A 1BM3L 5I28A 5EEVA 4GKGA 3H53A 3QDMA 5EUOA 3B9VA 5LDUA 4AK2A 1D3CA 1YLBB 5K39A 1YQVH 1N3NB 1QBLH 1P7KA 2NW2A 3G6JE 3OWRA 3WFDH 2XWCA 2LABA 3C8DA 3KYNB 4RMBA 2UUDH 2DQ6A 3B1TA 3L3OB 4JDTL 5SWZB 4IDLA 3Q05A 2QGCA 4ZUUB 1A4JA 1ZK5A 1XIWB 4JFZL 4PSPA 3RX5A 4DPBX 1SBBA 4LMQI 2I85A 3NZHL 4YIQB 1JGLL 2GBTA 2ZXQA 3ISWA 4XO9A 3K8KA 5CN2A 3RNQB 3SY6A 1UM5L 4G6JL 4P2RE 1CCZA 3O6LL 2VDKL 4FJ6A 2KUBA 4A6YH 1IEAB 3B8SA 5TDOB 4HPHA 1I31A 4RESB 4P9HH 4YSUA 3H1JJ 2FR4A 1SLVA 4G70B 2EDYA 1FNAA 3D18B 3ARFB 4RFNC 5C8JA 2AJZB 3WIAA 4BYHA 1RZIA 1NLDH 1A7OL 2JKWA 3Q2YA 1UB5A 4MLSA 3SDAA 2FD6L 1TEYA 4JG0H 1SF5A 1KCUL 1YHPA 4HKJA 5FA4B 2IDSA 4JHAH 3MV9B 4OD3H 5E6YA 3DO7B 1BVKA 2NW3B 3NJMA 4FQ1L 4G7QB 4Y5VB 2AEQL 4AL8H 4J4PA 4O02A 4ZX3A 3TURA 5E6IB 1HQ4A 1E6OL 1TMCB 4B9PA 3V6BR 4PJEE 2ZKMX 3G6AB 1JY3N 3BSZA 3TYYA 1OGTB 3L9BA 3NCJL 2IPKA 4N1HB 4PRAB 4B53A 2DTML 4GW4B 5D72H 2X05A 3IYLW 2YXQB 1IM9B 1ZT1B 2EIDA 3QAZB 5GHWL 3U46B 3PY9A 1BVOA 3BGFB 2KZIA 1SYSB 2HXAA 2NY5L 4LCIH 4XCCL 4Y4KC 1UM6L 2AHIA 3LIZL 2CDGB 4UT7L 1P53A 3CX5H 3E7KA 2F74A 2YOAA 4FCHA 1GGCL 4TL5A 5E9DD 1TZGH 1TR7A 1J0YA 3OPZH 2D0FA 4BSVA 3VXTB 5KSAD 1IFMA 3TN0D 3Q06A 4ACTA 1XL4A 4TRPL 1FVCB 4JY5H 2OM5A 1YN7A 1YC8A 4QAMB 4C58B 3RIFF 4ZRGA 3VW3H 1NC2B 4JQXA 2IDCA 3EOTH 4NP9A 4OLZH 5H37A 3ULUF 4OY9A 5BZZA 4QTFA 1TO5A 3ULVD 4F93B 2X4QA 1CJYA 5E24E 1SEBA 5IVXE 3BGAA 4B95C 2I60H 2AQ1A 1HHGB 2YAQA 4IOFD 4MJIA 1WV7T 2CO3A 2IAMD 4YFDB 2YBRB 4R4FL 1NJ9A 2MTAA 2NY3D 1TTGA 5ISZD 3E1F1 1F4YH 2X4TB 4U6VL 3TZVB 2AGJL 1DVFC 3L95B 2FWSA 4Z7WB 1S7XA 5KUKA 2WTYA 1IAKB 2DQTH 5E2TH 4OGZA 4NWUH 4Z7WF 3K2MC 1FGNL 1KENL 3AITA 3Q5TA 1QMUA 4N20A 3DX0A 3ZHNA 3EDKA 5MHSE 4I87A 5GJTL 1LWUB 4I6MC 3GSWB 1EXGA 3ILPA 6FABL 4JF7A 1A6UL 1YEWA 4HT1L 4MXQD 1GGBH 4P57A 4OZIF 1I7TB 1UZ8B 3OR7A 2AXCA 2GSIB 43C9A 3FW6A 5EBGA 5KLVK 3EGSA 1JZ3A 1E5AA 2EE0A 1QSED 3Q2NA 4GQZA 3FQUB 1PDKA 1F3DJ 2BSSA 2J8OA 3UJIL 2XA3A 4WU7A 3PF2A 2Y9RT 3Q8CA 5JQ6H 3ZL4L 2DBLL 1O6SA 3ARWA 3A7OA 2L4OA 4EN3A 4J27A 1K8IA 2R83A 4HJ0D 3CZFB 4MX7B 2WXGA 4KZ0A 2WO2B 3UC0H 1KYOI 3ESPA 1IM3D 1J8HB 4EO5A 4PRNB 3CSFA 1L5GA 2FB4H 3RVVC 4AM0B 4Z3JA 3DUUB 4N8PA 4UIMB 1S2EA 4CADB 4UTBL 1L0LJ 5GSVB 3ARED 1AP2B 1JF1A 1QKZL 4X9FA 1G7JB 1ID2A 2NNAB 1PZUB 1T2JA 2OJEA 4YDMA 5AW1B 1SDDA 2YXMA 4IHBA 2OYIB 4HJGB 4KQ4L 4NWTL 5CU9A 4HULB 3HD7A 3LKRA 3WS6C 5JIHA 2P49B 2EILB 5C2BH 2K9JB 2P5EB 1AO7A 3VCLB 2IZ0A 2CRIA 4DTGL 3IJYA 4AE1A 2A6KA 3IGUA 1DFBH 1S7XB 1R3IH 2IV8A 5SWQB 3WIIL 3DK0A 3H9SA 3TNMB 1GZQB 4QT5B 4OB5L 4Q58C 1EBPA 1XGUA 5I1HH 3L4UA 2WQUA 3IDJB 2NY7H 2Y6TE 3IMTA 3RJDA 3OKLA 1ULVA 1RJYA 1HI6B 3JV6A 4XBMA 5BZDB 3QUYB 3UTZB 3FUEA 3K0WA 4FEMA 1ZIBA 1PG7H 1BBDL 2Y2WA 3C6LD 4LLAA 4CC4C 1ZAGA 2WXRA 3TBVB 2XKSA 1WAAF 2IH8A 3US0A 2W9DH 4ZTEA 5T5NF 2MSPA 3D2TA 5DR5L 5AOJA 6TAAA 2ZUWA 2Y4SA 4P3CH 1JJUA 5D5ME 1MQKH 5JHDD 3VGDA 4EIGB 2L7QA 3B5TA 4ONHB 4DGYH 2JTYA 5AOKA 2CJTA 5HJBA 4J12A 5E95B 1NO4A 1KC8Q 1NH4A 1R3LB 5I73C 1A3LH 3GJEB 2WLKA 1XCQA 2Q2LA 1ZN5A 1VHPA 1JYXA 3HI5H 2D31A 3HUJA 4NOFA 1RLBA 1AKPA 3OF6D 2P80D 1TJHL 5F88A 4LLYB 3V0DA 1IK9A 2NT1A 2IJ0C 4JKMA 5CP7A 2YKPA 3L37A 1REIA 3HRZA 4RQQB 3T4AA 1MAJA 3HB3D 4E9QA 3GC3A 1QLEB 3AY2A 4KDTA 4L37A 4N2LA 4FABL 5DJXA 3HN5A 5I15H 3NK4A 5HPMA 1E40A 2QA4P 3L75G 3RWGB 2ITAA 3F05A 1ZR4A 3R0MA 3AE4C 1YUHB 5EC1B 1WHPA 4FJZA 4PJDF 1MFBL 4L23A 2ZUUA 1YY9D 1VF5C 5B39A 1UG9A 4LF3B 4FOMA 1OQXA 4HKJB 2YC1A 4N0FA 5FA4A 4Z23A 3S96B 3S8WA 4XMLL 5DDHB 1DLFL 1LYQA 5E4OA 1QI4A 2YRBA 3VXMD 1K8AQ 1ILSA 4ABUA 4I8DA 4H1LH 1OW6A 5I1DB 4GW5A 1NCCL 4NC2B 5FV1L 3WEAA 3QS2A 4AJWA 4XVSL 2RN0A 1IEAA 2HSIA 3QXWA 3O9WC 3CCUP 3VFNA 3GHEL 5CJXC 3K71B 3ARTA 1JHLL 1A21A 3ETBJ 3QO0A 1KBGL 4PTUA 2FKWB 1AGFB 1NBVH 4ELKA 4XPAH 1O5PA 2OL3L 1P84J 1FPTL 1MSPA 2KDYA 3WLBB 3P9LB 2FFDB 3TBTA 2OCFD 4N6JA 4ZUUA 2WLHA 1T5XA 2ZONA 3BT2L 4LASH 4YBLB 2VR6A 4D3CL 1PYWA 4WEEA 4DEWA 3OAKA 1WK0A 2G3MA 3VB9A 3K72B 3GXPA 1L9NA 5KVFL 5EIIB 4G42B 4LQFL 3SFEC 3PHLA 4Z9KB 2QJPC 4GW1B 3VGGA 1N8RQ 1MPAL 1NGPH 5L7XL 3B56A 5EORL 3ZYOA 3B2UC 2L91A 5C09A 4IK7A 2Y07L 1K5NA 1IC5L 2HJFA 1SHWA 3SKUD 1IC7L 2HKFH 5F1OB 4ODUA 1F90H 2EKSB 1JWSA 2EYTB 3TVMD 3IE9A 2HYMA 4NJAH 3O6QB 1YNLL 4WK2B 3BPCA 4PBVC 4ODHH 4XNYL 4LCWE 1V5JA 3X3GH 4KBPA 2APTA 2KXPB 3DX9A 3NP3A 5DRZA 3X1NA 2WYTA 4PY8I 1MVUA 1H8LA 1YC7A 4YDIH 4DO6A 4Q14A 4LLQB 2CHDA 3QQ4B 2JWAA 1FJKA 4X5XA 2QGEA 3HI6L 1BM7A 2EC9T 4FI6A 1NANI 3OC5A 3V6OE 3VXSB 3MUUA 4KV5F 1QBML 1U8JA 3AY4C 4Y19B 1ZTMA 2NX5A 1SQBG 5D4JA 5C0BB 5T1MA 5JOFA 1MLBA 2Z8WC 2Q86A 5CZKA 4CAGA 5A2FA 2H2SD 3MRJA 3P4MA 5L2JA 4KVPA 1IGTB 3AWGA 2OZ4A 5KYYA 5E2VL 4IFMA 1LO5B 3HUSC 2Z0UA 3PCYA 1KY6A 1QNZL 4DCQA 4LRIC 1NAYA 3BUTA 4EXPX 5ERWA 2HJLA 1AJ7L 4OIIL 3MN8A 1T1YB 3FU9A 4OSUH 5AW5B 4XPGL 3SYPA 2H2PC 2PYEE 2HX9A 3CZNA 3W67A 1J9RA 3KPRD 2WQXA 3K81A 4PRID 2N1TA 2XYBA 5KJRL 3U30C 1Q86Q 3DETD 4L1DA 4TSCL 1XR9A 3FU6A 5E1IA 2YIHA 5IJKC 3E6HA 3JWNE 3R0NA 3SDDC 2HFEA 2CGZA 3BGMB 1JPSL 2DQJH 2BVTA 4HMDA 4MASA 1L0QA 1YMMD 5BS0B 1FNSL 4Z8FL 4CJ0A 3CLFL 3MBXL 3N50A 2X9WA 4BZ1H 5JPMB 5AUMA 4W7YA 3D3VB 4ZS7L 2IWEA 3FTZA 4QHNA 4JMNA 4PD4K 3EBHA 1GL2D 4BGLA 2P1JA 2X89D 2ZWZA 3BLKA 3BP6B 3VRLE 4H0LD 1EA9C 1ESOA 2OLDA 3U9UA 5GGSA 2WNXA 5HHQA 3TO4B 2VUYA 1JV2A 2VITB 2WUBH 4N2KA 2R2HA 3LZFH 2DM4A 3BSHA 4JREC 4P59H 4U1NB 1D5MB 5DJYA 1N9PA 4AVHA 4K7FB 1UFGA 5C07A 3PG2A 2FWOB 3B5NB 1UOLA 2R23A 3QB7C 1Q9KB 2CALA 2GK2A 3K2UL 4MNGA 3SDCC 1J48A 3KPPA 1ROWA 5JORA 7FABH 4YHOL 5EPMA 3TZVC 3UTSE 1XH3B 2XZCH 4G8GB 4XNXL 3BVVA 4OLVL 5I5JA 4EF3A 5GS0D 3PFUA 1J9TA 4K8RC 1Q9WA 4WY7L 3X11A 3EJCA 3CFJB 1M7DA 4PD4D 4N68A 1HGVA 3TU6A 3FU7A 1U8QB 2BLFA 3TYGL 3DOHA 2XCMC 1OTSD 4YWGH 2HWZH 3K6NA 3VFTA 1MREH 2R23B 1C8QA 4ES9A 4IRJC 3CSTA 1DBKH 2VLKB 4R3SB 4U1KA 5KG9A 5IFAH 1T0NA 1EMTH 2R2EA 4RSYA 5A16A 4EI2A 2D03L 1DJHA 1MCFA 4W9JC 5JIKA 3GIZL 1AMXA 1KGJA 3ABMB 5CIPB 3QG7L 4N5ED 1E9QA 3ZSTA 2XACC 3INOA 1FAIL 1IBDA 1EHNA 2QZQA 2W9EH 2P44B 1VKXA 4BZYA 1CFSB 1NCIA 3T0EB 8PAZA 3IN6A 2FSEB 5K9KA 1GOHA 2LR2A 3GRGA 15C8H 4RVBA 5DQDL 4DN3H 1JZ2A 4LEOB 1DCEA 5DXWA 3E6FB 4GAGL 5CJ8A 4GO8A 4CBZA 5IR1B 3M7FB 2P52A 3PQYD 4KITB 4WFHE 2O5YH 4X7FC 2N1TE 2F5AL 3LSOA 2NZ9D 2XPGA 1UWGL 2AF2A 1HN1A 4X6CF 1SJMA 2Z35B 3FQ2A 2G9HB 1M71A 2EXYC 3OZ9L 4Y19A 5BPPA 3L7EB 4KTEH 3EH1A 1SQVE 2G8YA 3RIAK 3V4LA 4QCIB 3UC2A 2Q0ZX 4AXWA 4YDVB 5E6IC 4N5UA 3GZOA 3ML8A 3PWJA 4X98A 3MLVH 4MQ7B 3TNNB 4Y1AA 3NCXA 2G75B 5I8KH 3I9GL 2ZCLL 3BPCB 3WN6A 3MNMA 3SEPA 3QCVH 3PJSA 1OHQA 3L72D 3BE1L 3CC7P 4LL1A 5I1JL 2WQAA 2Q86B 4N9OB 4R8WH 1N70A 3BZFB 3NIFE 4OQTH 2FX8L 2C3XA 1MXDA 1AMYA 2CLRB 5A2AA 5MENE 4ATWA 1IC0A 3LKQB 4N8VA 5CIPA 5I18L 2CK3H 5T1JA 4NNYA 4JFXA 2OSXA 2YQBA 3H1KG 1D6EB 1RUAL 4PCSA 5KLVG 1BXAA 2VDLB 4OJYA 4XB8A 4FADA 1GRWA 4UINL 5KSAC 1KIRA 3N43F 3L3OC 4KZDL 3C6SA 3Q2LA 3DIFA 4J8RA 5JW4M 2RTTA 5EUKA 4L8SB 3EHBD 4F8TA 5EC2A 1U8QA 2DJSA 2BHFA 4PJIF 1NVOA 4G8IB 5EFWB 1BLNB 3PJNA 4HEPA 4Y2DB 5GIRA 5DSCA 1P4LA 3BPNC 2CDFA 1X9QA 4G6FD 5CCGE 1YNKL 4RMRA 5DVPA 3X3FH 1FZBA 4WJ5B 4UANA 4A6YA 3C5ZD 4L3AA 2XKNB 5D2NC 2BS9A 4BDVB 5C9KA 3QJHA 2X10A 3O2DH 2WYHA 4M1GH 3D4GA 5D7IB 4TOYL 2RMZA 1E2WA 2IAAC 4R5VA 4ZFZA 1PGJA 4J3UA 3T8XB 2EDFA 3NCYS 4Y7OC 3L74E 2ODIA 2FTAA 4P2OA 4YEFA 4H0LB 3D6ZA 3PGCA 3HNTL 3Q1SH 5DK2B 2FNBA 2IGFL 2VMCA 3MV11 4KKBC 4ELKB 1TLKA 4JFFB 3I85A 1ZEAH 2ZUQB 1L4IA 2QDVA 3NG5A 1E4WH 4J3OH 4B86A 4TNWK 3S5YA 2YN3A 3CZJA 1FHNA 3FTGA 5BRPA 1BFVL 4AEFA 1TQSA 3BJLA 3VXQB 1LO0H 2UY7A 3B9KA 2HPCB 5FHAH 4PCKA 2LE9A 1CICA 1PD0A 4G7VH 1JF6A 4D0CB 2KC0A 4P3DA 1K2DB 4PY7A 3I02A 2MHAB 1UXSB 2AI0L 3CXHI 4AIZA 5GS0C 2GITB 4N3UA 2NNCA 2WLNA 3BMWA 3FT2A 3N1FC 4TQEL 4UAOB 4F91B 1ZGLB 3QISA 4XMKL 1A25A 4E9WA 4UTAH 3V4UL 2WSPA 3DHMA 4F9PC 5T1LA 1JUFA 4GAJH 5I19H 1QEWB 4G5AA 3ATDA 4ODXB 1MJ8H 4GKNA 1ZJBA 3VWKA 1UT1A 2ODHA 3GZQA 4FQJH 4KHXL 5GGTL 5ALBH 3HS0C 4OUOA 3FTYA 3TBBA 5CCKH 1N64H 3SWYA 1FH2A 1VFBA 3ULVF 4EDXA 3B83A 1SQXD 2NPSA 3T4AB 3MVSA 2JP3A 5F1NB 2IDFA 1A3QA 1QSEA 3DDGA 3W0WD 2VSMB 2WXIA 1ZPUA 3DMMD 4JFFA 1XGRA 2F53B 1M57B 1KCSL 3QNZB 3T97B 3MYZA 1M9WA 1R3HA 5MP6H 1BVZA 4PWIA 4YE4H 4TNVF 1GKOA 1E9PB 5ILTH 5CGBA 1CZ8H 2WSCH 2ZXEB 2X6BA 4NQVB 4JHVA 3CHOA 5FR3A 1OK8A 3L35A 1DQML 2GTWB 1LTJB 2IPUG 2J5UA 5KYWA 3HC0A 2QPSA 3V2NA 1SEQH 2BIIA 3IDIA 1J5DA 4ONOA 5HI4D 4TXVB 3U6XS 2BJMH 4HHGA 3Q3GA 3TBVA 5C9JA 2VDOH 4XNUH 5D7LB 4D9QE 3VRJA 3LPFA 4WIQA 1CZQA 4ISVA 3RWCA 2C9QA 5FK9A 5FWQA 3VFOB 5BVJA 1GW6A 3FAWA 4TN9A 2AEPH 3H2PA 2ICWI 4JO3H 5DFAA 2RHEA 4M8RA 3QP3A 1NOFA 2AV7B 4JFPA 1GGYA 1WS7A 4NQUA 1J5CA 1DBJL 4G1MB 4IJ3C 3VMXA 2C3GA 3GHPA 4ZUSB 5IB2B 2N1TD 4POUB 3S37H 4N86A 3NJVA 4PLNC 1HOCA 3CHPA 1J8RA 5F70A 4CVZB 2D3JA 3PPSA 1A02J 3OAUL 1PD6A 4P0DA 3VWKD 4M3JA 4XR8C 3B2XA 3KPTA 3TH3T 3ZYIA 1J87A 1X5LA 1I9RH 4Z7IA 5IJVA 1RPQA 3ME0B 1K6QL 3CH1A 4ORZC 4JBZA 2CLRA 3VGAB 3ZK0A 5GTIE 3QO0B 4PD4J 5H8DA 5AAWA 5MEPA 4XH2B 3VGHA 3TT1H 1LO2L 1P4UA 2OMXA 3M17A 2JKRM 5D7LA 4BFNA 3UEZA 3FFDB 5HI5D 4O02L 5T1DL 3UACA 1NUDA 2AQ3A 2V5SA 3WJMA 3V4VB 5K9JH 5EBWA 3U2SA 3Q7JA 4PJ8A 3RG1C 4LIQE 4EIZC 3PABA 1XTCC 2BVQA 3AE8C 1ACCA 3V0IA 4RFEA 3GMLA 1TZOA 2RALA 3ZQ9A 4BRVA 2VDOB 4PV9A 2BDNL 2X70B 3ZKMC 2WXMA 1AQHA 1Q7YQ 1VFOA 3H25A 1MCWM 4IL6E 2VDRH 1EZVD 3IRZA 1JPTH 2LXCB 3WD5L 1K4CB 5HYQA 1AA0A 4HS3A 3X1FA 5FO8B 1OCCB 1RVFL 2JJTC 1CXFA 3GI8H 1SM3H 4YTPC 1C5BH 2EDKA 1MWAH 2BSSB 3ATBA 4XHJD 1RK0A 3ITKA 5C08E 4HH2A 3VFUA 4RRPA 2D2CC 2NY6D 4EDXB 1NGZB 3HVDA 3P77B 3OBAA 5FS5A 1BF5A 1R75A 1A64A 3N4XA 3VXME 3HRZB 1TCMA 3K6DA 2VIRB 1S9VA 4M1DH 1BDYA 4F7CB 2GI7A 1WEJH 3GJFK 1AR1C 2CM5A 3LEXA 4OZFB 4BUGA 1WWCA 4IGBB 4ZAKD 1NQBA 1GYAA 2H2SC 3GTTA 1IEHA 3QEQA 2ORBH 4JVPA 5AAPA 2CIIB 5MEQA 4JO5A 3W9DA 3ASWA 3OKMA 3GSOA 2VR8A 2WPSA 5J6GA 1T2QH 3K8LA 4XODA 1K4DB 4K94L 2E75C 5E6RB 4WJKB 1QGKB 1TSHA 2VW4A 3ZY7A 5TE7L 5JXEC 3VSQA 4YFLI 2UY7B 4Y5XC 1PSKH 1U8HB 2JK5A 5CINL 4JGNA 5L2KB 2EABA 2Z4QA 1FDMA 5J1AB 4QMAA 5EN2A 1Q2NA 4A1RA 3LQAH 3K6FA 3QRGH 2ZF8A 1S5LE 4KPHH 3RTQA 4UM8A 5C6WH 1WRFA 3FRPA 4KXDA 4GW4A 4Q4EA 1TFHA 3OQRA 4X6CA 2OCJA 5I9QB 3CDFA 1ZLLA 4HKZH 3OB0K 2KZJA 1N2RB 1S7SB 1XH3A 4G8GA 5M7QA 4CUCA 3IMUA 5ESVB 1SQMA 4NNPL 5CLZA 4YXKL 4J3WA 4H88H 2FCBA 3AE5C 2QPUA 2UZIL 4MB5A 1HKFA 1HIMH 5EU6A 5HHMB 2R0LH 3ZDXE 4Z7QE 1I3UA 4FKKA 4A2MA 1QFUL 3CPLA 4NQCB 2DWXA 4L9LB 1PZ5A 3CFKA 1IAIL 3QXDB 4UOZA 2R2HB 5DC9B 1HUCA 3FT4A 5B5EH 2N4IA 5EU3A 4C7RA 3TO4D 4ZMLA 4J39A 3LD8B 1G4RA 4Z7QF 3ZDXF 4HXAH 2CDFB 1CFBA 4HUKB 3VFPB 2CCVA 2G5RA 1VIWA 1N18A 2W80C 5E2JA 4H13C 1NINA 3RIKA 3OTTA 3T0XA 4N8CH 5JOEA 2CMRH 1CGSL 2WXHA 3BO8B 3Q44A 5M95B 1XIWC 1FNLA 2A4ZA 2AJVH 4IOFC 4C56A 1LE5A 4ELME 3EJZC 3U1CA 4GP8B 2YMTA 3MV9A 4PSRA 1CFMA 3VJ6B 4C7NB 3BP4B 3IETA 3OXSB 4E9SA 1KPVA 2YA2A 3LPWA 5CGYC 5B3JF 3KPMA 3ARGB 4KXZI 3MRNA 2NW2B 3MRPA 4JG1H 3U4AA 2AQRA 5EBWB 2NCMA 1B6DA 1NCNA 1UYWL 3EJQA 4BDVA 5B1BB 1S7RB 4LKXB 2P7JA 3LH9A 1IILE 4V11A 1T89A 5IHUL 1CTNA 2NSQA 3A0HE 1IIKA 3REWB 2GSMB 5ADOH 3WTXA 1JPST 3DOSB 3EYSH 3L4TA 4GH7B 3K8MA 2YKQA 4Y1AB 3IAPA 2FHFA 2J8UA 1SQBK 1W72H 1T1WA 3CBJB 4Y2OB 4ABQA 1NPJA 3WXWL 4HOMA 1TF4A 3DMMC 3JBG7 4U1GC 2FDBP 3RBXA 1HILB 3CZSA 1IE4A 2BIQA 3LQAC 2C34A 2YAOA 4YGAB 4ZTOH 1NAMH 2X7LA 1HEHC 2D3VA 3DXAA 4LBEB 1E5WA 4AZUA 2Z92B 1QZNA 1RI8A 3SCMD 1DVTA 4ZKUA 1ETZB 3TK1A 4LPCA 3WNMA 2CNYA 4AZ8A 3IN0A 3E3QC 7PCYA 5HVFB 2YXWA 4IL6X 5DZAA 3UTQA 2E8ZA 2ZUYA 3KWXA 4QF1A 4S1RH 2V33A 3AT8A 3U9WA 3B9AA 4NAQA 5B3JE 1SQPJ 2DW3A 5CBEA 4PJ0H 3T4YA 2QRXA 3HHMA 3BH9A 2B2XH 1TTCA 2JQZA 3CN2A 3S3JA 4ZTPH 2EXWC 4F1SA 1YYMH 2IAMC 4Z95H 2MTPA 4ELDA 4P23B 1PLGL 5BJTB 3QDMD 1XIWD 1RUQL 5EIIA 5EO1A 4LZKA 1DN2A 2CDGA 3D08A 2VLKA 1CK0H 3M45A 4IDJL 3BFOA 2R1YB 1BFTA 4PI2A 3J7HA 4W9LC 1EV2E 3ML9A 3UFIA 1KJ3L 2GT9B 2O1KA 2OMVB 1WGVA 2BNRE 2W5PA 5BO1H 3TZVD 5JPNC 5KVMC 4NPDA 4LLWB 3PHAA 4JE4B 4AEHL 4KROC 2H32A 4KKCC 4L48A 2ZYSA 4WI8A 4AKOA 4GJTB 4YSDA 4XCFH 4TUKH 1M3IA 4WAFA 1LE9B 4UOQA 2ATAA 2X53A 3B5GA 2JXMA 1LDPH 5JZ7C 4DKFL 1AR2A 4A7UA 1SVCP 4ZKPA 3QUMA 4XC3H 2NW3A 2FSEA 2CPUA 2WXJA 3PGDB 4CVUA 5KS9E 5D1ZI 5D1XC 4DJGA 2A6DB 3APDA 2H88C 4YHZH 4R96A 3T1FA 3L5WB 3GF7A 3D50A 4WNQA 2DIBA 2DM2A 4TVPE 5E8EB 3S96A 3A47A 3U9UB 5DRNA 2MQCA 2R1WB 1LJ2A 5B38G 5IT2H 3S5LA 1JGIA 4PS8A 2H3NA 2JIXA 1A3RL 2AERT 3T0VA 4IBLT 4FNTA 2PW1A 2ZX9A 2R59A 3IBOA 2GUVA 4L3EA 4AIEA 3UCRA 2YN5A 1NMCB 5BS0A 1BXVA 5BOPA 2V9UA 5KLVJ 1KBPA 3P0YH 1YEFL 3RWEA 3ZZSA 2R5BA 3MXWL 4KKLD 1A4JB 4RX4A 3IPFA 4WKXA 5IREA 3I6KB 1R0AL 4KQ0A 1DANT 1YJDC 5L8RJ 4XTRD 4I7ZC 3VI3B 3RDTB 1SQXG 2Z1KA 5TK4A 3N41B 4A39A 1NEUA 3EIFA 1V3MA 3VXSD 3ZTDC 5HVHC 2J5LC 2P43B 4MD5A 4OGYL 3DIVA 1ZCRA 1OKEA 3BEVA 2BZCA 5ERWB 3GMPB 3PDGA 2FIRT 3T2NL 1KWKA 5ES4B 4OV6F 1WGOA 4J4PC 5CLXA 2VSDA 5IF0B 3BH9B 4A7GA 3WG7B 3T4YB 4DZBB 4QHNB 3BN3B 3D3VA 1KTLB 35C8H 1PPJE 5L0QC 3BCDA 4F7MB 1TTRA 4R26H 5FUCC 2EDBA 3EDFA 2VXSL 3WS3A 3I5CA 2FIKB 3ZTJG 3UTZA 1H15B 3BIKB 3BGMA 4I3RL 2NTFB 3HNSH 5JPNB 1NFAA 2YIUC 1S7QA 2YSSA 2R69A 3QORC 4JDZB 1BEYL 4Y4FB 2Z92A 4JY6B 2BS71 3FL7A 2NZ9C 5BW7C 1CN4A 1BXUA 1AGCB 2ADJB 4MJJA 4DKTA 4HC1L 2GW5A 4HLZH 2POHA 2K70A 5G5DB 5IOPB 4URTB 4OF6A 4OIAA 3TT3H 2AK4E 3ECBB 1I7RB 3QUMH 4ZMZA 2EIZA 4AH2A 1P5UC 3DETC 1Z5LA 3B2UD 1VRSA 3O2VH 4K71C 3Q8BA 5BS0D 3A6BL 4F2EA 4QNPE 1KLGA 2JJUA 3L74D 1JM0A 1CD1B 3N1PC 2W81C 2D7TH 3SDAC 2F19L 4QAWA 1OTSC 2G75A 1ETZA 4FXGC 2CKBL 3V55A 1F1AA 1UH4A 5JUEL 1RK0B 2PP9A 2BFVH 2J55A 4OUUA 2CBTA 2OKMA 4BHUI 5KN5B 1FFPB 3PHOB 1NCDL 2BMKB 3H2QA 3QIUC 4OFVA 1VQ9P 4X4ZA 3LQZA 3WXVL 2DQGH 4LCCA 1A6WH 2FATL 1CF8H 4G8AC 2HFFA 3KBHE 3BUBA 4HH8A 1OOAA 3WO4C 4OFKA 3MUHL 3MLYH 1KPVB 1PCSA 1QWNA 1G5GA 1UGKA 2XICA 3DMMB 1OD7A 5HYIA 3JUZA 4KT0J 1GDTA 3ECUA 2ED6A 2WTOA 3HC2A 3AEBC 3AM8A 1W72B 5C0CD 1F2QA 4M7JH 4NQDE 5D6DA 2O1JA 5C1MB 1WITA 2EEAA 4XNZB 1BXXA 1AQ5A 4X80H 5E4AA 5JIQA 3BAWA 4GS7B 4Z7NF 2F7QA 3RGHA 2Y0DA 1KFAH 3CZGA 5DRWB 5E6SB 4GW5B 1EGJH 5MEND 3RY4A 3EUDA 4YJZL 2J25A 3QFJD 1ZTXH 4F7TA 1K72A 3V0WH 3RILA 1R46A 1RURL 3BUQA 3FT4B 4GW1A 5I0ZA 2PTUA 1PP9E 1RZPA 3DX6A 3L72G 4WGWB 2GTQA 1SN0A 3EJTA 2I32A 4QOKD 5J9PA 4G11A 4IOIB 5I1KH 2ZXBA 3N40P 2K8MA 4RRPM 2HRLA 2OW6A 3FFCA 5DD3H 3IGKA 4KXCA 2WB1A 4OCMC 4WWKB 1CLYH 3FQWB 3BVUA 2IC2A 4F5CE 5DZNA 4DOJA 1OSZA 3FO9A 4JGUA 3MV7A 4XP1L 5F3BA 4R6UA 3ZSSA 3SWKA 1SEBB 2A4CA 1KBWA 3VFNB 5GGQL 1J1OH 4HZLB 5TQ0H 4LOUD 4Z3FA 2HKAA 2P7TA 4L8CB 1KEGH 2QMKA 1JDDA 3Q3GB 2VMFA 3WL9B 1MCSA 1E6JL 5LWYH 3GJEA 3LEYH 4HV8A 2B0SL 5E5MB 4C4BA 1AQMA 2H0FA 2MEJB 5DK3A 3WNPA 4ALAC 4ONHA 4BWUA 5HDLA 1RV6X 3BQVA 2NY4B 5AQ0A 4TVSa 4WWPA 1HHHB 4OJAA 4OLWH 1QABA 3GSNA 2F5BL 3CN4A 3EJYC 3AEDC 4LEBA 4FERA 1ZXGA 3AEEC 1UCBL 1UA6H 1VERA 2IBZD 1V3KA 2D7MA 2Z7YA 4BFBD 3U1PA 3KVQA 3Q5SA 3UIZA 3RWGA 2WXQA 2DLTA 3QQDA 5KVDE 2RCSL 3SBWA 4HBCH 1N68A 4YXDC 3C1LA 1SF3A 2K9FB 3MRDB 4U1HA 3G6JF 5F0PB 4W6YB 2NNFA 3HI1B 4LLMA 5LXGL 3EDDA 2FWUA 1LTTC 2X87A 2DWDB 1ASPA 4XAKE 3HOGA 5BVPH 4ZD3H 2I1JA 4QMEA 3LKSA 1BQLH 1FO0H 3HUJB 3KGRA 2PWGA 3GSOB 3DPBA 5KLVE 5CP3H 2A9BA 2GJPA 3W9DB 2W27A 2W60B 5AWNL 1XH1A 1YEGH 3NABL 2BRRL 2ZYGA 2GBVA 3GGWB 3I6GA 5KYXB 3ROLB 3WFZA 5FW7A 2FYNC 2RKLA 3SDAB 1MCPH 3L36A 1I9IH 1RUML 1X5AA 4RFEB 4WHCA 2NOYA 3KHOA 1VFMA 2XFGB 1JOCA 3B9KB 4FXKC 1P5UB 3AU0A 3CDGA 4I3SH 5F9AC 1HEZB 3RWIB 4M1CD 3NJFA 4HIJA 5FYLE 2F8VA 4M93B 3K4AA 1MZYA 4ODVH 4P9MH 2F8XC 2YR3A 4LSPL 3UERA 5JO5A 3GSNL 4PPTA 4RMTA 4LVNB 2E74D 1H6EA 2VL5B 1FU1A 1GMIA 3UXFA 3QG6B 4FQLL 3Q9PA 4BE6A 3N9GL 4PFEA 3TNMA 4XVUD 3GMLB 1VESA 3J07A 3IFNH 1I8IB 5TQ2L 1XHHA 2OSLA 1A66A 3O4LB 3TXAA 1BAGA 4MDRA 3T0AA 1CYWA 3QJHB 4XZ4A 4JDEA 5TTRA 5CZVL 4XOEA 5FF6A 4MQSB 1MCWW 4F80A 2HLEB 2ZOTA 4D6TE 4NO0A 4GNKB 4ECNA 3LRLA 1MHCB 5FCSH 3CXHH 5F1IA 2UX7A 3QAQA 2J5LB 2R7EB 2DEXX 3DRQB 4OVUA 3EWKA 3MLZH 3KJ6L 3NRPA 2C1OA 5AVXB 1G9NL 3HR5A 1KCRH 1RF1C 3KWTA 4U6HB 5E5UB 4K9EH 4UZGA 2A9DA 5AB2A 3RPBA 4PREA 2WN3A 2I8DA 1XO8A 4UYQA 4F15C 1E3ZA 2HTKD 3FUNA 3P9LA 1FJ1B 2R0WL 4MJIB 2X0UA 3VI4E 3SZKC 1CFVH 4GG6F 4UT6L 1KYDA 3Q5RA 4KRPB 1OW0A 3R2PA 1MW2A 5CJQL 4MJ6A 3NOIA 2OR8A 1FNEB 4PJ5B 1J05B 3U4EB 1E8WA 2KHAA 4H8HA 4PJ9A 4I1PA 3RWIA 2X89A 1NC2A 4NGHH 3S5ZA 4JFYB 4B27A 5I1DA 3MGTB 5AW6B 4RAVB 2HTLC 1S5IH 3WELA 4ASWA 3MUZ1 3MXVH 3HN8A 4N2AA 4E41D 3VQ1C 1IGYB 4WWKD 5B39B 4O4YH 3NEXA 4B9GA 5G4MA 5SV3A 4XBEH 3L95A 4Z7WA 3WCYA 3ZRFC 5C0RL 1W0YT 3QIWC 3TH2T 1HH6B 2XI9A 3SKNB 2B5IB 4WI2A 3HG0A 1FVDA 3QUZB 2Z35A 4PRHB 1FS0E 1OGAE 1VGKA 3HI1A 4WGVB 1GKEA 5H94A 2XV3A 3D3VD 1IFIA 1BX2A 1I4FA 5FUCE 3PQYB 5B1JC 4MMZC 1ZV5A 4APQD 4PJ7A 2YPLB 2JB5H 3GMOB 2WANA 3B8EB 4XPHL 2A9NL 4S10A 3HS0B 1BG1A 3HTKB 3O6ML 3I75B 4G9FB 3QQ9C 2FYNB 5EF0A 4Z7UB 3H85A 3CLEH 2Y5TB 1CDIA 3O8ZA 2ZYHA 4N3TA 2W91A 3CSGA 4O2CA 1KIPA 4K3JL 4H0GA 2VR9A 1V7NH 4ODWA 3T6ZA 4CKQA 1TJMA 4W4NA 1UT9A 1E42A 1JDAA 3C08L 1DHKA 4LNVA 1P2CA 1U58A 1HQRA 1TQWA 2R69L 3QDHA 1KILD 4OKVB 4QR7A 4H8WH 3V6OA 5J56B 4R90H 2DYPB 4HF5L 3QPKA 1U8IA 3JZ7A 4ZO8A 3WIFA 4QJ4B 4JBSA 1M7DB 1DSYA 2WO4A 4MA7L 5JIIA 4CPGA 2KZKA 4YIQA 1JTHB 5E4EC 3GSUB 4J3OF 5C6PB 1JRHI 2PPCA 1NBYA 3FXIC 4JPSA 1YSOA 5E2WH 3CZLA 4KXZH 5EUKB 2P28B 2PF6A 2CA4A 3D9AH 1KB9I 1F6AB 2YOCA 2FWOA 1RHZB 3P40A 4LDOB 3IJYB 4NZFA 5K39B 4HIQA 3S3BB 1AO7B 1JNNL 3VCLA 1VQ8P 2CO6B 3OKKB 1GIGH 4KHTH 3RY6C 4AYFB 4E68A 1M1KQ 4U6VH 4JPKL 1O5DT 3WKQA 4A6YB 2D7OA 2FEJA 3RKPA 1NCHA 5EWIH 5FKPA 2DI8A 4M5YH 4XP4H 2R9HD 5DRWA 5D2NB 3VX1A 3KPRE 5INDB 1C1EH 2J21A 2Q2EB 4M62H 3G5ZB 3SGDH 4TSBH 2QQNL 5EZIH 4V1DE 3TBCA 2EVIA 4OZIB 3IU3B 5GRZA 1OIPA 2D2CD 2NY6C 5D5MF 1EZSA 3CWBJ 1ZT4B 4K9JA 4CU7A 4KK5C 3UAAA 2K1AA 5GTHH 4EBQL 4PLJC 4XPBL 3ZKNC 1DUYB 3U36A 5ESQB 5BRZB 2YA0A 3CHXA 2L0DA 1HYRC 1RQVA 4M7KL 1RIVL 1JGUH 4YL9A 1QVFO 1YTZI 1DBAH 4QRAA 5HDBE 1B0WA 1JMXA 2YPVA 5CBAA 1LNQA 2D7PA 3BIBX 3E9UA 3KAAA 2WV3A 1VGEH 4N22A 3ZDZF 1OVZA 2MPAH 5HHOB 2LAAA 2VLLB 2WWKT 5DZ9A 4OGQB 3UPRB 5DWPA 1L0XA 3MLPA 1B4LA 4PI0A 1FGVL 4XN8A 1TSRA 1FSKB 3KPOA 1PZ2A 4TULH 4BEIA 1QKZH 4ANUA 1CE6A 1N19A 3CN3A 3D2UD 4W9EC 3TH4T 1KPRB 1E3FA 2NY5C 4LEOA 1ZSHA 1E4XL 1JXDA 1OAXL 4M4RB 5KVDH 1JBJA 1XTLA 2ZNXA 4MYWB 4PRPE 1UD3A 4NHUB 5K9KB 4B7IA 2OX5A 1IGFH 2ARJB 2LU5A 2RA1A 4A38A 3TGUG 3HR6A 5JW5B 1YECL 3QEGL 2WWOA 1A1OA 2ED8A 3UGXA 2C7FA 5TE6H 2XPGB 1X5JA 4J3OG 4QHPA 2AV1A 2QVFB 4PQXA 4B6ZA 3QIUB 3PYCA 1T03H 4R2GD 2FZ3A 3O9WD 5ICYA 4LSSL 4NXSA 2AXJA 3IMBA 1IARB 4K5NA 4YNYA 4GXVL 4NP4H 1VACA 4IIQB 4HWEL 4RX4D 1PL5A 4PWFA 3LRMA 3IJSA 5C09B 5INCB 1F3RB 1KGCD 3RZCC 4A7QA 2ETWA 1T2KD 3H9SD 5I6MA 1FFQA 2N1TC 5AOZA 3T0WA 1NU1K 1P6WA 5AVWB 1GU5A 1BOGA 1PG7W 1XSJA 3F00A 3KEHA 4UQ2A 5DJYB 4KUCD 1QLEL 3DO3A 1KJ2H 5JQIB 1SYSA 4WWIA 4NKOA 3WDHA 4WTXA 4OJFL 4A68A 1NHLA 4R5XA 1VPOH 4MN4C 3E3QE 4JQXC 2XKUA 2ZP0T 3EJSA 3OMIB 4GBXD 2P2UA 3L4XA 5C0AB 3VO0A 4MNHB 1INQB 2GCYA 4FXLA 1EDLA 2DWTA 5DS8B 3C60C 4JO8A 4L8BB 4RMWA 1OM3L 2F2HA 1WLHA 1LO3H 1U8LB 4WUKL 1KCKA 4K8RL 3A2AA 5J1TC 3TESA 3VAEA 3BESR 3W82A 3KEDA 1OP3K 4EPSA 1JMZA 1ZHKA 1G7HA 4U1NA 3BSZL 3P2DA 2ZSVA 4NQXA 2RAMA 5DDHA 4JNXA 5GRJH 3ATEA 3MOQA 4ZMPA 3F7VB 2J3SA 1UJTA 3FB5A 3Q13A 4NKDB 5GJSH 3ARYA 4RJTA 2OTWB 4EMZA 1YEIH 1LTIC 3MBED 5KVEH 1CVRA 1X9LA 2NY2C 4F3FA 4MCYA 1AXTL 3HPLB 1KNOB 3CFCH 4LVOB 4WSKA 5DC0A 1LDSA 3LKNB 2DQUH 3MRMB 5E9DA 1I8MB 2ZX6A 1NMCC 4XMZA 1LK3H 1F3DH 2FYYB 3AREB 2C7UA 4PJDE 3WE6B 2RH0A 3DSFH 1GOFA 4PD4H 3PP3H 5CP7B 4ANKA 1OX3A 3ARDD 4PW9A 4LU5L 2H89C 1MFEL 1P7KB 1ZKAA 4L05A 2EO7A 4AJ0A 2YAMA 3FB8A 2EDTA 4HU8A 2MRYA 2APBA 3VTTA 2ZCHH 4PJBB 4QXGH 1CBJA 1XGTB 4NPEA 1D5IL 1PZAA 3TJHD 4B97A 3IDNB 3GXNA 4L9DA 3B9DA 5F7YC 5L4MA 3S3DB 3L3DA 1NTMD 1EEYB 3GHBL 1C8PA 4ENZA 1LO5A 2QV4A 4M9OA 3L71G 1SQPD 1N10A 4N3YB 5DK0A 3LPPA 4FA6A 2WUCH 4TUOB 2O5ZL 3UP1A 3R06B 5LBSL 1X5ZA 3LTVA 5B38A 3UZEC 2IBBA 4S1SH 2YD6A 1BHGA 4HCFA 4MRCA 3IMSA 3P4NA 2R32A 3G71P 2P5PA 4Z76B 4IRSB 2AW2A 4QGTA 1IGCH 3SPIA 1YJWP 1FUNA 4O2EA 1UADC 1YEJH 1MVUB 2VDKB 5C71A 2F58L 1NIBA 2M5AA 2CGYA 1V3JA 3KPLA 5L4FA 5B1KA 1WBZB 2WQSA 1HILA 5I16B 5LUMA 1NM9A 5I23A 5BV7C 2OS7A 4JPIA 5TF1L 1X5YA 4FZ8L 4F7PA 4KQ3L 5FA3B 5DFVC 3MX0B 5BNXD 4LP4A 3FOLA 3APMA 3FH5A 4DFIA 3UAFA 1SLQA 3MP7B 1F4XL 5DO8A 3GMQA 5CWSA 3C5ZA 1FZOA 4X6BB 2XZAH 3O11A 4F33A 5KAQF 1NMAL 3CFQA 4GPVA 3GRBA 3F7PC 3PJSK 2B1AH 3VXUE 4XP6L 1HXYB 4ONGL 4UBDD 3BHBB 1B4JL 3MV8B 3VH8A 3A0BH 3GLMA 3TEUA 2Y7QB 3MNWB 3K71A 1X22A 4D2NA 1U92B 1CI6A 1NTZE 1QUPA 2Y23A 3F6LA 5G2NA 2MOQA 3GLEA 1J86A 5DD0H 4HCRH 5A43C 4G82A 1IJDB 1B2WH 2BZDA 3MJWA 2AKRA 5APUA 2BNQA 3DV4B 1RH5B 1RZGA 2OTPA 3GXDA 3JWNH 4I2XB 4MBOA 4Y5XA 4NAJA 3EJRA 3EYQD 3G5YB 1Y18A 2LU4A 4DEPC 1OAZL 2C1PB 5AKSA 2FT7A 5D6CA 3S88L 3CZFA 5CHXA 3H42H 1H3GA 4OCSH 2PGDA 3PIQB 4KKBD 3DX4A 1JWUA 4JJ5B 1EFXA 1ND0A 3HD7D 4I0CC 5DHDA 3DC0A 4X4KA 1L2PA 5D7SH 3TWCH 3LNIA 3RPIA 3FQUA 1LEKA 4BKLA 4A63A 3N55A 3NPZB 4FFTA 4MCMA 2EDQA 2F1BA 2Q5UA 3C09C 3ZDMA 4O9HL 2B16A 5IGXH 4MJ5A 4HUNB 4NQSA 4LGSB 1DVFD 2FO4B 5JHBA 2DEYX 4DPAX 2KOGA 5ITBL 3DTDA 5FOBA 3IT8D 5DMKA 1XCQB 2BM3A 3QPXL 3ARGC 1HSBB 1L4AB 1OB0A 2XNAB 1A9VA 3AE3C 4AEIH 1YEHL 1OEZW 4BELD 4HPYL 4TUOA 4PGJA 2X4UA 4MAUL 1AGEA 4L1SA 4N1EA 2K7QA 2IWGA 3AGVA 3L3HA 4MDJA 5KEZA 4HJEA 2JCCB 4AWJC 1UB6A 5IVZB 5BUGA 4E36A 3T0DA 3IFOB 4U33A 3WUTA 3IDNA 5D5MA 5F8QC 2GKIA 2Y7OA 3V5DA 2OZ4H 4JUTA 4WY7H 1T83A 5L8JB 1R1CA 2PWDA 1SFDA 5BCAA 2IFFL 2WTRB 3NTCH 3QUYA 4RMSA 1ODAA 3VFGL 4BRYB 4M6MH 2WMPB 4HOWA 3O3DA 5BV7B 3FO1B 4X6DB 1V7ML 3TVMB 1V05A 4JDVA 1C5DB 4HETA 1GZQA 4A04A 1IFPA 3WFBH 4DUXA 3MNZA 4EIBA 5SWQA 1I85C 1VZIA 4RGOH 5E9DB 1S3RA 1BE3D 2B77A 3H9HB 1KG0A 2RBLA 1DTUA 1VCAA 4GMSL 3RDTD 3UMNA 3OZLA 1THAA 4PJ8C 5KSUA 1UWFA 4UNVA 4YZFF 1BQRA 2AJSH 3KL5A 3M9QA 2WKLA 3NP4A 4DP6X 1ICTA 1J8HE 3L48A 3M8OL 4Z6AT 1NGZA 2ZOOA 3P77A 4D9LL 5K5YA 1HXMB 4KO9A 3MLWH 5LHDA 4OCLC 4MGXA 1Q0YH 3TNUA 1MJUL 4DK3A 3RRQA 2Z64C 3GLAA 2V4HA 3H9SB 3U1AA 2K8QA 1YPZE 1PPJD 3PFQA 3G7TA 3V7AE 5CCJA 4UQIM 4I0PD 4JVUA 2ZOKA 3FONB 5LAXB 3RK2C 3FT9A 4UCFA 4Y5VA 4ADJA 3DA0A 4I0PB 5KW9L 2X0VA 1GY1A 5E7FA 4GKZA 5TK2A 1U2HA 3QQ3A 1JRHH 3UTTE 2CRMA 5HGHA 1AH1A 4WEMB 1BWMA 4OJEH 3DI2B 4X7DC 2VM3A 4ZSOB 5KANI 4KAQL 2NQDA 3UYPB 5AEAA 1CDJA 2FR4B 1XAUA 5LGHH 3Q6GH 3GXUB 5C0AD 4H26A 3VE0B 4AITA 2YXFA 5DA0B 5I2IB 1MOEA 4AYDC 4OD2A 5J13B 2VRKA 1XZWA 1XGZA 5D7KE 4QLRA 4NO3B 2EINB 5TDPA 1JGEA 3DURA 3G08A 4L4TD 3UO1H 2NY2B 5IVXA 1DBML 2FJGA 1Q4NX 3EH5B 3O2WH 3LN5B 3ASNB 5K9QG 3EBGA 3SIKA 1W2BO 1KQGB 2L7UA 4GB9A 4E41A 3O3DB 3IJSB 1YAZA 1O7SA 2VMEA 2XIBA 3JWDH 2XUWA 1HOEA 4WCYL 25C8L 3LEVL 3KPSE 1J9QA 1MHEA 5HGAA 3E8UH 1MWOA 3HCVA 1QUNB 5C39A 5D5MB 3MA9L 4E42A 1DSFL 1X5GA 5JHAA 1PY4A 2YMXL 1F4WH 4U4IA 5ICZB 3OR7B 1NFIB 2WW8A 3UEQA 1OAYL 3QHZH 4LCWA 1FZAA 1AO7E 2VN5A 3F89A 4AMXA 1K05A 3HPJB 1DVUA 5IHHA 1SJHA 2CR3A 2A74A 4JY4B 1GJIA 2EUWA 1JPEA 2JNZA 5AYUL 3E80A 2MCPH 1MF2H 2CPBA 1IM3A 2JSFA 4JB9H 2X4TA 4M6NH 4H2AA 1MIEL 2M83A 4NDMA 4Q6YA 3P1VA 3ZUCA 3BJ91 1QBAA 3F12B 2A0LD 1FVEB 1WZLA 3R4DA 4Y9FA 1DVFB 2IH3B 5F44A 1H19A 1MFUA 1SMOA 3C8VA 1KLUA 2QPFA 3OJMB 3UTSD 2K3TA 1NGWA 1UHVA 1LP9E 2X4QB 1EAOA 3GJFB 4FHJA 4GG8A 4MSWB 1YMHB 3KWWA 1GL2C 1E2VA 2E7HA 4QTIL 1QUNA 5F1NA 3MNVA 4NKMA 1SLUA 2ZOUA 3HZMA 1ONQA 2H47C 3ZPDA 4EI0A 5CEZE 4IIQC 2KZ1B 2UZXB 4IFFA 5E8NA 3ZBMA 2COQA 1QLRA 2WC7A 5E08L 3N44F 4IRJA 1LTGC 1DUYA 4R7VA 3U36B 2WT7B 4KKRA 4NM8L 4XPTH 2AJUH 1UTDA 3N5AA 2XVKA 4F2ME 3OAYK 5CILH 2HX7A 2AKRB 3ZTNH 2VDRB 1IVTA 2TSBA 1N6VA 4HA1A 1EK3A 5A1AA 5AW4B 3MR9B 3QNYA 1TZHB 2W83C 5I6OA 2B3RA 2DB8A 5D7EA 5FFOA 4KKZA 1NBQA 1AR1D 5DQ9B 5E9AA 4HLJA 2X9ZA 1SXBA 4KI1A 3QZWB 3NACL 4KMQA 5AFAA 4F57L 1ZGLP 4J23A 4WNJA 1Z9SA 4PS3A 4ZNCA 1MAMH 1L6PA 4ZOBA 2O61B 2AJXH 1NZRA 1TQTA 1JDCA 1JCCA 1SLXA 4JPIB 2WP3O 4ZPVB 3RGUA 3VQLA 1G84A 2ZG1A 3PGCB 5I24A 3GJFH 3S98A 3VB8A 1AHMA 2WIMA 2IQ9H 4MZRA 4WFFE 2WZ7A 4LGPB 1PFOA 1N73B 4YEEA 1KZQA 3HHSB 1WWWX 2WLIA 4U1MB 1DBBL 1OLLA 1KB9D 5IQOA 1G7PA 2DIJA 3UTSA 3D2UB 1IX2A 1T3FB 4Z76A 1N5AA 1GAFH 1WE5A 1A4BA 2CKNA 1U8CB 4W7ZA 1BVNT 1WFUA 4A37A 2VZVA 3E1ZA 3VVVA 1AI1H 4PIBA 2WSEJ 5DHYA 4ZYKA 3ZUNC 4KH9A 1ASOA 2BSED 3MBEB 1F5WA 4G43B 3QIUD 1T66C 4AQ1C 5IHLB 3OAZK 1WZ1L 2KI7B 5DFTA 3RBZA 3NSFA 3LKOA 3TA4D 1TTAA 4FFVC 3RYMA 3EG9A 1KIRB 4NHCL 3U59A 3V6IA 1AGDB 1H6UA 1XGYL 3QWOC 3SCMA 2WTRA 1DBJH 3CX5E 3HRPA 5I8EA 1BYPA 2HFGL 2WPGA 3IDYC 2V17H 3I3EA 1T22B 1PIXA 2EH8L 5B8CC 3C5JA 2E74B 3I2CH 1OXYA 1LK2A 3DX7A 3LH2L 1SGKA 4NKIL 3ZMEA 2V2WB 3L3HB 1ZTXE 1M4KA 3MR9A 2LLNA 1ACYL 2PPAA 4RGMC 2HVKB 3QH3A 2A1WL 2X42A 2P8PA 2W8CA 4A7TA 1I8UA 4I5BA 2WWWA 2YXVA 2J12B 1T21A 3W39B 4FQXA 4K23L 4Q97A 3MJ7A 4LOVA 1ZHBB 4ICWA 2XNAA 2EYRB 1A9EA 4QXTB 3UBXG 2ZAIA 2BCKB 1SOKA 1EGJA 1HINL 3EZJB 3FUDA 1EANA 3QZWG 3F7VA 4PV1C 1NFDF 3WBDA 1U3ZA 2HG5A 2XN9A 1VADA 2WWKO 1TLMA 4YH6A 1CGVA 1HSAA 2R56L 5HHVH 4XA4A 3SDCD 5GS0L 2EO9A 3AT9A 1N59A 1T1ZB 3ZKSD 1ONQB 1IKOP 3DKHA 1R34A 1E0OB 4BFRA 4LVHB 5I1CL 3PV6A 5HHOD 4TLSA 2DW5A 4RO0A 1WISA 2PCFB 2QGBA 1A4AA 1SJEA 2XN1A 3NGBB 4HHWA 1A4CA 4YQXL 4OU3A 4RBPH 5DHXB 2BCMA 4QRPB 2ADFL 3QYNA 4PB0L 2FJHA 5E6ID 1A0QL 2WXLA 5IWLC 3AWEA 4L9LC 1QFWH 3ZHLA 1BMWA 1ES0A 5TISE 4CC1A 1UWYA 4L4JA 1MNNA 1D6VL 2PYEA 1FL3A 3RFZA 4JO2L 5CCHE 4KO7A 3RWHA 2ADYA 4Y4HD 4JKWA 2WSEH 2VUOA 1A14H 1SVZA 4J1UB 3ULUC 3L71D 1NTZJ 3QIWB 1U4EA 4UNTA 4OFIA 1CI6B 2W6AA 2XX0A 3L73J 1NKOA 2BW4A 2PN5A 2PR4H 2GUYA 3O3AB 2DMCA 1KXQA 4FQHA 4F9PA 4JPQA 1ANUA 1JNHB 2LR4A 3O6LH 3UTTA 4JHBA 4A6YL 1X9UA 2VLKE 5AW7B 1S9WB 1CE1H 1FZOB 4X6BA 4E42B 4HWUA 4M8QB 4LPWA 2BVOA 5H4ZA 4FQXD 2Q8BH 8FABB 3FQXA 4UI2A 1FNFA 5J9PB 1H3TA 4FP8L 3STLB 2WPRA 3B7YA 4FNQA 1FDOA 4DKAA 4FTVB 3VX0A 1SQBD 3AG2B 4HGKC 5JLZB 2B87B 1MNUH 1NEZB 2BCCG 2ZPKL 3PAVA 3KHUA 2UYLB 1NOLA 4HUWA 1DH3A 4JFHE 5IEKA 5HI3D 1IQDA 1Q9KA 4XWGH 1GC1H 2VXQH 2VO5A 1OD9A 3B7UX 4XMVA 1W2EA 1N5YL 4V33A 3PGFH 1QSFD 1TYJA 4ICXA 4NUGL 4OI7A 2QM8A 3S3SA 1MCOH 3H6PA 5GHWH 4DGVL 2BK8A 4E9YA 3P8MC 1UJ3A 4C4KO 1IC4H 4PG2A 2H8PB 1MH5A 1LXMA 2WCPA 3G04B 2LTQB 1J1XH 4L3ED 5DGRA 5LAPA 4OLXH 4KVNL 1E2ZA 4OKDA 4F8PA 5HSFA 3FH7A 3FWLA 4PCTA 2F54B 4LHJB 4QGYA 4WF7A 5FB8B 3FK3A 3OHXC 4I2XE 5K59E 1KB5A 2UWJE 3CWBG 5IVXF 2ENYA 3S3PA 4PGEA 3K6SB 2JI3A 1N59B 4JY5L 3LKSB 3MLSH 4PP2B 4Q52A 3LKPB 1X79B 2ZJSE 1M1XB 2CBMA 1URQA 5DRXA 1OSYA 4NZ8A 3SO5A 1P7BA 1ACZA 3AS2A 3IGAA 5ANMB 2EYRA 3L5XL 1MY7A 3RU8L 4X7EC 5T1LD 1SVFA 2BP0A 2CUAA 4CVXB 4DWHA 1OTUC 3FRUB 3D39B 4XP5L 2YGVA 1PZBA 2B20A 2HJLB 3SDXF 3LN4B 3IDGB 1IBGH 3VWJD 1QPPA 4DCQB 3H9HA 1A6AA 2YAHA 2PCXA 4ZFGH 2OYKA 5HJ3B 4LL9A 5FYJH 4YX2H 4EN2A 5DA4A 4O51B 2FGWH 1RF1A 2WAQA 4UMGA 4X7TB 3CC1A 4P5TD 2WXOA 2Q3ZA 1QYGL 4QHMB 2WPVB 5DWUH 3V4PB 4IBWA 1IKFH 2AEMA 1CWVA 4HHAB 1EVUA 4K7PL 4OCXH 2ZAGA 1GGBL 3A23A 3OPUA 4EI5B 3SBRA 1NU1E 1XEDA 3AXIA 3APFA 3B7SA 5I1EL 2YGPA 1T6AA 2KS1B 1MLCB 3H1JD 2GK0A 4X5QA 5FDWB 3QNXB 1EXIA 2EKJA 2QIWA 3GSUA 4N87A 2B3IA 3FQWA 1J2JB 3V2RA 2Q7NA 4MBRA 3PTZA 4UV7L 1GL4B 1AQKH 3QJVB 3QDME 3GRWH 4NKOB 4BRJA 1OWRM 1L0NJ 2D3NA 1X5KA 5E79H 4UTAA 1Q38A 2HJKB 4UT9H 4KI5D 2QG4A 4UQ9A 4MVBD 1PBYA 4LEXH 1QI3A 1OE1A 4EDWL 2XTJB 4FQHB 3GKZA 2RQ8A 3MJGX 4AGLA 2KI6A 4F7TB 3FSAA 3FOMA 4U1JA 4X9HA 4LEEA 3TBWB 5CMZA 4QHLB 4ZK8A 3Q3DA 2XQ0A 1BQ5A 4U2YA 1RL1A 5APVA 1GZPB 1U8KB 2IG2H 1OAQH 3GKWL 4WHDA 4Y1AD 4YSCA 3IB4A 2DLEA 8FABA 5M94B 3ZDWA 2O61A 3LZLA 2ZWSA 4POYA 4XN4A 4L8DB 4BBWA 4AL8C 1RIHL 1JPGB 1CK0L 3CZKA 4IDJH 5F9WC 3WENA 4OBSA 4GIFA 3U0TA 4WI5A 4DEUA 3WEXA