5AVQB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 0.75 min.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avqB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avqB02
1CI6A 2Z5IA 5CMZA 1J2JB 2R5BA 1CSBA 2Z5HA 3LIEA 1KQLA 2W6AA 4C7NA 1CZQA 3NMDA 1NWQA 2P7JA 2C9NY 3TNUA 1G2CB 5AW6B 1FOSE 1MUUA 5APYA 2YNYA 1GD2E 1GTWA 2WT7B 3MD0A 3VMZA 3B8EB 1IO4A 4B86A 1S9KD 2XV5A 4LC1A 3KQGA 1OXZA 2WWWA 2N9BA 3L35A 3P8MC 5AVUB 2VRSA 5AVXB 5AW0B 1H89A 5AVTB 3VTPC 1GK6A 3TYYA 5AW9B 1GU5A 3A5TA 4AUWA 3HE4A 4RETB 5AW4B 2Q5UA 5AW5B 3NFQA 2Q3IA 1DH3A 2R3CA 2E42A 3NTNA 5AVRB 3KDPB 3I5CA 3VMXA 3VN0A 3HE5B 4GT1A 4JYCA 2YO3A 5AVQB 3V4WA 4AYCA 3A2AA 3M9HA 2R32A 5APWA 2XZRA 5APSA 5AW8B 1H8AA 5AW2B 4RESB 1HWTC 1FOSF 1JUNA 2Q7CA 4DZOA 1GK4A 3SWFA 5APVA 2YO2A 4KHXA 5AW1B 3T97A 1GZLA 3V4QA 1H88A 1A02F 5AW7B 1CI6B 1SLQA 4I2LC 3HTKA 3M9BA 3WGVB 5AVVB 1SP4A 5APQA 2R5DA 2QM8A 4C7NB 2BASA 4I6MC 3WGUB 3TNUB 1MV8A 4AQRD 3VMYA 4GKGA 3V5BA 1GU4A 1HJBA 2JJLA 3TK1A 3A3YB 3P32A 3P7KA 5APXA 1A02J 1JNMA 2E43A 2H7HA 2ZXEB 5AVSB 2WPSA 3IR9A 5APTA 1X8YA 3LIDA 3NXSA 2WT7A 1FAVA 2ZFCA 2WPRA 4C46A 2QM7A 3HE4B 2WTYA 2IPPA 5AVWB 1HUCA 3O8ZA 4JYBA 2P2UA 2KP8A 3M91A 1NAFA 1S9KE 1YYCA 4XE5B 1HBWA 5APUA 2XU6A 3M0DA 4EOTA 4M3LA 3HE5A 5AVZB 2P67A 3M0AA 3OAKA 2WPQA 5AW3B 3A7OA 2C9LY 4HYTB 3MGNA 5AVYB 3UIAA 1MFZA 1T2KC 1T2KD 2W27A 3M06A 3L36A 1OWAA 3L37A 3VYIA
chains in the Genus database with same CATH superfamily
2GBUA 1R5VB 4AQ8C 3WHXB 5H2FE 2XV0A 4Y2LA 4B9FA 4PIRF 1KGJA 2OMUB 3MUHL 4YH6A 4XNMB 1IEAA 1DVZA 4ELME 5J6SA 1GDTA 1A4KB 1KD1Q 5AW6B 1QFUL 2N7BA 4AENB 5DRWA 4DCQA 4R4NC 3P2DA 1VB9A 3CVHB 4P3CH 1AI1H 2H2SC 4MXQC 4GBXB 5I0WA 4M02A 4U3HA 2F74A 1J9QA 1Z6JT 1WC7B 1GZQA 3EUUA 5FYKL 4CSTA 3CHOA 2B59B 1ZJBA 5DJ0B 4UTAL 1ZD6A 3FHQA 4AQEA 1PFOA 5C39A 1U8QA 2RQ8A 2IH9A 2BOBB 3MOQA 4ASWA 4H44C 3L75G 2DWEB 1PZ2A 4GFXA 4O02L 5DS2A 3PGDA 4PJBA 2YZ1A 2QVMA 4GT0A 4YHIB 1HHKB 2X7LB 2ODIA 1AQTA 1ACXA 1MQKL 1JGDA 3PQYB 4X5WB 3BC9A 3K2MC 5AOMA 1GR7A 1RZKC 5EO9A 5ISZA 3K0WA 3G08B 4QWWC 2YO3A 4Q2ZA 1OK8A 1MJUL 2ZCHH 4MSWA 3HZMA 4Y9GA 3LMJL 4E9LA 3ZU8A 4ELKB 2OQJA 1PLGH 2GBAA 1DQDH 5MEQB 2WSDA 3JTTA 5CD3A 3AE9C 1KTLA 1VFOA 2HTLC 4XNQA 4E5XG 3WCYA 5DJ8A 5F7UA 2WV3A 3HRPA 3L3OA 1S7VB 3SWKA 2Y7MA 3P4NB 1H6EA 3ULVF 2A0LD 1I8IB 4LO9A 5KKZC 2Y69B 3OM3B 2BASA 1V3MA 3FC8A 1YEFH 2XG5A 3EOBB 1UB6A 5E6IA 1EIBA 3DX2A 5FGBA 5I1KL 5JIHA 3I56P 2WBJD 3RWFA 2DKMA 2ZYDA 4XO5A 4MA8L 4EI6B 3IDUA 1NIBA 4ABVA 3AADB 1WZLA 2BWIA 4J3OC 3P9WB 4Y7OC 3MV8D 1ZR2A 3LIDA 2IQAA 4FQ2L 3VTTA 5H2FH 1D5ZA 3ZGHA 3ZDWA 4Q9CA 1T0MB 2DS4A 4OF8A 1T5WB 1QLFA 2I1KA 4JN2A 5CGBA 7PAZA 2BMKA 3QRGL 4PY7B 3ZE1E 1U57A 5FS5A 4OKVA 3EFFA 1KN2H 1PX4A 2CJUL 1T04A 4HIEA 4XMLH 3SKOA 4E9WA 1Z5YD 5TGBA 1AQ5A 2H1PL 4OCYH 1EAJA 1CK0L 2VLJB 2YPVL 2AEPL 3G5XB 3IKCB 4WU5A 5E8EB 1S3KH 3CWGA 2WNKA 1YG9A 2JTDA 5TE4L 1ZLDA 4Z5RB 4P9HH 1OGAE 3C5XA 3RA7H 4NB7A 1LILA 5EN2A 1V27A 3MUDA 4GUPB 4HAKA 3UO1L 1X7SA 5J12B 1J7VR 1JMXA 4OI9A 3MZGB 1MELA 1O0VA 3PJSB 3S9OA 1HHHA 1U8JB 3BSZA 4FYSA 5K5YA 2Y1ZA 4N0FB 1FORL 1MW3A 3NIDE 5ESAA 3M6DA 4M6AA 3ILPB 4OZHB 5J5EA 2K4WA 3F6LA 1IZJA 4TUKL 1ZA3A 1H3UA 4P4KC 4YPCA 4P3CL 1AI1L 4GS7B 5C0AA 4RFOH 4PG2A 4FD0A 3VG0L 4HOMA 5F89A 2VSMB 2IGLA 2NQ3A 4WWKB 4FQPA 4UM9D 3VXUD 5T5FA 1X9UA 1KCSH 3MU3A 4LBEB 1HJ0A 2WAHA 2NNFA 4G8EB 3UTSA 3OB8A 5E94A 4Z3EA 1U8LB 3X1FA 1FDOA 3N42B 2R3CA 3B5TA 3AE1C 5AVRB 2XZQH 5CHXA 2C9SA 3FHAA 5JW4M 1LWUC 1S7QA 4R4FL 2XNAB 1IFIA 3VP8A 4PGDA 2X89A 5E4AA 3DO7A 4U7MA 1N59A 1ZR4A 1DQDL 2X70A 2X6VA 1SXAA 4N85A 1H9DA 4B9KC 3DX6A 4PJFE 2LOEA 2VZ3A 3MPCA 3DOSA 1XGTB 1AXTH 5C0BB 1VKXA 1IZNB 4PJIF 3P0GB 3QPKA 1FH5H 4HEPA 2R69A 3ME0A 4GRLB 4I18B 2J88L 2JJWA 1IJDB 1BZ9A 4F9PC 1KGUA 1F2QA 1YEFL 2ZXQA 3B3IB 2P48B 2E74C 3VB8A 3MV11 3DGDA 4TM9A 4WV1A 2WGXA 4ZS7H 2QBWA 1B4RA 2VUOA 3CBJB 3T04D 3MLVH 4TNFA 1EO5A 1ET5A 1X5AA 4B6ZA 5D93B 5KG9B 4Y88A 1F41A 2EABA 3OHMB 2R0ZH 2CHXA 3GDBA 4JHAH 4B7IA 2QVIA 3MFFB 3ZRSA 2LU5A 3HFFA 2YD7A 4A6YH 4E9QA 1XF2B 5KUMA 2A0LC 1Q9LA 5DJDA 4DZ8A 3WLBB 4MXVE 4X9BA 5MHSE 3MRIA 4K7PX 1FZKB 4JFFB 4WV1B 5IW3A 2LXCB 1TTBA 2FB4L 4X5RA 2VN3A 4G6JH 4N4YB 4HJ1A 5HGHA 1KN2L 2VMJA 1GJIA 3Q5TA 5EZLB 3OC5A 2GKIA 2R0LH 2WBJC 3IAPA 1I8AA 3E6HA 3NZHL 4XMLL 3S3CB 1IBGL 4WHDA 4JRYB 3H1KE 5CBOA 3G6AA 4NQCB 4Z7WA 2ZOWA 1QEWA 1MCPL 4W68A 1FFPA 3ZTJG 4ZFZB 2P8MA 5FUZL 1HEJC 1YN7A 4P9HL 3QNYB 3DRQA 3RA7L 4HC1H 1TLMA 3P2BA 1DVYA 1UGKA 32C2B 2OMWA 1JY3N 4Y8DC 2OCFD 1C5DB 2WYHA 2BINA 2YRBA 3R2PA 3C8HA 4WKXA 2I69A 3H9YA 4M4RB 2Y2TA 2W8ZA 1TQUA 2B87A 2XFXB 5D7IF 2X12A 3BH8B 3L1EA 3DKHA 3ORJA 4G8GD 2UZXB 3T0EC 3DTXB 5B8CA 1F45A 4PD4I 5AKRA 1ZLUH 1LL1A 4DK6A 2EO1A 1F6LL 1YPZA 4RFOL 4OM0L 4LVNC 3BUQA 4GQPH 2WNXA 3SB3A 4G6FB 3VI4B 3D2UD 4Q7DA 4NC1E 2HPTA 1KCSL 1BVNT 2ARJQ 2P46B 3HS9A 3BP7A 2BP3A 3II3A 2ARJA 4IW4C 4U6VH 4QRUA 2FHBA 3RU8H 2E42A 2VIRB 2R1YA 1RIHL 4FL4B 4Y5YC 4U1MB 2XZQL 2NOYA 2HKAA 2R1XB 1CE6A 5E03A 2VDOB 3L3JB 3CX5E 4KK8D 3CX2A 4ODTH 4KKCD 3O8XA 5D70L 1E4WL 4JHUA 4BSJA 2BSTB 2CIKB 4BSVB 3T3MF 1RMFL 4P2OA 3QQ9D 1CR9H 1G1OA 4NM8H 4U6HB 5IJVB 3AS3A 2OV0A 1AXTL 3K8KA 3QE5A 4P2YA 4BZ2H 1T6WA 4JM2D 4MASA 3CN2A 5GSRA 1IE4A 2JWYA 2JJSC 1TU3F 5SX5K 1CLVA 1W9XA 5AB2A 5LVEA 3AY4C 4A2FA 3UZQB 3QRFM 3U7YL 4ZS7L 1KWKA 1H5BA 3ML9A 3W38A 3SKNA 2DYPA 3IWVA 3MLVL 5FW6A 1EZVX 3IEAA 5I8OH 1AIFB 3QXDB 1FBIL 2VDQB 1LP1A 4TN9A 3X12A 2R0ZL 5K59E 1E3ZA 4KKLD 2IDQA 1EBPA 1S5IH 4A6YL 2VDMH 1P9MA 4KROB 2VE6B 1FNHA 3MRKB 4YQXH 1PPJD 1LP9E 3AXLB 2IWEA 2EVFA 3Q6GH 3MLXH 2BVQB 4MNQE 3H1JE 1ZHKA 4LLAA 4LXFA 3Q6FA 4U1GC 3QH9A 4U0RB 1AANA 2F7QA 3H32B 1NKZB 1IM3B 1P4BH 2JELL 2Z8WC 4GAGL 4ODXA 5GS3A 2R0LL 1DQLH 1HSBB 1LP1B 3C6LB 5KSAC 1MFAL 4YLQT 3CX5J 1BMGA 3EDDA 4KJWD 2DLGA 2J1ZA 1PF3A 2B9AA 5DD0L 3BW9A 4O5LL 4OGZA 4ZT1A 3G6JB 3BUIA 3IE9A 1EEYA 1N5YL 4I77L 2JI1A 2SEBB 4JO8A 2FZ3B 4KFMA 3VWJB 2EIEA 5D2LF 3QFJE 3H85A 3Q6FB 1UTDA 3L70G 1XR8A 2C9UA 5EUOE 2JK5A 3CX5H 2YQBA 1NC4B 4BFOA 3BKMH 1XH3B 2NNCA 1PG7X 4RISL 2ED7A 3AE4C 4OBRA 5DYOB 2R9HD 3D5OF 3RBGA 4QRTB 5I5RA 35C8L 1NCOA 4MJ5A 1CB4A 3CH1A 2ERJB 1E5ZA 4LSUL 2HWZH 5CSGA 6FABH 3WDHA 1I8LC 1FVCB 5GPRA 1JXDA 1T5XB 1TTUA 3QULA 1IFHL 1YEEH 1TXKA 1FLTX 3JV6A 4Q9RH 1H8SA 4OLWH 4U6VL 4XNDA 2BIPA 2X4SA 3RU8L 1MJJA 4MQSB 4OLUH 5HSFA 5F6IC 1U30A 4OZGE 3X1GA 2IZ1A 1QG3A 4OFDA 2Q8BH 1BCCG 1CICB 4CC0A 2J2ZA 2VABB 5BMFL 3KW8A 1ACYH 4ZOEA 4LNRA 3LN4B 3CHXA 1ES0A 1UACH 4ODTL 3V6OE 2G2RB 3MRQA 5C7ZA 2E76D 1CR9L 3CMOH 1VCAA 4NM8L 4KDVA 2OTLP 2UWJE 3B2MA 3PWPD 4EOWH 3IFPB 2W92A 2CCVA 4V2CB 2QKIC 2YD9A 5FW7A 2PCXA 2WWKO 3WOVA 1BOGB 4MJIE 4BZ2L 4F58H 4HIHB 2QVAA 1JTTA 3AG1B 4GKGA 3V2RA 2JLPA 2V33A 3IGAB 2WO4A 4WKZB 4FTVB 3WE1A 1OSZB 3JV4B 5C0JA 1AJ7H 2AS5M 1NGMB 1FNAA 2DN7A 1GC1H 1ODAA 3FXDA 1AS7A 1SYSB 3H3KA 3MJWA 4KKCC 4MBRA 4QKXB 4UT6A 3ZTEA 3PLYA 4QTIL 4XCFH 5I8OL 2MMXA 4JFDE 4DP4X 1NEZG 3QQ9C 4QHMA 5L88H 5EF1A 2NW3A 1S5IL 3TVMA 4WAFA 1GAFH 2WVVA 4PRAB 2C1PA 3PNRB 1MRFH 4YQXL 1SJMA 2NUPA 2DQUL 2O30A 1JF6A 2GAZB 2G5BB 2WXQA 2XWCA 3FUNA 3Q6GL 3VXMD 3NUKA 5I9QC 5GGRB 2XKNB 1MWAH 3ALXA 4HJJH 4F27A 2IX7C 3NJLA 3UABA 3WV0A 1P4BL 2P67A 4NRYB 4IBZA 4N90D 3THMH 1DQLL 4KO7A 2XC8A 1VF5B 5A3ID 4LLMB 2OYIB 2DIAA 4DHLA 3CFBB 3QDJD 3UYPA 3M8OH 2V37A 1XCQB 4YXLH 1KG0A 4X42A 4AYID 5FWRA 4J3XA 3W1ZA 1A1OB 2BNUB 2GY7B 4M61B 5I1LB 2EUWA 4MCZB 3LV3A 1A8JH 3HLKA 3VRIA 5BS0E 1BAGA 3CC5A 1W72B 1MFVA 5FECB 7CGTA 4M7ZB 3BCCD 1JY2N 1JK8A 2GI7A 3BKML 1JZGA 2ZD0A 4L0PB 3V7MA 4RFNB 1T2JA 5F3FA 4KK9C 1S7RB 2N0KA 4YDMA 2P5ED 4TVPE 4JFOB 1RK7A 3LV3B 3FB8B 2J8UA 2A45G 5JA9A 1DVFD 4XX1G 1P84E 3UAJD 2MEJB 6FABL 3DHUA 4FMFA 3DDFA 4Y99B 3SCMB 3F7YA 4BWWA 1KCWA 1DH3A 2ADJB 3EGSA 5EIIB 3L71D 1PFCA 2C1OB 2R29H 4OLWL 3FQTB 4Q9RL 4D9RE 1ZGLB 3N91A 2PRRA 4FE9A 4OLUL 1FLRH 1XEUA 4U6XA 2F7IA 4I5BB 4PJ5E 4F7CB 2XQBH 1K8IB 3UCRA 1FFOB 4WWPA 2XKMA 2R27A 1ACYL 2VN7A 1T1XB 4DPBX 2BVTA 2FGZA 4J3UA 4BZ1A 1UACL 5TH2A 1WIUA 4JBZA 2QMJA 4Q6YA 4QJ5B 1DJZA 2KK7A 4XAKD 1F5WA 4FLSA 1TT6A 1G7IA 3GRBA 5ACZA 2AXTE 1A6TA 4JM2F 2QQLH 3UIZA 3H9SB 5IG7B 5D1QA 4K71B 4OCNC 3GSRA 1KEGH 3AEFC 2YQGA 3LZFL 4QOKA 5AG8A 4EOWL 4RAUB 1XQ4A 2KQNA 5LKNA 3EFOA 2WLIB 1J0HA 4JQVC 1X4ZA 4KQ4H 5D7KE 2NMSA 2ZQKA 4WGKA 4P46C 1C8PA 3SOBH 1CDJA 1G7JB 1OEZW 4UQ3B 2VJ0A 3NK3A 3QJRB 1NBZA 4FG4A 2EVGA 1F86A 2ISDA 4F2MB 4B9IA 1JF1A 2HFEB 2YJLA 3DK0A 4LLQA 4Y1AD 5C09D 1NMCC 1AO7B 1FNEB 3Q05A 3L75D 4XCFL 5T1KD 3IJHB 2WN3A 2E8ZA 3VMOA 1I7UA 1FC2C 3BP5B 2Z0BA 2H0FA 5L88L 4APQB 2RKLA 2NDFA 1GAFL 2JKLA 1MRFL 3GYRA 5HD8C 3Q0HA 3AXIA 3KVPA 1S5HA 2QGDA 3C2AH 4D7BA 4XXCA 5TISE 4BA0A 1I8KB 4TVPH 3ZT5A 3FU7A 4N26A 1MWAL 2EE2A 2WANA 4UTCA 1HE8A 5EDSA 1P84H 3ES6A 1XGUB 2OTWB 5DK2A 3T3PF 3THML 2IG2H 2B4CC 3MA7A 1AQDA 1ONQA 4IOIB 2HJKA 2W07B 1M2VB 3M8OL 4ODWA 4ZNEA 3RL1B 1DQMH 4YXLL 5IHUH 2ATAA 2OM5A 1T83A 4GODA 5J7CC 4EO5A 3K2UH 1I1RA 1R3KA 4I13B 4QRQA 1KYAA 1BGXL 3QHTC 1OL0A 4KVCH 4JW3A 7TAAA 1AZVA 3NZ8A 1CFVH 1HOCB 1Y1UA 2CO7A 4PJ7F 5HYJA 2F53E 1YTZI 1HN1A 1DUYA 4KX9A 4UU9A 4WHTA 2AXTH 5A3IC 2RB8A 2O5XH 4NWTH 4OIBA 1ZDQA 1RUAH 4IMKC 2PCFB 4UT7H 1G0YR 4X6EB 4DP6X 4I2XA 4Y4HD 2FQEA 5GS2H 1NAKH 4RETB 3U0WH 4PS7A 3HG1D 3EF7A 4RBPK 1NOFA 2QLYA 4FQXB 1CE1H 5J11C 2WINA 5HHQB 1UG9A 3QEQD 2J59M 2KPWA 2VR3A 2Z92A 2J71A 1A66A 4LKXB 1FLRL 1SJXA 4N8VB 2GSIA 5J3HC 3EH3B 2BIOA 3HHMA 4MZIA 2XQBL 3ZQXA 4AIXA 3K6IA 5D1ZD 5C0ND 3WEMA 4OZIA 3RIAK 2JQZA 2L3BA 2MNJB 4AYMC 1KB5L 1A7QL 3WSQL 2BX5A 2OSWA 3GI8H 4XC3L 3CSFA 3WFCH 5GHWH 3ULVE 4W6WB 2APSA 2QQLL 4Y19A 5HGGS 2H6PA 3KYMB 1BXVA 3NESA 3FT9A 3JWNE 1FE6A 4MRBA 4AYSA 5JW3H 1NU1E 3CSGA 4KQ4L 3VRJB 4OD1H 2Z7UA 3L5IA 4X4ZA 2BHFA 3SOBL 4NKOB 4NQXB 1ZY9A 4OZFB 5I71C 1PBYA 3MV9A 5CCGA 2AJVH 2BY1A 4H13C 1XF3A 5JOEA 3ULSB 2PP7A 3HZVB 2AFNA 4F5CA 1EPFA 1G9HA 4Z7IA 3UTTD 1IBFA 4QLWA 3D2TA 4OH2A 3U1QA 1XEDA 5D1XD 1NTKE 4F7PA 4ETYA 3ETBJ 3VWKA 3KWXA 1QSFD 3LRGA 2XRAH 2M2DA 3FQNA 4FZEH 4PLKC 1CG9A 1L9RA 1W0VB 1PMYA 5HHOE 1S5LX 1ZIAA 1S1CX 1JZHA 3C2AL 1INEH 3ALPA 5F7EH 1RULH 4TVPL 1BVZA 3I6KB 4HXAH 1PD0A 2EECA 4ES8A 3EYQC 3MLRL 4Q97A 2CM5A 5L8KB 2FLRT 2FWOA 2PTTB 4NHUB 5G5DB 2RFXB 1LEKB 4NCDA 2ZF8A 2IG2L 4U7KA 3IMSA 4P2RE 4W9LC 3L73E 1KV3A 3EWKA 2EEFA 5A2CA 5ICUA 1DQML 1KB9K 1YQ2A 3VI3E 1QABA 4LLVA 1F00I 3DXAA 5D7JA 2EYTB 5IHUL 1QX8A 1BFVL 1T21A 4JJHA 3NMEA 1ZLWH 2E46A 4Q6KA 5CCJA 4BK5C 3GBEA 1IEHA 1WT6A 5DSCA 4X4YA 3SQBB 2BHYA 3K2UL 4NP4L 4ZYKB 1WHPA 1RERA 4KVCL 4H0GA 1OPGL 2GQHA 5C9JB 4GRMA 3WKYA 3QUYA 1CJYA 1NICA 5GGVY 5A2AA 3TBSA 1JXFA 1T1ZB 3MRNB 3FL7A 4Z7UB 2OBGA 2O5XL 2KDYA 4NWTL 1RUAL 1BJMA 4WIQA 3JWNH 3FQYA 4HIJA 1NTKJ 1G7QB 3GB7B 4KQ3H 1L9SA 4BEIA 5AW4B 3U0WL 3D39D 1SGKA 5HJ3B 2Z31A 5FW8A 2YSSA 3FCTB 4GRMB 1CE1L 4W7YA 3GSQB 3ZDXB 3EOYG 3QIUB 1EZSA 4GPVA 3QSKB 2GPZA 3CMEP 4JPWH 4X9GA 3TBVA 3OMZA 1JYXA 3O6KH 5CJQL 2CPSA 4JFQB 5DF0A 3RB5A 1YECL 3SDXA 3WUVA 4XO8A 1SHWA 1H88A 2IGFH 3GI8L 3HZKA 4Y4HC 4Y5XC 4FTDA 3VFPB 3WFCL 1WFUA 2YLKA 1JNLH 1D9KC 4C56E 3AE6C 3PREA 1RF1A 4KXDA 3VXSD 1D5IH 1UEMA 5JORA 4IIQB 5ABZA 4FGMA 2PXYA 5IWLC 1NBCA 2GIYA 3L17A 3VFTA 1JZ2A 4OD1L 3KYKH 1J5HA 1SFCB 2M3EA 2CRZA 3QEUA 3O3DA 4WNQA 5DDHA 5CIPH 2L7EA 4IGBA 1FZMA 2AJVL 4XPTL 4D0DB 4GSXA 5H4ZA 3NXSA 3QJQB 1F1GA 3UEZA 3WFEH 4L75A 4EXKA 5B7MA 1DN0B 1Z9LA 4C4KO 3SDDD 2WTYA 4QHLA 5E79E 1LK2A 3HE6B 1LDSA 3S88H 5A2LH 3L54A 3WU2E 2EXTA 3FRPG 4F15C 1UM6H 2XVLA 1LEGA 3RY6A 3DUSA 3G71P 1JPGA 4OGYH 4FZEL 5FK9B 3KL5A 4KHTL 1CYWA 1OGPA 2V8MA 2FL5A 3WEXB 5FYJD 4WNQB 3GS4A 1JVOA 2K45A 2WSEH 2YJQA 5T5NG 5CR1A 2W0FA 1INEL 2CDEB 5F7EL 1RULL 3W11C 3IN0A 5G4OA 4HXAL 2O6FA 1FYHB 3LRKA 4PJHA 3U4EB 4ZXBC 1N3NB 4A68A 1JFHA 3CSBA 4F2FA 4AT6A 3RI5K 2JIXB 2ZUXA 4V1DB 2DV6A 3QIWD 1NIDA 4U1HB 5FB8A 2KPNA 1JPGB 3B2VL 4NZFA 2B1OA 4DTGH 2VYRE 3ZDZE 5HI3C 3VOPA 2HODA 1WP6A 4I88A 1E40A 1CN4A 3CCEP 1C1EH 1X7TA 4WUUA 5I8KH 4XVUC 3MYJB 1JN6B 2JCCF 2JJUA 4UWQB 4X6CE 4ASVA 3KXFE 4GAYB 1NDMA 3ZKNC 4JJ5A 3BEWA 1CFNA 2CAKA 1IO4A 3QDMB 1Q0YL 1RF0C 1YJDL 4X0NA 3QBTB 3RK2B 1XSIA 5SV3A 2YPLB 3TURA 1S7TB 2R0WH 2YD8A 3ZZ1A 1IFPA 2LFEA 2H8PA 3ARUA 4OCXH 1GSKA 4PY8J 4BXVA 4FABH 5IW6A 4N0CC 3MGTB 2ZKHH 1UD3A 4GSRA 2IDUA 3BEWB 3WNMA 5APSA 1AXSA 1DSFL 4PBXA 5E79H 3WO3B 4JK0D 3HRZA 5T1LD 4JPWL 3KYQA 4AZ8A 5GRWA 4EYYQ 3O6KL 1CF8H 3ZTNL 2H6UA 5KYYA 4FFVD 1J9RA 4EIUA 3M46A 4JFPA 2IGFL 2IAMA 1F56A 4YSQA 2HG5D 2PPEA 3HG3A 2IEPA 2H6OA 2WSPA 3ZMNA 2ETWA 3L70D 4A7PA 2H43A 1QA9A 1ZPLA 2PCPB 3DX3A 4HSQA 1JNLL 1NGWA 2ZCLH 3O9WD 1MV8A 3CCJP 4L8DA 1I9IH 4HGMA 2ZWZA 4LFHG 3TBYB 1D5IL 4LP4A 1SJHA 1WMKA 1SFDA 1VQ9P 2P26A 3U9UB 3WNIA 2ZOUA 3OR7A 4HKJA 4OV6F 4ZO9A 3KYKL 3GK8H 3MRHB 4P07A 4W9KC 4HG4K 5DMGD 1IAOA 4GBXC 5DD5H 4OY9A 1A7NH 2XN0A 2ZCZA 1M7DA 1L0QA 3FONA 2EILB 2J44A 4LLUA 2X4PA 4PLNC 1UXWA 3GSUB 3WUWB 4J1UB 3VP9A 4HIQA 4W9JC 3S88L 2O01H 3C08H 3QQDB 3UZVA 1U58A 3CHRA 3TIDA 1UM6L 4GSDL 5M95B 3PHAA 3W57A 5DXWA 1BCCD 3U30B 3SY0A 3ZYIA 4F7EB 2EYSA 1M7DB 5CJ5A 2HKFH 5AW3B 4Q6IB 3STZA 3CFCH 2Q9IA 4N5UA 2E7HA 2DWDB 4CPGA 5H35B 3SDDC 1PZDA 4UAHA 4XXWA 3V4VB 3L74J 5B3SB 5IROC 2G8YA 2QADB 3N85H 1L0XA 5F3HB 4DTGL 4FQHA 4I4WA 2JR8A 1T4KB 1GS6X 3H4HA 1PIXA 1WV7T 3ESUF 3NGBC 3OB0K 1BYNA 2JI2A 3ZUCA 4JRXA 3DX9A 1S78D 3VMZA 3VXRA 4F7TA 3KPSA 5EZIH 3QA3B 4H7VA 4P5SA 3GMLB 4AGPA 4HUVA 3O3BA 2X3BA 1AGEA 5AVTB 1Z0MA 3QIWC 3IF4A 3IJSB 2X4OA 4N8CH 3L48A 5GGVH 5BZWA 1P5UB 2OMYB 3MNVB 4V11A 2AQQA 2VO8A 2XN9D 3Q2WA 2R0WL 5A2BA 3T4AB 5MEOB 2Z4TA 5F9OH 2Y9YA 5E1AB 2AXJA 2FGWH 2BVPB 4NQDD 4OCXL 4FABL 4JR9H 4L4VE 4UNUA 4BRYA 4HKZH 1HXYB 1OCZB 1TJMA 2YQ2A 1N7SC 1J5DA 5GJTH 4BFBD 1RK0B 3KWUA 3WNNA 3QXAB 4LCIL 4JZNA 1X5XA 1QAWA 4L73A 4JRWA 2PW1B 1SVCP 1KYOI 3CD4A 4GW1B 1C12A 4AWJC 3ZSTA 3SE8H 1PLCA 4LSSH 3H2QA 2V2TB 4Q0XL 4LSQL 3W9DA 1CF8L 2VDPH 1L0NJ 1JYVA 1N7MH 3T0WA 1UWXH 2CG9X 2LAAA 5CLYA 2BY2A 4NUPA 4MMZC 2OYLA 1WA1X 4QRRE 4ZUSB 1BD2D 5CLZA 3QDGB 1Q94A 1M56B 1EXGA 2CXGA 3VU1A 1QFWI 3NJIA 3S9DB 3U2IA 4M6NL 3LEVH 2M0BA 1I9IL 3ZHFA 3QEHB 2NY3B 4JG0H 2Q1EA 3IDIB 5F21B 3DHJA 4X99A 2N01B 3IMTA 3AMKA 5KSBF 1KJVB 1J12A 4WY4D 4ZTOH 3WJJC 4ADIA 2OTJP 2E6PA 3VFVB 5BO1L 5DD5L 1A7NL 4FLOA 3W2DH 2IBZD 2HAZA 3U2SB 3PHLA 1PYWB 4NT6A 8FABA 4J4PC 3BRVB 1EDJA 3SIKA 3BRGC 5B39G 5K9JL 5DR5L 5C0RL 3QYNA 1JZJA 3MXVH 4I8DA 1QLEB 1JV2A 4K55A 4OF6A 3RPIA 1QL1A 1RE4C 3P9MA 4EIJA 1NKGA 3B7TA 1L6ZA 3DROB 3PIQA 1XDTT 3O6LL 3DDGA 4AKPA 3OHXA 1QRND 2C9LY 1F3DJ 3K0YA 3OG4B 4GAJL 1E5BA 4KJPD 3KPQA 2X4NA 3CFCL 1FZCB 1NCBH 3RL0g 2N4IA 2K9FB 5DFWH 2CLVB 5JPNA 4WQOA 4P4RA 1K8DB 1BGYJ 3PJSK 2D2OA 2G9HA 3L5HA 4J3TA 1NCDL 1SQVE 2YK1H 2YN3A 4K8RC 2HJLB 1ZMEC 1MN4A 3L7FB 5CEZH 2P42B 3N85L 3BVDB 3PV6A 5I28A 2VKWA 3NJVA 1XCTB 4UTAA 1CT8A 1M6OA 1P4UA 5A40E 1MEXL 1HESA 5DZNA 5FDWB 3OAUH 1DQIA 1RZFH 1O6SA 5EBMB 4O02A 1OAXL 4LAJH 3QCUL 5CU5A 1JJUA 5DUMH 4PJIE 3T77A 4UOZA 4OD2A 3SDAB 2N9BA 2E9JA 1DEDA 1YMHA 2XPGB 3DMMA 5EZIL 5LBVA 3AACA 3S4SA 2DQGH 3VSVA 1SUJA 4PGEA 4XBEH 1D6EA 2FIKA 5DFTA 4CSPA 4N8CL 5GGVL 43CAB 2ZYGA 1WBZB 2J1KA 1C5CL 1A4BA 4MYWB 1QW9A 4U0QB 5KYUB 1CTOA 2AQRA 4AL8C 1SEBA 2FGWL 4N3UA 3ET9F 1E9OA 1FRGH 2W91A 5C0GA 3PF2A 1FC1A 1X79B 1J8HE 3R0NA 1OE2A 4OD2B 4ZJ9A 3HB3B 4EI5C 4A39A 2X6BA 3S96B 2WZ5A 5GJTL 3TEZA 1S78C 3CVIH 3M88A 3LQZA 2CBPA 3P3SA 4NI3A 1UVQA 2WQVA 3SE8L 4L8SB 1OVUA 3TP4A 4LSSL 4NQVA 4YNYA 4CVXA 3MLTA 1SEQH 1SLQA 1MCKA 2GVYA 3ZE2B 5LDSA 1JUFB 1SQVJ 5D2NA 1IGYB 3D12B 3I6GA 3VMPA 5SWZD 3QJTB 4QRPD 2IBZX 4GW4A 1GA2A 1X5MA 3JXAA 4L23A 4Y0GA 5HHME 4EUPG 3S36X 4P5TB 3QPXH 3TBTA 3ARFA 4CADB 4M5YH 5IB5A 4JQIH 3ROOA 5KN5B 1HJBA 4GOSA 4JG0L 3Q06A 1HX0A 1MFDH 5AYUH 4ZTOL 4HFUH 4K15A 3HC4H 3UG5A 1FE8L 1A7RL 3I6GB 3PUCA 4DOHB 1WS8A 2F7PA 4UQ9A 2GTQA 3K6DA 3TT3H 3FGAD 4Z7QE 1MFTA 1GVIA 3FF8A 1HUCA 1I7RA 3BQUB 3AS0A 5L9DH 1WFOA 3PG2A 1AC6A 1RVFH 2YPVA 2CHNA 2WXOA 4JDVB 1I1AA 3ULUD 2QEJA 2E7DA 4KX8A 2H1XA 2A83A 3QDHA 2PLTA 4ISVA 3MXVL 1F6FB 4LASH 3APCA 2JKVA 4G43B 4ONFH 3P4OB 1WQVT 5D7IA 4B5ZA 5ESVA 3V0AC 1NTZK 1KFMA 1BM7A 1ZOYC 5C0EB 3FBKA 4WY4C 5I6PA 4L8BA 3FUDA 4P59H 2WXIA 3DURA 4NQEB 3M7FB 3WY3A 3NSFA 4R5XA 4AH2B 1ORQA 4WI6A 3TF7C 1NCBL 5HYQA 4O4YH 3BZEA 1RZ7L 1HI6B 3QZWA 3RGBA 2OFQA 1GL2D 5C08D 5GZNC 4BELD 1IM9B 2B1HH 1CLCA 1FFNB 2YK1L 5CLXA 5A2FA 4W9EC 3O4LA 1PU0A 1VEPA 2GUOB 4G1MB 2Q3AA 3T2LA 4D0BA 1QR1B 4IKIA 4QCIB 5ESVB 3VXPA 4ZUVB 4POYA 2OCJA 2C5DC 1MCNA 1ETZA 4OGXH 4X5QA 3FKUS 4PYHA 4TNWK 5APYA 1YY8B 2PW2A 2YKKA 4ETQB 1CDGA 3FFDA 5JO5B 4HJUA 4R4BA 2DMKA 4KKRA 3FAXA 1RZFL 4MAYA 2N9YB 4P06A 4KJPC 1KYDA 3P8MC 3A67H 4NO3B 5IQOA 3GLEA 1Y6MR 4E36A 1V54B 2YLHA 4DP1X 3ALWA 2WQYC 1S7UA 4XBEL 1HL5A 9PCYA 1U95A 1D7FA 1ASQA 5CD5D 3HS0B 2AJ3B 3ZMEA 2N1TB 1IE5A 1AP2B 2W38A 3IT8D 3B7UX 3EO1B 2OSXA 2A9BA 3MV8E 4RX4A 3RJOA 4AE1A 1A3LH 3B5NC 4W6YB 1X5LA 2EDNA 1J1PH 1FRGL 4HISA 4UANA 4MA7L 3FQRB 4U0RC 4CU6A 1RZKL 4E0RA 2WSFJ 4J8RB 4ZOAA 1MFCH 4NENB 2MCPH 5HGDB 4UM8B 3LQMA 5JQ6H 3C6LC 4GO8A 1A4JA 3H7BB 4MKMA 2X2JA 3CVIL 1TMCB 2OJZH 1OVVA 4OGQC 4M9PA 2BC4B 5TDPB 1OIPA 4MQ7B 4A7VA 4KKBC 5AVVB 1SEQL 4S1DD 4W93A 4KPHL 3OR6A 2CPCA 3W0WB 1UD4A 3ESPA 2Q76B 4X98B 2E6JA 3D85D 3AREB 1JWMB 2W65B 3G5VA 1HHIA 2XETA 2WSFH 1MW1A 1P7KB 3B3BA 1OGTB 4A7TA 3QPXL 4MJ4A 4M5YL 5IT2H 1L4AD 1HSAA 1KJMA 3ARGA 5EG6C 1VQNP 4H88H 4U3SB 2BS9A 4NO5A 4K3HA 2KS1B 1KILC 3HC4L 3QUMH 3NRQA 5D2LE 3RIFK 1NGXA 3DYMA 5EU6A 2J5WA 5KBDA 2KERA 2PYED 3HNVH 5HGBB 3TT3L 1USZA 4DGIH 4KMLB 1Q0EA 3IJYA 2EDTA 1PKQA 3NEOA 5BRZE 5FOBB 2YAFA 3OKYA 1RVFL 5GGTL 1VHPA 1GXEA 3BZFA 3L1FA 1XB6A 4OGAD 5HI5C 1KIUB 5INCA 4LASL 2IFNA 4JQXA 4XB8A 4ONFL 1MHEB 3FQWB 4ELMB 5LGJA 1XF5B 2X0UA 2ZOOA 3F5WA 3K6NA 3B8SA 3SJVD 4FZ8L 1R5SA 3H3PH 2GY5A 1HHGB 3CBKB 3NJGA 1EAQA 3VXUA 3VJ6B 4OH8B 3MODL 2KUTA 2PP9A 4N2DA 4P59L 4F8TA 4RSYA 1RLBA 5FF6A 2DPKA 4O4YL 2AV1B 5JOPD 1BF2A 4JPIA 1I4FA 1RU9H 2B1HL 2EE9A 3SO3C 2NCMA 1F4XL 1VQ8P 4YFEA 3H2PA 2JB6B 2NX5D 2AANA 5I30L 5EF2A 3CE1A 3AU1B 4OGXL 5C6WH 4ZZKA 2P45B 1RUKL 5ANHA 5EF0A 4N2AA 4R9HA 4H0HB 1QD0A 3F6JA 3P0VH 4OR1A 5DUBA 3LXBA 3ARBB 3S3BB 3BPLC 3RURA 3C60D 1BDCA 4FC3E 3CFJB 1XH0A 4OLEA 3A67L 4RZCA 1ZHBB 1BLNA 3F3HA 1GL2C 2A9AA 2RR3A 3INUH 4HJGA 1E8WA 4MWFB 2XWJB 4M6OH 4RDQG 3CDZB 5ABDE 1REIA 3D3VE 1T2XA 3J07A 3EYFB 4BH7B 5H2BA 1A3LL 3NA9H 2ZJSE 3M9QA 1DVUA 1J1PL 2QE7H 3L4XA 4PJEA 3P73B 2APFA 2BNRA 2BIIA 1CFSA 2F19H 2NYYD 3GSOB 3KYOA 1URLA 4NFDA 1MFCL 2BZDA 4HUCA 5JQ6L 4R83A 2I9TB 4NCC2 1UENA 5FCSH 1OTTC 2OJZL 3QUXC 1NFAA 2J20A 5E9AA 3ESVF 1A14H 5CKGA 5JXEA 2QR0A 3WL9A 1E4KA 2ZUQC 3MGOA 3TF5A 2IF7A 3ZE1B 3JUZA 2V4LA 1KZQA 3LPOA 4U3CA 3OGCA 2I60L 4M7ZC 2FX9H 4FXKC 5DRNA 2Q0ZX 1XSOA 3HPJA 1T22B 3O0RH 1U41A 1FPTH 2WZ0A 5IIEB 3BRDA 1M71B 3DSFH 5KLIB 3KL3A 4NO0A 4H88L 3QUML 1XO8A 4PV8B 4M9OA 4DEPB 3FXIC 1J9TA 4Y2DA 1OP5K 4TPRH 1OGAB 4DPAX 1DP0A 4G8GE 4KO5A 4PSPA 1SLWA 1ZHLA 3DV4A 2A73B 1T8ZA 3BIKB 4JFXA 4P0DA 4S1DC 4W9DC 3ULUF 1GS7A 2EINB 2HA1A 4TL5A 3FB7B 3G5YA 2ITFA 15C8H 4EKXA 4YLCA 3BUPA 3RYMA 4A6YB 5I6NA 4LVHC 3HNTL 2UWEF 3NIDB 4N0UB 4X4XB 3S0PA 3VD3A 2DRUA 2WN2A 4ESKA 4Y16A 1L4AC 4L1LA 4MZRA 2ZYAA 3CHPA 1UM4H 3HZYB 4XI5D 3BP6B 5CBNA 3H3PL 3D2UA 3SQOL 3NOIA 5I5IA 1OLLA 3HN5A 1SYVB 5GGQH 3RL0B 1DO6A 2POHA 3SGKA 3BP4B 3ZUNC 3PJNA 4KKPA 1AS8A 2ZJSH 4K7FA 2Q6WA 4LPYA 4LFHD 2X53A 2IALB 3WJLA 1GCYA 4WW2B 3TPKA 5DU7A 3IETA 2HMID 2G4EA 3O6FB 2NQCA 5SV4A 3NP3A 5KS9F 1TZAA 5DEGA 3C75A 2LW3A 2X09A 3VYNA 1LO0L 1N0XH 5CWSB 4H20L 3N06B 5CGMA 4YR6B 3TT1L 3GXMA 3I3EA 3OKMB 2YUXA 3ARZA 3HKFA 2EJ1A 1T6AA 4BFEA 3K6OA 2BCKA 3B9DA 1F90L 2VRSA 1W8NA 2OL3L 4JL1A 4PJFB 1JM0A 1BFOA 4AQAA 2RN0A 4H5SA 3INUL 1RIVH 3FSOA 4APQC 4JKKA 1FN4B 2JWAA 4OVVA 4YMPA 4RRPG 3OKKB 4GKSA 4UT9H 4TMPA 1CW5A 2WLLA 4K5PA 4L8CB 1KSRA 2JMRA 2V2WB 1HYSD 1NANH 3GHGB 2YOCA 2WXRA 5IFAH 3VXQB 3O4OC 5KSVB 3RDTA 5EZOH 1ZKAA 1SY6A 2F19L 3NAAH 4QHNA 5EN3A 3V55A 4HD9A 3JC22 2BY0A 5D7EA 3QJFA 2YEZB 2OW7A 5L2JB 2Z65C 1CGSL 4NQUA 3PP3H 4OV5A 2UX6A 4BCXA 4M1GL 3FQ2A 3MRMB 5EOCL 4KXZH 3MV7D 4JVPA 5CZXD 4BQBA 2WKGA 3CGTA 4XH2A 1U92B 3UJTH 2IV8A 3FJTA 2JE8A 4WO4B 1BZDA 2DM7A 1PG7H 2W9EH 4XX5A 5D7LA 3NCMA 3FFCD 3GXUB 4OJEH 1GMIA 3P3TA 3QORA 1A3QA 2ZTBA 3HW7A 5DVOA 3BH4A 4PGZA 3O0RL 1FPTL 1R3JA 2NYYC 3K4ZA 4HJ0C 1FL6A 3DSFL 4R2GB 4B95C 2XHNA 4HPYH 2RACA 4IHOB 1ZJAA 2A9MH 8PAZA 2ADFH 3BN3B 4TPRL 4U6TA 1U6AH 2BNQA 5LXVA 5TDOB 3IJ7A 1LE5A 1DBBH 1DZBA 5E70A 5I75B 5ALCL 1MW0A 3NFPA 1Q90D 1SDYA 2P5WD 1U4EA 4G72B 3E1RA 5ICYA 4PJ7E 4PUBH 2ZSVA 5F1KC 2FYUJ 1PS3A 2P24A 1MG2C 3Q1EA 3CX5I 4EOTA 4PVNA 4O2EB 2VDMB 3N1FC 1R3HA 1OQOA 3TESA 4X8JA 1FZGA 4AVKA 1U3HB 3MRPB 3VXTB 2W9DH 1UM4L 4ATTA 1I8UA 4Q4IA 4HXBH 5B5EE 4X9HA 1OFCX 1KPRA 2RALA 1G7LA 1ZN5A 3FT4A 1H19A 3P77A 4KXBA 5GGQL 5GRVK 3ZKSD 2YD3A 5K69A 3X11A 1H15B 2X28A 2ORBH 5BOJA 3S35X 3O6QB 3SO5A 1H3XA 4EKJA 1LTAC 2ZJSL 5F0MB 5TF0A 1Z7JA 4M7KH 4H1LA 3SGJA 3T4YB 2YARA 4WFGD 5K5GB 3C5ZB 1KGCE 3OD3A 4AMKH 3WMM0 4DN4H 3IBOA 4RWHA 2JKNA 3D0VA 1JDCA 3EYSH 1DEBA 1Z66A 3OJAB 1EGJH 3KGRA 4Y9CA 3KH4A 2BLFA 2FSEB 4JO3L 5DEFA 1H0TB 1N0XL 2K78A 3PWPE 4WI2A 3QGVA 1IGFH 1BVNP 4XN4A 1FO0A 3EH5B 1TTFA 3D70A 5E08L 1CXHA 4PMFA 5HY9B 4GMTH 3RWHA 4XPHH 3OLGA 3U1PA 5I0ZA 4IKJA 5C8JA 5I73B 1FL5A 5T5NF 4JO4L 3IMBA 2Z93B 1MVYA 4Z0XA 1NC2D 3L5JA 4I3GA 2AXFB 1KIQB 1IBDA 3FUIA 2HMIC 1G7MA 2XYBA 1NLDL 5IJCC 3VW3L 1ASOA 3F12B 4YHML 2QJYC 3MUGB 5L4MA 4OQ1A 1JMZA 3U2JA 1HL9A 5IFAL 4LLYA 4ERSL 2YAMA 1UJ3C 3VFWA 5EZOL 2NY2D 4LGRB 4L48A 4P2QE 1NGYB 2VITA 2J6EH 3GPEA 1L9MA 5EB9A 3MP7B 3M9BA 1JFQH 3MOAL 4BH8A 3JUYA 3PAUA 2VRQA 3EFDL 3VXMA 4N90E 3WXVL 4NAQA 1ZP0C 1MAMH 1KZUB 2E3VA 4KTDH 4TVSa 5HBBA 3QDJE 5EUKA 2AEJA 1BEXA 1LP9B 3BQVA 3NN8A 3SPIA 3AUVA 1FYTD 1FGNH 4IRJB 1PG7L 2R7EB 2W9EL 5B5EH 4MNQB 2V3FA 3UC2A 4BE5A 2WGNB 4YSPA 5I1AB 4KZCA 1ZT1A 5IHZB 5BVZA 4JFEA 4PJAA 5D6CB 4AK2A 1E27B 2NNXA 4QF1A 1I9JL 2XWBB 1E9PA 3BCCE 2E4FA 2AKRB 4UILH 2AF2A 2DLIA 3E38A 2KZKA 1HYRC 2WXLA 3IDNB 2A9ML 4ZBJA 3KWWA 1U6AL 2BRRL 1FO0H 1Y6KR 1YAZA 1FDLL 1DBBL 1FJ1A 1H0DA 1R3IH 2EZ0D 2P5EE 2ZAHA 3JQOB 2KZJA 3QFJB 5K1VA 4PUBL 2X1QA 3P8CE 5EUOB 1UB5A 4NGHH 4YIQB 4F9LA 3HE5A 3CC7P 2K3TA 1BX2B 1UJTA 3DVGB 4EDWH 1AGDB 5I8EA 3MJ8A 2R2EB 5L7XH 4Z7VE 5LNGA 2NDGA 1CLZH 1DVFA 2W9DL 3L3KB 4GP8B 3UOAB 1TJGH 5A2KH 1MWAB 1T2KD 5C0CD 1L0PA 1K5NB 1PAZA 4Z78B 5SX4H 2FJFA 2A06G 3JWOC 4UQAA 3TNNB 3CLQA 3HR6A 4X6DF 4BQ9A 1YVLA 2ORBL 1KCUL 2BIMA 4HEPG 3LIEA 5DD6A 1JHLL 5DHVH 3VMAA 1NFDF 4ADGA 2GCYB 4FFYH 4NUGH 5C1MB 2Y7QA 4D0CA 2OXGB 2ATKB 4DN4L 4LEOA 1SXSA 3FTGB 3Q13A 3EYSL 2IPTL 3LDBC 5C6TH 1EGJL 3II1A 1LTJB 1RJZB 3B8EB 4OZGB 4X5PA 2B7DT 2LT9A 2VLRD 3V5HB 4CMMA 4NLHA 3BCCJ 5HTSA 2OI9B 3LSOB 2YBRB 5JIPA 7FABH 1QPPA 3M07A 4KRLB 2ITDA 2X6AA 5KJ4A 2YGPA 4GMTL 4A04A 1HILA 2V5TA 4UNIA 5H37H 1UZGA 2J5UA 1XVSA 2KBGA 1XTCC 1QMUA 3NSDA 3D08A 4KRPD 2Z4QB 4MD4B 3K4AA 4O2FB 4XPHL 2VDLH 1T0OA 3IFNH 3VN0A 1XD0A 1Q9OB 1CDCA 1AZNA 2IV9A 3DOHA 1KCRH 3B5HA 4MJIB 4XPFH 3NJMA 5CBEB 5AB9A 2DM3A 1KB5A 4DUVA 1YC7A 5C09A 4Y1AA 2HSIA 4JS7A 3QR1A 5AAMA 5F1IA 5CLWA 4WW1B 3L71J 1Z9SA 5C92A 2NY4C 4XZ4A 5AG9A 4ZAKD 1SVBA 3PH0A 4NKQB 2K6WA 2J6EL 4JFDB 1EQ7A 4XVSH 1TLKA 4KZDH 1JFQL 1NJ9A 2UZIH 4TQHA 4XCYA 3VFUA 1QWNA 4UDTB 4D8OA 5KYWB 2ITCA 3HBZA 4K35A 4PJ9D 5T3ZL 3D6GA 1MAML 4AW4A 3P3UA 3DIFB 2IXQA 2ENSA 4KTDL 4PBVC 5EU3A 3FSVA 4MMXA 2E9WA 1LVEA 4PN6A 3ECBB 3FT2A 5F1IB 2FQDA 4E5XA 3T8XA 3TV3H 2EIKB 5EA0L 4D9LH 3GDCA 3NACH 1AD0A 2ZXEB 4NN6B 1HQRA 4HIIA 4LL4A 1VLXA 5CJXC 1RHHA 1N19A 2NY2C 2G0LA 2DLFH 4YEFA 3CFIC 3ZHDA 4CGUB 5DC9B 2FO1A 4UILL 1UT2A 3IU3A 3NCXA 2Z91B 3JTSA 3ZDYE 4XNBA 1ETB1 5GS0D 1KMGA 3RK2C 4HS8H 4N6JA 3C5JB 3RWDA 5BS0B 1S2EA 1P6FA 3WS6C 3SDYH 4PJ8A 1I82A 1BVKB 3L75J 2F18A 1IL1B 4LRIC 1HXMA 1NPNA 4HIIB 3CC2P 5C7XH 4LOUD 2JCCA 4NGHL 5IKCB 4OT1H 4EDWL 5ACLA 5DJAB 3SE3C 1CD1A 4P5KB 4RAVB 5L7XL 3ZKXB 4HGKC 3L5WB 5TDNA 3IU3B 3OAZK 1CLZL 5E2JA 2H88C 3LKRB 4X0KA 3TO4B 5ECGA 3QI9A 3QEQE 3V7AG 4HEMA 3VYIA 2B4CL 2FYVA 4HBCH 2V7NB 3HG1A 3MO1A 3KDMA 3US1A 4UIKH 4TUOA 1D6VH 4WU7B 3TCXA 4WEUD 1ORSB 3UACA 4XCEA 2D4DA 1URQD 4UAOC 5JMRA 1KOAA 3KL0A 4NUGL 4YLBA 5JIKA 2DTML 3BISA 1WF5A 4UOW1 3AG3B 4GLRI 3D33A 1CFBA 5EBLA 1ECYA 5IB1B 5C6TL 4PJ5B 3HD7D 3S4RA 1LM8V 2PFXA 4BXLA 1SDDB 3WN5C 2IJ0C 4J6IA 5AUMA 1MI5A 4UTBH 4DKAA 3VQLA 3M17A 7FABL 4RMBA 5JHLH 1SXCA 5L8RJ 1OAJA 4TS6A 3HTLX 3E2HB 2EVHA 3IAOA 2VDLL 5BJTB 3IFNL 3IPFA 1VGKA 4HCRL 3KE0A 2QGCA 1OSPH 4M48H 1OP3H 2NUTB 1AZRA 1KCRL 4JM0A 4XPFL 5DK0A 1NINA 3UTTE 5D1XE 1SJEA 1FOSF 2C3VA 3I50H 1QSFE 3EADA 3DIVA 1KEMH 4P5MB 2JKRM 1EH9A 3N0PB 3RTQC 4CMHC 4Q6IC 2M3BA 1EX0A 1QI4A 2C7UA 3GMNB 2A2QT 4UDUA 4Y4FC 5BQ7A 4KZDL 1RK1A 2OTUA 1NDGA 2UZIL 3LH2H 3PL6D 4KRPC 4N25A 3Q2VA 2BCMA 2R44A 4KKAC 2EEAA 1SJEB 3VQ2C 2QADC 2JXMB 2LU4A 1N8ZB 3ARTA 3V4UH 2OQQA 1G2CA 3V10A 4EZLA 5TJWK 4WTQA 5AFAA 3SYCA 3TV3L 4D9LL 2NZIA 4JFHD 1YNTB 3NACL 3UH8A 3K46A 4R0LA 2C7UB 4XBPB 2WIIA 4ZAKC 1BFTA 1YCSA 2DLFL 1AKJB 1GY1A 1M6UA 1YHQP 4JVWA 3BWAB 4MD5B 1Z5LB 1YEHH 1P2CB 1UCBH 3OZ9H 1INDH 2VQ1A 2O61A 4CVZA 3RVTC 3SZKC 1SBSL 4AM0A 3WTSA 1DN2A 5JLZB 2VM3A 4IU3B 5EFIB 3S34L 4LVOB 3KXDA 2Q7YA 2UY7A 3SDYL 4PJXF 3RL2A 4XGZB 3NIFE 4I0PB 4M6MH 4XC1H 5C7XL 3FB5B 3A7OA 1NTDA 5IQNA 3I75A 4OT1L 3RX8A 3D39E 5TFSL 1RJYA 2F53B 4ZMXA 4OB5H 2DLTA 2ADGA 3MRBA 2A74C 3AU0A 4J27A 5DS8B 4CVZB 1DQJB 2X88A 3VFSA 1S72P 3BD3A 2BSBA 4HBCL 1AC0A 1NIFA 3UJIL 4TTGA 4ZPVA 5KVGE 2Q7YB 3OSVA 4UIKL 3OAWA 1D6VL 3CZGA 5KVDE 4PRHD 2DIJA 2EXYD 5F3BB 2YC1B 2AK4D 3BEVB 3IWUA 2C26A 4ZPTA 4X4MA 1DTUA 3QIBD 2A6KB 5IV2A 1HCFX 2GTZA 2FJGA 2NY3C 1MLBA 2JB5L 1TQWA 2BZ7A 4G9FE 1WEJH 4FA8A 1PEWA 1PGOA 1DBKH 3KBPA 1IGTB 5EU4A 4WI7A 5ID0B 4LL1A 1WBXB 2W80C 5D72H 4L3EA 4XTRD 1UA6H 3VD5A 1NCUA 5D9SB 4YHNA 5A6LA 5JHLL 3VXSA 2ZE0A 1NTME 3PHQA 3TNMA 2G3MA 4MCNA 4YZFF 1WUNT 4OFYD 2LTQB 4U1LA 2ENQA 2BHUA 3MBWB 5DRZA 3SE4C 2MOQA 2EE6A 4M48L 3KBHE 1OSPL 5KSBA 1H8NA 5AW8B 1H8AA 3RVXD 3QNFA 1YTZT 4HDIB 3KR3H 1Q1JH 2X41A 4A38A 5KW9H 3B9KD 3I50L 5B1CA 5A1AA 1KEML 1A02F 3E9UA 3B2PA 4F1ZA 3FO2A 4UQ2B 3ARDD 5DI8B 5FYJE 1O7DC 1WAPA 3UZEA 3WGVB 2IFFH 1NSNH 1BHGA 1FZCC 4MMYA 4Y9FA 5FFGA 5SWSA 1ZRUA 5ANMA 2BM3A 4L2LA 3SDCD 2WWOA 3MBEB 1EFXB 2V9TA 3VDCA 3LH2L 3X3GH 4DAGH 5L2KD 3V0IA 1D5MA 2FWSA 4NFBA 4PB0H 2IPKA 3O81A 4M5ZH 3VH8A 5HHOB 2HJFB 3VUAA 1BG9A 1X5GA 4YK4B 2FECL 3V4UL 2CU9A 2WLYA 1EAOA 1GGCL 4NS0A 5DVLA 5F7LB 3OWEA 2IANA 2OCCB 3H6AA 3HUJA 3S5ZA 3RNQB 4JRFA 2XCMC 4FCHA 5HXMA 2EEBA 1J48A 3IB4A 3PGFH 5E2VH 3WFBH 3S8WA 3GRWH 5CBAA 5KVGH 1E4XH 3OXRA 3ZTJH 4RCAA 5KVDH 3QUZD 3NYKA 4YO0B 3T8MA 1S9WA 1FAIH 4P2RB 3W39A 4XXDA 3EBGA 1YEHL 3FO1A 1KIRA 4XBGB 1D5MB 1F11A 1UCBL 3OZ9L 2EC9T 3WU1A 1TG8A 3PL6C 2EKSA 4GFTB 5CIPB 3VI3B 1HBWA 1R5IB 4YE4L 5B21A 1R24A 2EDJA 3HUSB 2WLZA 4N6RB 4PFEA 5A6MA 4P23B 5CEYA 2NY6B 3T6VA 2FFDA 1U8KB 1BVLA 1TEGA 3BH9B 4HK3J 1ADQH 1IGJA 3PP4H 4MJHA 2WPQA 2IPUK 4M6ML 4XC1L 1NBYB 3T09A 5AD0A 3FDWA 3V0FA 3CCMP 5DVMA 5FV2A 1FG2B 2GBVA 4NJAH 1N70A 4OB5L 2W0PA 1CGVA 4PJGF 3BLBA 4DK3A 3HMXH 3IRPX 3RGVC 4APXA 1RQVA 2R8SH 4NBYB 2VW4A 2VH5H 4DVBB 1TQCB 5E1IA 4X6BB 1ZS8B 2YAPA 2VLMD 3LKQA 3T1FB 2J12B 1FJPA 1OP9A 5HGAB 1BVLB 4BV1A 1BZ7B 3X13B 2JKTM 5JW5A 2W59A 3Q5OA 4AG4H 2N7SA 4CJ1A 3N43F 4P5TC 3F6IA 4IRZH 4QO1A 3SFEC 5B22A 5ETUB 1RPUA 2D2CD 2HYMA 2AV7B 3R06B 5FYJH 4X9FA 3L70E 1GIGH 4AYFA 4BRVA 1YUHB 4WI5A 4IMLB 2WWWA 2Y23A 1E6JH 1J1OH 2FCBA 2HG5A 1X6LA 5FA4A 2FDBP 3DNKA 4QAWA 2AXCA 1B9ZA 5D72L 3U0TB 1UA6L 2H26B 3HE4A 5I76A 1F0LA 3B4NA 2XVBA 4Y4KC 1U21A 4GQ9H 3Q2CA 1RUPL 4HFWA 5JW5B 4NC2B 4L76A 1F3JB 5D5MF 3DJRA 4DW2H 4G7SB 2W0LA 1ERNA 2EH8H 2A9NH 1SQXK 2WITA 3CFDB 3EIFA 2O1KA 3CXHK 4LSTH 3ZRFC 4C56B 1YJ9P 1P5VB 2EXYC 5CP7B 5HPOA 4EDXB 2ADYA 1E90A 3QIBC 4JDZB 2OMVB 1HAWA 4YDLB 3OKDA 4X80H 3U25A 1VEMA 4G8FA 1JTHB 1Z9MA 3LN9A 4K9JA 5D96B 2F2HA 1NAMA 3MDJA 5I1CH 3CDFA 4K3GA 5J6HA 1M1JC 1Q1JL 4S10A 5AW1B 5KW9L 1AY1H 1Q0XH 4TV3A 1QUNB 1GKEA 2NSQA 4I2LC 3GMMB 5E56A 4XTRC 5CILH 1BCCE 1DE4A 1NSNL 4C7NB 4JLRB 3U6RB 4OZ4A 2WLMA 1GKOA 3LQAH 1AHWA 4AQRD 3D69B 4ZFFA 3GJFH 4FYRA 4P48A 4BUHA 5E6ID 4LOFA 3X3GL 4HCFA 4DAGL 1VZHA 2W60B 3MCLH 3C5SA 2CHZA 4PB0L 5ESQB 3WLWD 4M5ZL 1N64H 3IFOA 5F1NB 4IFMA 3D0LB 1HQ4A 3IR9A 3L70J 2GJ6A 5KLVK 5EC1A 4L2YA 1OB1B 5KVFH 2VLJD 4W81A 2Z35A 5F97E 4JFYB 3PGFL 5KSUA 2HTKD 3EHBB 1R0AH 4U1IA 3TN0A 3NG5A 5BU8B 4HIXL 5DQJB 4RDQF 5KVDL 3SBQA 1Q9KB 5EH1A 3BGMA 2NTFB 3L72G 2ICEC 1FAIL 4CKQA 4N5ED 3SDCC 5CCHC 4LSVH 1V7ML 2I26N 1LO2H 2DEXX 3HS0C 3ZDZB 1T20B 3DSNA 4NQQA 1HDMA 1I1YA 1HH6A 4PWEA 1DCLA 4KOBA 4OLVH 1S7SB 2ZUYA 3K3QA 1ADQL 3PP4L 3T0XA 3DX0A 2DY2A 4LCCB 2H32A 2XN9E 4X6CB 3RILA 4U1IB 3KXFB 4FADA 1CGUA 5HHPA 3OJDA 1IT9H 2BO0A 1I1CA 1RZJC 2WLKA 4NQDE 4OZFG 3NIGF 4AJWA 1IJ9A 1VRSA 1AVOA 2A99A 4NJAL 1BCCJ 4L9LB 1GMJA 3CDGA 4WWKD 3HMXL 3TU6A 3ZO0A 2R3SA 5I66A 1F4AA 1KNOA 1KUMA 4BGLA 4LQFH 4PP2A 4RFEA 3FWLA 1W91A 2VH5L 4K8RH 1YLBB 3RFZB 4LPTA 1USDA 1HNYA 3OJ2C 5JIIA 4QHKJ 1WICA 4NZJA 3RZCB 5F9WB 1TF4A 3AREC 4H26B 4HKXB 4DPCX 3N44B 2FR4A 3HRNA 3VG9C 1OF0A 3OJMB 2I1JA 5IVXA 4BA8A 5C0AD 2VLLB 5FYJL 1BD2E 3VGHA 3EDJA 4LC1A 1GIGL 3CWBG 2Q3XA 2P80A 1QZNA 1EXUB 2CH8A 4PR5A 5IEHA 2Z7ZA 4KTGA 3TZVC 3WEAA 1SQBK 1U3NA 1E6JL 2MTAA 3H9HA 4R7DA 1EJOH 4ZUTA 5I1JH 3VFNA 3UTSD 3NJXA 2GK0B 2IIJA 2XWDA 4ZW5A 3PP5A 4HS6B 4LIQL 1KLFB 1XGQA 2DYSB 4DERA 5IB2B 3CSPA 4WEMB 1MZ9A 1J9SA 4G7YL 2A9NL 4FDWA 4YAQB 3FU9A 1ZVYA 3AWEA 4XX1E 5C07A 4XOCA 2P3YA 4PRPE 2X89D 3IGUA 3WNKA 4AL8H 3RG1C 2D2CC 1PEZA 1JE6A 3L3DB 4X80L 3V9CA 3GD1C 4Z23A 2XG4B 3D9AH 1YHPA 3PAVA 4N8UA 5C0IA 1T1YB 1HGZA 4GW5A 1AY1L 4YJZL 2FXPA 4ZKUA 2A06D 2A3TA 2W90A 3RWGB 1XGQB 4HKZB 2IH1A 4U1NB 2HLAA 4QHUB 5CILL 5AWNH 1CDYA 4FEIA 2NY0B 4B9ZA 2DB8A 1QRNE 4UB6E 5DD1H 3CZFA 4N28A 4WJ5A 5MEPA 1KBPA 2KDGA 5FDYA 2CO6B 1MQ8A 4MB3A 1XF1A 2VDPB 2G9KA 2BFVH 1NLBH 4BK8A 1VZIA 5EO1B 2HFTA 1N64L 4GMSH 1KWGA 3H55A 5DHYB 4MRCA 3LB6C 2AXGA 2AC0A 3ATFA 4FQCH 5DEZA 1AXIB 3D34A 4XOEA 1QSEA 2DQDH 2EDWA 2K9JB 4J7RA 2V9RA 2WB7A 4F92B 4AC4A 5IHBA 2N3JA 4NQSA 3EJZD 3MLUL 4I9WD 5DJZA 2X10A 3ASWA 2HRGA 3UTZB 3HMWH 3LKSB 1DL7H 1TZ8A 4MA1B 4LSVL 2FYYB 4HB1A 3H0TB 3NQKA 5E6IC 1I3RA 4RIRB 3DX7A 5CUSL 2CPUA 4HWBH 4FFWD 4ZDHA 3NCCB 3SPGA 4NKDA 4YDJB 1URZA 1ULVA 1Y0LA 2BSSB 2EDLA 5IVOA 4QRAA 1HAUA 3DLQR 4HUUB 1CFTA 1YEDA 1U8OA 1G1CA 3DGCR 3LPFA 3S5LB 3J7HA 3SE6A 4N6QA 3O2DA 3PWLB 3L37A 4ZMOA 4OAWB 1W6LA 2A45H 4N2LA 3S7GA 5I82A 2IBGA 4BQ6A 3U36B 1ECZA 4X7EC 1WITA 2V7QJ 1LO5B 1T89C 4PJCA 4PS4H 3LKOA 5F93C 4LQFL 2X6UA 5GGSY 1WBYB 1KILE 4K8RL 4KOCA 1TZHB 4XP9H 4ZDHB 2BP5M 1CU4L 3HR5B 2WSCJ 3F83A 4TT3H 5IR1B 3DHMA 1E50A 2FRGP 3FSAA 4GG8B 4PTTB 3VD4A 5K9KB 4BXSV 2MWCA 4L4VB 2WT7B 1UXSB 1NWOA 1UFUA 4UINH 4NAMA 4JB9L 4QRPE 4DJMA 3OKNA 4MX7A 4JAMA 2V7QH 4UB6H 1LD9A 4N2CA 2NT0A 4MZ2A 4WHYG 5IW1A 5SWZA 4GXUM 2CD0A 5IBUB 4OI7A 3R7RA 5I1JL 2DL9A 3MUDC 1FV1A 2WSCH 3GLDA 2O93L 1SN2A 2D7MA 2UYLA 3KNBA 4TLUA 4QRRB 1X5ZA 4XMWA 3M1BB 1VQKP 2L91A 4Y9EA 5AB1A 4XMKH 4BYHA 1JI1A 1O6VA 1WD8A 5DJCA 1RJCA 3ENEA 3LNFA 1A3RH 4AL8L 2MIZA 4H44B 3K5BA 2B16A 3QJHB 4WI8A 4DZOA 1B3IA 4PG2C 3BFOA 2Q5BA 2WVUA 3D9AL 2GA1A 1DQTA 1QO3A 3ULUE 4HWZB 1I1FB 2J25A 4BQCA 4F7MB 2QM8A 3RDJA 3AM8A 1C16B 4DSYA 3D50A 2CDFB 2DF3A 3T6XA 1J8KA 1AZZC 5AWNL 5F7WC 4ANKA 4YPGB 3BLKA 1XCXA 3BIAX 4YGAB 2CCWA 5DD1L 3QXTA 4AXWA 1JNHB 4X7FC 5EULV 4L4TE 2VXTL 4GAFB 4XMTA 3TA3A 2J21A 2UWEA 3P7KA 3O6FC 3ASOB 2QV2A 2VQUA 2O5ZH 3EYVA 4FI8A 1IGML 5KKZB 3GPSA 3CFKB 5JZ7C 2H9GA 1V8HA 4P3DA 5C08A 3FNKA 3L8QA 4FQCL 4UYQA 4DETA 5GGTA 4IL6X 5AVWB 1OK0A 4TSBH 2KLVA 1XSKA 3ITKA 4LCUB 4JMXA 3DBXB 1SBBA 5KS9E 4ZRGA 2QQKL 5KZCB 1E5YA 4O58L 3HMWL 2DQJH 1A6WH 2BS71 4ZMAT 1DL7L 3AAZB 4ZMLA 4UV7H 4G6KH 3VE0A 1RI8A 4FERA 4HWBL 1NC4D 1VQLP 2GT9A 1AGCA 3GXTA 2W9LA 3QR0A 3UIAA 2J1XA 1LT9A 3BT0A 3PXJA 5FOJA 1J8HA 2Q86B 4PJIB 5GZOC 3QWOA 1MCFA 2R2BA 5EC2A 2P8LA 3SOTA 2HLOA 2Z5IA 2IOOA 3K4DA 3WG7B 3GMOA 1YEWA 2NXYD 1KQLA 1GOGA 4PS4L 3JVFC 4HOWA 3WUWG 1UZ8A 3OKOA 1L5GB 4F37K 2EUZA 4P4KA 3ULUH 1TJXA 2VQTA 1JNJA 4WO4C 2PKDA 1EEUA 1FF5A 3HCVB 5FO7A 3VMNA 1J8HB 2DBJA 1ANUA 2HLEB 5L4IA 4OLXH 5B38A 2H2PC 4JKNA 1CICD 4H8WH 5J13C 1ZLUK 1W2BO 1MCHA 2NTSP 2FBJL 1KQGB 2DM4A 4EIBA 3KYNB 5BW7A 4KJMA 4XRCB 3D85A 5AW5B 4PV9B 4KO9A 5FEBA 2AAVA 4AIZB 3D52A 1LE9A 4H25A 5EOTB 1NCGA 5F7DA 1AQ8A 4LLDB 4RAHA 2VN5A 3ECVA 3QNXB 3O2WH 5HHMB 4L3FA 1FZJA 4A37A 5IK3B 4BKLA 2QSVA 5F9JB 3UJJH 3HG5A 5DMKB 2PYEE 5B8CC 5TQ2L 4JFZL 5EOQH 4N2FA 3WELA 4F2EA 1A3RL 1I7ZB 5DD3H 3BASA 2VR7A 4HW6A 5EWIH 1UT9A 4UIMB 4YDVB 3TCLA 1J10A 1RIUH 1SPDA 3HC0B 3I2CH 3H1HD 3BO8A 3FOLB 5AYTA 3HI1A 1LTTC 2BP8A 1N2RA 1LWUB 1SOSA 4WI0A 1TCRA 4PHXA 3GHBH 3KZIE 4Z7QB 4F9PA 3BWSA 3H7LA 5JHDE 5IVNA 1CYGA 1HU8A 1J0KA 3OPZL 2A6IB 1BQSA 1QKZH 3SJVA 1MPAL 3ARRA 2OX5A 4LCVA 3MRFA 2YMKA 3FPXA 2I27N 1TEFA 2A4CA 3O8XC 2D0HA 3LZNA 3L4WA 2V2XB 1WUZA 5HHNB 3AC0A 1VF5D 4P2OC 2EC9U 1VPOH 3MROA 1G6RH 5D7HA 3K80A 3TVMD 4DKFH 2JKJA 3RVUD 1JL8A 5KYNA 3ATAA 1KBGH 5EZJB 3MRRB 1GOFA 1BIIA 1XGRA 1CBJA 5ICXA 2NX5A 4U7SA 3QUMB 5I73C 2MCG1 2W95A 2DQJL 2VR8A 1QHQA 3BLPX 3CFEB 3FK3A 3C9NB 3CV5A 1WA0X 3JZ7A 1SQPK 4G6KL 4AEIH 4Z7WF 1E2WA 2AVFA 3L4TA 2OAAA 1N10A 1H5BC 3BVNB 4HJTA 3QAZC 1KPVA 5JHMA 1MFZA 3MROB 3PWVA 8CGTA 3X1NA 1N18A 1EDKA 3FRPA 3PXLA 3MXWL 3D25A 1XGRB 5EPMA 4K3DH 4E41A 1P9MC 4XNZC 2RQEA 3T65B 2BHZA 2WBJB 4OU3A 2WOBA 3DYOA 5IQ9A 4NJ9L 3V6FB 3RGUA 2WB1A 3WXWH 4FNLL 3BUYB 1Z9PA 3R18A 4TQPA 2NY1D 2DZEA 1BGYG 3SCMD 1EUTA 3FTXA 3T0EA 4ENEC 1LK3H 3MV8B 2ID5A 3QPQD 4CC4A 1YMMA 1YPZF 4KTYA 3RWCB 2OL3A 2VISA 3VXNB 1JEKA 2FX8H 4IRJC 4WY7L 2GFBB 1W8OA 4JRLA 4UF7C 5HI4D 4GOEA 3KZIH 3ZDMA 3DARA 1MVUB 4OLXL 3HE7A 4JO5A 4OTXL 4LK4A 5IJKA 4H8WL 1M3JA 1RZIB 3DUUA 1W0YT 2A6JB 4P49A 2WTRA 4FQIH 2FBOJ 5LCVA 4W9HC 1PAMA 3GUFA 3M1OA 2FX7H 3UC0H 3P11H 2X4RA 3GJEA 3CK0H 3DX8B 1TEYA 4EZJA 5B1AB 3VMXA 3HAEA 3HNSH 3QQ4A 2YN5A 4HIPA 1GC1C 1TKWA 4LVNB 5K39B 3A4AA 2QQNH 3FO0L 3UJJL 2L04A 2PR4H 2BY3A 2I25N 1KFNA 1VGEH 2PN5A 4Z18A 3V0JA 1FNLA 2BOLA 4NYLA 2NXZD 4XNUH 5EOQL 1BYPA 3V9EA 1ZA6B 2GUSA 2Q9OA 1WCBB 5LG1A 4HV8A 4P04A 2OMTA 2HVBA 1M4KA 1YEJH 5ITFB 1RIUL 4N2NA 4Y5YB 4F33B 5D2LB 3L7EB 2M5AA 3SGDH 4MDIB 1GGUA 3HAEB 1FNGB 1I7TA 1K2DA 1AO7D 1VERA 2QHRH 3FQXA 3AE3C 5GRXG 5D1QD 3GHBL 3ILQC 3VFRB 4ABWA 4QOKD 3ISRA 5JOFA 5B7EA 1FP5A 1WFTA 3AY4A 4FX5A 3CDYA 3NCYP 3UBXB 5BRZB 1RCYA 1F42A 2QPFA 5J9PB 1QKZL 3TK1A 4GKLA 5ERWB 1BLIA 2MJZA 5HJGA 2EO7A 4UM9B 3F05A 3C8VA 2D3LA 1WD9A 3GXNA 3TJPA 2AEWA 3B43A 1LTJC 1IAKB 2F5AL 1IC4L 2LXBA 1VPCA 1PNDA 3HG2A 3NEXA 4PRHA 4AMXA 4JANB 4MNGA 3GSWA 1NFDE 2Z7WA 4GQZA 3S4SG 1VPOL 3EDFA 1RXLA 3DX1A 1DVTA 1TZIA 3V6OC 3OLDA 3MLSH 4L0ZA 4IKLA 4JZJA 3RWJB 1KBGL 5E6ZA 4EPSA 3MJ9A 2KC0A 1GGTA 1VSCA 4FG2A 4ZFGH 2XACC 4AEIL 3KPRE 2HT3C 5E8NB 1S3RA 1OAQH 3KZ8A 1NKOA 2OMZA 2X1OA 1NBVL 1RZGB 2UY6A 5CCKL 1EZVI 2BVOA 1YUKB 5E4IA 1CD9B 3NK4A 2YWZA 4CDHA 2X2HA 3CIAA 4IQHA 5E1HB 5JDSB 4U1GB 3D18B 1BE3G 4XPBL 3U9WA 2OSLB 3RVUC 3QYMA 5CEXA 4LF3B 1L3WA 2H3NB 5KLVG 5KSAB 1NWQA 5FV1L 3WXWL 4ZMYA 1IX2A 3VGDA 4NDMA 1P4LB 4ODSH 1LK3L 3D3VB 3FTVA 3PLNA 4FNPA 2XI9A 2EIZB 3ESMA 4XPAL 2W1NA 4HZLA 1NANI 3CUPA 4IRSA 4NKMA 2FX8L 4W6XB 1JZEA 2ZWLT 3MV7E 5I6LA 5MENA 4NN6C 1VQOP 1I8LA 4L29B 3L72D 2WO3B 4FQIL 4EMZA 1MHCB 4X5XB 5JMOC 3AG2B 2FJUB 1IFDA 3UC0L 3VGAB 1AOHA 3EH4B 1C7SA 1M1XB 3EJPA 4KXZI 2OJEB 3NPZB 3HNSL 3FHEA 3GEWB 4HA1A 2NY1C 1TQBC 4HALA 5KJ7A 1PZBA 3VFOB 2VXQA 3R19A 3WFHA 5IJBC 4LCYB 3A0BH 5A16B 2QQNL 1L6PA 3RAJH 2PR4L 4K3AA 1VGEL 1PDKB 1A7BA 3G5ZB 5FYLD 2EH7H 1WIOA 4XNUL 1BEYH 4ZS6D 3L3IA 1OALA 3MTXA 2MFNA 3JCUH 4KMTL 3KPMA 1LWRA 1YEJL 2P5WA 4K2UH 1XGPB 2C9RA 4A2MA 3QZWG 5DZOA 3S35H 4NUMA 2QHRL 5F6IB 2CKBH 2YUZA 4G8GB 3RNKA 3T2NH 5HPMB 3DRTB 4ORGA 3IVKB 5IMOB 4DCKA 3D4ZA 2QSCH 1OTSD 5DHDA 1SQBG 5E4EC 4Z8FL 4KI1A 5GXBB 4A2GA 1U8CA 5DJ2A 1FJKA 2PF6A 3MV9D 4ZG1A 2OMXA 5CCGD 1E9QA 1GGBH 3IXTA 3CWBD 3LIZA 1NEUA 4UMSA 1FVEB 1JVKA 5ENWA 2CPBA 2EEXA 1WAAA 4LSRL 4DT2A 2CK0H 5KYXA 2QKIB 3Q3GA 4UZUA 3REVB 3V4PA 2HUEA 4DIXA 3NCYS 3VWKD 5D1QC 3GSXA 3GXPA 4ZQKB 3O11A 5I2IB 4FXLA 1DEEA 2FJSA 3CC1A 3P0YL 4IDLA 4NNPH 5DTFB 5IBTH 1EVUA 1KGYE 5ICZB 1JG9A 2FHCA 4W9FC 2IYOA 1SMAA 3V0GA 1OGSA 3KPNB 3W9EB 2IDFA 4U7JA 1LWJA 2Y7SA 3BKCH 1QZ1A 5BOZG 1PX8A 3S6CA 4ODVH 2AEQL 4QAMB 5TPWH 4FG6D 1P84K 4IS6A 3Q8AA 1KXHA 4QMEA 3U4BL 3NT0A 5DJYA 4JM2B 5B39A 4KQ0A 1ASPA 2WP3T 5ID1B 1A6UL 1CL7I 5C9KA 1LNUA 1FNSH 1O5DT 4Z7AA 4LSDA 2D4FA 3JWOH 2UZYB 1UXLA 4O9HH 2DJSA 3ZJAA 3LKNA 1FOSE 4XXCC 2XVKA 4Z7OE 3FH8A 2XKUA 1XR9A 2Y6SC 2BFGA 4ODSL 2HFGL 3QUYD 3OGOE 4AY0A 3WKNA 4WDIB 2NW2A 2J8UF 4X6DE 1P7HL 2VCOA 2MOGA 2R39A 4B27A 2CDGB 5I24A 3EGDB 5CSZB 3REWB 3CZLA 4J12A 3WBDA 4N2BA 4MD0A 1FYTE 2Y22A 4NO2A 4PVLA 4EN3A 3F64A 4FRWA 2X44D 3LEYH 1J11A 2HUHA 4HHAA 4NNXB 1V3JA 3W68A 4CU8A 4AVIA 1T83C 2OZ4H 4Q9QL 4KK6D 2DLEA 4AGOA 3TXAA 4LVOC 4LPWA 3B2UC 4XO9A 4HKBA 1NHLA 1T1WA 2ZZUT 3RAJL 4I0PC 4X7TB 3DYPA 1EV2E 3MREA 5DJ6A 2EH7L 1BEYL 5SWQB 3VXOA 4AQ1B 4BFRA 1ZT7A 1H3PL 2G2NA 4Y89A 3FQ4A 4JNXA 1ZTMA 4OM1H 3T0VA 2ICWJ 4GOFA 3F5HA 4K2UL 3CPUA 3I6LE 3IXAA 1NMAH 3TYFB 1T3FA 4JZOB 2F54A 4JQVA 5AAWA 2HN7B 2CKBL 1JCKA 5D6DA 3T2NL 2H5UA 3UFIA 4PJ7B 3HHSB 5C0CE 2FEDC 4PJXA 3EOAB 5DWUH 1LO4H 1MCRA 1U93B 3Q8CA 3RZWA 3QISA 5CHNA 1OT1A 3VCLA 3X14A 5C0FB 5EBWA 3OXSB 3E9TA 1MUJA 2AW2A 3FS9A 2Y25A 4Y5VA 2CK0L 3RQ3A 3GSNH 3JT0A 4YHYC 1ZV2A 4KKQA 2JIXD 4P46B 4TULH 4QRBA 4RA0C 2YMXH 5SX4I 4W9ZA 4J3WA 3ZY7A 3EAKA 3GMPA 3CNKA 4L5FL 4NNPL 1PZQA 5IBTL 2R56H 1ID2A 3PPSA 5E2TH 1NMCB 1KIPA 4FXGA 1I75A 4L05A 4LP8A 1NGZB 1Z56A 4FNUA 3JWNC 2VLRA 3DVNA 2QT6A 4BFJA 5CCGC 2VSCA 3BKCL 3Q5YA 2Y3AA 2VLKE 2HRPH 3PWPB 4ODVL 4PJDE 4OFQA 2Q7NA 2R23A 1CXIA 1DSWA 2DQFA 2MQ0A 4LSPH 2X9YA 4OD3H 2VDKH 1M1KQ 4U1KA 4YZFE 4ZD3L 3LW5J 4PRBB 5IB4A 3SKMB 3UTQB 4IEFB 3QDMD 1ZDSA 3FU0A 2RA1A 4JHZA 1IKFH 3A5VA 4J3SA 3VWKC 3G3ZA 1FNSL 1X22A 5I5JA 4DO4A 3JWOL 4JKLA 4U1JB 1MLCB 2OTPA 2WZPD 1R75A 4LKCB 4NSKA 4O9HL 1EZVG 3AWFA 2Z9TA 1VACA 1EDLA 4WUUD 5FYKU 5HDLA 1ZLWK 3T6ZA 4HOXA 3GUTA 1XIWA 1FGVL 2OTKE 2X5PA 4AYBA 4A7SA 1U91A 2GG1A 3LW5H 4IMKA 4J2XA 2AXHA 4JFWA 1OW0A 2H7WA 1OVRA 2PTVA 1Q4NX 5DHVB 3KH3A 4FG6C 4X50A 1RD6A 5FCUH 4P2QB 2VR6A 5IFHL 1DLFH 4HCRA 4WI9A 3QG6B 1EDYA 4PJ9A 5D7JC 5I0VA 2E86A 3GMRB 3MRCA 3LEYL 2H8PD 1PIGA 1JGLH 4LGPB 3WTXA 1J05A 1Q9WA 3GLMA 1TYRA 1NU1K 3D05A 3E3QC 4G8IB 4EUPH 4P57A 4ZMVA 2J4WH 2OZ4L 1S7WB 3IMVA 1YYML 3FO9B 3QDJB 4GI8A 4DP0X 5FA3B 3C87A 5HVFB 3HPLB 2CGRH 2DH3A 2X42A 2BOCB 2BVYA 2YEVB 3FU6A 2NY6C 2YPKB 4DN3L 1ED3A 2VDLB 5E5MB 2NPSA 1FSKC 3LZPA 5DRXA 3BN9D 4NRZB 4R90L 5DUJA 2DL2A 4C59B 1FBMA 2D03H 1NTKK 1N5AB 2JWDA 1AGFB 1SQQE 4RKUJ 1S7XB 1NEPA 3QUHA 2IAMD 4K73A 4LLWA 4UUJA 4AYDC 4NZUL 4OM1L 3K6FA 1UWYA 1VADB 1VDFA 4XP6L 1JWUB 4LCWA 3RLSA 3TGXA 1YY9D 1NMAL 3V6ZB 1MJ7H 4BWTA 2Z31C 4IKNA 4HWUA 1LJMA 1ZVSA 4G9DA 5TK2A 3HN8A 1YDPB 1QNIA 2P5EB 3CPLB 4KK6C 1A1MA 1ED3B 1A02J 3FAWA 1R5WA 3LKPA 2BSRA 1IFNA 2AJXH 1L0LE 1LO4L 1QSZA 4PJGE 4PRIE 2M83A 3TJHD 4YSEA 1GS8A 4GH7B 5I8CB 1ZVNA 1KYOE 2APTA 4Z7VB 4X4KA 2XIDA 1BQHB 5IHLB 2HT4D 2FYNC 2WXFA 4AIOA 3S1KA 3GSNL 5A2JH 4PBWD 4J23A 3K2KA 4TULL 1I9RH 2VZOA 4WHCA 1URQA 2FJHA 1PSKL 4PQXA 4BJLA 1YYCA 2XNDH 4HUWA 1A1MB 5I71B 1RF1C 3MYZA 3G6DH 4Z9KB 2VMCA 5JNYA 2PXYC 4I85A 3LTVA 4IU2B 1O7DE 2R56L 3PWNA 4J2QA 1CQKA 1V7NL 5E2TL 3HD7A 3LD8C 4IFFA 4N0RA 1JGIA 2VDRH 2AQSA 2XX1A 3STLB 2ZICA 4N3YB 1A64A 1AKPA 4K3JH 2BJMH 4IGBC 2FYUG 3IN2A 2ROYA 4AZUA 5D96C 4YGVA 3D6ZA 1UQSA 3BPCB 2HRPL 4FFZA 4UI2A 3EG9B 5D5ME 2WKLA 4MJ2A 4OD3L 1WWCA 1CI6A 2VDKL 1TZGH 1PPJG 2K0RA 3H1KG 3TWYA 3WTYA 4NNYA 5A7BA 1IKFL 1WAEA 3RY6C 1E6OH 2ZOLB 3EXLA 1A6AA 1KJ3H 2V5MA 3LRSA 1ZSDB 5EU5B 1KXQA 3ZDXF 1EDHA 4U6YA 2P7TB 4FJZA 3S37H 4HK0B 1P4IH 5T1KB 1F13A 4JRXD 1FVDA 3VXRD 2J57A 1AMXA 3QW9A 4JO2H 2X0VA 3L3GB 4EAEA 5J6GA 1TTGA 1KC5H 4GP4B 4PV1D 3UPRB 5K1NA 3KLSA 3SY6A 4XN5A 4DUWA 5FCUL 1SQPG 2QLVB 2APWA 2L5GB 1DLFL 3EHBC 1XF4A 4ABUA 4BDVA 4WENB 1FIGH 2VXUL 3CVBA 4JFHE 5FUOL 1PKOA 4XWOD 5E9DE 5J1SC 1JGLL 2HLFC 4HF5H 3WIFA 2ADIB 2ED9A 1M56D 2RTTA 2J73A 2J4WL 1KYOH 2HVJB 4B3VA 2GUVA 2O5NA 3NFNB 3N40P 1Y47A 1K73Q 2CGRL 3SDXF 5LQBH 1Q2NA 3O6MH 3V5DB 4E9XA 4PREB 1O5PA 3Q01A 1IO4C 2X0WA 1ZCRA 4GG6E 4PGJA 1I3VA 2XU9A 1D9KA 2QQQA 1D2OA 4QT5A 3E7JA 3BGFC 5D1ZI 1M7LA 3ZDYB 4HLZG 3GWJA 2ZSWB 1BGYD 5KTBA 2V3EA 5DZAA 4PTUB 1MJ7L 5I1IH 1S9YB 1VFMA 3NJKA 4H1LG 2ZXCA 1YN6A 4WB4A 1AR1D 4KNSA 1ET8A 4NRXA 4PRNB 2GSGA 5EEXA 2MHAB 3T1WA 1QLED