5AVQB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 0.75 min.
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avqB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avqB02
5APYA 1GU4A 4EOTA 2Z5HA 3HTKA 3I5CA 1MV8A 2BASA 1H88A 2WPSA 4KHXA 5AVQB 1CZQA 3P32A 3L37A 3HE5A 5AW2B 5APQA 1FAVA 3LIEA 3P7KA 1SLQA 4AQRD 1NWQA 5APWA 5AW8B 1DH3A 5AVUB 4C7NA 2P2UA 1A02F 1GU5A 3KDPB 2P7JA 3L36A 5AW0B 1JNMA 2IPPA 2R5BA 5AW6B 1H8AA 5AW5B 4RETB 2WPRA 3LIDA 3TNUA 4HYTB 2KP8A 2W27A 1G2CB 2XU6A 5AVVB 2YO2A 3A2AA 1FOSE 2C9LY 3VN0A 2QM7A 3M9HA 5AW4B 2WT7B 2Q5UA 3HE4B 5APSA 3P8MC 3VTPC 3A7OA 3OAKA 3VMYA 5AVXB 3A3YB 3V5BA 3VMZA 2YNYA 1JUNA 1T2KD 1KQLA 2R5DA 2N9BA 2JJLA 2ZXEB 5APVA 1YYCA 4AUWA 1T2KC 1GK6A 1CSBA 1CI6A 4XE5B 1H89A 1MUUA 3WGUB 3TK1A 4B86A 3M06A 2P67A 4M3LA 3MGNA 5AW3B 3B8EB 5APUA 2W6AA 2YO3A 1A02J 5APTA 3WGVB 5AVSB 2C9NY 3M0DA 4I6MC 3MD0A 2WTYA 1IO4A 3NMDA 4JYBA 1OXZA 3L35A 4C46A 1GTWA 1HJBA 2R32A 2E43A 3T97A 5AVRB 1HWTC 4GT1A 3M91A 2ZFCA 4JYCA 2R3CA 3NFQA 2XV5A 3IR9A 3V4WA 5AW1B 1FOSF 1X8YA 2VRSA 3O8ZA 1OWAA 5AW7B 2XZRA 1SP4A 3HE5B 2WT7A 2E42A 5AVZB 3HE4A 3UIAA 5APXA 4AYCA 4I2LC 3TYYA 3A5TA 3VYIA 3SWFA 1GK4A 4DZOA 2Q3IA 2WWWA 2Q7CA 4C7NB 3V4QA 1CI6B 1S9KE 1HUCA 4GKGA 1GZLA 1GD2E 2H7HA 3M0AA 1S9KD 3NTNA 3TNUB 3NXSA 3KQGA 3VMXA 2WPQA 1HBWA 5CMZA 1NAFA 4RESB 2Z5IA 1J2JB 5AVTB 2QM8A 4LC1A 3M9BA 5AW9B 1MFZA 5AVWB 5AVYB
chains in the Genus database with same CATH superfamily
1AKPA 3KGTA 4P59H 1EEZA 2CLRA 4GMTH 4HGMA 1AGEA 2AABH 3W5NA 4P5TD 4FABH 3L7EA 3MYZA 3VO0A 2R29A 3PWPA 2YSTA 4KQ3H 1PLAA 2H6PA 2O5YH 4BFFA 1OAXL 35C8L 3EJZD 5GISL 3S96B 1IFNA 3Q1MA 1JPFB 4L4TB 5DEZA 3FO2A 1HC1A 1UKTA 4JPKL 3KWXA 4I77H 2EVGA 4K07A 3WE6B 4ZAKA 1P2CA 1M6OA 2R2HB 3O2WH 3IPBA 3ZE0E 5CR1A 4C7NA 4MJIB 4YDIH 2TRHA 5DTFA 3QZOA 3C08L 4OCYH 1YY8A 2AQ3A 2OI9C 1URIA 5IW3A 2JV6A 5AW6B 1SBBA 1JNLH 3F7YB 3D69A 1VZGA 1QLFA 5KLVE 4HYTB 3EYSH 5KVDL 3LKRA 4LQFL 2ZD0A 3N55A 2OJEA 2LLNA 5AENA 4KJWC 3CJJA 3OHXB 5E2WL 3KVPA 4LSRL 3VRIA 2E75B 2YPLE 3L3OA 4NI6A 5TDPA 3VD4A 1MCKA 3ZDXF 3EDFA 43CAA 1YITP 1KY7A 1BG9A 3CQPA 4WY7L 4R4MA 4CW1B 2HT4C 2VXQA 4I4WA 1WWAX 5FYJU 2D7TL 2K6WA 2FYYB 2OMYB 4OGAC 2QR0A 1FYHB 3T8MA 3PP4H 1GW6A 1A6VL 1RVFH 1SQMA 1CI6A 4OCSL 5IK3B 1RCYA 2ORBL 2J2ZA 1AO7E 2MHAB 2QQQA 2AJZB 3G7TA 3L3KA 3MN8A 1NTMG 3ARSA 4DEUA 4I9WE 5A43C 3VFUA 1E4KA 2QHLA 4F9PA 4EZJA 5F3BA 3L71E 5C3LD 4NNXB 2B8OT 2OXGA 2ZXDA 2LU5A 3WD5H 3MD0A 2XTSA 1RL1A 4PTUA 5EWIH 3U48A 5A7EA 1SOXA 2R32A 4PGZA 1I7RA 1MFNA 1O6VA 3OKDB 2N3JA 4HAKA 3ZO9A 1J1DB 3NACL 5D7IF 4KQ0A 5C1MB 5C7ZA 3S35L 1FFQA 3DARA 1NIAA 1JVKA 3OJVC 2VR8A 1NC2A 1BEYL 3FO9A 5EEUA 2QELA 1B0WA 3ARBA 3H9SB 5JO5A 3K5BA 4PJEE 1AKJA 2DIEA 2W6JH 2APVA 3BUTA 1HXKA 4NAMA 4IKNA 1KLGA 1MAKA 2VLLB 5FUOH 1VQOP 1MREL 2A9AA 3US0A 1E5WA 2XV0A 4WGWB 2VW6A 5E79H 1GHFH 1NBCA 2FGWH 2YC1A 4N2DA 1XCQB 4UIMB 3QQ4B 1ZLVH 1S9XA 4XI5D 2W9DH 5JHDD 5IB5A 5IF0A 2Q2EB 2IFFL 2TAAA 4N2KA 3QUYB 3M9BA 3O0RL 3BJ91 4FTVB 1IAIM 4NZFA 3FTUA 2BCCE 4H0IA 1U8JB 3EJPA 4NENB 4R7DB 4NP4L 5EHFA 4HKXB 1HDMA 4K7FA 3NZ8A 2KS1A 5GS2D 4NO0D 4YHOH 4ZMNA 4WI5A 3LNEA 5CCKH 1MEXH 5IUSA 4W9DC 2FXPA 2YN5A 3TA3A 32C2B 3OXSB 4I18A 1DN2A 3O3DB 4PJBA 1OM3L 4YK4C 4AITA 5DHEA 3TT1L 4NNPH 3BUPA 1T1XB 1SF3A 1K4CA 1FG2A 2MOQA 4YDJA 4FQ1H 3S34H 2NY2C 5TF1H 3L7FB 5CF3A 1GL2B 1NH6A 3K71B 3LMJH 3WY2A 5BZDA 1OAYH 2C4FU 2X2YA 3C8HA 3EBHA 1YQVH 4QAMB 5D72H 5KAQF 3DVNA 4ENED 5TQ2L 1DSYA 1A3RL 4HV8B 1OT4A 4NM8L 3MR9A 1JERA 4MTMA 2XY2A 2MQGA 2V9TA 5J1AA 1I3UA 5I1AA 3UTSD 2A7BA 3B9KB 2DLFH 1A25A 2DWXA 3SZ6A 2JCCE 1WZAA 3RWGB 2OMZA 5D4IA 3WJJA 4GUPA 4JS7A 1U8PB 1FN4B 4RGNE 2DMCA 3ZBMA 2ADFH 4OFVA 2C9VA 2OL3A 5HHVH 3ULAB 5E4EB 1LJMA 4GQZA 1LDPH 4ZDHB 4DKFH 3SCMB 2D2CC 5I1HL 1E4XI 2W95A 5D7LE 4DSYA 1MJ8L 1QVOA 1GC1L 1GYUA 2IH1A 4POZD 5E7FA 2XXCB 4ZW3A 1QYGL 4PJ9C 3B8SA 3IDJB 1KG0A 3E3QC 3QO1A 4XCCH 3VFNA 2CGZA 5JMRA 1ACZA 5KZCD 5MEOB 5HHME 3OD3A 1DO5A 3F2LA 1DQQB 1JPEA 3PRZA 4MZIA 5IESH 2C9AA 2FWOA 3GO1H 1EC5A 1MJ7H 1XGYH 2OYMA 4HKJB 3LTVA 5ID0A 2N1TE 4PLJC 3SYQA 2W83C 3AUVA 3Q9QA 1BMWA 3UZVB 4QJ5B 2BSTB 1ZLSL 4BE5A 1EZVG 4L4TD 3FB7A 3ZDWA 3ESNA 1L9SA 3QQDA 4TPRL 1F4YL 1XZ0B 4MCYB 3FT3A 4EI0A 4U1GC 3BASA 3ZKMC 2B0SH 2QV2A 1U91A 1UH2A 1NMCB 1TNMA 3PNRB 1WAAA 3IN6A 2BSEA 3FUMA 5DQDH 1RLWA 3BCFA 4FNTA 2FHCA 3T2NL 4JFZL 3KDMB 1GGIL 3ECBA 2QPDB 4LGRB 2DQJL 4MN4C 1QWHA 2NYZA 3T97B 4BQCA 1BLNB 1AXIB 2XNAB 1WTGT 3SGEH 3DO7B 1NTKD 4ZD3L 2Y22A 2E9BA 1BZDA 1N4XL 5D2NC 1A66A 3IDMB 2K9JA 2XVBA 3BAYA 3WMQA 3LV3B 4IJ3C 4W7ZA 2Q6WA 2DZEA 4G9DA 5BS0B 5JZ7C 1UJ3B 5FYJL 2VDPB 3EYOA 3RWHB 1X3DA 2FFDC 1FNGA 4BWNA 4QAWA 4EVNB 3UTZA 4LIQL 1OWWA 2GCYB 4QRRD 4XP6L 1YUHA 2WIIB 4JFHE 4Z7WF 4GI9A 4PRID 3TBSA 5L6YL 4JPZB 1YZZA 3CXHK 4K9EL 3BO8B 4N22A 3BH8B 1RIVH 4P46B 4JDTH 4FLSA 4LNRA 4GIPD 1IFPA 1UM6H 1E28A 2HTKC 3E80A 3Q8AA 1Z5LB 1GRWA 2CPUA 5EULV 2IPTH 2RMNA 3DETD 4G2AA 4UM9A 3BPLB 1ROCA 2J59M 2D73A 5K1NA 1M7UA 2FATH 3FHEA 2XU9A 4WUUA 3UJIL 4EOWL 3JWNG 3DKHA 1T1WB 1JUNA 3AQYA 4B0MM 4HFWB 1NAMB 8CGTA 4NKOA 2EQDA 4KZDL 1M1JC 3ZJAA 3IDYB 2EIEA 3IAGC 3QWOC 2PW1B 3O4LB 2GAZA 3KLSA 1RPKA 1CFSB 1EZVD 3RBZA 2K6YA 3B3IA 4N2GA 4G7YL 4AXWB 1G7HB 2YPVH 4LPWA 2WVVA 4P57B 4XMVA 4EQ3A 2Z7WA 1KCWA 4ZMWA 2OARA 3X3GL 1TO4A 1N4XH 3AM8A 1F58H 5T3XE 4OZHB 3LYRA 3TO4B 5BV7H 3PUUA 3RU8H 1KTDB 2ZOUA 4W4OC 4H88H 3WHXB 1W2EA 4R5XA 1WUZA 1BCCD 1ZS8A 2VDPH 4PVNA 4ZFOB 4Y4HC 2WZPA 3T1FB 5D6DC 4GAYB 1NBYB 4ZD3H 4JKPH 2ZUWA 5KS9E 2WSCJ 1DQTA 1QFWH 2FBWC 1AY1H 2CJUL 2BVYA 1OSEA 4DCKA 5CEXB 1DQML 3MYJA 2NMSA 3VD2A 4PJXB 2VN7A 2RH0A 4C56D 3VB8A 4LCIL 3NSDA 5IHUL 1YEDB 5AL0A 5SWZD 1DBML 3U79A 4J23A 1IEAB 3QT2A 4AK1A 4U1MA 2Y1ZA 3II2A 3MV9A 4LIQE 3CHRA 3IMWA 1YY9D 1JD9A 3BP6B 1AFOA 3ULVC 4MAZA 1JY2O 2F58L 1SJHA 2XTJE 4IGBC 4X4KA 3H4HA 1PDKA 1JGLL 1U3HB 1B0GB 3MACH 4HGWA 4IU2A 3SDAD 2O1JA 1A5FH 5DT1L 2PR4H 4C56B 1UZ6E 4HPYH 4X5XB 5JPMC 2W0KA 5KSVA 2DQIH 5GRUH 2VXTL 3LQMA 3PJNA 5KOMC 1LD9A 1OAQH 4UU9A 3X1BA 5K9OB 3V0VB 1X5FA 1X5AA 2AV1A 3I2CL 5GJTL 4A6YL 3CUPA 3KJ4C 3U1QA 5HHPB 1FZMB 4EN3A 5GZOA 1U0QA 4OT1L 5AB0A 2YD1A 4BA8A 1IFRA 3ETSA 4FRWA 4TVSa 5IHZB 2VXVL 4LBAA 1QNZL 4AI7A 1JXJA 5F3BB 2DD8L 4FULA 5E6IA 2DYSB 4MCZB 4LMQE 4XMUA 1A02F 1P5VB 3UAJD 1M1XA 2GHWB 4L05A 4UTBL 1X0TA 1GMJA 1E9QA 4BEIA 2XYCA 3AM8C 4D0DB 4U1JA 5GGRA 2H6UA 3GHGB 3HR5A 4EI5D 4FD0A 3PGCB 2NX5E 5I1GL 2ATKB 1SQPE 3M9QA 1OE2A 3HRNA 1NC2B 3FO9B 3WEXA 2FX8L 5FGRA 5I1JH 1KPUB 2KQNA 3SY0B 1E50A 3CLEH 1CGUA 1D9KB 3P8MC 1OMIA 2PPEA 3EHBB 3LZPA 3PWVB 4GKNB 4YIQA 5IMLB 5K9QG 3MTXA 4C47A 5ANHA 1WBYA 4EJ1C 1U58A 4J8QA 2AF2A 4L3EA 4OKVB 4B60A 4GQQA 2FB4L 3SJVB 1B3IA 3MLPA 5D5MF 3QQ4A 4JFSA 1UTDA 5EO1B 4E36A 3KPOA 1ED3A 2BFVL 2JI1A 4YE4H 1AJ7L 2ZTBA 1U3HC 2EE0A 4U0QB 5HI4C 5C0GA 2HLFD 3K81A 3MRJB 3QZNA 3WU1A 5DWPA 5IQLA 4B7LA 2DI7A 2Z31D 3MHZA 3FT4A 1BVNP 4PI0A 5L2JA 1ACYH 3B7TA 3OKEA 1BXUA 2OSYA 5I1CL 1K8AQ 1CXIA 3U46A 3H1KE 3KWTA 3UDWA 4BWWA 3GF8A 1MCSA 1I9IH 4APXB 4GG8A 1QLEL 3ABVC 2MH4A 4Z7OF 2EYRB 1SUHA 2FFDA 3LB6D 3MRBA 2BNQE 4LLUB 3AE9C 5FUCE 2Z8WC 3BIKB 1RUQH 1XGTA 2NXZD 2ZYIA 3A67H 3TTYA 3BXNB 4J6RL 3IRZA 2W91A 2X6UA 3ARGB 5ANMA 1SY6H 4IU3B 3ARXA 3VP8A 2IFFH 1H6UA 2Z3FA 3VWJB 1LP1A 4WWOA 3TM6A 2K7QA 2VLKA 4MB3A 2BWIA 2YMOA 4QRRE 1OPGH 4QTFA 1EPFA 5IB4A 3GXNA 1VZHA 4YVNA 4UT9L 5IK3A 4BQBA 3NTCH 2VDPL 4G1MA 3TA4D 5D7HA 3RK2D 2EO7A 1GCFA 4QNPE 2UXFA 1PD6A 2BPBA 2YIUC 2BCMA 3NCEB 2R9HC 3HZMA 4MJ6A 3CXHJ 4HEPA 4PG9B 4PWJA 1KB9I 2WVRA 4AH2A 5E5LA 2QA4P 1NAKH 4ENEC 3WIAA 1DBJH 1MY5A 3RK3B 2JXMB 1VKXB 3ARYA 3KMDA 4DW2L 2J8UA 2WTOA 2WLLB 5ACMA 3P11L 2K45A 4XXDB 3CLQA 1EHAA 4Y89A 1U8HA 4OZGB 3QIWB 1WBZB 1IBGL 4AYBA 2R3SA 2DBJA 4PJGA 4I7ZC 3M1BA 3ARED 3FUDA 2O4EA 5CHNB 5EBMA 1R3IL 3BATA 3FPXA 5C09A 2EH7L 2OTUA 4PRHB 3RWGA 4EIUA 5I1DB 1A7QH 3QUZD 4KKAD 2IPTL 4G5AA 1PZUB 2VR7A 1UT9A 4M6OH 4KRPB 4Y99C 2YBGA 4UIMA 3TJPA 3FH8A 2PPAA 3GXTA 3QJQB 4A7VA 1MCQA 4R2GC 4FZ8L 1CUOA 4AYDC 1QSED 4ZW5A 1HWHB 2QVIA 3IDJA 3V4PH 5BUAA 4WY7H 1J12A 1YMHA 4YBQD 4N2OA 4UZUA 2VRAA 4HJUA 5L0QB 2BXYA 3WOVA 3QW9A 3QRLA 4QRRB 2Y9RT 4ZOBA 3ZDYB 3CC2P 2X42A 2WK2A 3DGGB 3WNOA 3D08A 3QUZC 2P8PB 1HHHA 3QCUH 2DMHA 5DK3A 5L4MA 3VMZA 1U8QB 5L9DH 2HKFL 4ZI8A 1TFPA 4AGLA 1TJGH 2EDHA 2YPLA 2EIJB 4R7DA 2FCBA 3GSUB 3M1CA 1O6SA 3I9GH 4BQ6A 3AGVA 4WQOA 2YMXH 4HKXA 3U2JA 5TH2A 4KJQC 5EPMA 3KPPA 1JNJA 3C8KA 3SO5A 2FWSA 1NLBH 3VXRB 1EEYA 1OAXH 3V2PA 3QIUB 3UZQB 1SQVE 4DN3H 4QCIB 2BCCJ 1F90H 4LCUA 4WNJA 3K6DA 3VH8B 5C0JB 2HT3D 3JT2A 5F96L 5AOJA 2OZNA 3BKML 3MBEC 1ZP0C 4UTCA 3NCFB 2F74B 2DQGL 4GKZB 3M7FB 1KV4A 3OAZH 4S1DD 2PXYB 2ROYA 2Y2YA 4WENB 4MAUH 2DQTH 5B3JE 5AW7B 1ZVYA 5DXWA 2J1YA 3PWUB 2VXQH 3ZT5A 1FO0L 4UOQA 4HMCA 1O9VA 4KRPC 2VZOA 4ETQA 4S2SA 3MV7B 3ETBF 1KJ3H 4ORGB 1HYRC 1PLGH 3CC4P 4TSBL 1U8NB 3V79C 4OCMC 2G2RA 5F89A 4E2OA 4X6EB 3NQKA 2E9JA 4TOYH 5G2NA 1FZEA 3SOBH 3ZKNC 4HBCL 1RZFH 1LTSC 3TVMB 4EZMA 3NFPA 4WEUD 1MCDA 3CDCA 1ID2A 5GGSB 1TG8A 4FFZA 4N2HA 3C6EA 5E9DB 5BS0D 1XB3A 4M6ML 4OZFB 3MUGB 1P9MA 1WG3A 1ASPA 5E79E 3AG3B 1QSFE 1S6NA 5TQ0L 4JM2B 4HKBB 3K8KA 4MSWA 1MFEL 3MSPA 1T04B 1K05A 3OMZA 1G7HA 1HT6A 1XHHA 1YUKB 3PG2A 4XMLL 3KPEA 4PJDE 4XMKL 5F9WB 2Q76B 2FJHB 1M90Q 1T2QH 1ZRUA 4PAZA 1HI6A 1RJCA 1ZN5A 3A47A 4DKFL 2KMWA 4NKQB 4MXVF 5D2LA 4ZBJA 2XACC 1XZ0A 4J3OH 4MCYA 4WHYH 4FA8A 1P84D 4TN9A 4OJFL 4JQXA 3V5DA 2A6IB 1KGIA 5E6YA 5I8KH 4PB9H 4XPAL 3MFFA 3U1PA 2XWXA 3E6HA 2GK0A 3TGUD 3ZE1E 1B9KA 1XGYL 3DYPA 3Q0HA 3C5ZA 3ZMEA 1ZTMA 2KZBA 3Q8EA 4OGQB 3WXVH 4DKEH 3VSUA 5MEPB 3FU8A 3AE5C 1ZHKB 4OFIA 4NP9A 4TRPL 4C56E 2PYED 1IK7A 3E1RA 4AL8L 1DQIA 3X1FA 1MVFA 1UIXA 4YL9A 1LMIA 2Q6WB 1JP5A 3OGCA 4HAGA 5I1HH 4Z8FH 1EDLA 2JJSC 5BOPA 2KB7P 3W82A 1HOCB 3BW9A 2X5PA 1F3JA 1SN0A 4WUKH 5GRVL 4FTVD 4IW4C 4KTEL 5C0BB 2Y36L 4I9XA 3S9OA 5BO0D 5G4OA 4OI7A 4R97C 4GPVA 3PDDA 5CJ5A 3PWJB 4W9EC 3H1LJ 1U92B 3HNTH 3VVVA 2WIMA 3U2IA 2DLFL 5J3HD 4X0NA 4DP1X 1P4BH 4GINA 4J4PD 5B66H 1M9WA 1F2QA 1NC4D 5ISZB 2IBGA 3PLNA 4DJGA 1AQMA 1Z9NA 3KHUA 4NN5B 3G5VB 4D0BB 3CMEP 3FCUB 1QL1A 3IMSA 3MKKA 2MWCA 4XOAA 5ITFB 2BY0A 3BWUC 3ZL2A 4H7VA 2X6CA 1G9MH 4XPHL 4L29B 3RAJH 2UUDK 4X9FA 1EO8H 5AWNH 1NAMA 5J7CC 3JV4A 4OZHA 1Q72H 3GBNL 5CSZA 4JQVA 4TTGA 4OVNF 2PW1A 1N6UA 5DFVD 1PBYA 1YEWA 3X1EA 1KN2L 4D0DA 2IADB 1EQ7A 1L6PA 4M8VA 2VSKB 2ZSVB 3RL2B 3TCLA 3PGCA 5KVEH 3VW3H 1QWUA 2Z31A 4MDRA 3IVKB 1OW8A 2E6JA 1YHPA 2VRKA 1SMOA 1ZXKA 3SBWC 1DD3A 4YSTA 4FCAA 3S37H 1BDCA 1KTMA 1ZS8B 3HTKA 3EOBB 3Q5RA 3CQFA 1YAZA 4CMMB 1NBYA 3ZX1A 3TTSA 2KIKA 2JB5H 3QUKB 1LO4L 4M1CD 2WZAA 1RHFA 1LILA 1LQBC 3GMLB 4I48A 4UTAA 3EQ2A 5T5NG 3VD5A 5D71L 5BZWA 1QNZH 3AXLB 3UG4A 1AZZC 2H26A 5IQ7H 3AEFC 3BUQA 2BP8A 3DUUB 4XZ4A 2IBZG 1IM3D 5L2JB 3HS0B 5E8PA 2H9GA 4IOFC 3DMMC 4KITB 4HWUA 1KYOE 1EGJA 3RGUA 1GY2A 3K6NA 4FQHA 3TLRA 3V5KB 3ZSTA 5KZCB 2DTSA 4Y19E 5F3HA 1RE3A 1AIFA 1FZCB 3CXHE 4ZX4A 1KBVA 3KZIE 1AXTH 1FP5A 3ARFA 4UQAA 1VDGA 5E4AA 4DWHA 3MLRL 2VO5A 1F0LA 1U6AH 2WKOF 4MX7B 5ISZA 1GJWA 2H32B 2WLYA 1PAZA 2OMVA 2YQGA 3GSNB 3N9GH 3SDAB 4NQVA 3CFDB 4LVNB 3ARQA 3PWLB 1OSYA 3S3CB 4AENB 5APVA 3RZCD 1BPVA 3S35H 3CU7A 3GSRA 5GSRB 1BQUA 1RZ8A 5T1KD 5JW4R 4HPOL 3TK1A 4WY4D 3W0WB 4BJLA 2O01J 1KNOB 4KU1A 4DZ8A 4TQ8A 5HYJA 3P2BA 2FIRT 4O5LL 4PG9A 5APUA 1BSHA 2G9HA 5I75C 2CO6A 1NGYB 4WHCA 4DHLA 1CZ8H 1IZNB 1HQRB 3CCEP 3C5JA 4PJ9B 4H0LB 5I26A 5I1IL 2BP0B 3P3UA 3CDFA 2ZXGA 1E9QB 4NUGL 4CILA 1KGJA 3RDTA 4OD3L 2GUOB 4NAQA 2CUMA 3QIBC 3IR9A 5GTHE 1T6AA 3GMRB 3P9LA 3M1BB 3QDJA 4M8UA 3OTTA 5B21A 5F21B 5F0LB 3HC4H 3U83A 1F58L 4P3DA 2K88A 4XNMA 3SDDA 2HAZA 3SKMA 1JK8B 5FEBA 4RA0C 1YO4A 4QT5A 1IL1A 4CJ1A 4Y4KA 3L3DA 4AT6B 4OJAA 1KYOK 1WA0X 4FMKA 1OANA 1JI1A 4K3DH 3GMQA 3ROOB 4XHJD 2VAJA 3HMXA 3ZXAC 4L9LA 2VH5H 1EFXA 1DLFL 3LPOA 2DN7A 3GWJA 1U8OA 4PJ0E 4KUZL 2IBZD 4AZ8B 2G3MA 4OU3A 4UOZA 1EXGA 4Q97A 2N0KA 5D2NB 2EXYD 3B7UX 4HCRH 1MFMA 3FT4B 2L7QA 4PSPA 5C0BD 4BIKA 3ZYJA 2XN9A 3C87A 1R3IH 3IU3A 4ANXA 2WYTA 1A3LH 1HHHB 1KBKA 4LSVL 5F7MC 4BRJA 2ZCZA 3NA4A 4FOMA 5EIIA 3MTUE 2E27L 4PJ8B 3OJAB 1R8EA 4PJBE 2O5NA 1D6VL 3BIKA 3E8UH 1M56B 5EIQA 3PNWB 1E5ZA 1WICA 2G5RA 3IJYB 1U3NA 3BXNA 4N0UB 4H0HB 4LIQH 5LNDA 1EFXD 3FB5B 2OZ4A 1F42A 4DPRA 3PV7A 3HS0C 1ERNA 2W38A 3LN4A 3QIUA 2VXTH 2NY2B 5IBLC 3UZQA 1WAEA 1LO5A 4JFUA 1NTMD 3OJDA 4DP2X 2P7TA 4LL4A 2BW4A 3QULA 4PB0H 4PJHA 4YVUA 1FHNA 4GDOA 1YPZA 4Z7VB 1CI5A 1HQ4B 1KYFA 3DC0A 3RK2B 4M43L 4UAOB 1W0WB 2AZUA 2DQJH 2AEQH 4MA8L 1TPXC 1QBAA 1KN4L 1BIHA 2M2DA 1BIIB 2XZCH 3B83A 3M9HA 3L3OC 2VLRD 4L3EE 2J8UB 3RURA 2IBZY 4HU2A 2X0UA 2F1EA 2XWJA 3ZE2E 1FG9C 4OZGA 1CR9H 3QIWA 5KSAC 2FO4B 4O9HL 4S2SB 3APCA 2VDNL 4PJGB 4FHBD 5I0DA 1I31A 4TPRH 3THML 3MBED 2R1WB 4JZOB 4Y9CA 4U6HB 5F89B 1TF4A 4GUOA 1GXEA 5IVZB 3JQOB 5AW3B 3L72G 4CC0A 3BCCG 3D9AL 1SBSL 4HBQA 5DA4A 1I1FA 3B5NA 1V5JA 2JF1A 3TVMD 4ZNEA 4N5ED 5B38G 1KCRL 1HNFA 4R7XA 5KSUB 1RURL 3AEGC 5M95B 4NC2B 5J6SA 4YFEA 1KT2A 1Q0XL 3O6MH 3D3VB 3VU1A 3MUGA 1SVCP 5LBSL 4XBGA 3TYGH 1IEBB 4KO9A 3JWOC 4NUMA 1ZT1B 4UB8E 2WXLA 3DX6B 4ZUSB 3MRMB 1D6VH 3H6JA 4XPBH 2VC2H 2DJSA 1S7SB 1A2YA 4KRMB 4WRLA 4D6TG 5I1JL 3IDNB 3O45A 1MCOH 4HGKC 3VXSE 1KIQA 5TPWL 3QXVA 3BRTB 1O6SB 1SQQK 4W81A 4U1NB 1S7QB 1EXJA 1J1EB 1E4JA 4U1KA 1JDAA 3C8KB 1MG3C 2K3RA 3K2KA 1OSPL 3KM1A 1CIUA 2AXHA 2W07A 2IGLA 4JO2H 4AEEA 3V5DB 4CC4C 4AY0A 2D7QA 1IC7H 4H0GA 4QRBA 1C5CL 4N9GA 5B3NA 5FLUA 4BFOA 3OJMB 1JHKL 2GITA 2O5XH 3K2IA 5FW7A 2WP3T 3IDUA 5HSFA 4OCWH 4BDVA 2G5UA 5F88A 3LKQB 3RUGF 4DGVH 2BWQA 2DLGA 1NTZD 2VZUA 5CR8A 2AJYL 3II3A 4Z7AA 4GKZA 5TF0A 3ARBD 4BCYA 3NIDB 5IJDC 4RFOH 5CWSB 3SDXB 2QHRL 4XE0A 3T6WA 2PGDA 3PGFH 3T4YA 3QAQA 1SDDB 3KGSA 4NUJA 1HN1A 3UTTE 2A5UA 1JGVH 2WBXA 1BP3B 3MP7B 2YPKA 4LCCA 1I1AC 1V27A 5SX5K 1F6FB 1M4KA 1YPZE 5AVUB 2CXKA 3T0VA 4R3SB 1S5IH 1DJGA 1SYSA 1ZIAA 1ZPLA 4XCYA 5FYLL 1FHGA 3JWNC 4GBXD 3P3SA 4N5UA 4RMVA 2L8AA 3L75E 5AAWA 1DN0A 2X0VA 4ODUA 1MW3A 4UILL 4H8WC 1A1OA 1AP2A 1MNUL 4ZPVB 3PHLA 1XXDC 2XX1A 1QSVA 2H41A 3T8XB 1X6LA 3VI4F 1MXGA 3QJFA 1AV1A 3QUXA 2IH9A 2WWOA 1SRDA 2IDCA 2CNZA 4PBXA 5A40E 4CKQA 3IMRA 3B1UA 3QQ9D 1JD7A 1LTIC 5EN2B 4KNTA 4L75A 3VFMA 2VOTA 4BFJA 2IAMB 2DAVA 2J1WA 3EYUL 3AROA 3GLZA 1FJKA 3JV4B 4HZAA 4LASH 4NWUH 1DSFL 1P4IH 4Y5VC 1T3UA 1MUUA 3U9UA 3KXDA 2F7RA 2M26A 2KDYA 1IKFL 2QPUA 2H5UA 2MKWA 1FH2A 5ESVB 3RZCB 4PD4D 2PPDA 2NY0C 1ND0B 3QRBA 3RGVA 1OXZA 1USEA 4YTPC 1C5DB 1X9RA 2C1OA 3L95B 1A4KB 1D5MA 1K4DB 2P5PA 5D7KD 3NACH 5J13C 3ML8A 2WVTA 1MHHA 4R84A 1EO8L 5FIEA 2C5DC 1JY2N 1T1YB 4UQEA 3QUKA 3GFUA 4G7RB 3SPVB 1BE3G 5I6PA 2F7QA 2JEEA 1KGCD 2NSXA 1FI8C 5EIVA 5CMAB 1ZHKA 1TYEB 2P9RA 4PS8A 3DTXA 3D87B 1A7OL 2PCXA 2XV2A 1HZKA 1A8ZA 4E41D 3N1MC 2B7DT 5BCAA 2NXZB 5FK9A 1L0NJ 3IDYC 5E8PB 1TTRA 3Q9PA 3QP3A 2ARJA 3QHFL 4OLUL 1H5BA 3RE0A 2Q86A 3KYQA 2BNUB 1ZLLA 1AJYA 2V6HA 2IFNA 2ENSA 4JRYA 4KPHH 5DVMA 3WNIA 1G1YA 3PS6A 4TMPA 2OP4H 1O75A 3SE3C 1B0RA 3STBA 3V4VL 5CJ0A 1P6FA 4Z77B 3IYLW 1PFCA 3K8LA 4XXCA 4AYEC 3TBTB 1KYOI 2OMVB 4ODTH 2YOCA 5JW3H 3VE0B 3DURB 3ARDA 5DEGB 3PWLA 5DURD 5LAPA 3MACL 4JBSA 4AL8H 1I7TA 1WV7T 1Q0YL 1ET7A 1J0JA 3DV4B 4PREA 1I8MA 1NMBH 4H2CA 4FFVD 4IOIA 2FO1A 3CSTA 2VSDA 3FTZA 4Z7WA 2QGDA 2W60A 3W37A 1UD5A 4P06A 3VXMB 1X79B 3CZSA 2L7JA 1T80A 4WO4A 4M4PA 4AKOA 4JFPB 3RVVC 1D9KC 4IRZH 4Q52A 5AUMA 3OG6B 2IDFA 4ANKA 2WM0A 1FDLH 4NUQA 1NC4B 2BP3A 4NC0B 5DMGD 3S8FB 4QHLA 4L76A 1ZR4A 1KC8Q 4HUWB 2XZCL 3KCWA 4OLYL 1QEWA 2AKRB 4RFEA 1JPGA 4UI2A 4CGUB 1D6EA 1GHFL 1OK8A 2J5UA 2H3NA 1LM8V 1DCLA 5DC0A 2IALB 3U0TB 2R5DA 2J88H 25C8L 2C1PB 3FQRA 4Y9GA 1IGCL 2HVBA 1DQJA 3CVIL 3GMNB 5FA4A 1ORSB 4G11A 5H94A 4PJAB 3V6FB 3I6KB 5E0QA 2AQSA 2BNRB 3GHEL 2ZOTA 3GM8A 3VXPA 1A6TA 4G8AC 1KLUA 2A6KA 3TJEL 4BSWA 1QATA 1O7DC 5ETUA 4Y1TA 1N6QH 5CN1A 3NMDA 2HUHA 3DX1A 4NPYB 5E5MB 3UAFA 4EOWH 5DJ8A 3ULVL 3IU3B 4Q2ZB 5LLIC 1HWTC 1PG7H 3R8QA 2HRPH 5JDJA 5EIIB 5D6DA 3SB3A 3GTVA 2XWEA 1XF3A 4UDTB 1J8HE 1E27B 1JE6A 4K3HA 1GMIA 1TXKA 4D6TE 2CDFB 2CRZA 2GJ6E 2HKAA 2VNCA 5T3XH 3ZE1F 3R1GL 4NHUA 1C16A 1YAIA 4AYMC 4DKTA 4K9EH 2G4EA 1OW0A 4YWGL 1D5IL 2XBZA 1N64L 1HTLC 2ESVE 4JJHA 3INUL 3UPAA 1LO5B 4LOVA 2Z4TA 1MH5B 2WPGA 2UYLA 3V4QA 5LCVA 1CURA 3F01A 4WWNA 3AUWB 1OT1A 3MV8D 5T5FH 1BZ7A 3VFTA 1UB5A 5JOEA 1MFAH 1ODAA 2OXHB 1R6VA 3BWAA 4HIXL 1VB9A 1N7SB 5F1KC 2EE3A 4UQ2B 2JQAA 2KYVA 1G0DA 4R7LA 4BZ2A 4PJDF 4RRPG 5C7XL 1QUPA 3ECQA 3N1PC 3X17A 5AVWB 3O6QB 1MCIA 4D8PA 3GIVB 3FCGA 1J86A 5JIQA 2WHVA 3G5YB 5HDBF 3W1ZA 3TF5A 1CB4A 4Y2OB 1PLBA 4KHXA 1JS4A 2M8RA 5BU8B 2EZ0D 3EKCA 3PIQB 2BZCA 4I77L 4FG6C 1KXVA 2WNGA 1H8NA 2CXGA 5I1KL 4ODBD 3BIAX 2B1OA 3QDGD 4UAHA 4HB1A 2JIXB 4PGBA 3H32A 1QL2A 3V8CA 2JJUA 3V4VH 1PGRB 2WGXA 3D4CA 3D09A 4AT6A 5DZLA 1L9RA 2AQRA 5JDSB 1X6NA 2J6EL 4N2EA 3BZEB 3B5NB 4IL6E 1XSJA 3S1KA 1CC3A 3R06A 1ZHNB 4M62L 2Y7MA 2E7LC 5D8JH 1HHGA 4UQDA 3STZA 2J71A 4YHYB 1NLBL 2ZG1A 2B87B 5DYOA 5IJCC 5EORL 1XEDA 2H7WA 3AMLA 2C9LY 2JQZA 4N2BA 1N2RB 2CRIA 3VFOA 1Z9LA 2PCPB 5JMOC 2YGNA 3CNKA 1NU1K 3IJ9A 2CUHA 1OV8A 1S7SA 5DK0A 1MFUA 4RQQB 1BBJB 4MS8C 4UT6H 1HEJC 3QG6B 4FAAB 4U7SA 2ZOKB 5ERWA 1U7JA 1JHTB 4JZNA 5E1AB 2ITAA 5SWQA 2ENQA 2XCMC 2KH2B 3FB5A 4R0LB 3TT3H 3AMKA 3RVUD 4MS6A 4EI5C 4QYOA 1LO4H 1OF2A 4X7SL 1J0IA 3RY4A 1HVXA 3KZIH 1HJ0A 4EI2A 3L2LA 4ONHA 1M71B 1EAQA 5H37A 2APBA 5KWYC 2L7EA 4PGDB 3CN4A 3QULB 3ZT7A 1TETL 3RNKB 2I69A 3QDHA 3MOAH 3CVDA 1IC1A 1UT2A 5DJ6B 1KJVB 3O11B 3V8OA 5J6HB 5ESQB 4Y4HA 2QJPC 1SEBA 4UAOC 2IAMD 4P5KB 3W38A 3EOYG 2WW8A 5KVEL 3P40A 5BO1L 5HGAA 5G4NA 3C9NB 3ZHLA 4E9RA 2M3BA 2R39A 1PPIA 4HWEL 1YG9A 2QGCA 3S48A 4PI2A 1BQLL 4ZOEA 2YPKB 4OJYA 4EPSA 1QLED 1RERA 2Q3IA 4UF7C 5FGBA 3WJJC 2ZPKH 4PRPE 3RKDC 3WHE0 3RL0g 3PL6A 3GXIA 5F72S 5F8RC 1ZLDA 5DD6A 3V4UL 4AQ1C 3KLHC 2O5XL 5I16A 1VJSA 3TBWB 3L1GA 4BXVA 1KACB 6PAZA 2JWYA 4P2OA 1IC7L 2G30A 1OF0A 3CFCL 3NPZB 2XXGA 4LCYA 1MI5A 3KHQA 3PWNB 1JOCA 1YJ9P 3BPNB 3CX2A 1WIUA 4FI7A 4NS0A 1F97A 4KKBD 1IFMA 2HRGA 2P46B 4MZ3A 3OHMB 1VRSA 3QS2A 1XIWD 2J1ZA 2K70A 2CKBH 2WXFA 2XWZA 2Y07L 5F7YC 3QISA 2FYZA 1XGRA 3BUIA 3D2UA 3VD0A 2WOYA 4GMTL 1ZT1A 3L5XL 4G5ZH 3O3UN 2GHZA 3LRGA 4J27A 3QFJA 4PJ0H 3CPWO 1T20B 2NT0A 3FB8A 4PFEA 1BXXA 1DJYA 1I9IL 3HMWL 4IBSA 3ZKSD 1JV2B 1LT1A 4HOXA 1BM7A 4XNQA 1MCWW 3BKJH 1A7PH 2P7JA 3DXAA 5AOMA 4S1SH 2XOTA 1H8AA 4U3FE 4IRJD 4RWYH 3TIEB 2ZXXA 1BZ9B 4P5TA 4UOW0 5DURB 2NW2A 1KB9E 1TU2B 4TQIA 3G6EP 5LCVH 1NU1E 5JHAA 3FX0A 1ONQB 3R4YA 3LEYL 3NFNB 3NJIA 5BQ7B 4ZMPA 4C55A 4OJFH 3RX9A 4RAUA 3GB7A 5KLIC 3FN0L 5I6XB 3CFIC 1L9QA 4QDGA 3BEVB 1TQSA 1D2OA 2EEFA 3RWJB 3H1LG 1BQLH 5HI5C 4LPVA 3J07A 3ZYOA 3ZU8A 3ES6B 2QKSA 2F5BH 5GXBB 4PRAA 1CBVH 3MNMA 2WJ5A 1H89A 1BGYG 3NCYS 3INUH 2ZONA 1IFGA 2KNCA 1N19A 1YEJL 3WV0A 1DANU 1RZJC 1AD9B 1KTLB 1OVRA 4ABWA 4YAQA 3U7YH 4N20A 3C5ZC 2Y7QB 3MBXH 3KBHE 1LJ2A 3N2JA 3SJVE 3RVWC 3ZOAA 3HUJB 2DDQH 4N2CA 9PCYA 4BKLA 1WFOA 3N06B 3JUYA 2VDRH 4RDQG 5KUMA 4XNAA 2GA1A 1CE1L 1T7WA 1OHQA 5DLLA 4OZIF 3OSKA 1R5VB 4H1LB 2R0KL 1TVHB 2BS71 4JY5H 4MMXA 3SE4C 4PBWD 2CMRH 1F2XK 2YAOA 2XT1B 4WHTB 1CFNA 4XVJL 3I2CH 1BQ5A 1GKOA 4MMZC 4WSJA 5GJTH 3WAJA 4HKZH 1OVZA 4PW9A 3MLWH 3NCBB 2WLHA 5C09E 3GLAA 4EKJA 2W60B 1HU8A 1N3NA 3V2AR 3SDDC 2J8OA 4G9FA 5AD0A 2VN4A 3CVIH 2Y0CA 1NAML 2FNBA 1AQKH 2NDFA 4AEIL 2Y69B 1S5HA 2VYRE 4NQTA 1KQGB 3M0AA 2WGNB 2BNQD 1AQDB 5DDHA 1SQQE 2KT6A 1CIDA 3TCXA 3BC9A 2ISDA 3UC0H 4HXAH 1NC4A 1RJYA 3BCCJ 1CF1A 1S2EA 2W9LA 4N8VB 3ZKMD 1OT2A 2YBRA 4WKZB 1NFDB 5E70A 5ES4B 5TDNB 1ND0A 2BEZF 4UB8H 5F9AC 2BVOA 3RJQB 3S36X 3BKMH 5ABDE 2C7FA 1D5MB 4NO0B 4Y19A 5ECJE 4LNVA 2OTKE 3UYPB 2OQJB 4MJ5B 5ACLA 5DSCA 3VNYA 5GGRY 2EVFA 3IFOA 2R9HD 4YXHL 1GS8A 2FLMA 1KPVA 1WS7A 4LSVH 3KPMB 1U93B 3V6FA 2Z92B 4N1HB 8FABB 2VMFA 3RVXD 4QWWC 2JLLA 4LAJH 2J6EA 5F1IB 3MV8E 4I3RL 4N8CL 2WNWA 1E79H 4K94C 3EUDA 4NBZB 4XC3H 1PG7X 1QPXA 2H0JA 4P2QD 4K0OA 4ZMXA 1U3YA 3SDAC 4ODSH 2DYPB 2EXWC 3LDBB 3LIZL 4Q7DA 4K3DL 4O2FA 1N7MH 1PU0A 5B3JF 5CAYB 3KYNA 2R0KH 4GIOA 4MAYB 5GZNC 1JFQH 1NEUA 5CKGA 5KW9H 2J56A 5EB9A 1BD2E 1Q9WA 4XMTA 3Q3DA 1T3FA 1Z3GL 2CZNA 4L4VE 4W93A 3AE6C 1KELL 3QUGA 4EUPB 4U3HA 2ZKMX 1MH5A 3PU7A 5T8IA 4HU8A 2Q7AA 1OSZA 3QFDA 3BQUC 1OVUA 4NKMA 4XE5B 5GRXG 1Z9PA 3WGUB 2Q8BH 3O2VL 4YDKL 2WXOA 1SM3H 2Y1AA 3BQUA 1CD0A 1NGPL 3VI3A 4X4MA 4ELME 1Z9OA 2NZ9D 1MSPA 2OAAA 4N25A 2KSJA 2R29L 4GOFA 1MCCA 4ZO9A 4YC2C 2B77A 4FYRA 5KLVG 1KORA 4N6JA 2OCFD 4BQ9A 2CLRB 2GI0A 3KJ4B 1WZLA 1QSEA 2P45B 4GKOA 4HCGA 3OW2O 1KN4H 2K4WA 3H1HE 3BAWA 3CMGA 5IHBA 3AS2A 3HC3L 4EIGB 3GINA 1J1DC 2JB5L 5EOCJ 4XH2A 5FYJE 1CFQA 2AEMA 5INCB 2XWBB 3VJ6B 1HHIB 1IC0A 1YC8A 1CDYA 4W9FC 2H3NB 1P2CB 5HGBB 1DBBL 4HPHA 2EDJA 1FLRH 3EJQA 2IPUK 4JPWL 5E00A 4KY1L 4QEGA 2DB8A 2EC9T 3STZB 3L4ZA 3JZ7A 4FQ1L 1FL6A 2X4QB 2Q8AL 2CU9A 3CFKA 2HG5A 4YDMA 4YMPA 1Z56A 4OLWL 2DQFA 4ZMDA 4FQXD 2FE0A 1J2JB 2JJTC 4QGTA 5DFWH 4G1EB 3CFUA 3UXFA 3QPKA 1LEKA 4L37B 5C0DA 1KEGL 4MA1C 2BRRL 3TFKC 3RPKA 3QXAA 1EAJA 5DK0B 1SJXA 1NC2D 3CXDH 2HPTA 3WKNA 1PS3A 3CFEB 2OMYA 3QQXA 3QI9B 4LFHD 3OLDA 4WV1B 4PY8J 1E27A 5HJ3B 2YAHA 1J8HA 2IANE 2BNQA 2EDYA 4GAGL 3TBBA 1CICC 2AJZA 5IVXA 1CWVA 2Z31C 3D12B 4ZAKC 5IFAH 1X7QB 1D7CA 5EBLA 3NPSB 3N91A 4NN6B 4LLQB 5AQ0A 3VTAA 5TFSH 5ITBL 3EFFB 3HZ3A 5IP4A 4EDWL 4S1RL 3FN0H 4TM9A 1EZLA 2ITCB 1LT9C 3FTYA 5F7AA 3TF4A 1T1ZA 1O5PA 2CPCA 4IM8A 1TJMA 3MNZB 5GHWL 1UXSA 1X9QA 2QFPA 1JJUA 4Y7OC 3CVHL 3K6OA 5GGUB 3QEHA 4OLUH 1G9ML 2VZ1A 1WGVA 5DUML 2VZTA 2ZOLB 4YSDA 3L08A 1ZVHA 1LE9B 1D7FA 3GIVA 1N67A 1RHHA 3NDZE 5FC9A 4X8CA 1FDMA 5AAPA 1DUZB 2YQ2A 4RLDA 4YHMH 3VFWA 2QE7H 2FWLB 5KTBA 2BC4B 4RX4D 1YQVL 1Y18B 1B3JA 5L8JB 2RQEA 4YHIB 2E4TA 1KV3A 3FCSB 1ZDQA 3OKKB 4LVEA 3TBWA 3W68A 1E8WA 1ZD6A 3BUDA 3WTSA 3N1FC 1SQVK 3T2OA 3WTTA 1AMYA 3R0NA 4ZUWA 2KUBA 1F4WL 2R23A 5D1XA 3T3PB 3TA3D 2GPZA 3WU2E 1F1GA 3NUKA 1MQKL 2AXJA 4K7PX 4EF3A 2NY5H 4OLWH 3WDJA 1RUPL 2ED6A 1R33A 1E4XH 3HS8A 2WKOA 2NY4B 4PRPA 5CZVH 5LAXB 1LO0H 2ARJQ 2A38A 4XAWH 2BNRD 1MPAH 1FPTH 3FWLA 2BSDA 4UMGA 4X2UA 1URQB 3BEWB 3SPJA 2CKBA 3G6JE 2FX7H 3AEBC 1E3ZA 3KW8A 2PCPA 4MXQD 4F33B 3IETA 1KB3A 2NXZC 3OR7A 4DZOA 4EKXA 3C6SA 3EBIA 1L0YA 1A7RH 2N1TD 2C3HA 1SQXD 4UIKH 1NDMA 4BCXA 1AHWA 1NMAH 3L13A 5GZOC 1U4EA 4PJBB 5D1ZA 3FYEB 2BVQA 1ETB1 1NL0L 1T1XA 1K4CB 3OLGA 3CK0H 4P5TB 2XA3A 2WNKA 3H1JD 1Z0MA 2F6AA 3KPQB 3SIKA 5KYXA 4LOFA 1FDOA 2Q1EA 4XMXA 1MQ8A 5JPMA 3ASWA 4U49A 3OAYH 4P4KD 3B37A 5I8EA 4JCLA 2KZWA 5FYLH 4X6CE 3SPCA 2DWEA 2P24B 3S37L 2G3NA 1KCLA 4MCMA 2LT9A 3MRDB 1EDQA 2ICWI 1TZGL 3OKLB 1NKOA 4QF1B 3D85A 4YSSA 4PRAB 1TZHA 2VITA 2YFOA 5GRWA 4H13B 1SJEA 5AOKA 1FAVA 1RF0C 2C4XA 5HHNB 2DS4A 3VXUD 1GGYA 1X4XA 1MJJA 4JHWL 2EH8H 4X7SH 1SQBG 3QHTC 5T5FL 1FO0B 4FN0A 5F1NB 2DWTA 2B3RA 4LU5L 1W6LA 1JY2P 1I85A 3U25A 2ZKWA 2MOVA 4ZDHA 3LCYA 2J20A 4XWGL 3ZLQC 2R5BA 5DHMC 3BCCD 2R0LH 4JY4B 1FZKB 1JNLL 2VL5B 2W80C 3EOTH 1C5CH 4JZJC 5TK2A 2OYKA 3TNMB 3FOMB 3QO1B 3A21A 3VFNB 1TVHA 1O0VA 3O2WL 1AOZA 3LRLA 2RFXA 4MXWL 4CA4A 1FLTX 5JOPD 3ULUD 2WBJD 3Q1SH 1QTSA 1NTMJ 1QI5A 1OGPA 3WKML 2BVPA 3N40P 2P52A 2ZKYA 4HIJA 1QBLH 1J9TA 3VXUA 4Q9RH 2YZ1A 3WLBB 4KUZH 4TQPA 4M5ZH 1HZHH 1NWOA 5E03A 3UAEA 4DKAA 2X4PB 2F8IA 2ZYHA 3UZVA 2DL2A 4G9FB 4NXKA 2UXVA 3ZW3A 4QHUB 1BFVH 2VR5A 4X6FA 1AZRA 1TEFA 2ZWNA 4WUUE 4RVBA 2NRGA 3HC0A 1HCZA 3IE4A 2W6AA 5HYSB 4N8VA 1NCBH 3MFGB 3ULUL 4KX8A 2WD0A 2HFEB 1QUNB 4AEFA 5IVNA 3WUTA 4XO5A 4N8CH 4GT0A 3NRPA 1GYWA 1E9PA 3GRBA 3H8NA 3T97A 3PP3H 2ADGA 4AGMA 3TEZA 3HFML 1TQBC 4JYCA 1K9TA 1URQD 3IXTB 5I66A 4X9YA 2OKMA 3NOIA 4NPJA 1SHMA 4R96B 2BY1A 2CAKA 3DXAE 2DLTA 3LDBC 1W6WA 2GB2A 5ESAA 1AH1A 3RGVD 3ZDXE 2NX5D 3T65B 4KK8C 2HKHH 4YXKH 8FABA 1KJ2L 4QY8A 3DUSA 2A9MH 1LTJA 2P10A 4OQTH 2NTSP 1TTAA 3SWKA 4WJ5B 4Z0XB 1JN6B 1JZ6A 4EVNA 1VAHA 3QORD 4JY5L 3VMOA 1F4YH 1YUHB 2WIIA 4YWGH 3ZE0B 1WIOA 1XR9B 2GJZA 5DVNA 3K5RA 4CVXA 3HBQA 2IH3B 3GO1L 3BZFA 5GS0C 1NGMB 4JBZA 1VQ6P 1E43A 3WJMA 2DYPA 4IBWA 5D4HA 4X6CA 3RY6C 4Q9RL 2DWSA 4MD4A 5FO7B 2CIKB 3RWDA 3ZYZA 1IKNA 5AVTB 1QD0A 5JXAH 4M6MH 2C9XA 3MRRA 3ZUNC 2HRPL 4HIIB 2QKIC 1UM5H 1J1OL 4QRSB 1F3RB 3JWDH 15C8L 4EDFA 1G4MA 1Q9WB 2Z8RA 4UB6H 2GBVA 5DJZA 3QNFA 3MXWH 1ZT4A 3BDYH 4BXSV 4YHZL 2PYFB 3HB3B 3H9SE 3CI9A 1CZQA 4RMTA 2JKLA 3EDKA 5C0RL 3MO1A 3E7JA 3SJVD 5HHVL 4E9XA 4XNYL 2OYIC 1Z6JT 1EMTH 4CVWA 3GXPA 1SVZA 1UOKA 3TO4C 1N8RQ 5I75B 3N40F 2ZYGA 2ADJA 3ILQC 2WJ7A 2RCSL 1OW0C 2XVLA 5J4MA 4N2MA 3CWBE 5JOFB 3ZY7A 3GKWH 2VAAA 1Q8MA 2AK4D 4X5LA 1BZEA 3GIZL 4GAYA 1M56D 4IBZA 5D2LE 5IV2B 4G6KL 1JXFA 3G6JA 4ODXB 5FDWA 1R3KA 4JZJA 4X98B 3APMA 3QHZL 5IBTH 3BAXA 2XKUA 5E2VL 3F83A 5TDNA 1KGWA 2C9PA 2PCFB 3MC0A 3AADB 3VWKD 1PZ5B 4XC1H 2TSBA 2YS4A 5JPNA 1FDLL 2XRAH 1DD4A 2KI6A 3BMVA 5DSCB 3SQOL 2DQHH 3TJHD 5KAFE 2BSCA 3G5ZA 4OCNC 4RDBA 1YIJP 3D8MA 4CMHC 2CPBA 1COBA 1JG9A 2ZYSA 3GI8L 4QKXB 5DJTB 3I74A 5DMIH 2Z92A 4OUUA 1WA2X 1KC5H 3I50L 4PR5A 3P9WB 3I9GL 1CLCA 1UATA 2P3YA 1KB9H 1YY9C 3RQ3A 3VTTA 2Y5TA 2R27A 4WO4D 4FNSA 1U3HA 4HGWB 1B0GA 4N90D 1MZYA 1H3TA 5KYYB 3F5HA 1AJ7H 1HHKA 4L37A 3JCUE 3W81A 5HHQB 4JDZB 2WUBH 3SEPA 2IDTA 1ZMEC 3BYTA 4IOIH 1FOSF 1ILSA 1ORQB 2OR9H 1Q7YQ 2LGNA 3AT8A 3MBEB 5J3HC 4JFYA 4P9MH 1E4HA 2H8PA 3D52A 4LZKA 5HHPA 1FZMA 1NFKA 2E9GA 2YD9A 3FQWA 1A6WH 2ZCHH 4QHNA 3ZIMA 2Q8AH 2OSXA 2UY6B 3HRZC 3Q3GA 4CU8A 5CP3A 4XO8A 4CVZB 1QRNE 4A7UA 1JNNL 4EXPX 1KB5H 4Z78B 3FYIB 3RUGE 4KK5D 2PP7A 5H35A 2HP4A 3V4PA 3LD8C 1JMMA 1JWUB 3BQUB 2Y7SA 1FBIL 3T04D 4F8LA 2UZYB 3GHGA 3LSOB 2NSMA 4CSPA 1CDGA 1HEHC 4S11A 2B59A 1V3MA 3TPUB 5PCYA 5I8CA 2LV4A 3EHBC 4DGVL 1KWGA 3D39D 2IQ9H 4IBUA 3U0PA 3H6PA 1C7SA 5D71H 2WXQA 4L3EB 4OFKA 4OKVA 4UNUA 1CFTA 1VDFA 4NYLB 1S7WB 3V0GA 3PHOA 2ESVA 1ESOA 4HPYL 1VF5D 2NXYC 2AJSH 4UB0L 2YOAA 5KVEE 3G04B 4GFTB 5FO9B 1JGEA 4ZO7A 3H1ZA 4P4KB 4QXWA 3OPZH 2LTQC 1JIBA 1MIMH 1TETH 2FJFA 3MGTB 4F9LC 1UFGA 1X4YA 4BSJA 5J89A 5D1QB 2X4UB 4AUJA 4LLUA 1G9NC 4ONFL 1A6AB 4HUXB 3NMEA 3ARGC 3GUTA 4Q6IA 1XGTB 3L1FA 5IROA 4MGXA 3WIIL 1ZA3B 3TEWA 2F53E 2QG4A 3CCLP 1B6DA 3FW6A 4NKDB 2D7OA 3OR7B 2HH0H 1SQPJ 3IFNL 1G4RA 5MP6H 1BWWA 2X4NB 2ADIA 1YJNP 2K8QA 5F2FA 2XJLA 1RF1C 5KVFH 1P84K 2BNQB 3BSGA 2AQ1A 4HF5L 4RMWA 4QRAA 1L0LG 1WYJA 2HMIC 4HX1A 2P8LA 3ABZA 3KPQA 5KYXB 5KBDA 4MLSA 5I82A 1DX7A 5CU9A 3X3GH 2XFXA 4MMZA 2XX0A 2C9NY 3X14A 1UYWH 3UPCA 4P9HH 1L9OA 3WTVA 4PUBL 4ERSL 4ASVA 3QFGA 1P7KB 2CK2A 2E74D 1EBPA 3D33A 4R9HA 4W70A 2PRRA 4PLJD 1T4KB 1GIGL 1UXSB 3BQVA 2R3CA 4F7PB 1QACA 1NGQL 2FL5B 4PW3A 4CKVX 1QQDA 4XP1L 4NRXB 3RWIB 3KHOA 3UC0L 2AEFA 1T2XA 3QAZB 4JEGB 4P48A 3US1A 5C6TH 1KYUA 3GF3A 3MA9H 1FNLA 2ETWA 2ZOLA 1CO1A 4M48L 1CLVA 3ESVF 1MJJB 1KILD 3SE8H 1UGKA 3L4VA 3IMTA 2DBLL 1FDIA 3NRQA 4ABVA 4OGYL 2GJ6A 2VDOH 4YZWA 2V5MA 3O2VH 2HR3A 2VABB 3HLAB 1IC4L 3A6OA 1V7NL 4UT7L 5C39A 4MJJA 5CP7B 3UYRH 1KULA 4BH8A 3DJZA 3FCSA 3MLWL 3OKKA 3PABA 1VQ9P 1PG7L 4JY4A 2CBPA 2EADA 4P5MA 5C2BL 3OMAB 3RFRA 1NUNB 5HYQA 2KLTA 1UCTA 2WP3O 4MLIA 5IQNA 3TNMA 5GGVH 3LH2L 5IJKC 5E8DH 1YMHB 4Y8AA 2Z5IA 4J8RB 3U4AA 3RK3E 1VQ4P 5DD3H 1T5XB 2Q3AA 4QRRA 5LXGL 4KVPA 3L71G 5FYJH 2F1BA 2I60H 2BCCD 2YRBA 5BOJA 4B50A 5B38A 1N64H 4HIJB 5LN4A 4W9IC 3BCCE 1YHQP 3AEDC 2ITDA 2NNAB 2VWEC 3GYRA 4J2QA 2FSDA 5I18L 1PZDA 4AM0B 3NAAH 1IE4A 1W0YT 4HQQH 2BO0A 4XCCL 1E7VA 2MQCA 1DDTA 3W9DB 2Y9YA 4LEBA 4YN3A 2GVYA 3ZIYA 3ZDMA 4I9WD 4X6CF 4JO5A 1E0OB 5IFHH 4POZC 5HDOA 3SDXE 3IGFA 3QA3A 2FJUB 2QSCL 2F74A 1OXYA 3M7OA 5GZNA 3CHPA 5T1LA 3QZWG 2HZHA 2R2EB 3UBXA 4R96A 4AG4L 4R4FL 1SMDA 3D06A 4NDMB 1NTZG 5E8OA 2NOYA 3LS4H 2OMUB 4GSRA 2QL1A 5CGMA 4PCSA 2G8YA 3DI2B 5F6HJ 3KLDA 2GKIA 3X3FH 2CLVA 2DKUA 4D9RE 2YEZB 1NINA 4BFBD 1A3RH 3QPQD 3MRHB 4NQDA 2WSCH 2W0LA 2BX5A 3D2UD 1E90A 5E8NA 1NCBL 2K9YA 4G6ML 2MTAA 1A1MA 4O5LH 4FE9A 4X6BA 4YHNA 3EO9H 1EHKB 2E7MA 5EU6B 3WUZA 3X12B 1MJ8H 2IH3A 3RHWK 3PL6C 1BFVL 2I60L 3N6YA 3HMWH 1E9OA 4M5YH 4GUQA 3OV6A 2F54D 4G8GD 4I0KA 5EH1A 3K6IA 3PHSA 3ZRSA 1KGXA 3TBYA 5DRXA 5F96H 4AMXA 1J5IA 1KBGH 2DOCA 2P8MB 3IPEA 2NX5B 5M94B 3VWKB 2N9YB 1MWAA 4PD4J 1M42A 1RZQA 4JM2F 1XGQA 3L48A 4LPYA 5F7KC 4WVZA 5DJZB 2H2PC 1OARH 3WS3A 4L48A 2AK4A 1MHPH 1QASA 4EEEA 3UTSB 3WN5C 3NVQA 1LK2B 2VDRL 4YHLL 1S5LH 1H0TB 3CAFA 3LRKA 3NDYE 4ESKA 4JM2A 1CQKA 2B1HH 4C4KO 2EDDA 1QSEE 4G42A 2JSFA 2O93L 2AK1H 3NIGF 3B43A 1FL3A 2DYRB 3KBEA 3WU2H 3SBPA 2BFVH 4FEIA 3RGBA 3EGXA 4N2FA 2ZXBA 1DR9A 3GJFB 3OXRB 1ZHBA 2R56H 1XMEB 3U1CA 3S4SA 1BE3D 4X6FB 1ECZA 3FQYA 4BK5A 1OL0A 1NQBA 3H2WA 3HC0B 4GQ9H 4P23A 1BGXH 1WEJH 2J8UE 3AABA 1RZ7H 2E59A 2WAHA 2V8MA 4MA1B 1G2CA 4CU7A 4AVIA 4DQOL 3G9AB 3VX0A 3WFHB 5IM7B 5KSBF 1HJCA 4BELD 3C5ZB 2ENYA 4U7MA 3FUFA 1WBXA 3LZRA 1NFDF 4HSAC 5DWUL 4PIRF 3T5WA 1X5JA 2V7NB 2HRLA 3GD1C 4J3OF 4OTXH 2HN7A 3KYMA 4JUSA 3H1LE 2Z35A 3IGAB 3NH7L 4JG1L 2LVCA 2HH0L 5AW2B 2ZP9A 4GUCA 4P2OD 2FIKB 4HPOH 4QY8B 1QG3A 4LLDA 4AVJA 2A4CA 4WJ5A 1EMTL 5KVMC 4B3EA 3BW9B 4ZTOH 3EW3B 1TITA 5C0EA 3R4DA 4FS0A 2O01H 2D2CD 3VMAA 3CPLA 4L1BA 1J1EC 1UKSA 2ZXAA 1IAKB 3O2DL 4QI3A 5J8OA 1AMXA 4XVSH 1IKFH 1NBZA 3VGEA 1USZA 5ENWB 4C83A 4HD9A 5BRZA 3FQTB 2PMZA 4HIIA 2MPAH 4U1IB 2V17H 3VYOA 1YRKA 4D0BA 1OPGL 4PTTA 4ECNA 5IWLA 3WUUA 1CG9A 5HI5D 4AX3A 4KNQA 1Z9MA 1YQ3C 2JKXA 2UY6A 1BHGA 2ZG2A 3Q3GB 3QJVB 2RQ8A 4JRXB 4YHPA 2ZCLL 3JBG7 3T3MB 7FABL 1IFJA 4N26A 4IMLB 2YEVB 1GK6A 1JFHA 1RPUA 4ZMQA 4K4KA 2R44A 1UXMA 3QNZB 1Q94B 5J11C 1SGKA 2F5AH 5T1LD 4Y2LA 3B2XA 4U6VH 2CO3A 3GPEA 5EWIL 4ZXBC 1W72H 1DBAH 1MFBL 3S2AA 2QSTA 1F1AA 5D8JL 4YHKL 4Q9QL 1E4KC 5I1EH 1IGYB 3GSXB 5DD5L 1ACYL 2YKKA 3TPUA 5I19L 3LEXA 3F5WA 3BIBX 5J9PA 4JG1H 1W72B 4MCNA 1FH5L 1CVRA 5DUMH 1S7UB 2ZSWA 1H8OA 4U6YB 5T5FA 2H6PB 1AQTA 1FGVH 4XPAH 3CLWA 1BM3H 3DOSA 3BHBA 5AKRA 4AIEA 1VLXA 3VOPA 4Z18A 1ZCRA 1SQPK 1PZSA 3V0WL 4AQ1A 1R24B 2ZWYA 1AO7D 1BBDL 2V5YA 1MCLA 2YRZA 5KLVJ 4JM4L 3DUUA 3CVHB 5C0CE 1EDYA 4K73A 2FJFB 3GHBL 1RURH 2JO1A 3P4OB 4K94L 1ZLUK 1A0QH 1QX1A 2VERA 5HGGS 3VFRA 1NJ9B 5LG1A 2YJLA 1E8ZA 1WFNA 3PPSA 4Z5RA 2XA8L 5I5RA 4HJ1A 3TV3H 2VXSL 3MLXL 3FQXB 5EC1B 5DD0L 3RVWD 3S5YA 1M7IB 3IS1X 1JUFA 1Q9KB 1JTHA 3HUJF 3KNBB 3HNTL 1P69B 4YLBA 4ONGL 3CG8A 1QBML 3ZT6A 1WZ1L 2C9UA 2JK5B 2O5YL 1INEH 5ISZE 4UTBA 2X4NA 4BKSC 1JTOA 1BE3J 2H8PB 3P54A 5GSRA 4PRBA 4Z7OB 3CCHB 2O6CA 2ZYDA 2QGEA 3P30H 4K5NA 5IEKB 3POHA 4YNYA 3TEYA 4OIIH 4NPFX 4ZPTB 1AS7A 1JTPA 3CL3D 3S6CA 4HEME 3RUGA 4HWZB 1T5WB 2X89D 4ALAC 2IZ1A 1SLXA 3HKZA 3GMPB 2X41A 4BKTC 1UASA 4NWTH 3VI4E 3QPXH 1JYVA 5KBMA 1CFVL 5HD8C 1JF1A 4UB6E 2P4AB 5CLXA 4Y5XC 5FUCC 1KCBA 5ADOH 1MRCH 3LQZB 3A24A 1OOWA 4ICXA 3KPTA 1NAYA 2WINB 3PV6B 2I26N 2NRDA 4PV1C 3RZWA 5AW4B 2APTA 1UT1A 3B9KC 5DGQA 3NIFB 2EDBA 2A45H 1VQ5P 2AP2A 2VLMD 5AVXB 1P7QB 3KEHA 5IHUH 1OP5K 3P2DA 3U0PB 3E8UL 3X2QB 2WSFH 1UUSA 3GMQB 3EDDA 4XMLH 5HVWA 1E6JH 4B97A 1JPTL 3A0HH 1NCOA 3MXWL 1KUMA 1NTME 1XCTB 4HUVB 4HLZG 2E74B 4UBDD 2WXHA 3BRFA 2Z91A 3KW7A 4FQIL 1KFMA 2CA4A 3PP4L 5SWZB 3DDGA 3ZMNA 5E8EA 2OL3H 4OZHE 2CO7A 3UTQA 1UUNA 1T5XA 4WKXA 2P5EA 4WFHE 3ZKND 4L9DA 2DEWX 4G6JL 1M2VB 2FXOA 3PQYA 3CHSA 3N85H 4J3VA 5KAFH 4POYA 5C0BE 1F6AA 1Q9LB 5JHMA 4MNHA 2KLSA 2R83A 4HT1H 1ZA3A 2E75C 3KM2A 1T7VA 2R2BA 5L4JA 4PRNA 3OAUL 4UDUB 5CJ8A 4OH2A 4W9ZA 6CGTA 2UWEB 2A1WH 3KCPB 1V7NH 4O51B 4M61A 4UT7H 2FRGP 3W9DA 3PP3K 3D0LB 4LEOA 3QDJE 3GLMA 3GEWB 1YPZB 1BDYA 3CZNA 3STLB 2IFGA 4Z7WE 2DJUA 3MLZH 2Y6SD 1HK6A 2O6PA 2PP8A 3U36A 1IM9A 3BKJL 2DBLH 5C0ND 1OQOA 1UA6L 4B9KC 3D6GA 2H3XC 3L7FA 1Y0LB 4IRSB 1FFOA 1YPZF 4XBEL 4DO5A 4NDMA 4ZNCD 3GSVA 2A99A 5BXFB 5BVJA 1BIIA 3N0AA 4BYHA 1JDDA 2F7IA 2WVUA 2XZQH 1P7KA 4N4YB 1G87A 3QWRA 1S7XA 8PAZA 1R0AH 1PZQA 1KQFB 4Q6IC 4IFMA 2FO4A 5EA0H 3VDCA 2DYPD 5E8NB 4Y9EA 4L8DB 3UDWC 2HJKA 4WNQB 4BH7B 2YMKA 4U6HA 5GRZA 2X44D 3LIZA 4HXBL 2I9LA 2FJGA 2OW6A 5D96C 4R7VA 2UY7A 3TV3L 1G7QB 1G1IA 2XA8H 1KILB 3DHMA 4Q56A 1T6BX 4UQ9A 2HG5D 3C60D 4YQXL 2FBRA 4XAKD 4HH9A 3RWFA 4IJTA 5A16A 4LASL 5CJQL 5LGYA 1MWAB 3KS0H 1G7LA 3TWCH 3WIIH 4KGJA 5ICZA 3WS3B 1KN7A 2QJPB 2AK4B 1EGJL 4KDWA 4NJ9H 2B0SL 1XV8A 2CCVA 3U9PH 1RUQL 4DPCX 1YVLA 2XPYA 3VD3A 1IEBA 4K5LA 3EH3B 1DUYB 5DQJB 5CLYA 3IGKA 1CICD 4JDVA 4U1HB 2QQLH 2HFTA 1RE4A 1MIEL 4ZO6A 4Z0BH 3QR1A 1YYLL 1OLZA 2FD6H 5I17A 5BW7A 4JCMA 3TYFA 2BSTA 2AJSL 3PJSA 4IL6H 3F12A 4K7PH 4PJ6A 4UB0H 5EOCH 4ADIA 3Q2LA 4U1KB 4X7DC 5BOZG 1R3JA 1L4AD 1FNHA 1AXSA 4IHOA 4L8SB 4R83A 4PJAF 2XG5A 4A37A 3MGNA 3AE7C 3UC2A 5B8CB 3MMEA 4JHZA 5GGTA 2EE2A 3H1LD 2CR3A 2D8KA 3LKOA 1BFTA 4U4BA 3IPFA 4I6MC 6FABL 2LXCB 4K3AA 1RPQA 4KGLA 3KDMA 4DGWC 4JO3H 1S4XA 4OY9A 5G5DB 3LKQA 4ABUA 2IG2H 4D7PA 1L3NA 4XCNB 1IBGH 2CHXA 1TR7A 4JGMA 4PJXE 2ZFCA 4YUEH 3QUXD 1G9HA 4F2MB 2CHDA 1VPOH 1YBKA 4LSPL 1OWAA 4ZKPA 5BJTB 4N0CD 3HI6L 5D2LF 3TL5A 5AG9A 1AZBA 5KVFE 3PWPE 4PJFF 4X80L 5APXA 3SSUA 2W5PA 1L0NE 4RJTA 4KKQA 4KVNH 3TF7C 1P7QD 3RWHA 4QRTA 4X8JA 3GKZA 5DUJA 1FRGL 4GAJH 4NQDB 2LVEA 5TPWH 4C7NB 2V9UA 4MJIA 5DTFB 3MRGA 3FF7A 3EYUH 3MHVA 3BPCA 3QJSB 2XQYG 5KUKA 1KFGA 4Z3FA 3VXNA 1EAPA 4OV5A 2R15A 5IY5B 3JYCA 4JFXA 1HSAB 4GRLA 5KSAA 2JH2A 1WA1X 4LNRB 2JNZA 3HD7C 2NY5L 4G43A 2QGBA 3L4YA 2YUXA 3A67L 5E56A 1MHCA 3OHXA 2WUBL 3H1KG 4JL1A 5CP3H 2NX5A 2K9FB 1MI5E 3FQUB 3OQ3B 2VIRB 4UQBA 5KANI 1SY6A 4X7TA 3KXFD 2BH0A 5E4EC 3I5CA 2FLBT 4UNTA 5JXEA 4JRXA 4OTXL 5HHOA 3P0YL 5CN2A 3O6FC 4IMLA 5I1LB 2JTDA 2PPFA 4GNKB 4E5XB 3B5TA 5DU7A 2I85A 2AQNA 5IHWA 1IQWL 3THMH 1TNNA 1XVSA 4NQUA 1S7RB 4O2EA 3J2PA 4E41A 4A2FA 3BVUA 3B2MA 1KD1Q 1BOGA 2NXYD 1U57A 2DKSA 4R2GB 3EH4B 4XVOA 4XZUA 3SQOH 3G4SP 1GAFL 4PJFA 3TO4A 2AXWA 1LNUB 2IPPA 4PTUB 1EEQA 4JB9H 3F5WB 3RTLA 2QT6A 4JFFD 1MKFA 2KQMA 4WWKA 3L95A 2AJ3A 2X4TA 1WCQA 1YN7B 1REIA 4JE4B 2ZSWB 4NN7C 5EU5A 4O58L 4QNPF 4ZUTB 3DOSB 2K3TA 1MJUL 3BD5A 3WFHA 4AM0Q 2HTLD 2I24N 3ZDZB 3H9SA 1TCRA 4FF9A 4YZFE 3EO0B 4BSVB 1LTBC 4G80B 1C08B 5J6GB 2V7NA 1WD8A 3DTXB 2K4AA 4MNQA 4JO8A 1QSFA 3LRMA 3RI5K 1ITBB 1HL4A 5FKAA 1VQLP 2X6AA 1WPCA 2P47B 4GKLA 4XNYH 1DL7H 4L4TA 1JB0J 4OIAA 4PWFA 1B4JL 2BNUA 1K3ZA 1P53A 2VDML 3AZUA 1NJ9A 1SXNA 5IB5B 3S3BB 4JRYB 4TSAL 2YK1L 4TVUA 1FVCA 1HE8A 1KB5B 3HUJE 5C0CA 4TVPH 2A74C 2XICA 1KZUB 4H8UA 4K5PA 5CBNA 4X5XA 2F15A 2Q7YA 2BWDA 2VO8A 2FR4A 1B2YA 3D69B 3H9HA 1VESA 4UU9B 4FQLH 1U8JA 1EO5A 1V7ML 2JK5A 2NY1D 1ES0A 2XNXA 2HT4D 1R3HB 4OGYH 2XZRA 3EF4A 3CMOH 3D39E 3FQTA 3WUWB 2WT7A 5E08H 4UT6A 1HDMB 4K7FB 4H8WL 1Y1UA 1X5KA 3E1F1 1BAFL 3TGUJ 2VJXA 2W92A 3BGMA 5C6TL 4TUKL 1T6VN 3H4FA 5E2UH 4MHHG 4YBLC 3ZQWA 1NLDL 4IL6X 2P80D 1C1EH 3O3DA 1EO7A 1UZ8A 4JJOA 2CGRL 1LHZA 1Q94A 5F7FA 2B89A 3S37X 3SGKC 2HX8A 5H8DA 5IBLD 2OMTB 2EE6A 3WFDL 2VM3A 1JF1B 3O9WA 1ZRTE 3VFUB 5IKCB 2FYUG 3EYSL 5K9QI 2XN0A 1QFUL 4RESB 1S9KC 1UD3A 3HE6A 2G5BB 3NIDF 4LC1A 1G5AA 4OD3H 3SY0A 4NPEA 3AITA 4HS6B 4OCYL 5EU7E 1HYSC 2P49B 3QSKB 4HV8A 1S7UA 2MNJB 3L16A 1ZXGA 2C1PA 3MVSA 3FQRB 4IIQC 1CXFA 1FYTB 1S7VA 2XPZA 3BVTA 4H8QA 5I1AB 5D7IB 3LPWA 3AE4C 2KHAA 1ACXA 1KIPA 1ZA6B 2JKSA 2P80A 35C8H 3DO4A 4JO1L 1XCTA 3ARBB 4HUVA 3KPOB 3T6ZA 4XN1A 2ATPB 2P5WD 3IDXL 2WC7A 4E9YA 2Z91B 2VLLA 1YQ4C 1R24A 3Q1EA 4WI8A 4BSWB 1U8PA 1FN4A 4XI5C 1EVUA 1H3GA 1VADB 5A6MA 4BHUA 1NGWA 4O4YL 3U46B 2CG9X 3QHFH 3C5SB 3SYOA 3H1JE 2WPRA 1GCYA 1QTPA 4Z3TA 5EBWA 3WKQA 1AACA 3ULVD 4J3OC 1HKLH 1CGXA 3FTSA 1DQQA 4PWKA 4RISH 5EC1A 4NZRH 2GY7B 1BA9A 1JZ7A 2R2BB 4GW4B 4ATWA 5JNYA 2OYHC 3R7RA 1E65A 3V5BA 2UWEA 5J0BA 4PWGA 3VWJA 2CLZB 2X4OB 4M00A 1NGQH 1PGPA 2PABA 2WO4A 2IG2L 5IEKA 1SQ2N 2VDLL 1II4E 2ID5A 3SE4A 5K39B 1S78C 1VA9A 2FVNA 2ZWZA 1H3PH 4MD0B 3S3JA 3BP4B 2BERA 3L73D 5IW6B 2WBJB 5BXFA 1IO4A 3REVA 1MDAA 2EXWD 2B5IC 2OW7A 4DOHB 5HGDB 1XGZA 3IFLH 4FYQA 2E8ZA 3OJ2C 3U7YL 4RGND 4Y99B 3G5YA 3W9EA 2BJML 5FDYA 3I02A 4PPTA 2BS9A 3UAAA 3LQZA 3QCTH 1I8LC 4NERA 3O81A 3P1VA 1SMAA 4ZS7L 3QUMB 3VU2A 3HMXL 3ZPDA 4DUXA 1FFPB 5GS0H 5KS9A 1KB9D 4BH7A 4ZQKB 3UIAA 1Q38A 3ABGA 3AT9A 3C09C 1DEDA 1AI1L 5CO1A 4E41E 1IBZA 2AK4E 1UJ3A 4QRFA 4ZZKA 1UVQA 3ZSSA 3BZ4B 4ZO8A 1ET8A 4PGBB 2CMRL 3H32B 1FNGB 5F9OL 1LWUC 1C5BL 1JRHI 1LT9B 1NDGB 3QUZB 5JW4N 1F8TL 3H1HG 1IBDA 1TQUA 1IFHH 5CJ4A 2OTWA 4N6RB 1G9MC 3O4OC 4FERA 3D18B 3DPBA 2A6DA 3I6LD 3TSIA 4Q4EA 5JQHC 1S5IL 2DIBA 2VE6B 5DRZA 4HIEB 1BQHG 3K72B 5FW6A 1Z5LA 1O7SA 5B1JC 1KZYA 4FMFA 1JY3P 3A23A 4NIYE 4EDXA 1QYGH 2OR8A 1A7PL 2A83B 3LKNB 3O6KL 3F58H 3OKOB 4H2AA 4F5CA 3US9A 2XN2A 4ODTL 4CADB 4AVHA 3EYFB 2H2SD 4RBPH 4BGLA 1XH3B 2WZ6A 2ADFL 4WY4B 3H1JG 2ZX7A 3W0WD 5DMYA 1NTKK 1WIPA 2IAAC 1E42A 1MF2L 5EA0L 1RFDL 1SQQJ 3UROR 1NCAH 2RKLA 1W8NA 4PJEF 2HWZL 4ADGA 5KN5B 5CCGE 1Y6KR 1RQUA 4HS3B 1S5LX 3KPPB 5F7EH 5F7LB 3ZK0A 2B39A 2VB5A 1HXYB 4GS7B 2OSWA 5K9JL 3G6AB 2H1LM 5JUEH 1EEYB 1MWAH 4U33A 1L5GA 1QBMH 3MMEB 3VSQA 2BSRB 3VFSA 1L0LD 2P2UA 2AXGB 4TRPH 1GU5A 3LS5H 5IMOB 4OZ4A 1EK3A 4JO2L 5K5YA 2VRQA 2VDMB 4ZFQA 4HEMA 1BVKB 3DX2A 3GKWL 1KJVA 3COOA 3TH3T 3FAXA 2PWDA 4GSUA 4H25B 1N7LA 2YIUB 2PXYA 3D39A 4DKEL 3B7YA 2VLRE 2VSMB 4L3ED 5BJTA 2NY4D 2AJXL 3C12A 3TN0C 4NRYA 4AWJC 3OAUH 4XCEB 1CDCA 1A8JH 1JCCA 4NEHB 1NM4A 2W65A 1UM4L 2V4LA 3PP5A 3B4NA 1ZW0A 4O2CA 4HWBH 1ZOXA 4XR8C 5D1QC 1SFCA 1G5GA 5C0FB 2JELL 2Y07H 4LLYB 3MLUL 5C86A 3MRGB 3QFJD 1SQBD 3MROA 4AQEA 3CZEA 1JM0A 1DDHB 4GJTB 1SYVB 3DVGA 3EYQD 4HHGA 5TK4A 4YSEA 2FWUA 3S8GB 3H1HD 3ZRCC 3F58L 2Y3AA 4N0FA 1GTFA 1IGMH 1NTMK 2KPWA 2UY7B 1G7QA 1TDQA 1JV5A 3PWNA 1J1PH 2FUQA 5CILL 3TURA 2YWYA 2Y1YA 1A9VA 3F89A 4FQ2H 1OX3A 2ZUQB 1IVLA 5ANME 2YZ8A 4M29A 1KPRB 2OYLA 2Q5BA 3UJTH 1QPPA 5C70A 1NA8A 2YKLH 1E28B 2LU3A 4K8RH 3MV9D 2KOGA 5D9SA 1D5XA 3ILEA 3PY9A 5DQJA 1TEGA 4F9LA 4KKLD 4WUUB 2P58A 3GT6A 1U8CB 1FLRL 2VR9A 1JAEA 5C09D 4FYTA 4XODA 4EE2A 4PCTA 3LPGA 4JRLA 1JV2A 5LNGA 1HI6B 3SYCA 3VXOB 3EO9L 2MPAL 4NKOB 5ECGA 2E7BA 2FECL 1JY3N 4Z3JA 3WNNA 1G7JA 4I0CC 3LZFH 4IHOB 4JFFE 1FWXA 4L74A 4U1JB 3Q5SA 1YN7A 4AXWA 3H3PL 5BPPA 2WPQA 4YGAB 2HMID 2DQ6A 1SZNA 4P2QE 4JHAH 1S9VA 4OGXL 4Y4HD 4FABL 2Y06H 3UAJA 1NANH 2NY4C 4RAUB 5IMLA 1NH4A 4R4BB 4HD5A 1KIUB 2WB1A 4NZJA 4S1QL 5AKTA 1BCCE 3HC2A 5DJ0B 1RULL 4Y5YB 1M1KQ 2X2JA 5T3ZD 1ZY9A 5EC2A 3L9BA 1VGKB 1IUZA 1LO2H 2FYNC 4JO1H 3MRIA 3VXSA 4ZX3A 3E7KA 1OZHA 4RH4A 4UQ3A 4D3CL 2EILB 4N2NA 3M0DC 4J3XA 3ZTCC 3EJSA 3W2DL 1BSIA 1G9NH 5CEZD 2FH6A 5GS0D 3GMMB 4YAQB 3IKCB 4GAAA 2D7TH 5TQ0H 1R17A 4KNSA 4KTDH 3A6BL 2Y7NA 5C0BA 3UADA 5BV7L 2FYVA 5FYLE 2YD7A 2BIPA 3BDBA 3OC5A 2BSSB 2EEXA 4QLWA 1I8UA 4K3JL 3T0EC 5L0QC 2LTQB 3GEFA 3BP6A 3PF2A 2X1XR 5E2WH 4RIRA 1T21A 4K35A 4JM4H 2Z6FA 3TYGL 3FSOA 4ODVL 4KK8D 3WLWC 1HHJB 2QJDA 1KBWA 1GOHA 1URLA 1WFTA 5SWQB 3DHUA 3HJ0A 5F8QC 3KPRD 1HH0A 1LQSR 4B9YA 2J55A 3TVMC 4S1DC 1KCRH 4UT9A 4KPHL 1GYVA 3BD3A 3OR6B 3UTTA 3BGMB 4W6WB 4YDIL 5HHOB 2JJLA 3NFSH 4R4NC 3R1GH 1KGUA 1MRDL 1YMME 4M8QB 4HHWA 3WS6C 3FFCE 4XGZB 4H20H 2ZUYA 3SDXF 2GJJA 3BFWA 5CUSH 2FO8A 5IKCA 5A2JH 3B8EB 2O1AA 4U7JA 3RL2A 5JIMA 5APTA 2IYOA 3KAAA 4MCZA 1PYWA 3GXFA 4MFHA 3IVKA 2V9RA 5I6LA 1KXTB 2IDUA 4JW3A 5FM4A 2OQJA 1XD0A 4D7BA 1N12A 4UNVA 5MI0C 2CRYA 3M17A 4MMXC 4RX4A 3ZTJH 3GJFH 5D7IA 1BDDA 3WEXB 1NM9A 3AY4A 4YSRA 2D2CB 2F8VA 5L8RJ 5EU3A 5F3FA 5SV4A 3PWVA 4GKNA 4KI5E 3EO0A 3OAYK 3R18A 2ALAA 4LLVB 3P3YA 3JZYA 3LHPH 2RGSA 1IVTA 3NG5A 1C08A 1BJMA 2Y3NA 5F1IA 5DI8A 3MRPA 3MCLL 5FKAB 4BFEA 4DPAX 3NT0A 4AEIH 2B14A 3GM0A 3BQUD 1GZLA 5I15L 2DRUA 2DIJA 5J11B 2R7EA 4KK6C 3L3HB 3BSZA 4FJ6A 2AXCA 1GJUA 2VKXA 1AIFB 4W9GC 4LCWA 1AQHA 1PP9E 1JI2A 2K37A 1KB5A 5DHVA 4B96A 3KYNB 5C0NC 3WIHA 4D0CB 3CHXA 2WWMD 3MLVH 2QDWA 2VDOB 3GZOA 4APQC 1FSKB 4G8FB 2Z5HA 1I1CA 4BRYA 2ZNWA 3WMM0 2OTLP 1JGUL 2DH2A 3ILDA 3K5SA 1X5HA 2EYRA 1WK0A 4LHQB 4NCC1 2BIHA 3EBGA 1I1AB 4Z6AT 1R3HA 4Z7QB 5IGXH 3MTRA 3NAAL 1SQPG 1ML0A 5D1ZD 3NN8B 1NTKJ 5TH2B 1HL9A 3FT0A 2DQCL 5H4ZA 5I71C 3HI5H 4LP5A 3HAEG 1BD2B 1W15A 5FHBL 3MBWB 5DHDA 3RK2C 5FOJA 3V52L 2VLKB 1WE5A 3C5JB 4NT6A 1RUPH 1JY3O 1UZ8B 1RSFA 4APQA 3CHQA 2KK7A 2W88A 4HJGB 4WU7B 4PWHA 3O9WB 1PIXA 2O01N 1QSEB 4NPDA 4PJ8D 2K3HA 1SLWA 1NMCC 3FAWA 4X83A 5TFSL 2CIIB 3AECC 3GMRA 3QDJB 3P9LB 4AH2B 4OGQC 1U95B 2LKMA 1EHLL 2V2WA 5DMJB 4HOZA 1PMYA 4HW6A 3SYPA 2FX8H 2LABA 4PVLA 3VDBA 1XF5B 3I3BA 2EDQA 2FT8A 3UYRL 3V6ZB 4DT2A 4ZMOA 4M9OA 1T0MB 3WNJA 1UEYA 5F0MB 1FIEA 1H3UA 1FPTL 3CDGA 3NQIA 2W94A 4M48H 4M6NL 5JIDA 3ROOA 1VEOA 1MAMH 4N6RA 2E3VA 1VEPA 5MHSE 2WKLA 3DPBB 3DROA 5EO9B 3JTTA 2FYUJ 2W0FB 1SY6L 3OZ9L 3P73A 2R4RL 5DHXB 4OGQD 4IEFB 4R2GD 2YKPA 3BGAA 4G9FE 3UERA 4DEPC 4G70B 3B9DA 3NFPB 3WNPA 3AG4B 4EDWH 1NGWB 1SFDA 4P9ML 2GBTA 2X28A 4PG2C 3F6IA 5DZVA 4CADA 2A0LD 3PFUA 5DRNB 3DK2A 5BS0E 3HI5L 4RFNC 2FEEI 3R19A 2F58H 4NNYB 4XP5H 1WD9A 4OLVH 2ICEA 2XNDH 1OE1A 5I71B 4LKXB 1J8HB 4DTGL 4I1PA 1MFDL 4CBZA