2KYVA

Hybrid solution and solid-state nmr structure ensemble of phospholamban pentamer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
52
structure length
52
Chain Sequence
MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural topology of phospholamban pentamer in lipid bilayers by a hybrid solution and solid-state NMR method.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
molecule keywords Phospholamban
total genus 19
structure length 52
sequence length 52
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2kyvA00
2KYVA 2HYNA 1N7LA 1FJKA 1FJPA 2KB7P 1ZLLA 2M3BA
chains in the Genus database with same CATH superfamily
1IK7A 1RQVA 1N7SA 4PD4H 1PZQA 3V2NA 3G3ZA 3P8MC 5APWA 1KYOE 3H1HD 4H13B 1BGYD 4H44D 5CBNA 3SWFA 2ZT9D 3CC4P 3ABVC 1UIXA 2IFMA 3H1JD 1URQD 3PP5A 2P10A 2W90A 2FFDB 4AUWA 1HF9A 3ITKA 1IFNA 1DD3A 1ZXGA 1BCCG 1VQKP 2H88C 2WPRA 3TNUB 1KB9I 2D2CB 1NYHA 1NU1J 4H13C 1K8AQ 5AVTB 2Q6QA 5GTIE 1NU1G 2YKQA 3BVHA 2K88A 1RE3C 4L74A 1BDCA 1LTBC 3L36A 2CPBA 5AVWB 1GW3A 2XU6A 4OWFA 5DJTB 3L72G 3MZWB 3CCRP 5CCHD 3SWYA 1E5WA 1NTKG 1J1EC 2IBZE 3AE2C 3WU2E 1SQQD 2GUVA 1JM0A 3HE5A 5KJ7A 5K5GB 1PFIA 3BCCE 2C9NY 1YQ4C 3HD7C 4Y99B 1MKMA 3ZDMA 3M0AA 2R3CA 2RN0A 3B5NC 2WSCH 3G9RA 3H1JE 4OGQD 3HTKA 3KHUA 2WT7B 1KV4A 2A45G 2LR2A 1SQBD 4TT3H 3CCVP 1VQ8P 1M1JA 1N73B 4TLFA 4W7ZA 2JEEA 2ITAA 1PP9E 4EYYQ 3A7OA 2I1JA 2KI7B 3P8CE 2OYIA 5AW0B 3HRNA 1LTJA 2NPSC 3RL0B 1GL2A 1S5LE 1SQBK 3U1AA 1BCCJ 1JTHA 4WY4A 4ZKPA 2IFNA 1VF5B 2W27A 1IFPA 3L74G 1HGZA 1KFNA 3V2RA 1IFMA 2KLVA 1YJNP 2KZIA 3KYQA 5B66H 1N2DC 4XA4A 5TISH 2OARA 4UB6H 3AE4C 4CPGA 2HPCA 3CWBE 4XE5B 1GMJA 1FDMA 1T6AA 1SQPK 2OYHC 2PGDA 3FX0A 1USDA 1NOHA 1IC2A 1QLED 1NTZD 1H89A 3L75E 1NAFA 1BE3D 1J1DB 1OW7A 1X79B 1LWUC 1WT6A 3GLMA 4K3AA 1URQC 3MP7B 3F89A 1L0LJ 1BSHA 3VP8A 3CL3D 2AEMA 2IYOA 4D6TD 3G4SP 1H0TA 2QJPB 1FOSF 1NU1E 4H13D 1OVVA 2Z5HA 5KLVD 1EDJA 1AQTA 2E74B 4XFJA 1URQB 3AEFC 1VQ9P 5CHXA 2KNCA 2H7HA 1QL2A 1SQXJ 1LTTC 2IBZD 4DJGA 4EDFA 2K37A 1X22A 3PRJA 2A45I 2BCCG 5E79E 3BCCJ 1JY2O 2NRGA 1KB9E 2O01N 1SQQG 2ZT9C 5KLVK 1T2KD 3I5CA 4JPZB 2R5DA 4I2LC 1KC8Q 5AVZB 2BCCE 1JEKA 4JYCA 4U3FE 2HODA 2IPPA 1BE3E 2C0WA 2YKPA 2J59M 1KQFB 4WBAA 1YQ3C 1VQNP 1SQVJ 1R5LA 2E5TA 3RL0D 2OYHA 1QEXA 1YIJP 1WRGA 1DEBA 1SFCD 2O01H 1LTIC 1AFOA 2B9BA 3JCUH 1KN7A 3CX5D 2HG5D 2JR8A 1NKNA 2WPSA 2ZAEB 3H1IJ 3RL0g 4RJTA 3KZIH 4M3LA 3CXHE 1VF5D 2YXRB 2C9LY 1FZCB 3U59A 3CX5H 3H1ID 1L4AC 2WITA 1CI6A 2ZXEB 1EC5A 2KSJA 3EWKA 4IFMA 4IOIH 2XKMA 4PD4I 1FS0E 1FE6A 3IAOA 3L73E 3Q1MA 3L75G 1RF1C 1NVOA 3AEAC 4UB8H 1ZRTE 3M9QA 3V2QA 5KTBA 5CCGA 1SQXK 3A0HH 4GOFA 2WPVB 2IYPA 2ZT9B 1RF0C 3AE6C 4JBZA 4YTPC 5TISE 5B66E 1L4AD 2YIUB 1LP1A 2J5UA 3N7NA 1LTGC 1AA0A 1IFJA 4ASVA 2G3AA 5AW4B 1YI2P 1FOSE 2Z5IA 1S5LH 2A06E 2V7QJ 1IJDB 3A0HE 1SQXD 3MHVA 5CJ4A 2Y0CA 2ZVOB 3NXSA 1HGVA 1N7SD 1VDFA 2CPSA 1SFCC 3TNUA 1NGMB 2E42A 2YKOA 1ZOYC 1GTWA 3HD7A 1L4AA 3PJSK 2Y0EA 4BRYA 2FXPA 3M06A 2Y9ZA 3FWNA 3OW2O 1HJBA 3V4QA 1DX7A 1KQLA 1Q90D 1X9VA 4D6TJ 3GMAA 1ZN5A 3AE8C 3H1HG 1N73C 1YYCA 3KZIE 1FJKA 2HFED 3P32A 2W6BA 3B5NB 4GDOA 3TSIA 2QEXP 3CD6P 1LTAC 3JCUE 3TGUJ 4WY4D 3W67A 1BDDA 2E75C 1BE3J 1GL2D 1NTZG 1KILD 3RK3C 1NTZJ 1GD2E 1J1EB 2FYUE 3CXHI 1SQQK 1VQ6P 3AECC 2NZ2A 3V2PA 3Q2YA 2WSSH 1ZLLA 1IK9A 2KUBA 4N6JA 5APSA 1SFCA 2ZYGA 3SFDC 3HUSB 1KB9H 4WB4A 1P84H 3H1HE 5H2FH 1PL5A 3IF4A 4GIFA 3RK3E 3CC7P 4JYBA 1RH5B 3USSA 1P84D 1S3JA 1U7MA 1R5SA 1Z56A 1BGYE 1VQMP 2H8PD 5AVSB 2M3BA 2N9YB 3E7KA 3HUSA 4D6TG 1SQBJ 1BGYG 1GK6A 3AE7C 1SQBG 2QA4P 3G6EP 1L0LK 1VQOP 1EZVI 4I7ZC 2H43A 2W83C 4DT0A 1JY2N 2O3JA 2FYNB 5AW3B 3L71D 2P2UA 1M1JB 2E76D 2KS1B 3AEBC 3BRTB 1KD1Q 4WWIA 3JC22 3WUTA 1SQXE 4C7NA 1SQPJ 2NPSD 3GF7A 3LIEA 5AVYB 1HBWA 1SQPG 3RBXA 1PPJD 3VMAA 3NTNA 3WMM0 1KZUB 3LIDA 2ZVNB 3AEEC 1M56D 2V7QH 3D70A 1NU1D 3V6IA 2FYUG 2OYIC 4I1LA 3RK3D 4D6TE 4PV1D 3H1IG 5KKZB 2LXBA 1EDKA 1OW8A 2E75D 2NPSA 2PFXA 2Q1KA 3E1IA 3L74E 3NMDA 2WVRA 3NFQA 3FWLA 4ZMDA 1YHQP 2R5BA 3CCQP 5CCHA 1MZ9A 3M0DC 5AW7B 2W6JH 3H1JJ 3CPWO 2WPQA 1JY2P 2N1TA 1T8ZA 3LW5H 3C8VA 4HH2A 1JO5A 2FYUK 4IL6X 2Q5UA 2Q3EA 3A5TA 2WSFH 3RBZA 5AW1B 1L0NG 3C1LA 1PPJG 3O8ZA 3QWOC 4W80A 5DJUB 2KOGA 1KORA 3L72J 5KAFH 4BWNA 1FBMA 3TGUD 3RK2D 4U7JA 1QGKB 2QIWA 1LP1B 3CCMP 3VYIA 3D6ZA 3CCEP 4WVZA 1EDLA 5EFWB 1SQQE 1CZQA 3H1KJ 3H6PA 3KDPB 4QMAA 3H1KG 3H32A 4A7PA 3WU2H 1HWTC 2FYNC 2JO1A 3BATA 1NTKE 2IBZG 4IL6E 4DOJA 3L74D 1KYOI 1VF5C 1G1IA 1Q2NA 3S4RA 1HJ0A 1U7JA 2JP3A 1X8YA 3GF3A 2QJPC 1JY3P 1ZP0C 1EZVD 2E74D 2L5GB 1W5CE 2O01J 2D2CC 3SSUA 1JY3N 1PGOA 2QVAA 3L70D 3L4FA 3R4YA 3VN0A 1L0LE 2XDJA 2OYOA 2YNYA 3PLNA 1N8RQ 3AE1C 1P84E 2HLOA 5AVRB 3BCCG 4RO0A 5AVUB 3CC2P 5APVA 4B86A 1CSBA 5GTHE 1XTCC 3H1KD 2M5AA 3WUVA 1NTKD 3GHGA 1EQ7A 1ZV8A 1S1CX 3VMZA 1S2EA 2PRRA 1RF1A 1DIPA 2YIUC 1PIXA 1OW6A 1YTZI 2XNXA 1QVGO 1RE4C 2FYZA 2R32A 2A06D 2E74C 3O6QA 2BCCD 2P58A 3CCJP 3CXHD 1HH0A 3N4XA 2NPSB 2R3SA 3RGUA 3PH0A 1BCCE 3PTZA 4PJ0H 4K35A 4KHXA 5L8RJ 3VP9A 1SS1A 5TJHA 1K05A 2E76C 1VQ4P 1YJ9P 4N78E 1KMIZ 3LW5J 1IFDA 1NWQA 1JCDA 1KYOH 4IFDK 2ZXXA 2O1JA 1EZVE 1FZAA 3L73D 4C7NB 3MD0A 2XNDH 1CW5A 3L70E 1T3UA 2KS1A 1AVYA 1DD4A 2XZRA 4N3YB 3CI9A 2A06G 2K9YA 3OAKA 3P7KA 2ZYAA 2E5YA 1SQPD 3GW6A 3RK3B 1G1JA 1Q82Q 3CCLP 2HPCB 1J1DC 1NTZK 1YITP 2AXTE 4L76A 2XV5A 2QJYC 4HKZH 3L71J 4RKUJ 3GHGB 4L73A 3TYYA 2M5AB 3L71G 2J58A 1A02F 1HUCA 1FC2C 4WY4B 3MIWA 2QM8A 1PP9G 2KK7A 2QSIA 3RL0C 2P7JA 3SFEC 1PP9J 1RF1B 4L75A 2B89A 3L73G 5AW2B 1PV3A 2JDIH 3PHLA 3B8EB 3H1LE 1AV1A 2E76B 1SFCB 1TU3F 2OQQA 2QE7H 3H1JG 2Y0DA 3M9HA 2WSFJ 3CXHH 3OJAB 3VMXA 3HTKB 1LTSC 2G8YA 3MUDA 4GODA 2JJLA 1N7LA 3TK1A 4C46A 5KKZC 2ZFCA 4YXDC 2IX7C 1LGHB 4LGDE 2QG4A 3C9IA 4NPFX 1GU5A 4R4MA 3MTUE 1EDIA 4DCKA 2QJKC 1U57A 4U3FJ 1S9KE 1VL2A 1G2CB 4YPCA 2KIKA 1QX8A 2KP8A 1FAVA 1OXZA 3B4SA 1LJ2A 1N7SC 3FXDA 1M8OB 3HE5B 4H44B 3CWBJ 3HD7D 3B71A 2KYVA 1NU1K 1OVRA 3Q5SA 3H1LD 2PP6A 4IFFA 1L4AB 1L2PA 1FZEA 1KILB 3JSVC 3L75D 4KT0J 4N78D 1FZCC 1BSNA 2GUSA 1VQLP 1RQUA 2MJZA 1W2EA 1SLQA 2BASA 2FKWB 2LXCB 2FFDA 4Z1MH 1LT9C 1H8AA 1PGPA 1GW4A 2GA1A 2LKMA 2W6AA 3F5HA 3KPEA 3KQGA 3L70G 4JQ0D 2YXQB 1K73Q 1HTLC 5CCGD 1OX3A 1KILA 2KSEA 2P67A 5CBOA 5KLVE 3H25A 1AJYA 2IZ0A 3T97B 3TGUE 1P84I 1Y47A 1S9KD 1JUNA 4GKGA 3HUSC 4WY4C 1NKZB 2KLUA 3K5BA 2N1TC 3L71E 2OTJP 1N7SB 2VRSA 1OMIA 1UIIA 1G2CA 1L0NK 2YMKA 2M3EA 3R2PA 3Q5RA 4JF7A 4NPEA 2QJKB 2YMYA 1XTGB 3L72E 2JKVA 1M1JC 1Y9BA 3CWBG 1D7MA 1PPJE 3U1CA 3Q5PA 1RHZB 3A3YB 3AEDC 4I6MC 1FZGA 1FZCA 1Y8AA 1L0ND 2D2CD 3AE3C 5B5EE 1NTMK 2FXOA 4AYCA 1LWUA 3HE4B 4GOEA 1JNMA 1NTMJ 3EFFK 5CJ0A 1YJWP 1NHLA 2HYNA 1Q81Q 2Z4EA 2PAJA 1IZNB 3IN6A 3L37A 5AVVB 2Y9YA 3H1IE 4BXLA 1NTMD 4W7YA 2HODB 2B87B 3W68A 5BU5A 2K1AA 1RE3A 1NO4A 1EXJA 2O1KA 3M0DA 1QVFO 1FZFA 1L0NJ 1LNQA 5CCGC 4O9BA 1SQVD 2L91A 2RMZA 1N86A 1FJPA 1KILE 2IDBA 2N9BA 4Y28J 5H2FE 3I56P 1E79H 1MUUA 2AEJA 5AW5B 2FXMA 2WSEJ 2Q7CA 1URQA 2WQYC 3M9BA 1OFCX 1OIPA 4HB1A 1JMBA 3BCCD 1ZW0A 1SQVG 3A0BH 1ZR2A 3CX5I 1IFIA 2IZ1A 3VMYA 2KXPB 1R8EA 3A2AA 1KTMA 1PGJA 1M1KQ 3II6A 4OVNF 1L0LG 3B5NA 2Q3IA 1RE4A 1KFMA 5KLVJ 1WMKA 1LTJC 1NTMG 5BVZA 1ZMEC 2YO3A 1MV8A 3D71A 2K9JA 2M0BA 3O6QB 1KQSO 2WZ7A 1NH4A 2FFDC 1MFTA 3RK2B 3T97A 1LT9A 3AE9C 4KJMA 1S72P 3IFMA 1X0TA 3HD7B 1L0LD 1OVUA 2B88A 3L75J 3H1LJ 1ZR4A 4PJ0E 1RF0A 2MKVA 3A0BE 5CMZA 2QM7A 4ASWA 2BEQD 5AW8B 1N73A 4BRYB 4MN4C 3M91A 4PV1C 5B5EH 3CWBD 5KLIB 2OGUA 3MGNA 5AW9B 5AW6B 3V4WA 1GK4A 1FDOA 4HYTB 4LC1A 3Q3DA 1RY3A 1A02J 4U3FD 1Q7YQ 5GTIH 1NTZE 3I55P 4H0LB 2C0XA 3B5ND 4OGQC 5M1BA 5APYA 5GTHH 1PGQA 3S9OA 2WTYA 1VQPP 1OWAA 1W2BO 1M90Q 2W8ZA 1BCCD 2RKLA 2FBWC 3CX5E 3WUUA 2POHA 1S5LX 2CK3H 1NAYA 2IBZI 3TDKA 1YTZT 3G71P 5APUA 3CMEP 1SQBE 3CLQA 1VQ5P 2HR3A 2JWAA 4ZKUA 1Q86Q 1CI6B 1PP9D 3L35A 5APTA 2AXCA 4UB8E 3H32B 1ZRTD 2AEFA 1GDTA 1BE3G 1SQVE 4EI2A 1KILC 2I1KA 1KB9D 1SQPE 4IL6H 4OH8B 2QRXA 4PD4D 1SQQJ 3H1KE 4PV1B 4OGQB 1JB0J 5APXA 2OYHB 4H44C 3CMAP 2Q9IA 2N1TB 2P1JA 5E79H 1OZHA 1J2JB 5KAFE 2OTKE 1M7LA 2A45H 3S1KA 2BEZF 5AVXB 3GG2A 4I7ZB 5KLIC 4ZNCA 1DEEG 4HJGH 4UB6E 3CCSP 3CCUP 3L73J 5BU8B 1EXIA 2WSCJ 2KNCB 2H89C 1JOCA 1GL2C 5AVQB 4R4LA 2OTLP 1SP4A 1LT9B 2ZJSE 5KAIE 1KYOD 1HVVA 2KB7P 3BRVB 4YXWH 1IO4A 5KAIH 2K9JB 3V5BA 4LLHA 3OA7A 1GU4A 1BGYJ 1LT1A 1AVOA 2V4HA 3H1HJ 3H1LG 5CCHC 1S4XA 2BCCJ 1MFZA 3MUDC 1H0TB 4C7RA 1FU1A 3SWKA 3UIAA 3QH9A 1NTKK 4U3FG 5KJ7C 2ZYDA 5APQA 1DH3A 1L0NE 1NTKJ 1SVFA 1USEA 2QJYB 3BASA 3AE5C 3FGAD 3TF5A 4EOTA 2AXTH 3VOPA 2K3RA 1GZLA 4RESB 2E75B 2YO2A 1JCCA 2JWDA 2WMMA 2FYUJ 1JMMA 2I8DA 3P8CD 4AQRD 5KLVG 1YBKA 1K04A 4EIJA 1QL1A 3RK2C 5KJ7D 3L70J 2B87A 1GL2B 5C39A 1EZVG 1VPCA 2WWWA 3IR9A 3AEGC 2GM4A 1NTME 2E43A 1JTHB 1H88A 2RH0A 2M8RA 3VTPC 1JY3O 2OYIB 1FDIA 1KQGB 1LTJB 1SQVK 3E1RA 1LWUB 2FYUD 3HE4A 4GT1A 3L74J 4H0LD 2SPZA 3EFGA 1SQXG 2R44A 1K9MQ 3GHGC 3KXDA 1T2KC 1VQ7P 2N1TD 2WT7A 1FZBA 4Y99C 4H0LC 2KZJA 4NPDA 2WSEH 4PD4E 1T3JA 1M57D 1AQ5A 1NJIQ 2DW3A 3TGUG 2UWJE 4DZOA 2FY8A 3D6YA 3EQ2A 3L72D 3FXEA
chains in the Genus database with same CATH topology
1N7SA 3V2NA 3G3ZA 3P8MC 5APWA 3SWFA 2IFMA 1URQD 3PP5A 2FFDB 4AUWA 1IFNA 3TNUB 2WPRA 5AVTB 2YKQA 3BVHA 1RE3C 1LTBC 3L36A 2CPBA 5AVWB 1GW3A 2XU6A 5CCHD 3SWYA 1E5WA 1J1EC 2GUVA 3HE5A 5KJ7A 1PFIA 2C9NY 3HD7C 4Y99B 3M0AA 2R3CA 3B5NC 2WSCH 2WT7B 3HTKA 2A45G 1M1JA 4W7ZA 2JEEA 2OYIA 3A7OA 2I1JA 3P8CE 5AW0B 3HRNA 1LTJA 2NPSC 3RL0B 1GL2A 1SQBK 3U1AA 1JTHA 4WY4A 4ZKPA 2IFNA 2W27A 1HGZA 1KFNA 3V2RA 1IFMA 2KLVA 3KYQA 1N2DC 4XA4A 2OARA 2HPCA 4XE5B 1FDMA 1SQPK 2OYHC 1NOHA 1IC2A 1H89A 1NAFA 1J1DB 1X79B 1LWUC 1WT6A 1URQC 3VP8A 3CL3D 1FOSF 2Z5HA 1URQB 5CHXA 2H7HA 1QL2A 1LTTC 2A45I 1JY2O 1T2KD 5KLVK 3I5CA 2R5DA 4I2LC 5AVZB 4JYCA 2HODA 2IPPA 2C0WA 2YKPA 2J59M 4WBAA 2OYHA 1WRGA 1DEBA 1SFCD 2O01H 1LTIC 1AFOA 2HG5D 2WPSA 1NKNA 2C9LY 4M3LA 1FZCB 3U59A 1L4AC 2WITA 1CI6A 2ZXEB 2KSJA 4IFMA 2XKMA 1RF1C 3M9QA 3V2QA 5KTBA 5CCGA 1SQXK 1RF0C 1L4AD 3N7NA 1LTGC 1IFJA 1FOSE 5AW4B 2Z5IA 1IJDB 5CJ4A 1N73B 3TNUA 3NXSA 1HGVA 1N7SD 1VDFA 2CPSA 1SFCC 2E42A 2YKOA 1GTWA 3HD7A 1L4AA 3M06A 1HJBA 3V4QA 1DX7A 1KQLA 1X9VA 1ZN5A 1N73C 1YYCA 1FJKA 2HFED 3P32A 2W6BA 3B5NB 3TSIA 1LTAC 4WY4D 1GL2D 1KILD 3RK3C 1GD2E 1J1EB 1SQQK 3V2PA 1ZLLA 1IK9A 4N6JA 5APSA 1SFCA 3HUSB 4WB4A 4GIFA 4JYBA 1Z56A 2H8PD 5AVSB 2M3BA 3HUSA 1GK6A 1L0LK 2H43A 1JY2N 5AW3B 2P2UA 1M1JB 3BRTB 4C7NA 2NPSD 5AVYB 3LIEA 1HBWA 3NTNA 3WMM0 1KZUB 3LIDA 2OYIC 4I1LA 3RK3D 3VTPC 3NMDA 2NPSA 3E1IA 3NFQA 2R5BA 5CCHA 1MZ9A 3M0DC 5AW7B 2WPQA 1JY2P 2N1TA 1T8ZA 3LW5H 1JO5A 4HH2A 2FYUK 2Q5UA 3A5TA 2WSFH 5AW1B 3O8ZA 4W80A 2KOGA 1FBMA 3RK2D 3VYIA 3H6PA 1CZQA 3KDPB 1HWTC 3H32A 4DOJA 3BATA 1G1IA 1X8YA 1JY3P 2L5GB 1JY3N 3L4FA 3VN0A 2XDJA 2YNYA 2HLOA 5AVRB 5AVUB 5APVA 4B86A 1CSBA 1XTCC 3GHGA 1EQ7A 1ZV8A 3VMZA 1RF1A 1YTZI 2XNXA 1RE4C 2FYZA 2R32A 1HH0A 3N4XA 2NPSB 3VP9A 4KHXA 1NWQA 4N78E 1IFDA 1JCDA 4IFDK 2O1JA 1FZAA 4C7NB 3MD0A 1CW5A 1T3UA 2XZRA 4N3YB 3CI9A 3OAKA 3P7KA 3RK3B 1G1JA 2HPCB 1J1DC 1NTZK 2XV5A 3TYYA 3GHGB 2J58A 1A02F 1HUCA 4WY4B 3MIWA 2QM8A 3RL0C 2P7JA 1RF1B 5AW2B 3B8EB 1SFCB 3M9HA 3OJAB 3VMXA 3HTKB 1LTSC 3MUDA 3TK1A 2JJLA 1N7LA 4C46A 2ZFCA 2IX7C 1LGHB 4LGDE 3C9IA 1GU5A 3MTUE 1S9KE 1G2CB 3RL0D 2KP8A 1FAVA 1OXZA 3HE5B 1N7SC 3HD7D 2KYVA 1NU1K 2PP6A 4IFFA 1L4AB 4N78D 1FZEA 1KILB 1FZCC 2GUSA 2MJZA 1W2EA 1SLQA 2BASA 2FKWB 2FFDA 1H8AA 1LT9C 1GW4A 2LKMA 2W6AA 3KPEA 3KQGA 1HTLC 5CCGD 1KILA 2P67A 1S9KD 1JUNA 4GKGA 3HUSC 4WY4C 1NKZB 2N1TC 1N7SB 2VRSA 1G2CA 1L0NK 3R2PA 4JF7A 2YMYA 1XTGB 1M1JC 3U1CA 1FZGA 4I6MC 3A3YB 1FZCA 1NTMK 4AYCA 1LWUA 3HE4B 1JNMA 5CJ0A 1NHLA 2HYNA 2Z4EA 2PAJA 3L37A 5AVVB 4W7YA 2HODB 5BU5A 1RE3A 1NO4A 2O1KA 3M0DA 1FZFA 5CCGC 4O9BA 1N86A 1FJPA 2N9BA 1MUUA 5AW5B 2FXMA 2Q7CA 1URQA 3M9BA 1ZR2A 1IFIA 3VMYA 3A2AA 3II6A 3B5NA 2Q3IA 1RE4A 1KFMA 5BVZA 1LTJC 2YO3A 1MV8A 2WZ7A 1NH4A 2FFDC 3T97A 1LT9A 3IFMA 3HD7B 1ZR4A 1RF0A 5CMZA 2QM7A 5AW8B 1N73A 3M91A 3MGNA 5AW9B 5AW6B 3V4WA 1GK4A 4LC1A 4HYTB 1A02J 1RY3A 2C0XA 3B5ND 5APYA 2WTYA 1OWAA 2POHA 1YTZT 5APUA 3CLQA 4ZKUA 1CI6B 3L35A 5APTA 3H32B 1GDTA 1KILC 2I1KA 4OH8B 5APXA 2OYHB 2Q9IA 2N1TB 2P1JA 1J2JB 1M7LA 2A45H 5AVXB 5BU8B 1JOCA 1GL2C 5AVQB 1SP4A 1LT9B 1HVVA 2KB7P 3BRVB 1IO4A 3V5BA 4LLHA 3OA7A 1GU4A 5CCHC 1MFZA 4C7RA 1FU1A 3UIAA 1NTKK 5KJ7C 5APQA 1DH3A 1SVFA 3BASA 4EOTA 3VOPA 1GZLA 4RESB 2YO2A 1JCCA 1JMMA 3P8CD 4AQRD 4EIJA 1QL1A 3RK2C 5KJ7D 1GL2B 3IR9A 1VPCA 2WWWA 2GM4A 2E43A 1JTHB 1H88A 2OYIB 2M8RA 1JY3O 1LTJB 4GT1A 1SQVK 3RK2B 1LWUB 3HE4A 3EFGA 3GHGC 1T2KC 2N1TD 2WT7A 1FZBA 4Y99C 2WSEH 1T3JA 1AQ5A 4DZOA 3EQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KYV A;  2HYN A;  1N7L A;  1FJK A;  1FJP A;  2KB7 P;  1ZLL A;  2M3B A; 
#chains in the Genus database with same CATH topology
 1IK7 A;  1RQV A;  1N7S A;  4PD4 H;  1PZQ A;  3V2N A;  3G3Z A;  3P8M C;  5APW A;  1KYO E;  3H1H D;  4H13 B;  1BGY D;  4H44 D;  5CBN A;  3SWF A;  2ZT9 D;  3CC4 P;  3ABV C;  1UIX A;  2IFM A;  3H1J D;  1URQ D;  3PP5 A;  2P10 A;  2W90 A;  2FFD B;  4AUW A;  1HF9 A;  3ITK A;  1IFN A;  1DD3 A;  1ZXG A;  1BCC G;  1VQK P;  2H88 C;  2WPR A;  3TNU B;  1KB9 I;  2D2C B;  1NYH A;  1NU1 J;  4H13 C;  1K8A Q;  5AVT B;  2Q6Q A;  5GTI E;  1NU1 G;  2YKQ A;  3BVH A;  2K88 A;  1RE3 C;  4L74 A;  1BDC A;  1LTB C;  3L36 A;  2CPB A;  5AVW B;  1GW3 A;  2XU6 A;  4OWF A;  5DJT B;  3L72 G;  3MZW B;  3CCR P;  5CCH D;  3SWY A;  1E5W A;  1NTK G;  1J1E C;  2IBZ E;  3AE2 C;  3WU2 E;  1SQQ D;  2GUV A;  1JM0 A;  3HE5 A;  5KJ7 A;  5K5G B;  1PFI A;  3BCC E;  2C9N Y;  1YQ4 C;  3HD7 C;  4Y99 B;  1MKM A;  3ZDM A;  3M0A A;  2R3C A;  2RN0 A;  3B5N C;  2WSC H;  3G9R A;  3H1J E;  4OGQ D;  3HTK A;  3KHU A;  2WT7 B;  1KV4 A;  2A45 G;  2LR2 A;  1SQB D;  4TT3 H;  3CCV P;  1VQ8 P;  1M1J A;  1N73 B;  4TLF A;  4W7Z A;  2JEE A;  2ITA A;  1PP9 E;  4EYY Q;  3A7O A;  2I1J A;  2KI7 B;  3P8C E;  2OYI A;  5AW0 B;  3HRN A;  1LTJ A;  2NPS C;  3RL0 B;  1GL2 A;  1S5L E;  1SQB K;  3U1A A;  1BCC J;  1JTH A;  4WY4 A;  4ZKP A;  2IFN A;  1VF5 B;  2W27 A;  1IFP A;  3L74 G;  1HGZ A;  1KFN A;  3V2R A;  1IFM A;  2KLV A;  1YJN P;  2KZI A;  3KYQ A;  5B66 H;  1N2D C;  4XA4 A;  5TIS H;  2OAR A;  4UB6 H;  3AE4 C;  4CPG A;  2HPC A;  3CWB E;  4XE5 B;  1GMJ A;  1FDM A;  1T6A A;  1SQP K;  2OYH C;  2PGD A;  3FX0 A;  1USD A;  1NOH A;  1IC2 A;  1QLE D;  1NTZ D;  1H89 A;  3L75 E;  1NAF A;  1BE3 D;  1J1D B;  1OW7 A;  1X79 B;  1LWU C;  1WT6 A;  3GLM A;  4K3A A;  1URQ C;  3MP7 B;  3F89 A;  1L0L J;  1BSH A;  3VP8 A;  3CL3 D;  2AEM A;  2IYO A;  4D6T D;  3G4S P;  1H0T A;  2QJP B;  1FOS F;  1NU1 E;  4H13 D;  1OVV A;  2Z5H A;  5KLV D;  1EDJ A;  1AQT A;  2E74 B;  4XFJ A;  1URQ B;  3AEF C;  1VQ9 P;  5CHX A;  2KNC A;  2H7H A;  1QL2 A;  1SQX J;  1LTT C;  2IBZ D;  4DJG A;  4EDF A;  2K37 A;  1X22 A;  3PRJ A;  2A45 I;  2BCC G;  5E79 E;  3BCC J;  1JY2 O;  2NRG A;  1KB9 E;  2O01 N;  1SQQ G;  2ZT9 C;  5KLV K;  1T2K D;  3I5C A;  4JPZ B;  2R5D A;  4I2L C;  1KC8 Q;  5AVZ B;  2BCC E;  1JEK A;  4JYC A;  4U3F E;  2HOD A;  2IPP A;  1BE3 E;  2C0W A;  2YKP A;  2J59 M;  1KQF B;  4WBA A;  1YQ3 C;  1VQN P;  1SQV J;  1R5L A;  2E5T A;  3RL0 D;  2OYH A;  1QEX A;  1YIJ P;  1WRG A;  1DEB A;  1SFC D;  2O01 H;  1LTI C;  1AFO A;  2B9B A;  3JCU H;  1KN7 A;  3CX5 D;  2HG5 D;  2JR8 A;  1NKN A;  2WPS A;  2ZAE B;  3H1I J;  3RL0 g;  4RJT A;  3KZI H;  4M3L A;  3CXH E;  1VF5 D;  2YXR B;  2C9L Y;  1FZC B;  3U59 A;  3CX5 H;  3H1I D;  1L4A C;  2WIT A;  1CI6 A;  2ZXE B;  1EC5 A;  2KSJ A;  3EWK A;  4IFM A;  4IOI H;  2XKM A;  4PD4 I;  1FS0 E;  1FE6 A;  3IAO A;  3L73 E;  3Q1M A;  3L75 G;  1RF1 C;  1NVO A;  3AEA C;  4UB8 H;  1ZRT E;  3M9Q A;  3V2Q A;  5KTB A;  5CCG A;  1SQX K;  3A0H H;  4GOF A;  2WPV B;  2IYP A;  2ZT9 B;  1RF0 C;  3AE6 C;  4JBZ A;  4YTP C;  5TIS E;  5B66 E;  1L4A D;  2YIU B;  1LP1 A;  2J5U A;  3N7N A;  1LTG C;  1AA0 A;  1IFJ A;  4ASV A;  2G3A A;  5AW4 B;  1YI2 P;  1FOS E;  2Z5I A;  1S5L H;  2A06 E;  2V7Q J;  1IJD B;  3A0H E;  1SQX D;  3MHV A;  5CJ4 A;  2Y0C A;  2ZVO B;  3NXS A;  1HGV A;  1N7S D;  1VDF A;  2CPS A;  1SFC C;  3TNU A;  1NGM B;  2E42 A;  2YKO A;  1ZOY C;  1GTW A;  3HD7 A;  1L4A A;  3PJS K;  2Y0E A;  4BRY A;  2FXP A;  3M06 A;  2Y9Z A;  3FWN A;  3OW2 O;  1HJB A;  3V4Q A;  1DX7 A;  1KQL A;  1Q90 D;  1X9V A;  4D6T J;  3GMA A;  1ZN5 A;  3AE8 C;  3H1H G;  1N73 C;  1YYC A;  3KZI E;  1FJK A;  2HFE D;  3P32 A;  2W6B A;  3B5N B;  4GDO A;  3TSI A;  2QEX P;  3CD6 P;  1LTA C;  3JCU E;  3TGU J;  4WY4 D;  3W67 A;  1BDD A;  2E75 C;  1BE3 J;  1GL2 D;  1NTZ G;  1KIL D;  3RK3 C;  1NTZ J;  1GD2 E;  1J1E B;  2FYU E;  3CXH I;  1SQQ K;  1VQ6 P;  3AEC C;  2NZ2 A;  3V2P A;  3Q2Y A;  2WSS H;  1ZLL A;  1IK9 A;  2KUB A;  4N6J A;  5APS A;  1SFC A;  2ZYG A;  3SFD C;  3HUS B;  1KB9 H;  4WB4 A;  1P84 H;  3H1H E;  5H2F H;  1PL5 A;  3IF4 A;  4GIF A;  3RK3 E;  3CC7 P;  4JYB A;  1RH5 B;  3USS A;  1P84 D;  1S3J A;  1U7M A;  1R5S A;  1Z56 A;  1BGY E;  1VQM P;  2H8P D;  5AVS B;  2M3B A;  2N9Y B;  3E7K A;  3HUS A;  4D6T G;  1SQB J;  1BGY G;  1GK6 A;  3AE7 C;  1SQB G;  2QA4 P;  3G6E P;  1L0L K;  1VQO P;  1EZV I;  4I7Z C;  2H43 A;  2W83 C;  4DT0 A;  1JY2 N;  2O3J A;  2FYN B;  5AW3 B;  3L71 D;  2P2U A;  1M1J B;  2E76 D;  2KS1 B;  3AEB C;  3BRT B;  1KD1 Q;  4WWI A;  3JC2 2;  3WUT A;  1SQX E;  4C7N A;  1SQP J;  2NPS D;  3GF7 A;  3LIE A;  5AVY B;  1HBW A;  1SQP G;  3RBX A;  1PPJ D;  3VMA A;  3NTN A;  3WMM 0;  1KZU B;  3LID A;  2ZVN B;  3AEE C;  1M56 D;  2V7Q H;  3D70 A;  1NU1 D;  3V6I A;  2FYU G;  2OYI C;  4I1L A;  3RK3 D;  4D6T E;  4PV1 D;  3H1I G;  5KKZ B;  2LXB A;  1EDK A;  1OW8 A;  2E75 D;  2NPS A;  2PFX A;  2Q1K A;  3E1I A;  3L74 E;  3NMD A;  2WVR A;  3NFQ A;  3FWL A;  4ZMD A;  1YHQ P;  2R5B A;  3CCQ P;  5CCH A;  1MZ9 A;  3M0D C;  5AW7 B;  2W6J H;  3H1J J;  3CPW O;  2WPQ A;  1JY2 P;  2N1T A;  1T8Z A;  3LW5 H;  3C8V A;  4HH2 A;  1JO5 A;  2FYU K;  4IL6 X;  2Q5U A;  2Q3E A;  3A5T A;  2WSF H;  3RBZ A;  5AW1 B;  1L0N G;  3C1L A;  1PPJ G;  3O8Z A;  3QWO C;  4W80 A;  5DJU B;  2KOG A;  1KOR A;  3L72 J;  5KAF H;  4BWN A;  1FBM A;  3TGU D;  3RK2 D;  4U7J A;  1QGK B;  2QIW A;  1LP1 B;  3CCM P;  3VYI A;  3D6Z A;  3CCE P;  4WVZ A;  1EDL A;  5EFW B;  1SQQ E;  1CZQ A;  3H1K J;  3H6P A;  3KDP B;  4QMA A;  3H1K G;  3H32 A;  4A7P A;  3WU2 H;  1HWT C;  2FYN C;  2JO1 A;  3BAT A;  1NTK E;  2IBZ G;  4IL6 E;  4DOJ A;  3L74 D;  1KYO I;  1VF5 C;  1G1I A;  1Q2N A;  3S4R A;  1HJ0 A;  1U7J A;  2JP3 A;  1X8Y A;  3GF3 A;  2QJP C;  1JY3 P;  1ZP0 C;  1EZV D;  2E74 D;  2L5G B;  1W5C E;  2O01 J;  2D2C C;  3SSU A;  1JY3 N;  1PGO A;  2QVA A;  3L70 D;  3L4F A;  3R4Y A;  3VN0 A;  1L0L E;  2XDJ A;  2OYO A;  2YNY A;  3PLN A;  1N8R Q;  3AE1 C;  1P84 E;  2HLO A;  5AVR B;  3BCC G;  4RO0 A;  5AVU B;  3CC2 P;  5APV A;  4B86 A;  1CSB A;  5GTH E;  1XTC C;  3H1K D;  2M5A A;  3WUV A;  1NTK D;  3GHG A;  1EQ7 A;  1ZV8 A;  1S1C X;  3VMZ A;  1S2E A;  2PRR A;  1RF1 A;  1DIP A;  2YIU C;  1PIX A;  1OW6 A;  1YTZ I;  2XNX A;  1QVG O;  1RE4 C;  2FYZ A;  2R32 A;  2A06 D;  2E74 C;  3O6Q A;  2BCC D;  2P58 A;  3CCJ P;  3CXH D;  1HH0 A;  3N4X A;  2NPS B;  2R3S A;  3RGU A;  3PH0 A;  1BCC E;  3PTZ A;  4PJ0 H;  4K35 A;  4KHX A;  5L8R J;  3VP9 A;  1SS1 A;  5TJH A;  1K05 A;  2E76 C;  1VQ4 P;  1YJ9 P;  4N78 E;  1KMI Z;  3LW5 J;  1IFD A;  1NWQ A;  1JCD A;  1KYO H;  4IFD K;  2ZXX A;  2O1J A;  1EZV E;  1FZA A;  3L73 D;  4C7N B;  3MD0 A;  2XND H;  1CW5 A;  3L70 E;  1T3U A;  2KS1 A;  1AVY A;  1DD4 A;  2XZR A;  4N3Y B;  3CI9 A;  2A06 G;  2K9Y A;  3OAK A;  3P7K A;  2ZYA A;  2E5Y A;  1SQP D;  3GW6 A;  3RK3 B;  1G1J A;  1Q82 Q;  3CCL P;  2HPC B;  1J1D C;  1NTZ K;  1YIT P;  2AXT E;  4L76 A;  2XV5 A;  2QJY C;  4HKZ H;  3L71 J;  4RKU J;  3GHG B;  4L73 A;  3TYY A;  2M5A B;  3L71 G;  2J58 A;  1A02 F;  1HUC A;  1FC2 C;  4WY4 B;  3MIW A;  2QM8 A;  1PP9 G;  2KK7 A;  2QSI A;  3RL0 C;  2P7J A;  3SFE C;  1PP9 J;  1RF1 B;  4L75 A;  2B89 A;  3L73 G;  5AW2 B;  1PV3 A;  2JDI H;  3PHL A;  3B8E B;  3H1L E;  1AV1 A;  2E76 B;  1SFC B;  1TU3 F;  2OQQ A;  2QE7 H;  3H1J G;  2Y0D A;  3M9H A;  2WSF J;  3CXH H;  3OJA B;  3VMX A;  3HTK B;  1LTS C;  2G8Y A;  3MUD A;  4GOD A;  2JJL A;  1N7L A;  3TK1 A;  4C46 A;  5KKZ C;  2ZFC A;  4YXD C;  2IX7 C;  1LGH B;  4LGD E;  2QG4 A;  3C9I A;  4NPF X;  1GU5 A;  4R4M A;  3MTU E;  1EDI A;  4DCK A;  2QJK C;  1U57 A;  4U3F J;  1S9K E;  1VL2 A;  1G2C B;  4YPC A;  2KIK A;  1QX8 A;  2KP8 A;  1FAV A;  1OXZ A;  3B4S A;  1LJ2 A;  1N7S C;  3FXD A;  1M8O B;  3HE5 B;  4H44 B;  3CWB J;  3HD7 D;  3B71 A;  2KYV A;  1NU1 K;  1OVR A;  3Q5S A;  3H1L D;  2PP6 A;  4IFF A;  1L4A B;  1L2P A;  1FZE A;  1KIL B;  3JSV C;  3L75 D;  4KT0 J;  4N78 D;  1FZC C;  1BSN A;  2GUS A;  1VQL P;  1RQU A;  2MJZ A;  1W2E A;  1SLQ A;  2BAS A;  2FKW B;  2LXC B;  2FFD A;  4Z1M H;  1LT9 C;  1H8A A;  1PGP A;  1GW4 A;  2GA1 A;  2LKM A;  2W6A A;  3F5H A;  3KPE A;  3KQG A;  3L70 G;  4JQ0 D;  2YXQ B;  1K73 Q;  1HTL C;  5CCG D;  1OX3 A;  1KIL A;  2KSE A;  2P67 A;  5CBO A;  5KLV E;  3H25 A;  1AJY A;  2IZ0 A;  3T97 B;  3TGU E;  1P84 I;  1Y47 A;  1S9K D;  1JUN A;  4GKG A;  3HUS C;  4WY4 C;  1NKZ B;  2KLU A;  3K5B A;  2N1T C;  3L71 E;  2OTJ P;  1N7S B;  2VRS A;  1OMI A;  1UII A;  1G2C A;  1L0N K;  2YMK A;  2M3E A;  3R2P A;  3Q5R A;  4JF7 A;  4NPE A;  2QJK B;  2YMY A;  1XTG B;  3L72 E;  2JKV A;  1M1J C;  1Y9B A;  3CWB G;  1D7M A;  1PPJ E;  3U1C A;  3Q5P A;  1RHZ B;  3A3Y B;  3AED C;  4I6M C;  1FZG A;  1FZC A;  1Y8A A;  1L0N D;  2D2C D;  3AE3 C;  5B5E E;  1NTM K;  2FXO A;  4AYC A;  1LWU A;  3HE4 B;  4GOE A;  1JNM A;  1NTM J;  3EFF K;  5CJ0 A;  1YJW P;  1NHL A;  2HYN A;  1Q81 Q;  2Z4E A;  2PAJ A;  1IZN B;  3IN6 A;  3L37 A;  5AVV B;  2Y9Y A;  3H1I E;  4BXL A;  1NTM D;  4W7Y A;  2HOD B;  2B87 B;  3W68 A;  5BU5 A;  2K1A A;  1RE3 A;  1NO4 A;  1EXJ A;  2O1K A;  3M0D A;  1QVF O;  1FZF A;  1L0N J;  1LNQ A;  5CCG C;  4O9B A;  1SQV D;  2L91 A;  2RMZ A;  1N86 A;  1FJP A;  1KIL E;  2IDB A;  2N9B A;  4Y28 J;  5H2F E;  3I56 P;  1E79 H;  1MUU A;  2AEJ A;  5AW5 B;  2FXM A;  2WSE J;  2Q7C A;  1URQ A;  2WQY C;  3M9B A;  1OFC X;  1OIP A;  4HB1 A;  1JMB A;  3BCC D;  1ZW0 A;  1SQV G;  3A0B H;  1ZR2 A;  3CX5 I;  1IFI A;  2IZ1 A;  3VMY A;  2KXP B;  1R8E A;  3A2A A;  1KTM A;  1PGJ A;  1M1K Q;  3II6 A;  4OVN F;  1L0L G;  3B5N A;  2Q3I A;  1RE4 A;  1KFM A;  5KLV J;  1WMK A;  1LTJ C;  1NTM G;  5BVZ A;  1ZME C;  2YO3 A;  1MV8 A;  3D71 A;  2K9J A;  2M0B A;  3O6Q B;  1KQS O;  2WZ7 A;  1NH4 A;  2FFD C;  1MFT A;  3RK2 B;  3T97 A;  1LT9 A;  3AE9 C;  4KJM A;  1S72 P;  3IFM A;  1X0T A;  3HD7 B;  1L0L D;  1OVU A;  2B88 A;  3L75 J;  3H1L J;  1ZR4 A;  4PJ0 E;  1RF0 A;  2MKV A;  3A0B E;  5CMZ A;  2QM7 A;  4ASW A;  2BEQ D;  5AW8 B;  1N73 A;  4BRY B;  4MN4 C;  3M91 A;  4PV1 C;  5B5E H;  3CWB D;  5KLI B;  2OGU A;  3MGN A;  5AW9 B;  5AW6 B;  3V4W A;  1GK4 A;  1FDO A;  4HYT B;  4LC1 A;  3Q3D A;  1RY3 A;  1A02 J;  4U3F D;  1Q7Y Q;  5GTI H;  1NTZ E;  3I55 P;  4H0L B;  2C0X A;  3B5N D;  4OGQ C;  5M1B A;  5APY A;  5GTH H;  1PGQ A;  3S9O A;  2WTY A;  1VQP P;  1OWA A;  1W2B O;  1M90 Q;  2W8Z A;  1BCC D;  2RKL A;  2FBW C;  3CX5 E;  3WUU A;  2POH A;  1S5L X;  2CK3 H;  1NAY A;  2IBZ I;  3TDK A;  1YTZ T;  3G71 P;  5APU A;  3CME P;  1SQB E;  3CLQ A;  1VQ5 P;  2HR3 A;  2JWA A;  4ZKU A;  1Q86 Q;  1CI6 B;  1PP9 D;  3L35 A;  5APT A;  2AXC A;  4UB8 E;  3H32 B;  1ZRT D;  2AEF A;  1GDT A;  1BE3 G;  1SQV E;  4EI2 A;  1KIL C;  2I1K A;  1KB9 D;  1SQP E;  4IL6 H;  4OH8 B;  2QRX A;  4PD4 D;  1SQQ J;  3H1K E;  4PV1 B;  4OGQ B;  1JB0 J;  5APX A;  2OYH B;  4H44 C;  3CMA P;  2Q9I A;  2N1T B;  2P1J A;  5E79 H;  1OZH A;  1J2J B;  5KAF E;  2OTK E;  1M7L A;  2A45 H;  3S1K A;  2BEZ F;  5AVX B;  3GG2 A;  4I7Z B;  5KLI C;  4ZNC A;  1DEE G;  4HJG H;  4UB6 E;  3CCS P;  3CCU P;  3L73 J;  5BU8 B;  1EXI A;  2WSC J;  2KNC B;  2H89 C;  1JOC A;  1GL2 C;  5AVQ B;  4R4L A;  2OTL P;  1SP4 A;  1LT9 B;  2ZJS E;  5KAI E;  1KYO D;  1HVV A;  2KB7 P;  3BRV B;  4YXW H;  1IO4 A;  5KAI H;  2K9J B;  3V5B A;  4LLH A;  3OA7 A;  1GU4 A;  1BGY J;  1LT1 A;  1AVO A;  2V4H A;  3H1H J;  3H1L G;  5CCH C;  1S4X A;  2BCC J;  1MFZ A;  3MUD C;  1H0T B;  4C7R A;  1FU1 A;  3SWK A;  3UIA A;  3QH9 A;  1NTK K;  4U3F G;  5KJ7 C;  2ZYD A;  5APQ A;  1DH3 A;  1L0N E;  1NTK J;  1SVF A;  1USE A;  2QJY B;  3BAS A;  3AE5 C;  3FGA D;  3TF5 A;  4EOT A;  2AXT H;  3VOP A;  2K3R A;  1GZL A;  4RES B;  2E75 B;  2YO2 A;  1JCC A;  2JWD A;  2WMM A;  2FYU J;  1JMM A;  2I8D A;  3P8C D;  4AQR D;  5KLV G;  1YBK A;  1K04 A;  4EIJ A;  1QL1 A;  3RK2 C;  5KJ7 D;  3L70 J;  2B87 A;  1GL2 B;  5C39 A;  1EZV G;  1VPC A;  2WWW A;  3IR9 A;  3AEG C;  2GM4 A;  1NTM E;  2E43 A;  1JTH B;  1H88 A;  2RH0 A;  2M8R A;  3VTP C;  1JY3 O;  2OYI B;  1FDI A;  1KQG B;  1LTJ B;  1SQV K;  3E1R A;  1LWU B;  2FYU D;  3HE4 A;  4GT1 A;  3L74 J;  4H0L D;  2SPZ A;  3EFG A;  1SQX G;  2R44 A;  1K9M Q;  3GHG C;  3KXD A;  1T2K C;  1VQ7 P;  2N1T D;  2WT7 A;  1FZB A;  4Y99 C;  4H0L C;  2KZJ A;  4NPD A;  2WSE H;  4PD4 E;  1T3J A;  1M57 D;  1AQ5 A;  1NJI Q;  2DW3 A;  3TGU G;  2UWJ E;  4DZO A;  2FY8 A;  3D6Y A;  3EQ2 A;  3L72 D;  3FXE A; 
#chains in the Genus database with same CATH homology
 1N7S A;  3V2N A;  3G3Z A;  3P8M C;  5APW A;  3SWF A;  2IFM A;  1URQ D;  3PP5 A;  2FFD B;  4AUW A;  1IFN A;  3TNU B;  2WPR A;  5AVT B;  2YKQ A;  3BVH A;  1RE3 C;  1LTB C;  3L36 A;  2CPB A;  5AVW B;  1GW3 A;  2XU6 A;  5CCH D;  3SWY A;  1E5W A;  1J1E C;  2GUV A;  3HE5 A;  5KJ7 A;  1PFI A;  2C9N Y;  3HD7 C;  4Y99 B;  3M0A A;  2R3C A;  3B5N C;  2WSC H;  2WT7 B;  3HTK A;  2A45 G;  1M1J A;  4W7Z A;  2JEE A;  2OYI A;  3A7O A;  2I1J A;  3P8C E;  5AW0 B;  3HRN A;  1LTJ A;  2NPS C;  3RL0 B;  1GL2 A;  1SQB K;  3U1A A;  1JTH A;  4WY4 A;  4ZKP A;  2IFN A;  2W27 A;  1HGZ A;  1KFN A;  3V2R A;  1IFM A;  2KLV A;  3KYQ A;  1N2D C;  4XA4 A;  2OAR A;  2HPC A;  4XE5 B;  1FDM A;  1SQP K;  2OYH C;  1NOH A;  1IC2 A;  1H89 A;  1NAF A;  1J1D B;  1X79 B;  1LWU C;  1WT6 A;  1URQ C;  3VP8 A;  3CL3 D;  1FOS F;  2Z5H A;  1URQ B;  5CHX A;  2H7H A;  1QL2 A;  1LTT C;  2A45 I;  1JY2 O;  1T2K D;  5KLV K;  3I5C A;  2R5D A;  4I2L C;  5AVZ B;  4JYC A;  2HOD A;  2IPP A;  2C0W A;  2YKP A;  2J59 M;  4WBA A;  2OYH A;  1WRG A;  1DEB A;  1SFC D;  2O01 H;  1LTI C;  1AFO A;  2HG5 D;  2WPS A;  1NKN A;  2C9L Y;  4M3L A;  1FZC B;  3U59 A;  1L4A C;  2WIT A;  1CI6 A;  2ZXE B;  2KSJ A;  4IFM A;  2XKM A;  1RF1 C;  3M9Q A;  3V2Q A;  5KTB A;  5CCG A;  1SQX K;  1RF0 C;  1L4A D;  3N7N A;  1LTG C;  1IFJ A;  1FOS E;  5AW4 B;  2Z5I A;  1IJD B;  5CJ4 A;  1N73 B;  3TNU A;  3NXS A;  1HGV A;  1N7S D;  1VDF A;  2CPS A;  1SFC C;  2E42 A;  2YKO A;  1GTW A;  3HD7 A;  1L4A A;  3M06 A;  1HJB A;  3V4Q A;  1DX7 A;  1KQL A;  1X9V A;  1ZN5 A;  1N73 C;  1YYC A;  1FJK A;  2HFE D;  3P32 A;  2W6B A;  3B5N B;  3TSI A;  1LTA C;  4WY4 D;  1GL2 D;  1KIL D;  3RK3 C;  1GD2 E;  1J1E B;  1SQQ K;  3V2P A;  1ZLL A;  1IK9 A;  4N6J A;  5APS A;  1SFC A;  3HUS B;  4WB4 A;  4GIF A;  4JYB A;  1Z56 A;  2H8P D;  5AVS B;  2M3B A;  3HUS A;  1GK6 A;  1L0L K;  2H43 A;  1JY2 N;  5AW3 B;  2P2U A;  1M1J B;  3BRT B;  4C7N A;  2NPS D;  5AVY B;  3LIE A;  1HBW A;  3NTN A;  3WMM 0;  1KZU B;  3LID A;  2OYI C;  4I1L A;  3RK3 D;  3VTP C;  3NMD A;  2NPS A;  3E1I A;  3NFQ A;  2R5B A;  5CCH A;  1MZ9 A;  3M0D C;  5AW7 B;  2WPQ A;  1JY2 P;  2N1T A;  1T8Z A;  3LW5 H;  1JO5 A;  4HH2 A;  2FYU K;  2Q5U A;  3A5T A;  2WSF H;  5AW1 B;  3O8Z A;  4W80 A;  2KOG A;  1FBM A;  3RK2 D;  3VYI A;  3H6P A;  1CZQ A;  3KDP B;  1HWT C;  3H32 A;  4DOJ A;  3BAT A;  1G1I A;  1X8Y A;  1JY3 P;  2L5G B;  1JY3 N;  3L4F A;  3VN0 A;  2XDJ A;  2YNY A;  2HLO A;  5AVR B;  5AVU B;  5APV A;  4B86 A;  1CSB A;  1XTC C;  3GHG A;  1EQ7 A;  1ZV8 A;  3VMZ A;  1RF1 A;  1YTZ I;  2XNX A;  1RE4 C;  2FYZ A;  2R32 A;  1HH0 A;  3N4X A;  2NPS B;  3VP9 A;  4KHX A;  1NWQ A;  4N78 E;  1IFD A;  1JCD A;  4IFD K;  2O1J A;  1FZA A;  4C7N B;  3MD0 A;  1CW5 A;  1T3U A;  2XZR A;  4N3Y B;  3CI9 A;  3OAK A;  3P7K A;  3RK3 B;  1G1J A;  2HPC B;  1J1D C;  1NTZ K;  2XV5 A;  3TYY A;  3GHG B;  2J58 A;  1A02 F;  1HUC A;  4WY4 B;  3MIW A;  2QM8 A;  3RL0 C;  2P7J A;  1RF1 B;  5AW2 B;  3B8E B;  1SFC B;  3M9H A;  3OJA B;  3VMX A;  3HTK B;  1LTS C;  3MUD A;  3TK1 A;  2JJL A;  1N7L A;  4C46 A;  2ZFC A;  2IX7 C;  1LGH B;  4LGD E;  3C9I A;  1GU5 A;  3MTU E;  1S9K E;  1G2C B;  3RL0 D;  2KP8 A;  1FAV A;  1OXZ A;  3HE5 B;  1N7S C;  3HD7 D;  2KYV A;  1NU1 K;  2PP6 A;  4IFF A;  1L4A B;  4N78 D;  1FZE A;  1KIL B;  1FZC C;  2GUS A;  2MJZ A;  1W2E A;  1SLQ A;  2BAS A;  2FKW B;  2FFD A;  1H8A A;  1LT9 C;  1GW4 A;  2LKM A;  2W6A A;  3KPE A;  3KQG A;  1HTL C;  5CCG D;  1KIL A;  2P67 A;  1S9K D;  1JUN A;  4GKG A;  3HUS C;  4WY4 C;  1NKZ B;  2N1T C;  1N7S B;  2VRS A;  1G2C A;  1L0N K;  3R2P A;  4JF7 A;  2YMY A;  1XTG B;  1M1J C;  3U1C A;  1FZG A;  4I6M C;  3A3Y B;  1FZC A;  1NTM K;  4AYC A;  1LWU A;  3HE4 B;  1JNM A;  5CJ0 A;  1NHL A;  2HYN A;  2Z4E A;  2PAJ A;  3L37 A;  5AVV B;  4W7Y A;  2HOD B;  5BU5 A;  1RE3 A;  1NO4 A;  2O1K A;  3M0D A;  1FZF A;  5CCG C;  4O9B A;  1N86 A;  1FJP A;  2N9B A;  1MUU A;  5AW5 B;  2FXM A;  2Q7C A;  1URQ A;  3M9B A;  1ZR2 A;  1IFI A;  3VMY A;  3A2A A;  3II6 A;  3B5N A;  2Q3I A;  1RE4 A;  1KFM A;  5BVZ A;  1LTJ C;  2YO3 A;  1MV8 A;  2WZ7 A;  1NH4 A;  2FFD C;  3T97 A;  1LT9 A;  3IFM A;  3HD7 B;  1ZR4 A;  1RF0 A;  5CMZ A;  2QM7 A;  5AW8 B;  1N73 A;  3M91 A;  3MGN A;  5AW9 B;  5AW6 B;  3V4W A;  1GK4 A;  4LC1 A;  4HYT B;  1A02 J;  1RY3 A;  2C0X A;  3B5N D;  5APY A;  2WTY A;  1OWA A;  2POH A;  1YTZ T;  5APU A;  3CLQ A;  4ZKU A;  1CI6 B;  3L35 A;  5APT A;  3H32 B;  1GDT A;  1KIL C;  2I1K A;  4OH8 B;  5APX A;  2OYH B;  2Q9I A;  2N1T B;  2P1J A;  1J2J B;  1M7L A;  2A45 H;  5AVX B;  5BU8 B;  1JOC A;  1GL2 C;  5AVQ B;  1SP4 A;  1LT9 B;  1HVV A;  2KB7 P;  3BRV B;  1IO4 A;  3V5B A;  4LLH A;  3OA7 A;  1GU4 A;  5CCH C;  1MFZ A;  4C7R A;  1FU1 A;  3UIA A;  1NTK K;  5KJ7 C;  5APQ A;  1DH3 A;  1SVF A;  3BAS A;  4EOT A;  3VOP A;  1GZL A;  4RES B;  2YO2 A;  1JCC A;  1JMM A;  3P8C D;  4AQR D;  4EIJ A;  1QL1 A;  3RK2 C;  5KJ7 D;  1GL2 B;  3IR9 A;  1VPC A;  2WWW A;  2GM4 A;  2E43 A;  1JTH B;  1H88 A;  2OYI B;  2M8R A;  1JY3 O;  1LTJ B;  4GT1 A;  1SQV K;  3RK2 B;  1LWU B;  3HE4 A;  3EFG A;  3GHG C;  1T2K C;  2N1T D;  2WT7 A;  1FZB A;  4Y99 C;  2WSE H;  1T3J A;  1AQ5 A;  4DZO A;  3EQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...