2KYVA

Hybrid solution and solid-state nmr structure ensemble of phospholamban pentamer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
52
structure length
52
Chain Sequence
MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Phospholamban
publication title Structural topology of phospholamban pentamer in lipid bilayers by a hybrid solution and solid-state NMR method.
pubmed doi rcsb
source organism Escherichia coli
total genus 19
structure length 52
sequence length 52
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2kyvA00
2KYVA 1N7LA 1ZLLA 1FJKA 1FJPA 2KB7P 2HYNA 2M3BA
chains in the Genus database with same CATH superfamily
3MUDA 1JOCA 4JF7A 3CL3D 3M9HA 4H0LD 3C9IA 3GHGC 2FY8A 1L0NJ 1IJDB 2ZT9C 1L4AB 1U7MA 3EWKA 3N7NA 1AFOA 4XE5B 2JWAA 3RL0g 1IO4A 3VP9A 1LP1A 2HR3A 1NHLA 1SP4A 2Q9IA 1SQPE 3A0HE 1T3JA 2IBZE 4WY4D 3A3YB 1AJYA 5APUA 2A45G 1G1IA 4H13D 3OW2O 1EXIA 1FBMA 1EQ7A 1S5LH 3V6IA 4I2LC 1SQQK 1KILA 2FYUG 1USDA 2FYUD 4RJTA 5CBNA 1SQBE 3B5ND 3HUSC 2FXPA 2Y0CA 3S9OA 1JCCA 1FDOA 4C46A 2E42A 3RK3D 3SFEC 3CMAP 5BU8B 4HH2A 3P8CE 4IFMA 3TGUE 4KJMA 2L5GB 1KB9E 1P84I 2A45I 3BCCD 1NOHA 2FYNB 2NRGA 1IK7A 2WSSH 2K9JB 2FBWC 4TLFA 2HODB 5TISH 4M3LA 2E76B 1OX3A 2JO1A 1OIPA 2BCCE 2A06G 1ZV8A 1N7SD 2A06D 2GM4A 1NO4A 1M8OB 3AEBC 1GD2E 1KFNA 3SWFA 3V2PA 1RE4C 1S1CX 2AEMA 1KQLA 3L74G 2Y9ZA 2KP8A 3UIAA 5E79H 1HJBA 4H0LC 1OXZA 1R8EA 2N1TB 1ZP0C 1G2CB 4UB6E 2E75B 3H1HE 3P8MC 1VF5B 1SQXG 1GL2D 1EDLA 1SQXD 4I7ZC 1EDIA 3RL0D 1EXJA 1NTKG 3RGUA 1NTKD 2FXOA 2K9JA 2ZAEB 1P84H 4N78E 3H1IG 2HODA 2O01N 2D2CC 1NTZE 5EFWB 2K9YA 1IFIA 1MV8A 1BDDA 1Q2NA 3B5NC 3VMXA 1GMJA 3PJSK 3CXHD 2RMZA 3CWBJ 2W6AA 3IN6A 1BSNA 1NAYA 1NGMB 3USSA 3AEAC 1LNQA 2V7QH 3D6YA 5M1BA 2N1TA 1G2CA 1K73Q 1PP9J 3KQGA 2ZVNB 4DJGA 1VDFA 3GHGB 4PD4D 1OZHA 2KLVA 3HD7D 4NPDA 3PHLA 4U7JA 1E79H 1S2EA 3G6EP 1BSHA 2WSEH 2P2UA 1N7SC 2JR8A 3CCVP 1NTMJ 1N8RQ 1KMIZ 3G3ZA 3HRNA 2XDJA 1VPCA 5H2FH 3L70E 2OTKE 5KKZB 5AVRB 2KB7P 1ZRTE 4IOIH 1SQPG 4ASVA 1J1EC 3MD0A 1SQPD 2R3SA 3T97B 2OYOA 3HUSB 3V5BA 1J1DC 2W90A 5KJ7D 1Q82Q 1IC2A 1QGKB 2QJPC 2FXMA 1QL2A 1ZW0A 4HJGH 3Q5PA 4ZNCA 3H1JG 3RL0C 3GHGA 3H1JD 4L74A 2WPRA 1NJIQ 3JC22 1IFPA 1XTGB 2J5UA 3CWBE 3EFGA 4OH8B 3TGUG 1X0TA 1OMIA 1JTHB 4L73A 3TGUD 1FE6A 5AVUB 2P1JA 5AW3B 2IBZI 3H1KE 4GODA 3B4SA 1VQ7P 1U7JA 3NTNA 1FU1A 5TISE 4GOFA 4K35A 2PRRA 1FZGA 3KPEA 1FZEA 1MUUA 3M9BA 1EZVD 3T97A 1HTLC 1NU1E 2HFED 1KB9I 1RHZB 3BCCJ 3PTZA 5E79E 1KYOH 1LGHB 1RF1C 1PFIA 3HD7C 1SFCD 3LW5J 3FXDA 3Q5SA 5KLVK 3H1LJ 1JTHA 3MHVA 2WSCH 5CHXA 3H1HG 3PLNA 5KAFE 2M8RA 3H32A 4C7RA 2YXRB 2QM8A 4WY4B 4H13B 1FAVA 1YI2P 1KQSO 3Q5RA 3AEFC 3P7KA 4R4LA 3O8ZA 3B5NB 2UWJE 5KJ7C 4EDFA 2BASA 1NTZG 3RK3B 3TSIA 2IX7C 2IPPA 2O01J 3AE7C 3CLQA 1SQXJ 1BE3G 1BE3D 2YXQB 4OGQD 1NTKJ 3VMAA 3IFMA 1FZBA 1KB9H 2AXCA 2OARA 2M3BA 1RE3C 3V4QA 3CCJP 3AE2C 1RH5B 4ASWA 1SQQE 3EFFK 3MIWA 4WY4A 2PP6A 2ZT9D 1S72P 2IYOA 3JSVC 5CMZA 1S4XA 2P7JA 3N4XA 3I5CA 3GMAA 5AVXB 1WRGA 3B5NA 1OWAA 4D6TD 2CPSA 3L70G 1FZFA 3CCSP 3CCLP 1J1DB 1IFMA 3KZIH 2CPBA 1ZRTD 1SFCC 4PJ0E 2QJPB 5CJ0A 4H44D 1W2BO 1GL2B 2IFNA 3M06A 1M7LA 3RL0B 4N3YB 4RKUJ 3L75E 5CCHA 1SQVD 2N9YB 3AEDC 1QVFO 3C8VA 1PPJE 4ZKUA 3PRJA 3O6QB 2W6BA 1BDCA 4WVZA 1JCDA 1T2KD 3GLMA 5B66H 1VQKP 3VP8A 1L0LG 3IAOA 3WMM0 2OYIC 1VL2A 3L71J 1L0LD 3L35A 1T6AA 5BU5A 2XV5A 1K04A 5TJHA 5AVSB 4IL6H 3D6ZA 2WPVB 4OGQC 1NYHA 1FS0E 3Q1MA 1LTJC 3F89A 1BCCJ 1OFCX 3OJAB 5C39A 2PAJA 1GL2A 1DX7A 1NU1G 1SVFA 3HD7B 1USEA 1KYOE 2QJKC 2W27A 1ZMEC 1KILE 3CMEP 3FWLA 3LIEA 1VQMP 3KHUA 5AVWB 1URQB 2AEJA 1LTIC 2QJYC 1NKZB 2FYUK 4CPGA 3F5HA 1QX8A 5CCGD 4TT3H 2LKMA 1YHQP 1HWTC 2C0XA 3OAKA 4W80A 2GUSA 5AW6B 2DW3A 3W68A 1P84D 1HVVA 1PGQA 2D2CD 2W8ZA 4H44C 1WT6A 1QL1A 1BGYG 1QVGO 1BGYD 1UIXA 1HJ0A 5AW9B 1YJWP 2KXPB 2QG4A 1IFJA 2RKLA 2OYHC 3SWYA 3L73J 3L72E 3M0DA 1PIXA 1T2KC 1L4AA 2H88C 5KLVJ 1URQA 2CK3H 1N7LA 2ITAA 4U3FG 1EDKA 3AE6C 1YYCA 1BCCE 3BRTB 4U3FD 4QMAA 2OGUA 5B5EE 1N2DC 4Y99C 5APYA 3KDPB 1ZR2A 2Y9YA 1PGPA 1SQQG 2K3RA 1X9VA 2WTYA 2OTJP 2JKVA 3R4YA 3L4FA 1L0NE 4N6JA 2G8YA 2YMYA 2QE7H 4C7NB 1FC2C 1LWUC 1SQXK 3G9RA 4LC1A 3W67A 1KN7A 1VQLP 1H89A 1FJPA 1NTKK 3L74D 3MGNA 1SFCB 4B86A 3KZIE 3KXDA 1X22A 2OQQA 1HGZA 1HF9A 4HB1A 1EDJA 1RE3A 1JUNA 1GK4A 5APWA 3CI9A 2KOGA 2IYPA 2KZJA 3WUVA 1OVVA 1YIJP 5KAFH 5CCGC 1GW4A 3L75G 2ZXEB 2B89A 3L75D 4D6TJ 1W2EA 2QVAA 1X8YA 1K9MQ 1NH4A 3K5BA 4KHXA 2M5AB 3A7OA 2OYIB 3H1ID 5B66E 1HGVA 1PPJG 2FFDC 2C9NY 1H88A 1GZLA 4HKZH 5KLVE 2QEXP 3CX5E 5APXA 2AEFA 4IL6E 4OGQB 3AE1C 2MJZA 1SQVJ 1LTJB 2XNDH 1GTWA 1SFCA 3V2RA 1YQ4C 2NPSD 1JY3N 4BWNA 1Y47A 3RBZA 2QJKB 2QM7A 1GDTA 1K8AQ 3AE9C 1L0LJ 2ZT9B 1CI6B 1VQ4P 1SQPK 1KZUB 3AE8C 2R3CA 3PH0A 3I56P 3Q2YA 3LW5H 1LT1A 2M5AA 2OYIA 5AW2B 3A2AA 4EI2A 1H0TB 1S3JA 3U1CA 1KFMA 2SPZA 1KD1Q 4JQ0D 2Z5IA 3BRVB 1GU5A 1FZCC 5AW8B 1JO5A 4H44B 1KYOI 2YNYA 2IBZG 2Y0EA 2Q7CA 1LTJA 4PJ0H 2IBZD 5CBOA 4L76A 2OYHB 1SQBG 4HYTB 1JY2P 1RQUA 1SQBD 2K37A 2W6JH 2O01H 4NPFX 1ZLLA 1MFZA 1FOSE 3RK2C 1CI6A 2O1KA 3P8CD 3L72G 1KORA 2Q3EA 3L72D 2OTLP 1IK9A 1KB9D 4PV1D 2E5TA 1H0TA 3HE5B 1PP9E 2H8PD 2FYUJ 1LJ2A 1BGYJ 1CZQA 2B88A 4MN4C 3FGAD 1JMMA 1R5LA 2ZYDA 1LWUB 3G4SP 2IZ1A 1Z56A 3CXHH 1M56D 2BCCG 1L0NG 2BCCD 1Q81Q 2ZVOB 2NPSC 3HUSA 1L0ND 1JM0A 1S9KE 1Y8AA 3GW6A 1NTME 4H0LB 3KYQA 2IFMA 1Q7YQ 4YXWH 1LTBC 2MKVA 3E1RA 3QWOC 2OYHA 3ZDMA 2H7HA 4I7ZB 4YTPC 3H25A 3H1HD 2WSFH 1PZQA 4GT1A 1N73C 2JDIH 2D2CB 3L74J 2N1TD 2RN0A 2XKMA 1AQTA 2E75D 5APTA 1LTGC 4IFDK 2JP3A 4N78D 2QRXA 3CPWO 4JPZB 1RE4A 1RQVA 1NTZD 2AXTE 2Q6QA 1KC8Q 1AQ5A 3RK3E 3GG2A 1GK6A 4BRYB 5AVZB 1A02F 3H1IJ 1DD3A 4WB4A 5CCGA 2JWDA 2WZ7A 3RBXA 4PV1C 1VQ6P 1T8ZA 1IZNB 3BCCE 5B5EH 5GTIH 4RO0A 1N7SB 4DOJA 1R5SA 2NZ2A 3B8EB 3S4RA 3CX5I 3L37A 1EC5A 1YTZT 2GA1A 5APVA 2WT7B 2E5YA 3H1LE 2QIWA 2G3AA 1S5LX 2FYNC 3WU2H 4KT0J 3NFQA 4Z1MH 1SQVK 1FZCB 3A0BH 1J1EB 4EYYQ 3L70D 4RESB 5AW4B 2BEQD 1NWQA 3IR9A 5KTBA 3Q3DA 2VRSA 4K3AA 4GDOA 1L0LK 1AV1A 1DIPA 5AW1B 1VQOP 4BRYA 3S1KA 5AW7B 2GUVA 3E7KA 1UIIA 2PFXA 3CCUP 2WSCJ 2QA4P 2HPCB 2PGDA 1SQXE 2N1TC 1YJNP 1N7SA 3CWBG 1NTKE 3CWBD 2E75C 1MZ9A 3D70A 1SQPJ 4DT0A 1AVYA 1PGJA 3H1KG 2WT7A 3GF3A 3H1KD 4Y28J 2YKOA 2C0WA 3CX5H 1VQPP 5APQA 5APSA 1SQBJ 3M0AA 3H1JJ 2NPSB 1KQFB 3TNUB 3CXHE 2I1JA 3WUTA 2K88A 3V4WA 3TGUJ 1VQ5P 1N86A 1RF1B 5K5GB 2P10A 2YO2A 3SSUA 1NU1D 1VQ9P 1NTMG 3CC2P 4W7YA 4YXDC 2KZIA 4PD4E 1JY2O 4ZMDA 5BVZA 2HPCA 3NMDA 3CD6P 3O6QA 2YKQA 2M3EA 2Z5HA 2IZ0A 1LT9C 3M9QA 2BCCJ 1N73B 2HYNA 3E1IA 2KUBA 1K05A 2Q5UA 2KLUA 4GKGA 1LTTC 2L91A 2W83C 3D71A 2NPSA 3TNUA 1VQNP 2I8DA 4GOEA 2XZRA 2WVRA 2J58A 1M1JC 1Y9BA 2YO3A 1KV4A 5KKZC 3L71E 1RF1A 2H89C 3H1HJ 3H6PA 3HD7A 3IF4A 2ZYGA 3BVHA 2C9LY 3AE4C 1ZOYC 1G1JA 4ZKPA 2J59M 1U57A 3H1JE 4PV1B 1FJKA 5KAIE 2E43A 4WBAA 3HE4B 1FZAA 3QH9A 1NTZJ 1LTSC 1N73A 5GTIE 1HBWA 1HH0A 3BCCG 5DJUB 3AECC 1SQQD 1BE3J 2RH0A 2WPSA 1VQ8P 1HUCA 5CCHD 3VMZA 5KJ7A 3WU2E 1DEEG 3TK1A 2R32A 3H1LG 3A0BE 3H1LD 2ZYAA 2Q3IA 1EZVE 3AE3C 2IDBA 4JBZA 1IFNA 3CCRP 4EIJA 3SFDC 1ZN5A 2KNCB 2I1KA 4AUWA 2Z4EA 3FWNA 3I55P 1JY3P 2FYZA 3L36A 4O9BA 1YTZI 3TDKA 2YIUC 2R5BA 3HE4A 1M57D 3FX0A 3II6A 1OW6A 2XNXA 3RK2D 2P58A 3L70J 2E74D 2XU6A 3L73E 1FDIA 1PPJD 3CCQP 4JYBA 3M91A 3VMYA 3VYIA 1RY3A 4C7NA 1OW7A 2A45H 2AXTH 1QLED 4AQRD 4WY4C 1JNMA 1CW5A 1DD4A 4NPEA 4H13C 1H8AA 1KQGB 1ZXGA 1J2JB 1OVUA 2KNCA 1PL5A 1BE3E 3JCUH 2K1AA 3RK3C 4LGDE 4I1LA 3VTPC 1FDMA 3MZWB 3R2PA 3H1KJ 1GU4A 1KYOD 2QJYB 1KILD 2KS1B 1LT9B 4OVNF 3BASA 3CC7P 5CCHC 3CXHI 1SQBK 4DZOA 4W7ZA 1RF0C 1YBKA 3WUUA 4UB8H 1NU1J 2JJLA 4D6TE 1L4AD 1QEXA 1URQD 1M1JB 2KSJA 4PD4I 1JEKA 4XFJA 2H43A 2WITA 5KLIC 3L71G 5CJ4A 1S5LE 3L71D 1OVRA 2WPQA 3ITKA 1W5CE 1SQVE 2WWWA 3BATA 3CC4P 1DEBA 2E74C 1A02J 4WWIA 2KS1A 1L0NK 1GL2C 3TF5A 3V2NA 1LT9A 3MUDC 4Y99B 4GIFA 2O1JA 1NVOA 3LIDA 2B87B 2BEZF 2LXCB 3VN0A 1BCCG 3G71P 1M1KQ 1BCCD 1L0LE 5GTHH 5AVYB 2HG5D 3H32B 3AEGC 1M1JA 3HTKB 2KI7B 2V7QJ 2WMMA 5DJTB 4I6MC 1FOSF 3B71A 1Q86Q 2Y0DA 4U3FJ 1GW3A 1EZVG 2E76D 2V4HA 2B9BA 4PD4H 4A7PA 1KILC 3V2QA 1SQQJ 2YIUB 1JY2N 5AW5B 5L8RJ 3TYYA 1NTZK 3A5TA 3AEEC 2WSEJ 1LTAC 3HE5A 2B87A 4YPCA 2LXBA 1CSBA 2FFDB 3GF7A 3M0DC 1NKNA 2O3JA 1Q90D 2POHA 4IL6X 2ZXXA 1EZVI 2N9BA 2LR2A 1OW8A 1L4AC 3MTUE 1L2PA 1URQC 1X79B 1VF5D 3P32A 1LWUA 2WQYC 4AYCA 3L73G 3L73D 1P84E 1WMKA 3HTKA 1DH3A 3A0HH 3VOPA 5KLVG 5AW0B 3ABVC 5KLVD 1YITP 2FYUE 1SLQA 3CX5D 1BGYE 2ZFCA 3L75J 4OWFA 3U59A 2QSIA 2YMKA 3JCUE 4R4MA 5KAIH 1T3UA 1NAFA 2FKWB 5AVVB 1M90Q 4L75A 1TU3F 3PP5A 2KIKA 1JY3O 1PV3A 1YJ9P 1AVOA 4JYCA 2JEEA 4U3FE 5AVTB 4BXLA 2FFDA 2P67A 2R5DA 2R44A 4DCKA 2ZJSE 3OA7A 3EQ2A 3FXEA 1ZR4A 2A06E 3MP7B 2KSEA 4UB8E 1SS1A 2E76C 1KTMA 1IFDA 4EOTA 5H2FE 4D6TG 3L74E 2HLOA 2KYVA 5KLIB 3U1AA 1PGOA 4XA4A 1AA0A 3RK2B 2E74B 1XTCC 4UB6H 2WSFJ 1SQVG 3AE5C 3SWKA 1D7MA 3CCMP 1VF5C 1E5WA 2YKPA 3C1LA 1NU1K 3H1IE 1RF0A 1NTMK 1JB0J 1PP9G 1FZCA 5GTHE 1PP9D 4LLHA 3CCEP 1JMBA 1LP1B 4IFFA 2M0BA 1YQ3C 2Q1KA 3NXSA 3L72J 5AVQB 1S9KD 1MFTA 2KK7A 1MKMA 1NTMD 1KILB
chains in the Genus database with same CATH topology
2O01H 1YTZI 1ZLLA 3MUDA 1JOCA 1MFZA 2R5BA 1FOSE 4JF7A 3CL3D 2OARA 2M3BA 3HE4A 3RK2C 1RE3C 1CI6A 3M9HA 2O1KA 3C9IA 3P8CD 3V4QA 3II6A 2XNXA 3GHGC 3RK2D 1IJDB 1IK9A 2XU6A 1L4AB 3N7NA 1AFOA 3HE5B 4XE5B 3MIWA 4JYBA 4WY4A 2PP6A 2H8PD 3M91A 3VMYA 3VYIA 1RY3A 5CMZA 1CZQA 1IO4A 2P7JA 4C7NA 3N4XA 1JMMA 3VP9A 2A45H 4AQRD 3I5CA 1NHLA 1SP4A 2Q9IA 4WY4C 1LWUB 5AVXB 1WRGA 1JNMA 1Z56A 3B5NA 1CW5A 1OWAA 1T3JA 1H8AA 4WY4D 2CPSA 3A3YB 5APUA 2A45G 2NPSC 1G1IA 3HUSA 1J2JB 1S9KE 1FZFA 1FBMA 1EQ7A 3KYQA 4I2LC 1J1DB 2IFMA 1IFMA 1SQQK 1KILA 1LTBC 2CPBA 1SFCC 5CJ0A 3B5ND 3HUSC 2OYHA 3RK3C 1JCCA 4LGDE 4I1LA 3VTPC 1GL2B 1FDMA 2IFNA 3M06A 2H7HA 4C46A 1M7LA 3R2PA 3RK3D 3RL0B 2E42A 4N3YB 5BU8B 4HH2A 1GU4A 3P8CE 4IFMA 5CCHA 1KILD 2L5GB 1LT9B 2A45I 2WSFH 3BASA 1NOHA 4ZKUA 2W6BA 5CCHC 1JCDA 4GT1A 1T2KD 1N73C 2N1TD 1SQBK 3VP8A 4DZOA 4W7ZA 3WMM0 1RF0C 2XKMA 2OYIC 3L35A 5APTA 1LTGC 2HODB 4IFDK 4N78D 2JJLA 5BU5A 4M3LA 2XV5A 1L4AD 5AVSB 1RE4A 1URQD 1N7SD 1ZV8A 1M1JB 2KSJA 2GM4A 1NO4A 1GD2E 1KFNA 3SWFA 3V2PA 2H43A 2WITA 1RE4C 1LTJC 1KQLA 1AQ5A 2KP8A 5CJ4A 3OJAB 3UIAA 2PAJA 1GL2A 1HJBA 1DX7A 1GK6A 1SVFA 3HD7B 2WPQA 5AVZB 1OXZA 1A02F 2W27A 2WWWA 3BATA 2N1TB 4WB4A 5CCGA 1G2CB 1DEBA 2WZ7A 1A02J 3LIEA 3P8MC 1L0NK 1T8ZA 1GL2C 3V2NA 1LT9A 4Y99B 4GIFA 1GL2D 2O1JA 5AVWB 3LIDA 1URQB 3RL0D 1N7SB 4DOJA 1LTIC 1NKZB 3B8EB 3VN0A 2FYUK 3L37A 1YTZT 5CCGD 2LKMA 5APVA 2WT7B 5AVYB 1HWTC 4N78E 2HG5D 3H32B 2HODA 2C0XA 3OAKA 4W80A 2GUSA 3NFQA 1SQVK 1FZCB 5AW6B 1J1EB 1M1JA 3HTKB 1HVVA 4RESB 5AW4B 1IFIA 1MV8A 4I6MC 3B5NC 3VMXA 1FOSF 1WT6A 1QL1A 1NWQA 3IR9A 5KTBA 2VRSA 2W6AA 1GW3A 5AW9B 1L0LK 5AW1B 1KILC 3V2QA 5AW7B 1IFJA 2GUVA 1JY2N 2N1TA 2OYHC 5AW5B 3SWYA 1G2CA 3TYYA 3KQGA 1NTZK 3M0DA 1VDFA 3A5TA 3GHGB 2HPCB 1T2KC 1L4AA 1LTAC 2N1TC 3HE5A 1URQA 2KLVA 1N7SA 3HD7D 1CSBA 1N7LA 2FFDB 1YYCA 3M0DC 1MZ9A 3BRTB 1NKNA 2POHA 1N2DC 2N9BA 4Y99C 5APYA 2WT7A 3KDPB 1ZR2A 1L4AC 3MTUE 1URQC 1X79B 1N7SC 2P2UA 2WSEH 3P32A 1LWUA 2YKOA 4AYCA 1X9VA 2C0WA 2WTYA 3G3ZA 3HRNA 2XDJA 1VPCA 3L4FA 4N6JA 5APQA 3HTKA 5APSA 1DH3A 2YMYA 4C7NB 3M0AA 5AVRB 3VOPA 2NPSB 3TNUB 2KB7P 1LWUC 2I1JA 5AW0B 1SQXK 4LC1A 1SLQA 2ZFCA 1H89A 1FJPA 3V4WA 1NTKK 1J1EC 3MD0A 3MGNA 1SFCB 1N86A 1RF1B 3U59A 4B86A 3HUSB 2YO2A 3V5BA 1J1DC 5KJ7D 1IC2A 1T3UA 1NAFA 2FKWB 2FXMA 5AVVB 3PP5A 1HGZA 1QL2A 1RE3A 4W7YA 1JUNA 1GK4A 1JY3O 1JY2O 3RL0C 5APWA 5BVZA 3CI9A 3GHGA 3NMDA 2HPCA 2KOGA 2WPRA 5CCGC 4JYCA 2YKQA 1GW4A 2ZXEB 2JEEA 1XTGB 2Z5HA 3EFGA 4OH8B 1JTHB 5AVTB 2FFDA 2P67A 2R5DA 1LT9C 5AVUB 3M9QA 2P1JA 5AW3B 1W2EA 1N73B 2HYNA 1X8YA 1NH4A 4KHXA 3A7OA 2OYIB 3OA7A 3E1IA 1HGVA 2FFDC 3EQ2A 2Q5UA 1ZR4A 4GKGA 2C9NY 1LTTC 1H88A 3NTNA 1FU1A 1GZLA 2NPSA 3TNUA 5APXA 2XZRA 1IFDA 4EOTA 1FZGA 3KPEA 2J58A 1M1JC 2YO3A 2HLOA 1FZEA 2MJZA 2KYVA 1MUUA 3M9BA 1LTJB 1GTWA 1SFCA 1RF1A 3T97A 1HTLC 3H6PA 3V2RA 3HD7A 2HFED 3U1AA 2NPSD 1JY3N 4XA4A 3BVHA 2C9LY 3RK2B 1G1JA 4ZKPA 1LGHB 1RF1C 2J59M 2QM7A 1GDTA 1XTCC 3HD7C 1FJKA 1SFCD 1PFIA 2E43A 5KLVK 4WBAA 3HE4B 1CI6B 1JTHA 1FZAA 1SQPK 1KZUB 2WSCH 5CHXA 2R3CA 1E5WA 2YKPA 1LTSC 1N73A 1HBWA 1HH0A 3LW5H 1NU1K 2M8RA 3H32A 1RF0A 5AW2B 3A2AA 4C7RA 2OYIA 1NTMK 2QM8A 1FZCA 4WY4B 3U1CA 4LLHA 2WPSA 1KFMA 1HUCA 5CCHD 3VMZA 5KJ7A 1FAVA 2Z5IA 3BRVB 3TK1A 2R32A 1GU5A 4IFFA 3P7KA 1FZCC 5AW8B 1JO5A 3O8ZA 3B5NB 2Q3IA 2YNYA 5KJ7C 2BASA 3NXSA 2Q7CA 1LTJA 3RK3B 1IFNA 3TSIA 4EIJA 2IX7C 2IPPA 1ZN5A 5AVQB 1S9KD 2I1KA 3CLQA 1KILB 4AUWA 2Z4EA 2OYHB 1JY3P 4HYTB 1JY2P 2FYZA 3IFMA 1FZBA 3L36A 4O9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KYV A;  1N7L A;  1ZLL A;  1FJK A;  1FJP A;  2KB7 P;  2HYN A;  2M3B A; 
#chains in the Genus database with same CATH topology
 3MUD A;  1JOC A;  4JF7 A;  3CL3 D;  3M9H A;  4H0L D;  3C9I A;  3GHG C;  2FY8 A;  1L0N J;  1IJD B;  2ZT9 C;  1L4A B;  1U7M A;  3EWK A;  3N7N A;  1AFO A;  4XE5 B;  2JWA A;  3RL0 g;  1IO4 A;  3VP9 A;  1LP1 A;  2HR3 A;  1NHL A;  1SP4 A;  2Q9I A;  1SQP E;  3A0H E;  1T3J A;  2IBZ E;  4WY4 D;  3A3Y B;  1AJY A;  5APU A;  2A45 G;  1G1I A;  4H13 D;  3OW2 O;  1EXI A;  1FBM A;  1EQ7 A;  1S5L H;  3V6I A;  4I2L C;  1SQQ K;  1KIL A;  2FYU G;  1USD A;  2FYU D;  4RJT A;  5CBN A;  1SQB E;  3B5N D;  3HUS C;  2FXP A;  2Y0C A;  3S9O A;  1JCC A;  1FDO A;  4C46 A;  2E42 A;  3RK3 D;  3SFE C;  3CMA P;  5BU8 B;  4HH2 A;  3P8C E;  4IFM A;  3TGU E;  4KJM A;  2L5G B;  1KB9 E;  1P84 I;  2A45 I;  3BCC D;  1NOH A;  2FYN B;  2NRG A;  1IK7 A;  2WSS H;  2K9J B;  2FBW C;  4TLF A;  2HOD B;  5TIS H;  4M3L A;  2E76 B;  1OX3 A;  2JO1 A;  1OIP A;  2BCC E;  2A06 G;  1ZV8 A;  1N7S D;  2A06 D;  2GM4 A;  1NO4 A;  1M8O B;  3AEB C;  1GD2 E;  1KFN A;  3SWF A;  3V2P A;  1RE4 C;  1S1C X;  2AEM A;  1KQL A;  3L74 G;  2Y9Z A;  2KP8 A;  3UIA A;  5E79 H;  1HJB A;  4H0L C;  1OXZ A;  1R8E A;  2N1T B;  1ZP0 C;  1G2C B;  4UB6 E;  2E75 B;  3H1H E;  3P8M C;  1VF5 B;  1SQX G;  1GL2 D;  1EDL A;  1SQX D;  4I7Z C;  1EDI A;  3RL0 D;  1EXJ A;  1NTK G;  3RGU A;  1NTK D;  2FXO A;  2K9J A;  2ZAE B;  1P84 H;  4N78 E;  3H1I G;  2HOD A;  2O01 N;  2D2C C;  1NTZ E;  5EFW B;  2K9Y A;  1IFI A;  1MV8 A;  1BDD A;  1Q2N A;  3B5N C;  3VMX A;  1GMJ A;  3PJS K;  3CXH D;  2RMZ A;  3CWB J;  2W6A A;  3IN6 A;  1BSN A;  1NAY A;  1NGM B;  3USS A;  3AEA C;  1LNQ A;  2V7Q H;  3D6Y A;  5M1B A;  2N1T A;  1G2C A;  1K73 Q;  1PP9 J;  3KQG A;  2ZVN B;  4DJG A;  1VDF A;  3GHG B;  4PD4 D;  1OZH A;  2KLV A;  3HD7 D;  4NPD A;  3PHL A;  4U7J A;  1E79 H;  1S2E A;  3G6E P;  1BSH A;  2WSE H;  2P2U A;  1N7S C;  2JR8 A;  3CCV P;  1NTM J;  1N8R Q;  1KMI Z;  3G3Z A;  3HRN A;  2XDJ A;  1VPC A;  5H2F H;  3L70 E;  2OTK E;  5KKZ B;  5AVR B;  2KB7 P;  1ZRT E;  4IOI H;  1SQP G;  4ASV A;  1J1E C;  3MD0 A;  1SQP D;  2R3S A;  3T97 B;  2OYO A;  3HUS B;  3V5B A;  1J1D C;  2W90 A;  5KJ7 D;  1Q82 Q;  1IC2 A;  1QGK B;  2QJP C;  2FXM A;  1QL2 A;  1ZW0 A;  4HJG H;  3Q5P A;  4ZNC A;  3H1J G;  3RL0 C;  3GHG A;  3H1J D;  4L74 A;  2WPR A;  1NJI Q;  3JC2 2;  1IFP A;  1XTG B;  2J5U A;  3CWB E;  3EFG A;  4OH8 B;  3TGU G;  1X0T A;  1OMI A;  1JTH B;  4L73 A;  3TGU D;  1FE6 A;  5AVU B;  2P1J A;  5AW3 B;  2IBZ I;  3H1K E;  4GOD A;  3B4S A;  1VQ7 P;  1U7J A;  3NTN A;  1FU1 A;  5TIS E;  4GOF A;  4K35 A;  2PRR A;  1FZG A;  3KPE A;  1FZE A;  1MUU A;  3M9B A;  1EZV D;  3T97 A;  1HTL C;  1NU1 E;  2HFE D;  1KB9 I;  1RHZ B;  3BCC J;  3PTZ A;  5E79 E;  1KYO H;  1LGH B;  1RF1 C;  1PFI A;  3HD7 C;  1SFC D;  3LW5 J;  3FXD A;  3Q5S A;  5KLV K;  3H1L J;  1JTH A;  3MHV A;  2WSC H;  5CHX A;  3H1H G;  3PLN A;  5KAF E;  2M8R A;  3H32 A;  4C7R A;  2YXR B;  2QM8 A;  4WY4 B;  4H13 B;  1FAV A;  1YI2 P;  1KQS O;  3Q5R A;  3AEF C;  3P7K A;  4R4L A;  3O8Z A;  3B5N B;  2UWJ E;  5KJ7 C;  4EDF A;  2BAS A;  1NTZ G;  3RK3 B;  3TSI A;  2IX7 C;  2IPP A;  2O01 J;  3AE7 C;  3CLQ A;  1SQX J;  1BE3 G;  1BE3 D;  2YXQ B;  4OGQ D;  1NTK J;  3VMA A;  3IFM A;  1FZB A;  1KB9 H;  2AXC A;  2OAR A;  2M3B A;  1RE3 C;  3V4Q A;  3CCJ P;  3AE2 C;  1RH5 B;  4ASW A;  1SQQ E;  3EFF K;  3MIW A;  4WY4 A;  2PP6 A;  2ZT9 D;  1S72 P;  2IYO A;  3JSV C;  5CMZ A;  1S4X A;  2P7J A;  3N4X A;  3I5C A;  3GMA A;  5AVX B;  1WRG A;  3B5N A;  1OWA A;  4D6T D;  2CPS A;  3L70 G;  1FZF A;  3CCS P;  3CCL P;  1J1D B;  1IFM A;  3KZI H;  2CPB A;  1ZRT D;  1SFC C;  4PJ0 E;  2QJP B;  5CJ0 A;  4H44 D;  1W2B O;  1GL2 B;  2IFN A;  3M06 A;  1M7L A;  3RL0 B;  4N3Y B;  4RKU J;  3L75 E;  5CCH A;  1SQV D;  2N9Y B;  3AED C;  1QVF O;  3C8V A;  1PPJ E;  4ZKU A;  3PRJ A;  3O6Q B;  2W6B A;  1BDC A;  4WVZ A;  1JCD A;  1T2K D;  3GLM A;  5B66 H;  1VQK P;  3VP8 A;  1L0L G;  3IAO A;  3WMM 0;  2OYI C;  1VL2 A;  3L71 J;  1L0L D;  3L35 A;  1T6A A;  5BU5 A;  2XV5 A;  1K04 A;  5TJH A;  5AVS B;  4IL6 H;  3D6Z A;  2WPV B;  4OGQ C;  1NYH A;  1FS0 E;  3Q1M A;  1LTJ C;  3F89 A;  1BCC J;  1OFC X;  3OJA B;  5C39 A;  2PAJ A;  1GL2 A;  1DX7 A;  1NU1 G;  1SVF A;  3HD7 B;  1USE A;  1KYO E;  2QJK C;  2W27 A;  1ZME C;  1KIL E;  3CME P;  3FWL A;  3LIE A;  1VQM P;  3KHU A;  5AVW B;  1URQ B;  2AEJ A;  1LTI C;  2QJY C;  1NKZ B;  2FYU K;  4CPG A;  3F5H A;  1QX8 A;  5CCG D;  4TT3 H;  2LKM A;  1YHQ P;  1HWT C;  2C0X A;  3OAK A;  4W80 A;  2GUS A;  5AW6 B;  2DW3 A;  3W68 A;  1P84 D;  1HVV A;  1PGQ A;  2D2C D;  2W8Z A;  4H44 C;  1WT6 A;  1QL1 A;  1BGY G;  1QVG O;  1BGY D;  1UIX A;  1HJ0 A;  5AW9 B;  1YJW P;  2KXP B;  2QG4 A;  1IFJ A;  2RKL A;  2OYH C;  3SWY A;  3L73 J;  3L72 E;  3M0D A;  1PIX A;  1T2K C;  1L4A A;  2H88 C;  5KLV J;  1URQ A;  2CK3 H;  1N7L A;  2ITA A;  4U3F G;  1EDK A;  3AE6 C;  1YYC A;  1BCC E;  3BRT B;  4U3F D;  4QMA A;  2OGU A;  5B5E E;  1N2D C;  4Y99 C;  5APY A;  3KDP B;  1ZR2 A;  2Y9Y A;  1PGP A;  1SQQ G;  2K3R A;  1X9V A;  2WTY A;  2OTJ P;  2JKV A;  3R4Y A;  3L4F A;  1L0N E;  4N6J A;  2G8Y A;  2YMY A;  2QE7 H;  4C7N B;  1FC2 C;  1LWU C;  1SQX K;  3G9R A;  4LC1 A;  3W67 A;  1KN7 A;  1VQL P;  1H89 A;  1FJP A;  1NTK K;  3L74 D;  3MGN A;  1SFC B;  4B86 A;  3KZI E;  3KXD A;  1X22 A;  2OQQ A;  1HGZ A;  1HF9 A;  4HB1 A;  1EDJ A;  1RE3 A;  1JUN A;  1GK4 A;  5APW A;  3CI9 A;  2KOG A;  2IYP A;  2KZJ A;  3WUV A;  1OVV A;  1YIJ P;  5KAF H;  5CCG C;  1GW4 A;  3L75 G;  2ZXE B;  2B89 A;  3L75 D;  4D6T J;  1W2E A;  2QVA A;  1X8Y A;  1K9M Q;  1NH4 A;  3K5B A;  4KHX A;  2M5A B;  3A7O A;  2OYI B;  3H1I D;  5B66 E;  1HGV A;  1PPJ G;  2FFD C;  2C9N Y;  1H88 A;  1GZL A;  4HKZ H;  5KLV E;  2QEX P;  3CX5 E;  5APX A;  2AEF A;  4IL6 E;  4OGQ B;  3AE1 C;  2MJZ A;  1SQV J;  1LTJ B;  2XND H;  1GTW A;  1SFC A;  3V2R A;  1YQ4 C;  2NPS D;  1JY3 N;  4BWN A;  1Y47 A;  3RBZ A;  2QJK B;  2QM7 A;  1GDT A;  1K8A Q;  3AE9 C;  1L0L J;  2ZT9 B;  1CI6 B;  1VQ4 P;  1SQP K;  1KZU B;  3AE8 C;  2R3C A;  3PH0 A;  3I56 P;  3Q2Y A;  3LW5 H;  1LT1 A;  2M5A A;  2OYI A;  5AW2 B;  3A2A A;  4EI2 A;  1H0T B;  1S3J A;  3U1C A;  1KFM A;  2SPZ A;  1KD1 Q;  4JQ0 D;  2Z5I A;  3BRV B;  1GU5 A;  1FZC C;  5AW8 B;  1JO5 A;  4H44 B;  1KYO I;  2YNY A;  2IBZ G;  2Y0E A;  2Q7C A;  1LTJ A;  4PJ0 H;  2IBZ D;  5CBO A;  4L76 A;  2OYH B;  1SQB G;  4HYT B;  1JY2 P;  1RQU A;  1SQB D;  2K37 A;  2W6J H;  2O01 H;  4NPF X;  1ZLL A;  1MFZ A;  1FOS E;  3RK2 C;  1CI6 A;  2O1K A;  3P8C D;  3L72 G;  1KOR A;  2Q3E A;  3L72 D;  2OTL P;  1IK9 A;  1KB9 D;  4PV1 D;  2E5T A;  1H0T A;  3HE5 B;  1PP9 E;  2H8P D;  2FYU J;  1LJ2 A;  1BGY J;  1CZQ A;  2B88 A;  4MN4 C;  3FGA D;  1JMM A;  1R5L A;  2ZYD A;  1LWU B;  3G4S P;  2IZ1 A;  1Z56 A;  3CXH H;  1M56 D;  2BCC G;  1L0N G;  2BCC D;  1Q81 Q;  2ZVO B;  2NPS C;  3HUS A;  1L0N D;  1JM0 A;  1S9K E;  1Y8A A;  3GW6 A;  1NTM E;  4H0L B;  3KYQ A;  2IFM A;  1Q7Y Q;  4YXW H;  1LTB C;  2MKV A;  3E1R A;  3QWO C;  2OYH A;  3ZDM A;  2H7H A;  4I7Z B;  4YTP C;  3H25 A;  3H1H D;  2WSF H;  1PZQ A;  4GT1 A;  1N73 C;  2JDI H;  2D2C B;  3L74 J;  2N1T D;  2RN0 A;  2XKM A;  1AQT A;  2E75 D;  5APT A;  1LTG C;  4IFD K;  2JP3 A;  4N78 D;  2QRX A;  3CPW O;  4JPZ B;  1RE4 A;  1RQV A;  1NTZ D;  2AXT E;  2Q6Q A;  1KC8 Q;  1AQ5 A;  3RK3 E;  3GG2 A;  1GK6 A;  4BRY B;  5AVZ B;  1A02 F;  3H1I J;  1DD3 A;  4WB4 A;  5CCG A;  2JWD A;  2WZ7 A;  3RBX A;  4PV1 C;  1VQ6 P;  1T8Z A;  1IZN B;  3BCC E;  5B5E H;  5GTI H;  4RO0 A;  1N7S B;  4DOJ A;  1R5S A;  2NZ2 A;  3B8E B;  3S4R A;  3CX5 I;  3L37 A;  1EC5 A;  1YTZ T;  2GA1 A;  5APV A;  2WT7 B;  2E5Y A;  3H1L E;  2QIW A;  2G3A A;  1S5L X;  2FYN C;  3WU2 H;  4KT0 J;  3NFQ A;  4Z1M H;  1SQV K;  1FZC B;  3A0B H;  1J1E B;  4EYY Q;  3L70 D;  4RES B;  5AW4 B;  2BEQ D;  1NWQ A;  3IR9 A;  5KTB A;  3Q3D A;  2VRS A;  4K3A A;  4GDO A;  1L0L K;  1AV1 A;  1DIP A;  5AW1 B;  1VQO P;  4BRY A;  3S1K A;  5AW7 B;  2GUV A;  3E7K A;  1UII A;  2PFX A;  3CCU P;  2WSC J;  2QA4 P;  2HPC B;  2PGD A;  1SQX E;  2N1T C;  1YJN P;  1N7S A;  3CWB G;  1NTK E;  3CWB D;  2E75 C;  1MZ9 A;  3D70 A;  1SQP J;  4DT0 A;  1AVY A;  1PGJ A;  3H1K G;  2WT7 A;  3GF3 A;  3H1K D;  4Y28 J;  2YKO A;  2C0W A;  3CX5 H;  1VQP P;  5APQ A;  5APS A;  1SQB J;  3M0A A;  3H1J J;  2NPS B;  1KQF B;  3TNU B;  3CXH E;  2I1J A;  3WUT A;  2K88 A;  3V4W A;  3TGU J;  1VQ5 P;  1N86 A;  1RF1 B;  5K5G B;  2P10 A;  2YO2 A;  3SSU A;  1NU1 D;  1VQ9 P;  1NTM G;  3CC2 P;  4W7Y A;  4YXD C;  2KZI A;  4PD4 E;  1JY2 O;  4ZMD A;  5BVZ A;  2HPC A;  3NMD A;  3CD6 P;  3O6Q A;  2YKQ A;  2M3E A;  2Z5H A;  2IZ0 A;  1LT9 C;  3M9Q A;  2BCC J;  1N73 B;  2HYN A;  3E1I A;  2KUB A;  1K05 A;  2Q5U A;  2KLU A;  4GKG A;  1LTT C;  2L91 A;  2W83 C;  3D71 A;  2NPS A;  3TNU A;  1VQN P;  2I8D A;  4GOE A;  2XZR A;  2WVR A;  2J58 A;  1M1J C;  1Y9B A;  2YO3 A;  1KV4 A;  5KKZ C;  3L71 E;  1RF1 A;  2H89 C;  3H1H J;  3H6P A;  3HD7 A;  3IF4 A;  2ZYG A;  3BVH A;  2C9L Y;  3AE4 C;  1ZOY C;  1G1J A;  4ZKP A;  2J59 M;  1U57 A;  3H1J E;  4PV1 B;  1FJK A;  5KAI E;  2E43 A;  4WBA A;  3HE4 B;  1FZA A;  3QH9 A;  1NTZ J;  1LTS C;  1N73 A;  5GTI E;  1HBW A;  1HH0 A;  3BCC G;  5DJU B;  3AEC C;  1SQQ D;  1BE3 J;  2RH0 A;  2WPS A;  1VQ8 P;  1HUC A;  5CCH D;  3VMZ A;  5KJ7 A;  3WU2 E;  1DEE G;  3TK1 A;  2R32 A;  3H1L G;  3A0B E;  3H1L D;  2ZYA A;  2Q3I A;  1EZV E;  3AE3 C;  2IDB A;  4JBZ A;  1IFN A;  3CCR P;  4EIJ A;  3SFD C;  1ZN5 A;  2KNC B;  2I1K A;  4AUW A;  2Z4E A;  3FWN A;  3I55 P;  1JY3 P;  2FYZ A;  3L36 A;  4O9B A;  1YTZ I;  3TDK A;  2YIU C;  2R5B A;  3HE4 A;  1M57 D;  3FX0 A;  3II6 A;  1OW6 A;  2XNX A;  3RK2 D;  2P58 A;  3L70 J;  2E74 D;  2XU6 A;  3L73 E;  1FDI A;  1PPJ D;  3CCQ P;  4JYB A;  3M91 A;  3VMY A;  3VYI A;  1RY3 A;  4C7N A;  1OW7 A;  2A45 H;  2AXT H;  1QLE D;  4AQR D;  4WY4 C;  1JNM A;  1CW5 A;  1DD4 A;  4NPE A;  4H13 C;  1H8A A;  1KQG B;  1ZXG A;  1J2J B;  1OVU A;  2KNC A;  1PL5 A;  1BE3 E;  3JCU H;  2K1A A;  3RK3 C;  4LGD E;  4I1L A;  3VTP C;  1FDM A;  3MZW B;  3R2P A;  3H1K J;  1GU4 A;  1KYO D;  2QJY B;  1KIL D;  2KS1 B;  1LT9 B;  4OVN F;  3BAS A;  3CC7 P;  5CCH C;  3CXH I;  1SQB K;  4DZO A;  4W7Z A;  1RF0 C;  1YBK A;  3WUU A;  4UB8 H;  1NU1 J;  2JJL A;  4D6T E;  1L4A D;  1QEX A;  1URQ D;  1M1J B;  2KSJ A;  4PD4 I;  1JEK A;  4XFJ A;  2H43 A;  2WIT A;  5KLI C;  3L71 G;  5CJ4 A;  1S5L E;  3L71 D;  1OVR A;  2WPQ A;  3ITK A;  1W5C E;  1SQV E;  2WWW A;  3BAT A;  3CC4 P;  1DEB A;  2E74 C;  1A02 J;  4WWI A;  2KS1 A;  1L0N K;  1GL2 C;  3TF5 A;  3V2N A;  1LT9 A;  3MUD C;  4Y99 B;  4GIF A;  2O1J A;  1NVO A;  3LID A;  2B87 B;  2BEZ F;  2LXC B;  3VN0 A;  1BCC G;  3G71 P;  1M1K Q;  1BCC D;  1L0L E;  5GTH H;  5AVY B;  2HG5 D;  3H32 B;  3AEG C;  1M1J A;  3HTK B;  2KI7 B;  2V7Q J;  2WMM A;  5DJT B;  4I6M C;  1FOS F;  3B71 A;  1Q86 Q;  2Y0D A;  4U3F J;  1GW3 A;  1EZV G;  2E76 D;  2V4H A;  2B9B A;  4PD4 H;  4A7P A;  1KIL C;  3V2Q A;  1SQQ J;  2YIU B;  1JY2 N;  5AW5 B;  5L8R J;  3TYY A;  1NTZ K;  3A5T A;  3AEE C;  2WSE J;  1LTA C;  3HE5 A;  2B87 A;  4YPC A;  2LXB A;  1CSB A;  2FFD B;  3GF7 A;  3M0D C;  1NKN A;  2O3J A;  1Q90 D;  2POH A;  4IL6 X;  2ZXX A;  1EZV I;  2N9B A;  2LR2 A;  1OW8 A;  1L4A C;  3MTU E;  1L2P A;  1URQ C;  1X79 B;  1VF5 D;  3P32 A;  1LWU A;  2WQY C;  4AYC A;  3L73 G;  3L73 D;  1P84 E;  1WMK A;  3HTK A;  1DH3 A;  3A0H H;  3VOP A;  5KLV G;  5AW0 B;  3ABV C;  5KLV D;  1YIT P;  2FYU E;  1SLQ A;  3CX5 D;  1BGY E;  2ZFC A;  3L75 J;  4OWF A;  3U59 A;  2QSI A;  2YMK A;  3JCU E;  4R4M A;  5KAI H;  1T3U A;  1NAF A;  2FKW B;  5AVV B;  1M90 Q;  4L75 A;  1TU3 F;  3PP5 A;  2KIK A;  1JY3 O;  1PV3 A;  1YJ9 P;  1AVO A;  4JYC A;  2JEE A;  4U3F E;  5AVT B;  4BXL A;  2FFD A;  2P67 A;  2R5D A;  2R44 A;  4DCK A;  2ZJS E;  3OA7 A;  3EQ2 A;  3FXE A;  1ZR4 A;  2A06 E;  3MP7 B;  2KSE A;  4UB8 E;  1SS1 A;  2E76 C;  1KTM A;  1IFD A;  4EOT A;  5H2F E;  4D6T G;  3L74 E;  2HLO A;  2KYV A;  5KLI B;  3U1A A;  1PGO A;  4XA4 A;  1AA0 A;  3RK2 B;  2E74 B;  1XTC C;  4UB6 H;  2WSF J;  1SQV G;  3AE5 C;  3SWK A;  1D7M A;  3CCM P;  1VF5 C;  1E5W A;  2YKP A;  3C1L A;  1NU1 K;  3H1I E;  1RF0 A;  1NTM K;  1JB0 J;  1PP9 G;  1FZC A;  5GTH E;  1PP9 D;  4LLH A;  3CCE P;  1JMB A;  1LP1 B;  4IFF A;  2M0B A;  1YQ3 C;  2Q1K A;  3NXS A;  3L72 J;  5AVQ B;  1S9K D;  1MFT A;  2KK7 A;  1MKM A;  1NTM D;  1KIL B; 
#chains in the Genus database with same CATH homology
 2O01 H;  1YTZ I;  1ZLL A;  3MUD A;  1JOC A;  1MFZ A;  2R5B A;  1FOS E;  4JF7 A;  3CL3 D;  2OAR A;  2M3B A;  3HE4 A;  3RK2 C;  1RE3 C;  1CI6 A;  3M9H A;  2O1K A;  3C9I A;  3P8C D;  3V4Q A;  3II6 A;  2XNX A;  3GHG C;  3RK2 D;  1IJD B;  1IK9 A;  2XU6 A;  1L4A B;  3N7N A;  1AFO A;  3HE5 B;  4XE5 B;  3MIW A;  4JYB A;  4WY4 A;  2PP6 A;  2H8P D;  3M91 A;  3VMY A;  3VYI A;  1RY3 A;  5CMZ A;  1CZQ A;  1IO4 A;  2P7J A;  4C7N A;  3N4X A;  1JMM A;  3VP9 A;  2A45 H;  4AQR D;  3I5C A;  1NHL A;  1SP4 A;  2Q9I A;  4WY4 C;  1LWU B;  5AVX B;  1WRG A;  1JNM A;  1Z56 A;  3B5N A;  1CW5 A;  1OWA A;  1T3J A;  1H8A A;  4WY4 D;  2CPS A;  3A3Y B;  5APU A;  2A45 G;  2NPS C;  1G1I A;  3HUS A;  1J2J B;  1S9K E;  1FZF A;  1FBM A;  1EQ7 A;  3KYQ A;  4I2L C;  1J1D B;  2IFM A;  1IFM A;  1SQQ K;  1KIL A;  1LTB C;  2CPB A;  1SFC C;  5CJ0 A;  3B5N D;  3HUS C;  2OYH A;  3RK3 C;  1JCC A;  4LGD E;  4I1L A;  3VTP C;  1GL2 B;  1FDM A;  2IFN A;  3M06 A;  2H7H A;  4C46 A;  1M7L A;  3R2P A;  3RK3 D;  3RL0 B;  2E42 A;  4N3Y B;  5BU8 B;  4HH2 A;  1GU4 A;  3P8C E;  4IFM A;  5CCH A;  1KIL D;  2L5G B;  1LT9 B;  2A45 I;  2WSF H;  3BAS A;  1NOH A;  4ZKU A;  2W6B A;  5CCH C;  1JCD A;  4GT1 A;  1T2K D;  1N73 C;  2N1T D;  1SQB K;  3VP8 A;  4DZO A;  4W7Z A;  3WMM 0;  1RF0 C;  2XKM A;  2OYI C;  3L35 A;  5APT A;  1LTG C;  2HOD B;  4IFD K;  4N78 D;  2JJL A;  5BU5 A;  4M3L A;  2XV5 A;  1L4A D;  5AVS B;  1RE4 A;  1URQ D;  1N7S D;  1ZV8 A;  1M1J B;  2KSJ A;  2GM4 A;  1NO4 A;  1GD2 E;  1KFN A;  3SWF A;  3V2P A;  2H43 A;  2WIT A;  1RE4 C;  1LTJ C;  1KQL A;  1AQ5 A;  2KP8 A;  5CJ4 A;  3OJA B;  3UIA A;  2PAJ A;  1GL2 A;  1HJB A;  1DX7 A;  1GK6 A;  1SVF A;  3HD7 B;  2WPQ A;  5AVZ B;  1OXZ A;  1A02 F;  2W27 A;  2WWW A;  3BAT A;  2N1T B;  4WB4 A;  5CCG A;  1G2C B;  1DEB A;  2WZ7 A;  1A02 J;  3LIE A;  3P8M C;  1L0N K;  1T8Z A;  1GL2 C;  3V2N A;  1LT9 A;  4Y99 B;  4GIF A;  1GL2 D;  2O1J A;  5AVW B;  3LID A;  1URQ B;  3RL0 D;  1N7S B;  4DOJ A;  1LTI C;  1NKZ B;  3B8E B;  3VN0 A;  2FYU K;  3L37 A;  1YTZ T;  5CCG D;  2LKM A;  5APV A;  2WT7 B;  5AVY B;  1HWT C;  4N78 E;  2HG5 D;  3H32 B;  2HOD A;  2C0X A;  3OAK A;  4W80 A;  2GUS A;  3NFQ A;  1SQV K;  1FZC B;  5AW6 B;  1J1E B;  1M1J A;  3HTK B;  1HVV A;  4RES B;  5AW4 B;  1IFI A;  1MV8 A;  4I6M C;  3B5N C;  3VMX A;  1FOS F;  1WT6 A;  1QL1 A;  1NWQ A;  3IR9 A;  5KTB A;  2VRS A;  2W6A A;  1GW3 A;  5AW9 B;  1L0L K;  5AW1 B;  1KIL C;  3V2Q A;  5AW7 B;  1IFJ A;  2GUV A;  1JY2 N;  2N1T A;  2OYH C;  5AW5 B;  3SWY A;  1G2C A;  3TYY A;  3KQG A;  1NTZ K;  3M0D A;  1VDF A;  3A5T A;  3GHG B;  2HPC B;  1T2K C;  1L4A A;  1LTA C;  2N1T C;  3HE5 A;  1URQ A;  2KLV A;  1N7S A;  3HD7 D;  1CSB A;  1N7L A;  2FFD B;  1YYC A;  3M0D C;  1MZ9 A;  3BRT B;  1NKN A;  2POH A;  1N2D C;  2N9B A;  4Y99 C;  5APY A;  2WT7 A;  3KDP B;  1ZR2 A;  1L4A C;  3MTU E;  1URQ C;  1X79 B;  1N7S C;  2P2U A;  2WSE H;  3P32 A;  1LWU A;  2YKO A;  4AYC A;  1X9V A;  2C0W A;  2WTY A;  3G3Z A;  3HRN A;  2XDJ A;  1VPC A;  3L4F A;  4N6J A;  5APQ A;  3HTK A;  5APS A;  1DH3 A;  2YMY A;  4C7N B;  3M0A A;  5AVR B;  3VOP A;  2NPS B;  3TNU B;  2KB7 P;  1LWU C;  2I1J A;  5AW0 B;  1SQX K;  4LC1 A;  1SLQ A;  2ZFC A;  1H89 A;  1FJP A;  3V4W A;  1NTK K;  1J1E C;  3MD0 A;  3MGN A;  1SFC B;  1N86 A;  1RF1 B;  3U59 A;  4B86 A;  3HUS B;  2YO2 A;  3V5B A;  1J1D C;  5KJ7 D;  1IC2 A;  1T3U A;  1NAF A;  2FKW B;  2FXM A;  5AVV B;  3PP5 A;  1HGZ A;  1QL2 A;  1RE3 A;  4W7Y A;  1JUN A;  1GK4 A;  1JY3 O;  1JY2 O;  3RL0 C;  5APW A;  5BVZ A;  3CI9 A;  3GHG A;  3NMD A;  2HPC A;  2KOG A;  2WPR A;  5CCG C;  4JYC A;  2YKQ A;  1GW4 A;  2ZXE B;  2JEE A;  1XTG B;  2Z5H A;  3EFG A;  4OH8 B;  1JTH B;  5AVT B;  2FFD A;  2P67 A;  2R5D A;  1LT9 C;  5AVU B;  3M9Q A;  2P1J A;  5AW3 B;  1W2E A;  1N73 B;  2HYN A;  1X8Y A;  1NH4 A;  4KHX A;  3A7O A;  2OYI B;  3OA7 A;  3E1I A;  1HGV A;  2FFD C;  3EQ2 A;  2Q5U A;  1ZR4 A;  4GKG A;  2C9N Y;  1LTT C;  1H88 A;  3NTN A;  1FU1 A;  1GZL A;  2NPS A;  3TNU A;  5APX A;  2XZR A;  1IFD A;  4EOT A;  1FZG A;  3KPE A;  2J58 A;  1M1J C;  2YO3 A;  2HLO A;  1FZE A;  2MJZ A;  2KYV A;  1MUU A;  3M9B A;  1LTJ B;  1GTW A;  1SFC A;  1RF1 A;  3T97 A;  1HTL C;  3H6P A;  3V2R A;  3HD7 A;  2HFE D;  3U1A A;  2NPS D;  1JY3 N;  4XA4 A;  3BVH A;  2C9L Y;  3RK2 B;  1G1J A;  4ZKP A;  1LGH B;  1RF1 C;  2J59 M;  2QM7 A;  1GDT A;  1XTC C;  3HD7 C;  1FJK A;  1SFC D;  1PFI A;  2E43 A;  5KLV K;  4WBA A;  3HE4 B;  1CI6 B;  1JTH A;  1FZA A;  1SQP K;  1KZU B;  2WSC H;  5CHX A;  2R3C A;  1E5W A;  2YKP A;  1LTS C;  1N73 A;  1HBW A;  1HH0 A;  3LW5 H;  1NU1 K;  2M8R A;  3H32 A;  1RF0 A;  5AW2 B;  3A2A A;  4C7R A;  2OYI A;  1NTM K;  2QM8 A;  1FZC A;  4WY4 B;  3U1C A;  4LLH A;  2WPS A;  1KFM A;  1HUC A;  5CCH D;  3VMZ A;  5KJ7 A;  1FAV A;  2Z5I A;  3BRV B;  3TK1 A;  2R32 A;  1GU5 A;  4IFF A;  3P7K A;  1FZC C;  5AW8 B;  1JO5 A;  3O8Z A;  3B5N B;  2Q3I A;  2YNY A;  5KJ7 C;  2BAS A;  3NXS A;  2Q7C A;  1LTJ A;  3RK3 B;  1IFN A;  3TSI A;  4EIJ A;  2IX7 C;  2IPP A;  1ZN5 A;  5AVQ B;  1S9K D;  2I1K A;  3CLQ A;  1KIL B;  4AUW A;  2Z4E A;  2OYH B;  1JY3 P;  4HYT B;  1JY2 P;  2FYZ A;  3IFM A;  1FZB A;  3L36 A;  4O9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...