2KYVA

Hybrid solution and solid-state nmr structure ensemble of phospholamban pentamer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
52
structure length
52
Chain Sequence
MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phospholamban
publication title Structural topology of phospholamban pentamer in lipid bilayers by a hybrid solution and solid-state NMR method.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 19
structure length 52
sequence length 52
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2kyvA00
1ZLLA 2KYVA 2M3BA 1FJKA 1N7LA 2KB7P 1FJPA 2HYNA
chains in the Genus database with same CATH superfamily
5AW4B 2A45H 2JDIH 1BSHA 1QGKB 1HGZA 2MJZA 1YITP 3Q5SA 2R44A 2JEEA 5KLIC 1L0NK 2OGUA 3TNUB 2N1TD 1EDLA 1EZVI 2O1JA 1R5LA 3SWFA 3L72J 1L4AB 1LT9B 3L73J 1YJ9P 1DD4A 1JTHB 1OWAA 1UIXA 1H89A 1PGPA 2XU6A 1ZP0C 2WPVB 1JO5A 3HE4A 1VQ8P 3EFFK 3PHLA 1KZUB 1ZLLA 5AVVB 2QJYB 2M8RA 1WRGA 2G3AA 1JM0A 2WQYC 3B5NC 4JF7A 1ZRTD 2C0XA 1MZ9A 3C1LA 3HD7B 1EC5A 4W7ZA 3H1KE 2FYUJ 1GL2D 3BCCG 3M9HA 2AEMA 3HE5B 1IFMA 2NPSD 1T3JA 2A45I 3TK1A 3Q1MA 1LTJB 2QM7A 4WBAA 1M57D 5DJUB 3BCCD 1NTMG 4N78D 5KAIE 2CPSA 2ZYAA 3U1AA 5BVZA 2QIWA 4DZOA 3BASA 1AQTA 1NU1K 1JNMA 2BCCG 2Y9YA 1NTMD 3Q3DA 4I7ZC 3VP8A 3HUSB 1PZQA 3G4SP 4YXDC 3AE8C 3ITKA 2BCCD 1FJPA 2E74C 4LGDE 1NH4A 1NVOA 3RK3D 1KTMA 1VQ6P 1T2KD 3CI9A 1BGYJ 3GHGC 1YIJP 1N8RQ 1EZVD 4CPGA 5AW6B 1T3UA 4U3FJ 3H25A 1W5CE 4N3YB 4C7NA 4C7NB 1KYOE 1M1JB 1NTZE 1QVGO 5EFWB 1L0LK 3MHVA 3K5BA 2J5UA 2MKVA 1KN7A 3G71P 1PFIA 3SSUA 5CCHC 3NTNA 4OGQB 1AVYA 1LGHB 3KDPB 2R5DA 1SQQE 1QX8A 3MUDA 2OTKE 2FFDA 5AVXB 1RE3A 2A45G 2HG5D 2WSFH 4WB4A 1FDOA 2ZYDA 4Y99C 3W68A 1JY2N 1KILB 3CWBJ 1S4XA 1S5LE 1BE3G 2NPSC 4RESB 3H1JJ 3L73E 4MN4C 2HPCA 1KB9H 1NGMB 2ZT9B 1LWUC 4PD4E 3KPEA 3AE2C 1LNQA 1PPJE 1GTWA 1R8EA 3H1KG 4HKZH 2E43A 4WVZA 1AQ5A 1SQXK 4I6MC 2GA1A 3I55P 1FJKA 4H44B 2D2CD 3H1KD 1IFIA 2OYHC 3PP5A 2VRSA 3CD6P 1AA0A 1ZR2A 1CZQA 4R4MA 1YHQP 1S72P 2BEQD 4JYCA 2I1KA 2O01J 4D6TJ 4PD4I 3LW5H 1EDKA 2L91A 1KC8Q 1U7MA 1NJIQ 4UB8E 3CCVP 2JWAA 1LTTC 3PJSK 3HTKA 3CXHE 4PV1C 2H43A 1DD3A 3EQ2A 3C8VA 2KS1B 2YNYA 5GTHH 1TU3F 1GDTA 3MD0A 1YJWP 1IO4A 1BCCJ 1KB9I 1AVOA 4EOTA 4WY4C 2IBZE 2XKMA 3RGUA 2QA4P 2AXTH 1KQLA 1JY2P 2P2UA 1VPCA 1KYOD 1NTZD 1K9MQ 1BGYE 1VF5D 3HRNA 1N7SB 1N7SA 2HR3A 2YXRB 3AECC 4OVNF 2QG4A 3CXHI 4WWIA 1EDJA 2WPQA 3HUSC 2YMYA 1HWTC 4W80A 1FZEA 2JKVA 1URQB 1URQA 1USEA 2KSJA 1NTKG 1SQQD 1HBWA 1XTCC 2IBZI 5AVUB 1VQ7P 1SLQA 3TF5A 1MV8A 5H2FH 3H1IG 2ZXXA 2DW3A 3N4XA 1X79B 2LKMA 3L74G 4IFFA 1HH0A 2Q3EA 3CCRP 2AXCA 1FZGA 4PD4D 1Y47A 3L74D 2K1AA 1AJYA 5M1BA 1SQVG 1PPJD 2QJPB 4DJGA 4GKGA 2W83C 3H1JE 3IAOA 3QH9A 1SQBK 1IFJA 2IZ1A 2K9YA 1FZCC 3L75G 2B87B 2WVRA 3L71G 3WUUA 1OVUA 1OMIA 1JMBA 2M5AB 3WU2H 1NKZB 5KAFE 1N73C 4ZKPA 1SQBG 1Q86Q 1N2DC 3D71A 3CCMP 4UB6H 2V4HA 4L76A 3O6QA 2K3RA 1GU5A 5AVZB 1KV4A 1GK6A 3BRVB 2RH0A 2P7JA 1Q2NA 1QLED 4H13C 3BATA 2O3JA 2GUSA 2KZIA 3CXHD 1HJ0A 1JUNA 3A0BE 5AW3B 3WUVA 1PP9E 2QM8A 2WSSH 3R2PA 1Y9BA 1BE3J 4O9BA 2LXCB 4IFDK 2IBZD 1WT6A 3H1LJ 1L0NE 4RJTA 2SPZA 2YKQA 1CI6A 1W2BO 1GZLA 4GODA 1BCCE 1H0TA 3V2QA 1Z56A 2Y0CA 2XNDH 2KOGA 1QEXA 3B5ND 4NPDA 1RQUA 3OW2O 3KZIH 3RBXA 5AW2B 1HVVA 3RK2B 1JB0J 3GHGA 1E79H 1G1JA 1LTSC 3AE7C 1SQPK 5AW8B 2N1TB 1FAVA 3Q5RA 1PL5A 2OYIC 1GW4A 4W7YA 3RL0C 3CCEP 3M9BA 5AW9B 1A02J 1SQPG 3L70G 2P10A 2E76C 3PTZA 5CCHA 2FYNC 4HYTB 2WSCH 2PFXA 3TGUJ 4ZMDA 2WT7A 3V4QA 2WT7B 1VL2A 2YKPA 1QL1A 3P32A 3H1JD 5DJTB 2KIKA 3M06A 1DX7A 2E74D 1NU1E 2OARA 1GL2B 1GL2A 3M0DC 1YI2P 1S1CX 2PAJA 3CC2P 2NPSA 2M3EA 5AVWB 1Y8AA 5APUA 1E5WA 3B71A 2HYNA 3MTUE 1NTKJ 4H0LC 3QWOC 1T6AA 3HE4B 2QJPC 1R5SA 1NHLA 3V2PA 3U59A 2OYHA 5CCHD 1L0LE 1DEEG 3H1IJ 3W67A 1PP9D 5AVRB 5KAIH 5APQA 5KLVG 2BEZF 4BRYA 3RK3B 3L4FA 2KUBA 1JY3O 1CW5A 1RF1C 2FXMA 2E75C 1NAYA 1VQ5P 2N9YB 3T97A 2PRRA 5KLVD 1L0ND 2WSFJ 1GW3A 1NTMK 1SQVJ 5AVSB 1H88A 2P67A 1BCCD 1SVFA 1OFCX 4XE5B 4JQ0D 2C9NY 2ITAA 3AE9C 3L75J 4EIJA 3H1LE 1FZAA 3L71J 2KNCA 1S9KE 2BASA 4B86A 3A7OA 1SQBJ 3VP9A 1KYOH 2KZJA 1EXJA 1RHZB 3M9QA 3MGNA 1PGOA 3VMAA 5APSA 1VQOP 4AQRD 1SQXE 3V4WA 1KILE 1EZVG 1M90Q 1X22A 4GOFA 4QMAA 2QEXP 1NO4A 3H1HE 1SFCC 4DT0A 2LR2A 2A06E 2ZFCA 2QVAA 3A3YB 3A0HE 1J1EB 3LW5J 2Q5UA 4DOJA 1IK7A 4IFMA 3RK2C 4PV1D 3UIAA 3KQGA 3VYIA 2FY8A 3TGUE 1NU1D 1JCCA 2D2CB 2CPBA 3AEEC 4PD4H 2H89C 3VN0A 4WY4D 1ZV8A 3NMDA 2FFDB 4OH8B 2N9BA 1KYOI 5KKZC 4PJ0E 1JEKA 5B5EH 1FZCA 1S5LX 1LTAC 3L72E 3AEAC 4GDOA 5AVYB 2HPCB 1L0LD 1MFZA 5AVTB 1H8AA 1RE4C 2IYOA 1IFPA 5B66E 3ZDMA 1N7LA 3EWKA 1SQPJ 3L70J 4Y28J 1MKMA 2QJKB 5TJHA 2Q7CA 2XDJA 3A5TA 4UB8H 3MZWB 1CSBA 1U57A 3USSA 3CXHH 5AW7B 3M0AA 5KTBA 3OAKA 1GMJA 1RF0C 4ZKUA 2ZJSE 1L4AC 1LT9C 1VF5B 3IFMA 4YXWH 2Y0EA 1RH5B 2FYUE 1DIPA 5AW5B 3CLQA 1S9KD 3SWKA 1M8OB 2QJYC 3CCQP 1FBMA 1VQ4P 3HTKB 1LP1A 1NTZK 5CCGC 2YIUB 3GF3A 3VTPC 3C9IA 3TDKA 1SQXD 4AUWA 1J2JB 3LIDA 1KILD 3HD7C 2WPSA 2RN0A 3P8CE 1JCDA 3I56P 2HFED 1NTZG 3H1HD 2KP8A 1OVVA 1EXIA 1KFMA 1W2EA 1LTJC 2ZT9D 2QSIA 1FC2C 2P58A 3CC4P 4H13D 2IYPA 3L37A 3JCUE 1NTKK 1EDIA 3AEBC 1YBKA 1SQQG 3FX0A 4U3FE 3RL0g 2OYIA 3SFDC 3BCCJ 1GU4A 4A7PA 2WWWA 2YO2A 4YTPC 2H7HA 2XV5A 3CPWO 2XZRA 4DCKA 3PH0A 1NTMJ 1YTZI 4RKUJ 3CMAP 2V7QH 3CX5E 3L72G 3L73G 2R5BA 2BCCJ 1SQVK 2YMKA 2HLOA 1NOHA 1M1JC 2PGDA 5KAFH 1PPJG 4ASWA 1MFTA 4JBZA 3L72D 3L73D 3M0DA 1BDDA 1OW7A 2G8YA 3CWBE 5APWA 1P84E 5KLIB 2ZAEB 1FZFA 1KFNA 1IC2A 3G9RA 4OGQC 2WZ7A 1VQKP 2IFNA 1G2CA 1AV1A 1JY3N 1KORA 3GMAA 3L36A 3RL0D 3Q2YA 2JJLA 2FYUG 2KLUA 4IOIH 2E76D 1VQ9P 1KILC 1LJ2A 1M7LA 2FYUD 5H2FE 3B5NA 3B5NB 2WSCJ 1OZHA 3O6QB 3WUTA 1RF1A 1OIPA 2ZT9C 1HF9A 3AEDC 2K88A 1KD1Q 3FGAD 3KYQA 2NRGA 2JP3A 4D6TE 4HJGH 3CCUP 5APYA 5C39A 3LIEA 4IL6E 3P8CD 4H44C 4IL6X 2IBZG 4XA4A 2YKOA 4TLFA 3CL3D 5K5GB 1BGYG 2PP6A 4JPZB 3ABVC 3IR9A 5E79E 5KJ7D 1N86A 1LTIC 3V2NA 3WU2E 4H0LD 1CI6B 1BGYD 4I7ZB 3G6EP 1H0TB 3D6YA 3H1KJ 3FXDA 3V6IA 1M1KQ 1FS0E 5GTIE 3L35A 4U3FD 2E74B 2LXBA 1GD2E 1FU1A 3B4SA 3GLMA 4KT0J 1HUCA 3N7NA 3GHGB 2FBWC 2E75D 2POHA 1KQFB 1JMMA 1GK4A 1JY3P 2C9LY 2Y9ZA 3BCCE 4N78E 3CX5D 1FOSF 4LLHA 1PV3A 1T8ZA 1WMKA 5APVA 3JC22 1NTME 3H6PA 4Z1MH 1BSNA 1QVFO 1N7SC 2FKWB 2WSEH 3CWBD 3H1JG 1P84D 2WITA 4KHXA 3I5CA 3G3ZA 2Y0DA 4K3AA 4ASVA 3E7KA 3RK3E 4BWNA 2B89A 1NTZJ 4AYCA 1URQC 2K9JA 5TISE 5AVQB 3H32A 3KHUA 3KZIE 3VMZA 1BDCA 1LTBC 5L8RJ 3SWYA 1IFNA 4I2LC 2M3BA 3PRJA 2NPSB 3F89A 1A02F 1SFCD 1ZOYC 4HB1A 4LC1A 2KB7P 1RE4A 1SQQJ 2W6JH 1LWUA 1LWUB 2Q6QA 2O01N 2ZVNB 5KJ7C 5CBNA 3RK2D 4D6TG 1VQMP 5CJ4A 1FE6A 2GM4A 5KLVK 1PP9G 3TNUA 2Q3IA 2FYZA 2OYHB 4K35A 4D6TD 1KMIZ 4NPEA 1RF0A 1L4AA 1LT9A 1YQ4C 1JTHA 1OX3A 2Z5HA 4BRYB 1S3JA 1L0NG 5CMZA 2WMMA 3L74J 3OJAB 4M3LA 1BCCG 1FDMA 2O1KA 4L73A 3AE5C 3S4RA 3T97B 2W27A 1X0TA 2IPPA 1YJNP 1BE3E 4XFJA 4PV1B 5CCGA 3CMEP 1LTGC 1S2EA 1FOSE 3HD7A 2KNCB 1Q81Q 2H8PD 1PGJA 1K05A 3A0HH 3HE5A 2JR8A 2H88C 2KSEA 2Q1KA 4WY4A 2FXOA 4WY4B 2OQQA 1LTJA 2I8DA 4OWFA 3A2AA 1L4AD 1XTGB 3P7KA 2I1JA 2ZYGA 4YPCA 3R4YA 3CCJP 1K8AQ 3HUSA 1PGQA 1RY3A 1NU1G 4PJ0H 5CCGD 1IZNB 3FWLA 1S5LH 3EFGA 2ZVOB 2RMZA 3HD7D 1Q90D 2N1TC 3NFQA 5CHXA 1UIIA 2NZ2A 5B66H 1M1JA 2W90A 4GOEA 4NPFX 5APTA 2AEJA 1KQGB 5APXA 1DEBA 3S1KA 1L2PA 3AE3C 2OTJP 3NXSA 4KJMA 1ZMEC 1L0LG 3D70A 3GG2A 4L74A 1FZCB 4JYBA 2YXQB 3SFEC 2KYVA 1J1DB 2KLVA 1NTKE 1KILA 1N73A 1N73B 2ZXEB 2R3CA 3JSVC 1GL2C 4RO0A 2J59M 1PIXA 5CBOA 3H1IE 1NKNA 2Q9IA 2M0BA 3H1LG 1BE3D 2V7QJ 2W8ZA 4H13B 3L74E 2Z5IA 3TYYA 1D7MA 3H1LD 1IFDA 1VQLP 4U7JA 1SQVE 1HJBA 4N6JA 4OGQD 1ZR4A 5B5EE 1SQXG 2UWJE 1OW6A 3L75E 1YYCA 3MIWA 3RK3C 3JCUH 1KB9E 1NYHA 3L71E 1LP1B 3PLNA 3GW6A 1M56D 1T2KC 3F5HA 3AEFC 3H1HG 1IJDB 3CCLP 1RQVA 1KQSO 1SQBE 2QRXA 2RKLA 2A06G 1PP9J 2KXPB 5AW1B 4C46A 2WPRA 2QE7H 2OTLP 2YO3A 1K73Q 2A06D 5AW0B 1SQQK 3B8EB 2KS1A 3TGUG 5KLVJ 1L0NJ 3CX5H 4GIFA 2AEFA 1X8YA 1USDA 1ZN5A 1OVRA 3TGUD 3IF4A 4H44D 2OYIB 1LT1A 3RL0B 2E42A 3VMXA 3OA7A 1P84H 2E76B 2GUVA 4TT3H 3M91A 3GF7A 2FYNB 2XNXA 3AE4C 3AE6C 2IFMA 5GTHE 3VMYA 3Q5PA 1FDIA 1J1EC 2W6AA 1U7JA 1IK9A 2R3SA 1SP4A 2AXTE 3VOPA 2HODB 2HODA 1NTKD 1EQ7A 2IDBA 3IN6A 2D2CC 5CJ0A 2FYUK 1QL2A 1G2CB 3H1ID 4R4LA 1X9VA 3MUDC 2OYOA 5KJ7A 2O01H 3U1CA 3RBZA 2FFDC 3A0BH 4H0LB 3CX5I 1SQPE 3L70E 1DH3A 1RE3C 1NU1J 4BXLA 4IL6H 3WMM0 3MP7B 1N7SD 1NAFA 3O8ZA 2J58A 1JOCA 1SQVD 3AE1C 2B87A 2WSEJ 3E1IA 5E79H 1K04A 1P84I 1J1DC 2M5AA 2P1JA 2IX7C 1URQD 1RF1B 2K37A 2JWDA 1OXZA 2E5YA 5BU5A 2E75B 3L75D 1VQNP 1KB9D 4ZNCA 3L71D 4EYYQ 2QJKC 5GTIH 1JY2O 2IZ0A 2B9BA 2E5TA 1SQBD 1L0LJ 4GT1A 2KK7A 3II6A 1VF5C 2WTYA 3FWNA 1OW8A 1YQ3C 4U3FG 1ZRTE 3KXDA 3V2RA 1VDFA 3E1RA 1G1IA 3FXEA 2W6BA 1NWQA 2C0WA 4C7RA 4UB6E 4L75A 5KLVE 5BU8B 1FZBA 2FXPA 3P8MC 2YIUC 3TSIA 1SFCB 1SFCA 1HGVA 1Q7YQ 4I1LA 5TISH 2Z4EA 3S9OA 2B88A 3AEGC 1MUUA 1VQPP 1HTLC 1ZW0A 1YTZT 3D6ZA 1SQXJ 3CWBG 1AFOA 1Q82Q 2N1TA 2L5GB 3V5BA 3H1HJ 3BRTB 3CCSP 4EI2A 2BCCE 4EDFA 3BVHA 2K9JB 1ZXGA 2CK3H 2R32A 3H32B 4Y99B 4HH2A 1EZVE 5KKZB 1SQPD 3L70D 3CC7P 2JO1A 2KI7B 1SS1A
chains in the Genus database with same CATH topology
3VTPC 3C9IA 4AUWA 1J2JB 3LIDA 1KILD 3HD7C 2WPSA 3P8CE 5AW4B 2A45H 1JCDA 5CCGD 1GU5A 5AVZB 2HFED 1GK6A 3EFGA 1HGZA 3BRVB 3HD7D 2MJZA 2P7JA 2KP8A 2N1TC 3NFQA 3BATA 2JEEA 5CHXA 2GUSA 1KFMA 1W2EA 1LTJC 1L0NK 1M1JA 1JUNA 3TNUB 2N1TD 5AW3B 5APTA 2O1JA 5APXA 1DEBA 3SWFA 3L37A 2QM8A 1NTKK 1L4AB 1LT9B 3R2PA 1JTHB 4O9BA 1OWAA 1H89A 3NXSA 4IFDK 2OYIA 2XU6A 1JO5A 3HE4A 1GU4A 1KZUB 1WT6A 2WWWA 1FZCB 1ZLLA 2YO2A 5AVVB 4JYBA 2YKQA 1CI6A 1GZLA 2M8RA 2H7HA 3V2QA 1WRGA 1J1DB 2KYVA 2XV5A 1Z56A 2XZRA 2KLVA 3B5NC 4JF7A 2C0XA 1KILA 1YTZI 1N73A 1N73B 2ZXEB 2R3CA 1MZ9A 1GL2C 2KOGA 2R5BA 3B5ND 2J59M 3HD7B 1SQVK 2HLOA 5AW2B 1HVVA 1NOHA 3RK2B 4W7ZA 1M1JC 1GL2D 3GHGA 1NKNA 2Q9IA 1G1JA 1LTSC 3M9HA 1SQPK 3M0DA 3HE5B 1IFMA 5AW8B 2NPSD 2N1TB 1FAVA 5APWA 1T3JA 2A45I 3TK1A 1FZFA 1LTJB 2Z5IA 3TYYA 1KFNA 2QM7A 4WBAA 1IC2A 1IFDA 4N78D 1GW4A 2OYIC 2CPSA 4W7YA 3RL0C 2WZ7A 2IFNA 3U1AA 5BVZA 3M9BA 1G2CA 5AW9B 1HJBA 1A02J 4DZOA 1JY3N 4N6JA 3BASA 1NU1K 1JNMA 1ZR4A 3L36A 3RL0D 5CCHA 3VP8A 3HUSB 2JJLA 4HYTB 2WSCH 1YYCA 3MIWA 1KILC 3RK3C 2WT7A 3V4QA 2WT7B 1T2KC 1FJPA 2YKPA 1QL1A 4LGDE 1NH4A 3P32A 1M7LA 1IJDB 3RK3D 3B5NA 3B5NB 1T2KD 3CI9A 3M06A 1DX7A 3GHGC 5AW1B 4C46A 1RF1A 2OARA 2WPRA 1GL2B 1GL2A 3M0DC 2YO3A 5AW6B 1T3UA 2PAJA 4N3YB 4C7NA 4C7NB 2NPSA 5AW0B 1SQQK 3B8EB 3KYQA 1M1JB 1L0LK 5AVWB 5APYA 3LIEA 4GIFA 3P8CD 4XA4A 1X8YA 5APUA 1E5WA 2YKOA 2HYNA 1ZN5A 3CL3D 1PFIA 3MTUE 5CCHC 3NTNA 2PP6A 2OYIB 3RL0B 3IR9A 2E42A 1LGHB 3HE4B 3VMXA 3KDPB 5KJ7D 2R5DA 1N86A 1LTIC 1NHLA 3V2PA 3OA7A 3U59A 3V2NA 2OYHA 3MUDA 5CCHD 2GUVA 3M91A 1CI6B 2FFDA 2XNXA 5AVXB 1RE3A 2A45G 5AVRB 2HG5D 5APQA 2WSFH 4WB4A 4Y99C 1JY2N 1KILB 3RK3B 3L4FA 2IFMA 1JY3O 3L35A 1CW5A 1RF1C 3VMYA 2FXMA 1GD2E 1FU1A 3T97A 1J1EC 2W6AA 1HUCA 2NPSC 4RESB 1GW3A 1NTMK 2HPCA 1IK9A 3N7NA 3GHGB 5AVSB 1H88A 2P67A 1SP4A 2POHA 1SVFA 3VOPA 1LWUC 4XE5B 2HODB 1JMMA 2HODA 1GK4A 3KPEA 1JY3P 2C9LY 1EQ7A 1GTWA 2C9NY 2E43A 4EIJA 1AQ5A 4N78E 5CJ0A 1FZAA 1SQXK 2FYUK 4I6MC 1FOSF 4LLHA 1QL2A 1S9KE 1T8ZA 1FJKA 1G2CB 5APVA 2BASA 4B86A 1X9VA 1IFIA 2OYHC 3A7OA 5KJ7A 3PP5A 2O01H 3VP9A 3H6PA 2VRSA 3U1CA 2FFDC 1N7SC 2FKWB 2WSEH 1DH3A 1ZR2A 1RE3C 1CZQA 3M9QA 3MGNA 2WITA 4KHXA 3I5CA 3G3ZA 3WMM0 5APSA 4JYCA 1N7SD 4AQRD 1NAFA 2I1KA 3V4WA 3O8ZA 2J58A 4AYCA 1URQC 1JOCA 5AVQB 3LW5H 3E1IA 3H32A 1J1DC 1NO4A 3VMZA 2P1JA 2IX7C 1URQD 1RF1B 1SFCC 1LTBC 1OXZA 1LTTC 3SWYA 5BU5A 3HTKA 3A3YB 2ZFCA 1IFNA 4I2LC 2H43A 2M3BA 3EQ2A 1J1EB 2NPSB 2Q5UA 1A02F 4DOJA 1SFCD 1JY2O 2YNYA 4LC1A 4IFMA 2KB7P 1RE4A 3RK2C 3UIAA 3KQGA 1LWUA 1LWUB 3VYIA 1GDTA 3MD0A 4GT1A 1IO4A 1JCCA 5KJ7C 3RK2D 3II6A 5CJ4A 4EOTA 4WY4C 2XKMA 2CPBA 2GM4A 5KLVK 2WTYA 1KQLA 3TNUA 1JY2P 2P2UA 1VPCA 2Q3IA 2FYZA 3VN0A 4WY4D 2OYHB 1ZV8A 3NMDA 1RF0A 3HRNA 1L4AA 1LT9A 2FFDB 1N7SB 1N7SA 1JTHA 3V2RA 1VDFA 4OH8B 1G1IA 2WPQA 2N9BA 2Z5HA 2W6BA 1NWQA 3HUSC 2C0WA 2YMYA 5CMZA 4C7RA 1HWTC 3OJAB 4W80A 4M3LA 1FZEA 1FDMA 5BU8B 1URQB 1URQA 2O1KA 1FZCA 1FZBA 3P8MC 1LTAC 2KSJA 2W27A 3TSIA 1HBWA 1XTCC 5AVYB 2IPPA 2HPCB 1MFZA 5AVTB 1H8AA 1RE4C 1SFCB 1SFCA 5AVUB 1HGVA 1N7LA 1SLQA 4I1LA 5CCGA 1MV8A 2Z4EA 1LTGC 3N4XA 1MUUA 1FOSE 3HD7A 1X79B 2Q7CA 2XDJA 1HTLC 3A5TA 1CSBA 2LKMA 1YTZT 1AFOA 4IFFA 5AW7B 2H8PD 3M0AA 1HH0A 5KTBA 3OAKA 3HE5A 2N1TA 2L5GB 1FZGA 1RF0C 4ZKUA 4WY4A 4WY4B 1L4AC 1LT9C 3V5BA 1LTJA 3BRTB 3IFMA 3A2AA 4GKGA 3BVHA 1L4AD 1XTGB 3P7KA 1SQBK 2I1JA 5AW5B 3CLQA 1S9KD 1IFJA 1FZCC 2R32A 3H32B 4Y99B 4HH2A 1FBMA 3HUSA 1NKZB 3HTKB 1N73C 4ZKPA 1NTZK 5CCGC 1RY3A 1N2DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZLL A;  2KYV A;  2M3B A;  1FJK A;  1N7L A;  2KB7 P;  1FJP A;  2HYN A; 
#chains in the Genus database with same CATH topology
 5AW4 B;  2A45 H;  2JDI H;  1BSH A;  1QGK B;  1HGZ A;  2MJZ A;  1YIT P;  3Q5S A;  2R44 A;  2JEE A;  5KLI C;  1L0N K;  2OGU A;  3TNU B;  2N1T D;  1EDL A;  1EZV I;  2O1J A;  1R5L A;  3SWF A;  3L72 J;  1L4A B;  1LT9 B;  3L73 J;  1YJ9 P;  1DD4 A;  1JTH B;  1OWA A;  1UIX A;  1H89 A;  1PGP A;  2XU6 A;  1ZP0 C;  2WPV B;  1JO5 A;  3HE4 A;  1VQ8 P;  3EFF K;  3PHL A;  1KZU B;  1ZLL A;  5AVV B;  2QJY B;  2M8R A;  1WRG A;  2G3A A;  1JM0 A;  2WQY C;  3B5N C;  4JF7 A;  1ZRT D;  2C0X A;  1MZ9 A;  3C1L A;  3HD7 B;  1EC5 A;  4W7Z A;  3H1K E;  2FYU J;  1GL2 D;  3BCC G;  3M9H A;  2AEM A;  3HE5 B;  1IFM A;  2NPS D;  1T3J A;  2A45 I;  3TK1 A;  3Q1M A;  1LTJ B;  2QM7 A;  4WBA A;  1M57 D;  5DJU B;  3BCC D;  1NTM G;  4N78 D;  5KAI E;  2CPS A;  2ZYA A;  3U1A A;  5BVZ A;  2QIW A;  4DZO A;  3BAS A;  1AQT A;  1NU1 K;  1JNM A;  2BCC G;  2Y9Y A;  1NTM D;  3Q3D A;  4I7Z C;  3VP8 A;  3HUS B;  1PZQ A;  3G4S P;  4YXD C;  3AE8 C;  3ITK A;  2BCC D;  1FJP A;  2E74 C;  4LGD E;  1NH4 A;  1NVO A;  3RK3 D;  1KTM A;  1VQ6 P;  1T2K D;  3CI9 A;  1BGY J;  3GHG C;  1YIJ P;  1N8R Q;  1EZV D;  4CPG A;  5AW6 B;  1T3U A;  4U3F J;  3H25 A;  1W5C E;  4N3Y B;  4C7N A;  4C7N B;  1KYO E;  1M1J B;  1NTZ E;  1QVG O;  5EFW B;  1L0L K;  3MHV A;  3K5B A;  2J5U A;  2MKV A;  1KN7 A;  3G71 P;  1PFI A;  3SSU A;  5CCH C;  3NTN A;  4OGQ B;  1AVY A;  1LGH B;  3KDP B;  2R5D A;  1SQQ E;  1QX8 A;  3MUD A;  2OTK E;  2FFD A;  5AVX B;  1RE3 A;  2A45 G;  2HG5 D;  2WSF H;  4WB4 A;  1FDO A;  2ZYD A;  4Y99 C;  3W68 A;  1JY2 N;  1KIL B;  3CWB J;  1S4X A;  1S5L E;  1BE3 G;  2NPS C;  4RES B;  3H1J J;  3L73 E;  4MN4 C;  2HPC A;  1KB9 H;  1NGM B;  2ZT9 B;  1LWU C;  4PD4 E;  3KPE A;  3AE2 C;  1LNQ A;  1PPJ E;  1GTW A;  1R8E A;  3H1K G;  4HKZ H;  2E43 A;  4WVZ A;  1AQ5 A;  1SQX K;  4I6M C;  2GA1 A;  3I55 P;  1FJK A;  4H44 B;  2D2C D;  3H1K D;  1IFI A;  2OYH C;  3PP5 A;  2VRS A;  3CD6 P;  1AA0 A;  1ZR2 A;  1CZQ A;  4R4M A;  1YHQ P;  1S72 P;  2BEQ D;  4JYC A;  2I1K A;  2O01 J;  4D6T J;  4PD4 I;  3LW5 H;  1EDK A;  2L91 A;  1KC8 Q;  1U7M A;  1NJI Q;  4UB8 E;  3CCV P;  2JWA A;  1LTT C;  3PJS K;  3HTK A;  3CXH E;  4PV1 C;  2H43 A;  1DD3 A;  3EQ2 A;  3C8V A;  2KS1 B;  2YNY A;  5GTH H;  1TU3 F;  1GDT A;  3MD0 A;  1YJW P;  1IO4 A;  1BCC J;  1KB9 I;  1AVO A;  4EOT A;  4WY4 C;  2IBZ E;  2XKM A;  3RGU A;  2QA4 P;  2AXT H;  1KQL A;  1JY2 P;  2P2U A;  1VPC A;  1KYO D;  1NTZ D;  1K9M Q;  1BGY E;  1VF5 D;  3HRN A;  1N7S B;  1N7S A;  2HR3 A;  2YXR B;  3AEC C;  4OVN F;  2QG4 A;  3CXH I;  4WWI A;  1EDJ A;  2WPQ A;  3HUS C;  2YMY A;  1HWT C;  4W80 A;  1FZE A;  2JKV A;  1URQ B;  1URQ A;  1USE A;  2KSJ A;  1NTK G;  1SQQ D;  1HBW A;  1XTC C;  2IBZ I;  5AVU B;  1VQ7 P;  1SLQ A;  3TF5 A;  1MV8 A;  5H2F H;  3H1I G;  2ZXX A;  2DW3 A;  3N4X A;  1X79 B;  2LKM A;  3L74 G;  4IFF A;  1HH0 A;  2Q3E A;  3CCR P;  2AXC A;  1FZG A;  4PD4 D;  1Y47 A;  3L74 D;  2K1A A;  1AJY A;  5M1B A;  1SQV G;  1PPJ D;  2QJP B;  4DJG A;  4GKG A;  2W83 C;  3H1J E;  3IAO A;  3QH9 A;  1SQB K;  1IFJ A;  2IZ1 A;  2K9Y A;  1FZC C;  3L75 G;  2B87 B;  2WVR A;  3L71 G;  3WUU A;  1OVU A;  1OMI A;  1JMB A;  2M5A B;  3WU2 H;  1NKZ B;  5KAF E;  1N73 C;  4ZKP A;  1SQB G;  1Q86 Q;  1N2D C;  3D71 A;  3CCM P;  4UB6 H;  2V4H A;  4L76 A;  3O6Q A;  2K3R A;  1GU5 A;  5AVZ B;  1KV4 A;  1GK6 A;  3BRV B;  2RH0 A;  2P7J A;  1Q2N A;  1QLE D;  4H13 C;  3BAT A;  2O3J A;  2GUS A;  2KZI A;  3CXH D;  1HJ0 A;  1JUN A;  3A0B E;  5AW3 B;  3WUV A;  1PP9 E;  2QM8 A;  2WSS H;  3R2P A;  1Y9B A;  1BE3 J;  4O9B A;  2LXC B;  4IFD K;  2IBZ D;  1WT6 A;  3H1L J;  1L0N E;  4RJT A;  2SPZ A;  2YKQ A;  1CI6 A;  1W2B O;  1GZL A;  4GOD A;  1BCC E;  1H0T A;  3V2Q A;  1Z56 A;  2Y0C A;  2XND H;  2KOG A;  1QEX A;  3B5N D;  4NPD A;  1RQU A;  3OW2 O;  3KZI H;  3RBX A;  5AW2 B;  1HVV A;  3RK2 B;  1JB0 J;  3GHG A;  1E79 H;  1G1J A;  1LTS C;  3AE7 C;  1SQP K;  5AW8 B;  2N1T B;  1FAV A;  3Q5R A;  1PL5 A;  2OYI C;  1GW4 A;  4W7Y A;  3RL0 C;  3CCE P;  3M9B A;  5AW9 B;  1A02 J;  1SQP G;  3L70 G;  2P10 A;  2E76 C;  3PTZ A;  5CCH A;  2FYN C;  4HYT B;  2WSC H;  2PFX A;  3TGU J;  4ZMD A;  2WT7 A;  3V4Q A;  2WT7 B;  1VL2 A;  2YKP A;  1QL1 A;  3P32 A;  3H1J D;  5DJT B;  2KIK A;  3M06 A;  1DX7 A;  2E74 D;  1NU1 E;  2OAR A;  1GL2 B;  1GL2 A;  3M0D C;  1YI2 P;  1S1C X;  2PAJ A;  3CC2 P;  2NPS A;  2M3E A;  5AVW B;  1Y8A A;  5APU A;  1E5W A;  3B71 A;  2HYN A;  3MTU E;  1NTK J;  4H0L C;  3QWO C;  1T6A A;  3HE4 B;  2QJP C;  1R5S A;  1NHL A;  3V2P A;  3U59 A;  2OYH A;  5CCH D;  1L0L E;  1DEE G;  3H1I J;  3W67 A;  1PP9 D;  5AVR B;  5KAI H;  5APQ A;  5KLV G;  2BEZ F;  4BRY A;  3RK3 B;  3L4F A;  2KUB A;  1JY3 O;  1CW5 A;  1RF1 C;  2FXM A;  2E75 C;  1NAY A;  1VQ5 P;  2N9Y B;  3T97 A;  2PRR A;  5KLV D;  1L0N D;  2WSF J;  1GW3 A;  1NTM K;  1SQV J;  5AVS B;  1H88 A;  2P67 A;  1BCC D;  1SVF A;  1OFC X;  4XE5 B;  4JQ0 D;  2C9N Y;  2ITA A;  3AE9 C;  3L75 J;  4EIJ A;  3H1L E;  1FZA A;  3L71 J;  2KNC A;  1S9K E;  2BAS A;  4B86 A;  3A7O A;  1SQB J;  3VP9 A;  1KYO H;  2KZJ A;  1EXJ A;  1RHZ B;  3M9Q A;  3MGN A;  1PGO A;  3VMA A;  5APS A;  1VQO P;  4AQR D;  1SQX E;  3V4W A;  1KIL E;  1EZV G;  1M90 Q;  1X22 A;  4GOF A;  4QMA A;  2QEX P;  1NO4 A;  3H1H E;  1SFC C;  4DT0 A;  2LR2 A;  2A06 E;  2ZFC A;  2QVA A;  3A3Y B;  3A0H E;  1J1E B;  3LW5 J;  2Q5U A;  4DOJ A;  1IK7 A;  4IFM A;  3RK2 C;  4PV1 D;  3UIA A;  3KQG A;  3VYI A;  2FY8 A;  3TGU E;  1NU1 D;  1JCC A;  2D2C B;  2CPB A;  3AEE C;  4PD4 H;  2H89 C;  3VN0 A;  4WY4 D;  1ZV8 A;  3NMD A;  2FFD B;  4OH8 B;  2N9B A;  1KYO I;  5KKZ C;  4PJ0 E;  1JEK A;  5B5E H;  1FZC A;  1S5L X;  1LTA C;  3L72 E;  3AEA C;  4GDO A;  5AVY B;  2HPC B;  1L0L D;  1MFZ A;  5AVT B;  1H8A A;  1RE4 C;  2IYO A;  1IFP A;  5B66 E;  3ZDM A;  1N7L A;  3EWK A;  1SQP J;  3L70 J;  4Y28 J;  1MKM A;  2QJK B;  5TJH A;  2Q7C A;  2XDJ A;  3A5T A;  4UB8 H;  3MZW B;  1CSB A;  1U57 A;  3USS A;  3CXH H;  5AW7 B;  3M0A A;  5KTB A;  3OAK A;  1GMJ A;  1RF0 C;  4ZKU A;  2ZJS E;  1L4A C;  1LT9 C;  1VF5 B;  3IFM A;  4YXW H;  2Y0E A;  1RH5 B;  2FYU E;  1DIP A;  5AW5 B;  3CLQ A;  1S9K D;  3SWK A;  1M8O B;  2QJY C;  3CCQ P;  1FBM A;  1VQ4 P;  3HTK B;  1LP1 A;  1NTZ K;  5CCG C;  2YIU B;  3GF3 A;  3VTP C;  3C9I A;  3TDK A;  1SQX D;  4AUW A;  1J2J B;  3LID A;  1KIL D;  3HD7 C;  2WPS A;  2RN0 A;  3P8C E;  1JCD A;  3I56 P;  2HFE D;  1NTZ G;  3H1H D;  2KP8 A;  1OVV A;  1EXI A;  1KFM A;  1W2E A;  1LTJ C;  2ZT9 D;  2QSI A;  1FC2 C;  2P58 A;  3CC4 P;  4H13 D;  2IYP A;  3L37 A;  3JCU E;  1NTK K;  1EDI A;  3AEB C;  1YBK A;  1SQQ G;  3FX0 A;  4U3F E;  3RL0 g;  2OYI A;  3SFD C;  3BCC J;  1GU4 A;  4A7P A;  2WWW A;  2YO2 A;  4YTP C;  2H7H A;  2XV5 A;  3CPW O;  2XZR A;  4DCK A;  3PH0 A;  1NTM J;  1YTZ I;  4RKU J;  3CMA P;  2V7Q H;  3CX5 E;  3L72 G;  3L73 G;  2R5B A;  2BCC J;  1SQV K;  2YMK A;  2HLO A;  1NOH A;  1M1J C;  2PGD A;  5KAF H;  1PPJ G;  4ASW A;  1MFT A;  4JBZ A;  3L72 D;  3L73 D;  3M0D A;  1BDD A;  1OW7 A;  2G8Y A;  3CWB E;  5APW A;  1P84 E;  5KLI B;  2ZAE B;  1FZF A;  1KFN A;  1IC2 A;  3G9R A;  4OGQ C;  2WZ7 A;  1VQK P;  2IFN A;  1G2C A;  1AV1 A;  1JY3 N;  1KOR A;  3GMA A;  3L36 A;  3RL0 D;  3Q2Y A;  2JJL A;  2FYU G;  2KLU A;  4IOI H;  2E76 D;  1VQ9 P;  1KIL C;  1LJ2 A;  1M7L A;  2FYU D;  5H2F E;  3B5N A;  3B5N B;  2WSC J;  1OZH A;  3O6Q B;  3WUT A;  1RF1 A;  1OIP A;  2ZT9 C;  1HF9 A;  3AED C;  2K88 A;  1KD1 Q;  3FGA D;  3KYQ A;  2NRG A;  2JP3 A;  4D6T E;  4HJG H;  3CCU P;  5APY A;  5C39 A;  3LIE A;  4IL6 E;  3P8C D;  4H44 C;  4IL6 X;  2IBZ G;  4XA4 A;  2YKO A;  4TLF A;  3CL3 D;  5K5G B;  1BGY G;  2PP6 A;  4JPZ B;  3ABV C;  3IR9 A;  5E79 E;  5KJ7 D;  1N86 A;  1LTI C;  3V2N A;  3WU2 E;  4H0L D;  1CI6 B;  1BGY D;  4I7Z B;  3G6E P;  1H0T B;  3D6Y A;  3H1K J;  3FXD A;  3V6I A;  1M1K Q;  1FS0 E;  5GTI E;  3L35 A;  4U3F D;  2E74 B;  2LXB A;  1GD2 E;  1FU1 A;  3B4S A;  3GLM A;  4KT0 J;  1HUC A;  3N7N A;  3GHG B;  2FBW C;  2E75 D;  2POH A;  1KQF B;  1JMM A;  1GK4 A;  1JY3 P;  2C9L Y;  2Y9Z A;  3BCC E;  4N78 E;  3CX5 D;  1FOS F;  4LLH A;  1PV3 A;  1T8Z A;  1WMK A;  5APV A;  3JC2 2;  1NTM E;  3H6P A;  4Z1M H;  1BSN A;  1QVF O;  1N7S C;  2FKW B;  2WSE H;  3CWB D;  3H1J G;  1P84 D;  2WIT A;  4KHX A;  3I5C A;  3G3Z A;  2Y0D A;  4K3A A;  4ASV A;  3E7K A;  3RK3 E;  4BWN A;  2B89 A;  1NTZ J;  4AYC A;  1URQ C;  2K9J A;  5TIS E;  5AVQ B;  3H32 A;  3KHU A;  3KZI E;  3VMZ A;  1BDC A;  1LTB C;  5L8R J;  3SWY A;  1IFN A;  4I2L C;  2M3B A;  3PRJ A;  2NPS B;  3F89 A;  1A02 F;  1SFC D;  1ZOY C;  4HB1 A;  4LC1 A;  2KB7 P;  1RE4 A;  1SQQ J;  2W6J H;  1LWU A;  1LWU B;  2Q6Q A;  2O01 N;  2ZVN B;  5KJ7 C;  5CBN A;  3RK2 D;  4D6T G;  1VQM P;  5CJ4 A;  1FE6 A;  2GM4 A;  5KLV K;  1PP9 G;  3TNU A;  2Q3I A;  2FYZ A;  2OYH B;  4K35 A;  4D6T D;  1KMI Z;  4NPE A;  1RF0 A;  1L4A A;  1LT9 A;  1YQ4 C;  1JTH A;  1OX3 A;  2Z5H A;  4BRY B;  1S3J A;  1L0N G;  5CMZ A;  2WMM A;  3L74 J;  3OJA B;  4M3L A;  1BCC G;  1FDM A;  2O1K A;  4L73 A;  3AE5 C;  3S4R A;  3T97 B;  2W27 A;  1X0T A;  2IPP A;  1YJN P;  1BE3 E;  4XFJ A;  4PV1 B;  5CCG A;  3CME P;  1LTG C;  1S2E A;  1FOS E;  3HD7 A;  2KNC B;  1Q81 Q;  2H8P D;  1PGJ A;  1K05 A;  3A0H H;  3HE5 A;  2JR8 A;  2H88 C;  2KSE A;  2Q1K A;  4WY4 A;  2FXO A;  4WY4 B;  2OQQ A;  1LTJ A;  2I8D A;  4OWF A;  3A2A A;  1L4A D;  1XTG B;  3P7K A;  2I1J A;  2ZYG A;  4YPC A;  3R4Y A;  3CCJ P;  1K8A Q;  3HUS A;  1PGQ A;  1RY3 A;  1NU1 G;  4PJ0 H;  5CCG D;  1IZN B;  3FWL A;  1S5L H;  3EFG A;  2ZVO B;  2RMZ A;  3HD7 D;  1Q90 D;  2N1T C;  3NFQ A;  5CHX A;  1UII A;  2NZ2 A;  5B66 H;  1M1J A;  2W90 A;  4GOE A;  4NPF X;  5APT A;  2AEJ A;  1KQG B;  5APX A;  1DEB A;  3S1K A;  1L2P A;  3AE3 C;  2OTJ P;  3NXS A;  4KJM A;  1ZME C;  1L0L G;  3D70 A;  3GG2 A;  4L74 A;  1FZC B;  4JYB A;  2YXQ B;  3SFE C;  2KYV A;  1J1D B;  2KLV A;  1NTK E;  1KIL A;  1N73 A;  1N73 B;  2ZXE B;  2R3C A;  3JSV C;  1GL2 C;  4RO0 A;  2J59 M;  1PIX A;  5CBO A;  3H1I E;  1NKN A;  2Q9I A;  2M0B A;  3H1L G;  1BE3 D;  2V7Q J;  2W8Z A;  4H13 B;  3L74 E;  2Z5I A;  3TYY A;  1D7M A;  3H1L D;  1IFD A;  1VQL P;  4U7J A;  1SQV E;  1HJB A;  4N6J A;  4OGQ D;  1ZR4 A;  5B5E E;  1SQX G;  2UWJ E;  1OW6 A;  3L75 E;  1YYC A;  3MIW A;  3RK3 C;  3JCU H;  1KB9 E;  1NYH A;  3L71 E;  1LP1 B;  3PLN A;  3GW6 A;  1M56 D;  1T2K C;  3F5H A;  3AEF C;  3H1H G;  1IJD B;  3CCL P;  1RQV A;  1KQS O;  1SQB E;  2QRX A;  2RKL A;  2A06 G;  1PP9 J;  2KXP B;  5AW1 B;  4C46 A;  2WPR A;  2QE7 H;  2OTL P;  2YO3 A;  1K73 Q;  2A06 D;  5AW0 B;  1SQQ K;  3B8E B;  2KS1 A;  3TGU G;  5KLV J;  1L0N J;  3CX5 H;  4GIF A;  2AEF A;  1X8Y A;  1USD A;  1ZN5 A;  1OVR A;  3TGU D;  3IF4 A;  4H44 D;  2OYI B;  1LT1 A;  3RL0 B;  2E42 A;  3VMX A;  3OA7 A;  1P84 H;  2E76 B;  2GUV A;  4TT3 H;  3M91 A;  3GF7 A;  2FYN B;  2XNX A;  3AE4 C;  3AE6 C;  2IFM A;  5GTH E;  3VMY A;  3Q5P A;  1FDI A;  1J1E C;  2W6A A;  1U7J A;  1IK9 A;  2R3S A;  1SP4 A;  2AXT E;  3VOP A;  2HOD B;  2HOD A;  1NTK D;  1EQ7 A;  2IDB A;  3IN6 A;  2D2C C;  5CJ0 A;  2FYU K;  1QL2 A;  1G2C B;  3H1I D;  4R4L A;  1X9V A;  3MUD C;  2OYO A;  5KJ7 A;  2O01 H;  3U1C A;  3RBZ A;  2FFD C;  3A0B H;  4H0L B;  3CX5 I;  1SQP E;  3L70 E;  1DH3 A;  1RE3 C;  1NU1 J;  4BXL A;  4IL6 H;  3WMM 0;  3MP7 B;  1N7S D;  1NAF A;  3O8Z A;  2J58 A;  1JOC A;  1SQV D;  3AE1 C;  2B87 A;  2WSE J;  3E1I A;  5E79 H;  1K04 A;  1P84 I;  1J1D C;  2M5A A;  2P1J A;  2IX7 C;  1URQ D;  1RF1 B;  2K37 A;  2JWD A;  1OXZ A;  2E5Y A;  5BU5 A;  2E75 B;  3L75 D;  1VQN P;  1KB9 D;  4ZNC A;  3L71 D;  4EYY Q;  2QJK C;  5GTI H;  1JY2 O;  2IZ0 A;  2B9B A;  2E5T A;  1SQB D;  1L0L J;  4GT1 A;  2KK7 A;  3II6 A;  1VF5 C;  2WTY A;  3FWN A;  1OW8 A;  1YQ3 C;  4U3F G;  1ZRT E;  3KXD A;  3V2R A;  1VDF A;  3E1R A;  1G1I A;  3FXE A;  2W6B A;  1NWQ A;  2C0W A;  4C7R A;  4UB6 E;  4L75 A;  5KLV E;  5BU8 B;  1FZB A;  2FXP A;  3P8M C;  2YIU C;  3TSI A;  1SFC B;  1SFC A;  1HGV A;  1Q7Y Q;  4I1L A;  5TIS H;  2Z4E A;  3S9O A;  2B88 A;  3AEG C;  1MUU A;  1VQP P;  1HTL C;  1ZW0 A;  1YTZ T;  3D6Z A;  1SQX J;  3CWB G;  1AFO A;  1Q82 Q;  2N1T A;  2L5G B;  3V5B A;  3H1H J;  3BRT B;  3CCS P;  4EI2 A;  2BCC E;  4EDF A;  3BVH A;  2K9J B;  1ZXG A;  2CK3 H;  2R32 A;  3H32 B;  4Y99 B;  4HH2 A;  1EZV E;  5KKZ B;  1SQP D;  3L70 D;  3CC7 P;  2JO1 A;  2KI7 B;  1SS1 A; 
#chains in the Genus database with same CATH homology
 3VTP C;  3C9I A;  4AUW A;  1J2J B;  3LID A;  1KIL D;  3HD7 C;  2WPS A;  3P8C E;  5AW4 B;  2A45 H;  1JCD A;  5CCG D;  1GU5 A;  5AVZ B;  2HFE D;  1GK6 A;  3EFG A;  1HGZ A;  3BRV B;  3HD7 D;  2MJZ A;  2P7J A;  2KP8 A;  2N1T C;  3NFQ A;  3BAT A;  2JEE A;  5CHX A;  2GUS A;  1KFM A;  1W2E A;  1LTJ C;  1L0N K;  1M1J A;  1JUN A;  3TNU B;  2N1T D;  5AW3 B;  5APT A;  2O1J A;  5APX A;  1DEB A;  3SWF A;  3L37 A;  2QM8 A;  1NTK K;  1L4A B;  1LT9 B;  3R2P A;  1JTH B;  4O9B A;  1OWA A;  1H89 A;  3NXS A;  4IFD K;  2OYI A;  2XU6 A;  1JO5 A;  3HE4 A;  1GU4 A;  1KZU B;  1WT6 A;  2WWW A;  1FZC B;  1ZLL A;  2YO2 A;  5AVV B;  4JYB A;  2YKQ A;  1CI6 A;  1GZL A;  2M8R A;  2H7H A;  3V2Q A;  1WRG A;  1J1D B;  2KYV A;  2XV5 A;  1Z56 A;  2XZR A;  2KLV A;  3B5N C;  4JF7 A;  2C0X A;  1KIL A;  1YTZ I;  1N73 A;  1N73 B;  2ZXE B;  2R3C A;  1MZ9 A;  1GL2 C;  2KOG A;  2R5B A;  3B5N D;  2J59 M;  3HD7 B;  1SQV K;  2HLO A;  5AW2 B;  1HVV A;  1NOH A;  3RK2 B;  4W7Z A;  1M1J C;  1GL2 D;  3GHG A;  1NKN A;  2Q9I A;  1G1J A;  1LTS C;  3M9H A;  1SQP K;  3M0D A;  3HE5 B;  1IFM A;  5AW8 B;  2NPS D;  2N1T B;  1FAV A;  5APW A;  1T3J A;  2A45 I;  3TK1 A;  1FZF A;  1LTJ B;  2Z5I A;  3TYY A;  1KFN A;  2QM7 A;  4WBA A;  1IC2 A;  1IFD A;  4N78 D;  1GW4 A;  2OYI C;  2CPS A;  4W7Y A;  3RL0 C;  2WZ7 A;  2IFN A;  3U1A A;  5BVZ A;  3M9B A;  1G2C A;  5AW9 B;  1HJB A;  1A02 J;  4DZO A;  1JY3 N;  4N6J A;  3BAS A;  1NU1 K;  1JNM A;  1ZR4 A;  3L36 A;  3RL0 D;  5CCH A;  3VP8 A;  3HUS B;  2JJL A;  4HYT B;  2WSC H;  1YYC A;  3MIW A;  1KIL C;  3RK3 C;  2WT7 A;  3V4Q A;  2WT7 B;  1T2K C;  1FJP A;  2YKP A;  1QL1 A;  4LGD E;  1NH4 A;  3P32 A;  1M7L A;  1IJD B;  3RK3 D;  3B5N A;  3B5N B;  1T2K D;  3CI9 A;  3M06 A;  1DX7 A;  3GHG C;  5AW1 B;  4C46 A;  1RF1 A;  2OAR A;  2WPR A;  1GL2 B;  1GL2 A;  3M0D C;  2YO3 A;  5AW6 B;  1T3U A;  2PAJ A;  4N3Y B;  4C7N A;  4C7N B;  2NPS A;  5AW0 B;  1SQQ K;  3B8E B;  3KYQ A;  1M1J B;  1L0L K;  5AVW B;  5APY A;  3LIE A;  4GIF A;  3P8C D;  4XA4 A;  1X8Y A;  5APU A;  1E5W A;  2YKO A;  2HYN A;  1ZN5 A;  3CL3 D;  1PFI A;  3MTU E;  5CCH C;  3NTN A;  2PP6 A;  2OYI B;  3RL0 B;  3IR9 A;  2E42 A;  1LGH B;  3HE4 B;  3VMX A;  3KDP B;  5KJ7 D;  2R5D A;  1N86 A;  1LTI C;  1NHL A;  3V2P A;  3OA7 A;  3U59 A;  3V2N A;  2OYH A;  3MUD A;  5CCH D;  2GUV A;  3M91 A;  1CI6 B;  2FFD A;  2XNX A;  5AVX B;  1RE3 A;  2A45 G;  5AVR B;  2HG5 D;  5APQ A;  2WSF H;  4WB4 A;  4Y99 C;  1JY2 N;  1KIL B;  3RK3 B;  3L4F A;  2IFM A;  1JY3 O;  3L35 A;  1CW5 A;  1RF1 C;  3VMY A;  2FXM A;  1GD2 E;  1FU1 A;  3T97 A;  1J1E C;  2W6A A;  1HUC A;  2NPS C;  4RES B;  1GW3 A;  1NTM K;  2HPC A;  1IK9 A;  3N7N A;  3GHG B;  5AVS B;  1H88 A;  2P67 A;  1SP4 A;  2POH A;  1SVF A;  3VOP A;  1LWU C;  4XE5 B;  2HOD B;  1JMM A;  2HOD A;  1GK4 A;  3KPE A;  1JY3 P;  2C9L Y;  1EQ7 A;  1GTW A;  2C9N Y;  2E43 A;  4EIJ A;  1AQ5 A;  4N78 E;  5CJ0 A;  1FZA A;  1SQX K;  2FYU K;  4I6M C;  1FOS F;  4LLH A;  1QL2 A;  1S9K E;  1T8Z A;  1FJK A;  1G2C B;  5APV A;  2BAS A;  4B86 A;  1X9V A;  1IFI A;  2OYH C;  3A7O A;  5KJ7 A;  3PP5 A;  2O01 H;  3VP9 A;  3H6P A;  2VRS A;  3U1C A;  2FFD C;  1N7S C;  2FKW B;  2WSE H;  1DH3 A;  1ZR2 A;  1RE3 C;  1CZQ A;  3M9Q A;  3MGN A;  2WIT A;  4KHX A;  3I5C A;  3G3Z A;  3WMM 0;  5APS A;  4JYC A;  1N7S D;  4AQR D;  1NAF A;  2I1K A;  3V4W A;  3O8Z A;  2J58 A;  4AYC A;  1URQ C;  1JOC A;  5AVQ B;  3LW5 H;  3E1I A;  3H32 A;  1J1D C;  1NO4 A;  3VMZ A;  2P1J A;  2IX7 C;  1URQ D;  1RF1 B;  1SFC C;  1LTB C;  1OXZ A;  1LTT C;  3SWY A;  5BU5 A;  3HTK A;  3A3Y B;  2ZFC A;  1IFN A;  4I2L C;  2H43 A;  2M3B A;  3EQ2 A;  1J1E B;  2NPS B;  2Q5U A;  1A02 F;  4DOJ A;  1SFC D;  1JY2 O;  2YNY A;  4LC1 A;  4IFM A;  2KB7 P;  1RE4 A;  3RK2 C;  3UIA A;  3KQG A;  1LWU A;  1LWU B;  3VYI A;  1GDT A;  3MD0 A;  4GT1 A;  1IO4 A;  1JCC A;  5KJ7 C;  3RK2 D;  3II6 A;  5CJ4 A;  4EOT A;  4WY4 C;  2XKM A;  2CPB A;  2GM4 A;  5KLV K;  2WTY A;  1KQL A;  3TNU A;  1JY2 P;  2P2U A;  1VPC A;  2Q3I A;  2FYZ A;  3VN0 A;  4WY4 D;  2OYH B;  1ZV8 A;  3NMD A;  1RF0 A;  3HRN A;  1L4A A;  1LT9 A;  2FFD B;  1N7S B;  1N7S A;  1JTH A;  3V2R A;  1VDF A;  4OH8 B;  1G1I A;  2WPQ A;  2N9B A;  2Z5H A;  2W6B A;  1NWQ A;  3HUS C;  2C0W A;  2YMY A;  5CMZ A;  4C7R A;  1HWT C;  3OJA B;  4W80 A;  4M3L A;  1FZE A;  1FDM A;  5BU8 B;  1URQ B;  1URQ A;  2O1K A;  1FZC A;  1FZB A;  3P8M C;  1LTA C;  2KSJ A;  2W27 A;  3TSI A;  1HBW A;  1XTC C;  5AVY B;  2IPP A;  2HPC B;  1MFZ A;  5AVT B;  1H8A A;  1RE4 C;  1SFC B;  1SFC A;  5AVU B;  1HGV A;  1N7L A;  1SLQ A;  4I1L A;  5CCG A;  1MV8 A;  2Z4E A;  1LTG C;  3N4X A;  1MUU A;  1FOS E;  3HD7 A;  1X79 B;  2Q7C A;  2XDJ A;  1HTL C;  3A5T A;  1CSB A;  2LKM A;  1YTZ T;  1AFO A;  4IFF A;  5AW7 B;  2H8P D;  3M0A A;  1HH0 A;  5KTB A;  3OAK A;  3HE5 A;  2N1T A;  2L5G B;  1FZG A;  1RF0 C;  4ZKU A;  4WY4 A;  4WY4 B;  1L4A C;  1LT9 C;  3V5B A;  1LTJ A;  3BRT B;  3IFM A;  3A2A A;  4GKG A;  3BVH A;  1L4A D;  1XTG B;  3P7K A;  1SQB K;  2I1J A;  5AW5 B;  3CLQ A;  1S9K D;  1IFJ A;  1FZC C;  2R32 A;  3H32 B;  4Y99 B;  4HH2 A;  1FBM A;  3HUS A;  1NKZ B;  3HTK B;  1N73 C;  4ZKP A;  1NTZ K;  5CCG C;  1RY3 A;  1N2D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...