2KYVA

Hybrid solution and solid-state nmr structure ensemble of phospholamban pentamer
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
52
structure length
52
Chain Sequence
MEKVQYLTRSAIRRASTIEMPQQARQNLQNLFINFCLILICLLLICIIVMLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phospholamban
publication title Structural topology of phospholamban pentamer in lipid bilayers by a hybrid solution and solid-state NMR method.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Membrane protein
total genus 19
structure length 52
sequence length 52
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04272 Phospholamban Phospholamban
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.290 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2kyvA00
1FJPA 1N7LA 2KYVA 2HYNA 2KB7P 2M3BA 1FJKA 1ZLLA
chains in the Genus database with same CATH superfamily
2YIUB 2WPSA 3BCCG 2OTJP 1K73Q 3L71J 3KHUA 3KZIH 4I7ZB 4KHXA 5KKZB 2G3AA 2ZYDA 2KP8A 1GK4A 3RL0D 3VOPA 1AQ5A 2B88A 2LXCB 1FBMA 3L37A 4OWFA 2FFDC 3U59A 4BXLA 4N78E 4DZOA 1JY3N 3BCCE 2XU6A 1HTLC 5KTBA 1SQQJ 1EZVG 1NKNA 3V4QA 1Q81Q 2BCCE 2R32A 4JPZB 3F89A 1MZ9A 1N86A 2ZT9B 1L0ND 3JSVC 1S1CX 1KILA 3MP7B 1NTZD 3L74J 5APYA 3H1JE 2RH0A 3L72G 5APUA 1ZV8A 2WSFH 1X9VA 3IAOA 1S9KD 2KB7P 2Z5IA 2AXTH 5KAFE 4KJMA 3L70J 1BGYD 1VL2A 1DD3A 2W6AA 2A45H 2KUBA 2ZVOB 1L0NK 2A45G 3L72E 1KB9D 5AW5B 3KXDA 3O6QA 3L35A 3Q5RA 3TDKA 3W67A 5CCGC 4L73A 4MN4C 3L36A 1UIIA 1HGVA 2QVAA 1KILC 5AVYB 3Q5SA 3S9OA 5AVRB 1LTIC 2FYNB 2J5UA 1FJPA 3H1KD 4JYCA 2B89A 1X0TA 4WY4C 2HFED 1PL5A 1QVGO 2O01N 3EWKA 1KQGB 3HUSB 2KSEA 1IO4A 3A0HE 2O1JA 4JF7A 1P84H 1QGKB 3L70D 1S4XA 1IFIA 2IBZG 1LTTC 1KB9I 5TISE 3AEBC 1LNQA 4OGQD 3AE3C 2Z5HA 3WUUA 1GMJA 3D70A 1S72P 3BATA 1W5CE 2YIUC 2VRSA 3RL0g 1ZR4A 1YBKA 2IBZE 1USDA 1FDMA 1M57D 3M9QA 1VQ5P 3RK2B 3H25A 1LP1B 4H44D 3E1RA 4PV1B 1FC2C 3MIWA 1NO4A 4U3FJ 2O1KA 1ZXGA 1UIXA 3CC2P 5E79H 4N78D 4NPEA 5KLVJ 1GL2C 3H6PA 4EYYQ 3HE4A 1Q82Q 5AVTB 2DW3A 2BCCD 3GHGB 2RN0A 1URQD 3A0BH 3V2RA 3AEDC 5CBNA 1G2CB 1OXZA 3NXSA 1N73B 2Q3IA 1AVOA 4ZKUA 2W6BA 3H1JD 1G1JA 2WSCH 3P8MC 5AW1B 1JCDA 4WB4A 4EOTA 1KMIZ 2WITA 5AVWB 3A0BE 1LTGC 1BCCE 2JO1A 3V2NA 2Q1KA 2WSSH 4ASWA 1HF9A 1S5LX 1FJKA 2IYOA 1ZLLA 2O3JA 3RGUA 1SFCB 5GTIE 2AEJA 2PGDA 4GOFA 3TK1A 4IL6H 3M0DA 2NPSC 1KYOH 3PTZA 4LC1A 3GMAA 5CHXA 1T3UA 5KLVD 1VQLP 2QRXA 1NAFA 1BE3J 2FYNC 3IN6A 3PH0A 5KJ7D 1L4AC 1IZNB 3B5ND 1FZBA 2GUSA 1SQBJ 3C9IA 3CX5D 3Q1MA 1LP1A 4I2LC 1PP9J 1IFNA 5M1BA 2M3BA 1RE3C 1L0LJ 1Q7YQ 3HUSC 1OX3A 4RKUJ 3VMZA 1OIPA 2OYHB 1M56D 3GHGA 1NVOA 3N7NA 5KLVK 5AW4B 5AW9B 1SP4A 1NTKG 1X8YA 5KAIH 4WWIA 2OQQA 1OW8A 4EDFA 2C0WA 1KORA 2JWAA 1NTMG 2E5TA 1FZEA 1GU4A 1NU1G 2A06G 3Q2YA 1GU5A 1NTKE 1HBWA 2KK7A 1OZHA 1ZMEC 1T2KD 3IR9A 3BVHA 4YPCA 1SFCA 1KQFB 1NTME 4PV1C 3L73G 1NU1E 2A06E 2PP6A 1PP9D 1URQB 2OYIB 1SQXJ 5AVZB 2KLUA 2JKVA 5C39A 2XDJA 1SQVD 4K3AA 2N1TD 2C9LY 2QSIA 1YTZI 4O9BA 3L73E 2HYNA 1P84I 1N73C 2CPSA 2B87B 3OJAB 2MKVA 3D6YA 3A3YB 4BRYB 3LW5H 1VQNP 4Z1MH 2NRGA 2LR2A 2WTYA 3BRTB 3HD7D 2YKQA 2K9JA 1VPCA 1BCCD 5APVA 2Q6QA 3MZWB 5B66E 4DT0A 2Y9YA 3OW2O 2D2CB 1HH0A 2QJYB 2V7QJ 1SQVK 2AXCA 5KLIB 1J1DC 5BVZA 2RKLA 3L71G 2KXPB 3R4YA 4M3LA 5APQA 1VQKP 4N3YB 1N2DC 1VF5D 2LXBA 1T6AA 3QWOC 4PD4D 2QIWA 4PJ0E 1KB9H 4QMAA 3EQ2A 3CCRP 1CSBA 2AEMA 3MUDC 4JBZA 1SQQG 1R5LA 3L71E 3B4SA 1MFTA 1K9MQ 3H1IG 1JY2O 1ZR2A 4XA4A 3A5TA 1EC5A 3V2QA 4BWNA 3HTKB 3L74G 2OYHC 1CI6A 3B71A 1YTZT 2HR3A 2ZJSE 5AVXB 4OGQC 1FZCB 3H1IE 2WSEJ 4I6MC 4W7YA 2FFDA 4R4LA 5APXA 2E74B 2B87A 2JJLA 3P32A 3AEFC 3I56P 4BRYA 2ZAEB 2M8RA 3VYIA 4OH8B 1OW7A 4H44C 1L0NJ 4R4MA 3M9BA 4LGDE 1NTZJ 4PD4I 3K5BA 1GD2E 1DH3A 1NJIQ 4ZNCA 1N7SD 5CCHA 4ZMDA 3JC22 3CCVP 1URQC 2N1TB 2OYIC 2L91A 1KV4A 1QX8A 3CXHD 1SVFA 2IX7C 3RK3D 5TJHA 4GOEA 4Y99B 3TGUJ 1BGYJ 1PZQA 3A7OA 2E75D 1NAYA 3L75E 3OA7A 5AW7B 1S5LH 2Q7CA 4NPFX 2H43A 2FBWC 3I5CA 2FYZA 1GL2B 3KZIE 5CCGA 2E43A 2FXMA 1FU1A 3NFQA 2JP3A 2KS1B 3H1KJ 3PP5A 3SWYA 5CCHC 2D2CC 2FXPA 2QJYC 1ZRTE 1XTCC 2KIKA 5KLIC 2L5GB 3CCQP 2WVRA 1YIJP 1U57A 1JM0A 4UB8H 4WY4A 1EZVE 2I8DA 3NTNA 3WMM0 3FXEA 3TSIA 5KJ7C 1YI2P 3LIEA 3B5NC 4LLHA 1K05A 1CZQA 1OW6A 1LT1A 1IK7A 3TGUD 1FDIA 4U3FG 4YTPC 2JEEA 2NPSB 2K3RA 1NTZK 1H89A 2YXRB 1A02F 3CCSP 1OVVA 1D7MA 5AW0B 3GW6A 1LTAC 3S4RA 3JCUH 2AXTE 1PPJD 5K5GB 5BU5A 3CX5H 1L4AB 3RBZA 2FXOA 1PGQA 2IZ0A 1K8AQ 3SWKA 1FOSF 2ZXEB 1JUNA 1FZCC 3H1HD 5AVSB 3BASA 2E74C 2KYVA 2YMYA 3CC4P 2BCCJ 1GL2A 1KQLA 1VQ9P 3CCLP 2OARA 2H89C 1HJBA 1S3JA 3P7KA 2R3SA 4UB6H 1JY3P 3H1JJ 1YJ9P 3RK3B 1T3JA 2N1TC 1SQPD 1U7JA 3H1LD 1KD1Q 1BE3G 1KILE 2ZVNB 1QVFO 3G4SP 3RL0B 3EFGA 1P84E 2FYUG 1VQMP 3UIAA 4Y99C 1HWTC 1SQBG 1RHZB 3U1AA 3HD7C 3L75D 3CWBG 3VMAA 3CCEP 2JDIH 2NPSA 4C7NB 2YKPA 1L0LG 1GW4A 2Z4EA 3VP8A 3BCCD 1LTBC 2FYUE 1NHLA 4YXDC 2Y0DA 1SQPK 1T8ZA 3CWBE 2YNYA 1L4AA 1ZRTD 2SPZA 4W80A 5E79E 4L75A 1J1EB 1EZVD 4GKGA 2HPCB 1X22A 2QJKC 1RE3A 4EIJA 3C1LA 3I55P 1LTSC 1FDOA 3HUSA 4ZKPA 3KPEA 2H7HA 1YITP 2WT7B 4XFJA 1M1KQ 1AFOA 1YQ4C 3L72D 1J1DB 2KZJA 2UWJE 4DOJA 1SQXG 1Q86Q 3CCMP 2IFNA 4PD4H 3U1CA 3MHVA 1RF0C 1NOHA 3G6EP 2POHA 2PAJA 1E5WA 4IL6E 1AV1A 2XKMA 1KYOE 2IZ1A 4RESB 1Y47A 1IJDB 3TNUB 2NZ2A 1YQ3C 1DEEG 1W2EA 1BSNA 1USEA 3AE8C 4C7RA 1LT9C 4C7NA 5B5EH 1MKMA 2GA1A 1SQVJ 1ZOYC 1N7SC 2W90A 2G8YA 2KSJA 2K9YA 2V7QH 3FWNA 3V6IA 1FE6A 1DEBA 4OGQB 1G2CA 3TYYA 1IFJA 3D71A 3HRNA 1N73A 4TT3H 3RK3C 2WPVB 2QE7H 5GTHH 1BCCJ 3AE7C 3E1IA 1KILD 4H44B 3RL0C 2E75C 2MJZA 4JYBA 2HPCA 1LWUB 2IBZD 1NH4A 4D6TG 5KAIE 3CX5I 4XE5B 2WT7A 4A7PA 2WWWA 3FWLA 2OGUA 5AVUB 3CXHH 3H32B 2CPBA 1YJWP 2P2UA 1JCCA 2M5AB 1RF1C 2J58A 5AW8B 4D6TE 2GUVA 5H2FH 2E5YA 1YYCA 2QG4A 1VQPP 1X79B 2Y0EA 2WSEH 2RMZA 1N8RQ 1J1EC 3CD6P 3AE9C 3MUDA 2QM8A 1L0NG 3WU2H 3T97B 1JO5A 5H2FE 1OVRA 1IFMA 3VN0A 2IBZI 3II6A 1WRGA 4AQRD 2OYHA 4I1LA 3NMDA 2M3EA 1ZN5A 3GF3A 3AE4C 1L0NE 2WPRA 3B5NB 1QL1A 1VQ8P 2IPPA 1H88A 3FXDA 1NTKJ 4YXWH 2ZT9D 1BGYG 2W83C 1BDDA 1HUCA 2R5BA 4NPDA 4AUWA 1KYOD 1NTMJ 2IDBA 1NU1J 2C0XA 1IK9A 1KZUB 1M8OB 3CC7P 2B9BA 2OYOA 1URQA 1BGYE 2ZYAA 3H32A 2P67A 2OYIA 1S2EA 1E79H 3H1KG 1KB9E 2KNCB 3L73J 2KOGA 1NYHA 2W8ZA 1SQQE 4L74A 2YO2A 3AEEC 3OAKA 3S1KA 5CJ0A 4TLFA 3BRVB 2E76D 3H1KE 3R2PA 3VMXA 1NWQA 1FOSE 3L74E 5APWA 4KT0J 1NTKD 3L70G 1Y8AA 4AYCA 1LWUC 1HGZA 3ITKA 3W68A 1IC2A 2OTKE 4GODA 1NTMD 1NU1D 1DIPA 1KFNA 2A06D 3E7KA 1GK6A 3IF4A 3L70E 4H0LD 5KJ7A 2YXQB 3B5NA 4RO0A 1WMKA 3ABVC 3TF5A 1Z56A 5CBOA 4H13D 3SFDC 3MD0A 3L73D 2QEXP 4U7JA 5AW3B 1EDKA 3HD7B 3Q3DA 1NTKK 1NGMB 1LTJB 1VQ4P 2JWDA 2BCCG 3VMYA 1WT6A 3SSUA 1DD4A 2W6JH 1NTMK 1NU1K 1RH5B 4HYTB 1EXJA 1A02J 3MGNA 1N7LA 3RK2D 3HTKA 2FY8A 2QJPB 3H1JG 1S5LE 2KNCA 4PV1D 3H1IJ 5EFWB 3SFEC 3H1HJ 1KC8Q 1FZCA 1VF5B 4GIFA 2XNXA 3CXHI 2QJKB 2BEZF 5KAFH 1OFCX 1EDLA 3HE5B 1VQOP 4L76A 4WVZA 2Y0CA 3F5HA 4UB8E 5AW6B 3FGAD 5L8RJ 3G71P 1SS1A 3CMAP 5KLVG 1PV3A 2HLOA 1SQPJ 3H1LJ 3L71D 2I1JA 2N9YB 1FS0E 2N1TA 2P58A 2O01J 4U3FE 5APSA 1SFCD 3HE4B 1JMBA 3AEAC 5KLVE 3L75J 2E76B 1JB0J 2K88A 1SQQD 1QEXA 3AE6C 3H1ID 3HD7A 4EI2A 1LTJA 3CLQA 5DJUB 3BCCJ 3JCUE 1W2BO 1LT9B 3A0HH 1N7SB 1T2KC 2E42A 3CX5E 3L74D 1CW5A 3WUTA 1FZFA 3PHLA 2V4HA 3A2AA 5TISH 2KS1A 2J59M 3CMEP 3V5BA 3G9RA 3AE2C 2ZXXA 4JQ0D 4H0LB 2KZIA 3L4FA 5CMZA 1PGJA 4H13B 1SQQK 1NKZB 2E75B 1M1JB 3PJSK 1GW3A 3PRJA 4UB6E 1GDTA 1PP9G 3L72J 3HE5A 1LTJC 1DX7A 3KQGA 2WSFJ 1BE3E 4RJTA 2PRRA 4I7ZC 4IOIH 1SQVG 5KKZC 1IFPA 1JTHB 1L2PA 3V4WA 1RF1B 3MTUE 5BU8B 1SQBE 2WQYC 4N6JA 2JR8A 3AEGC 2H88C 1JY2N 1RF0A 1PP9E 2BASA 1H0TB 3RBXA 2KLVA 1KTMA 2QJPC 1L0LE 2WMMA 1MV8A 1SQVE 3LIDA 3WUVA 2GM4A 2ZT9C 1VF5C 1BCCG 4CPGA 1G1IA 2R44A 2YO3A 2AEFA 1LT9A 5GTIH 1RQVA 1AQTA 2PFXA 1N7SA 4IFFA 2K1AA 3P8CE 2HODB 2R5DA 1H8AA 1M7LA 4HJGH 2BEQD 1KQSO 1KN7A 2N9BA 4W7ZA 1EXIA 1AA0A 3ZDMA 2KI7B 3M0AA 2YMKA 4U3FD 5CCHD 1M1JA 3CPWO 1OWAA 1PFIA 2D2CD 3M06A 5APTA 1SQXE 1Y9BA 1XTGB 2E76C 2P7JA 3IFMA 1EZVI 4WBAA 4PD4E 1ZP0C 2R3CA 3GG2A 1HVVA 1JEKA 2FYUJ 1JTHA 1JY3O 1VQ7P 3M91A 1RF1A 1M90Q 1U7MA 3CWBJ 2XZRA 1VDFA 2K9JB 2ITAA 4IFMA 2XV5A 3V2PA 3GF7A 1H0TA 2K37A 4H0LC 1IFDA 1EDJA 4Y28J 1J2JB 5B5EE 1QLED 1EQ7A 5CCGD 1GTWA 2M0BA 4H13C 3VP9A 2P1JA 3M0DC 1JY2P 1M1JC 1LGHB 1P84D 1AJYA 2A45I 1EDIA 2HODA 1FAVA 2WSCJ 1VQ6P 2CK3H 3CL3D 4WY4D 2LKMA 5GTHE 4GT1A 1BE3D 1AVYA 3Q5PA 2E74D 2C9NY 3KYQA 2P10A 2H8PD 2IFMA 2FYUD 4HKZH 5AVQB 1HJ0A 3RK2C 4GDOA 1SQBD 1GZLA 3N4XA 3VTPC 4HH2A 3SWFA 3CWBD 2OTLP 3FX0A 2QA4P 3CI9A 1RQUA 1R5SA 1L0LD 3CXHE 4K35A 2Q5UA 3RK3E 1PGOA 1CI6B 3GHGC 3TNUA 3G3ZA 1YJNP 2IYPA 4DCKA 1MUUA 2W27A 3CCUP 5B66H 2ZYGA 1NTZG 3AE1C 2HG5D 3GLMA 2FFDB 3PLNA 3P8CD 1JMMA 2FYUK 4B86A 1LJ2A 1SQBK 3CCJP 3WU2E 1GL2D 1NTZE 1SFCC 5DJTB 1L0LK 1YHQP 4ASVA 1BDCA 4PJ0H 1OVUA 3TGUG 3O8ZA 2YKOA 3QH9A 3C8VA 1K04A 1TU3F 3AE5C 4HB1A 5AW2B 1LWUA 1SQXD 2I1KA 1S9KE 2WZ7A 1Q2NA 1R8EA 4OVNF 1QL2A 1PPJG 3TGUE 1JOCA 2XNDH 4D6TJ 2M5AA 1RE4A 2Y9ZA 2QM7A 2NPSD 1FZGA 3H1HG 4IL6X 3B8EB 1KILB 1PPJE 3KDPB 1ZW0A 1SQXK 2ZFCA 3M9HA 1RY3A 1MFZA 4WY4B 3T97A 2WPQA 1PGPA 1L4AD 3EFFK 1OMIA 4IFDK 1KYOI 3H1HE 1FZAA 5AVVB 5CJ4A 1KFMA 4C46A 3LW5J 1Q90D 1SQPG 3H1LG 2Q9IA 3USSA 4DJGA 3AECC 2FKWB 1SLQA 2O01H 2Q3EA 3O6QB 3D6ZA 4D6TD 1RE4C 1PIXA 3L75G 1SQPE 3H1LE 1JNMA 1BSHA
chains in the Genus database with same CATH topology
1E5WA 2WPSA 2XKMA 4RESB 4KHXA 1IJDB 1HH0A 3TNUB 3L4FA 5CMZA 1SQVK 2KP8A 1W2EA 1GK4A 3RL0D 4C7RA 1SQQK 1J1DC 3VOPA 1AQ5A 1NKZB 5BVZA 1LT9C 1FBMA 3L37A 4C7NA 2FFDC 1M1JB 3U59A 1GW3A 1N7SC 4N78E 4DZOA 2KSJA 1JY3N 4M3LA 5APQA 2XU6A 1HTLC 5KTBA 4N3YB 1N2DC 1GDTA 1NKNA 3V4QA 2R32A 1MZ9A 3HE5A 1N86A 1DEBA 1G2CA 1LTJC 3TYYA 1IFJA 1DX7A 1KILA 3KQGA 3EQ2A 3HRNA 1N73A 3RK3C 1CSBA 1JTHB 5APYA 3V4WA 1RF1B 3MTUE 5BU8B 4N6JA 3E1IA 1KILD 1JY2O 1JY2N 5APUA 3RL0C 2MJZA 1ZR2A 4JYBA 1RF0A 4XA4A 2BASA 3A5TA 2HPCA 1ZV8A 2KLVA 3V2QA 1LWUB 2WSFH 1NH4A 3HTKB 1X9VA 2OYHC 1CI6A 1S9KD 2KB7P 1MV8A 3LIDA 2Z5IA 1YTZT 2GM4A 5AVXB 4XE5B 2WT7A 2WWWA 1FZCB 5AVUB 1G1IA 2W6AA 3H32B 2A45H 2YO3A 1L0NK 2A45G 4I6MC 2CPBA 5AW5B 1LT9A 2P2UA 4W7YA 2FFDA 1JCCA 5APXA 1N7SA 2JJLA 3L35A 4IFFA 3P8CE 3P32A 1RF1C 2J58A 5AW8B 2HODB 5CCGC 2R5DA 2M8RA 2GUVA 1H8AA 3L36A 3VYIA 4OH8B 1M7LA 1HGVA 3M9BA 1YYCA 1KILC 4LGDE 5AVYB 1GD2E 5AVRB 1LTIC 1DH3A 1X79B 1N7SD 2WSEH 1FJPA 5CCHA 1J1EC 4JYCA 2N9BA 4W7ZA 3MUDA 2QM8A 4WY4C 2HFED 1URQC 2N1TB 2OYIC 3M0AA 1JO5A 5CCHD 1M1JA 1SVFA 1OWAA 2IX7C 1PFIA 1IFMA 3VN0A 3M06A 3II6A 1WRGA 3RK3D 5APTA 4AQRD 3HUSB 1XTGB 1IO4A 2O1JA 2P7JA 4Y99B 2OYHA 4I1LA 3IFMA 3A7OA 3NMDA 4JF7A 1ZN5A 4WBAA 2R3CA 1HVVA 3OA7A 1IFIA 1LTTC 2WPRA 5AW7B 2Q7CA 2H43A 3B5NB 3I5CA 1JTHA 1GL2B 2FYZA 1JY3O 1QL1A 3M91A 2IPPA 1H88A 1RF1A 5CCGA 2XZRA 2Z5HA 2E43A 1VDFA 2FXMA 4IFMA 1FU1A 3NFQA 3BATA 2XV5A 1HUCA 3V2PA 2VRSA 2R5BA 1ZR4A 4AUWA 3PP5A 3SWYA 5CCHC 1IFDA 1J2JB 1FDMA 3M9QA 1EQ7A 1XTCC 5CCGD 3RK2B 1GTWA 2C0XA 1IK9A 1KZUB 2L5GB 3VP9A 2P1JA 3M0DC 3MIWA 1NO4A 1JY2P 2O1KA 4WY4A 1URQA 1M1JC 3NTNA 1LGHB 3H32A 2P67A 3WMM0 2OYIA 3TSIA 4N78D 5KJ7C 3LIEA 3B5NC 1GL2C 3H6PA 3HE4A 2A45I 4LLHA 5AVTB 2HODA 1FAVA 1CZQA 3GHGB 3CL3D 2KOGA 4WY4D 1URQD 2LKMA 3V2RA 4GT1A 1G2CB 2YO2A 1OXZA 3OAKA 2JEEA 2NPSB 5CJ0A 2C9NY 3KYQA 3BRVB 3NXSA 2H8PD 2IFMA 1NTZK 1N73B 1H89A 2Q3IA 5AVQB 3RK2C 1A02F 4ZKUA 3R2PA 2W6BA 3VMXA 1NWQA 1FOSE 1G1JA 1GZLA 2WSCH 3P8MC 5APWA 5AW0B 5AW1B 3N4XA 1JCDA 1LTAC 4WB4A 4EOTA 2WITA 5AVWB 3VTPC 4AYCA 4HH2A 3SWFA 1LWUC 1HGZA 1LTGC 3V2NA 3CI9A 5BU5A 1L4AB 1IC2A 1FJKA 1ZLLA 2Q5UA 3GHGC 1CI6B 1SFCB 3TNUA 3G3ZA 1FOSF 1KFNA 1MUUA 2ZXEB 1JUNA 1FZCC 2W27A 3TK1A 3M0DA 2NPSC 1GK6A 2HG5D 5AVSB 3BASA 2FFDB 4LC1A 5KJ7A 5CHXA 3P8CD 2KYVA 2YMYA 1T3UA 3B5NA 1GL2A 1JMMA 1Z56A 2FYUK 4B86A 1KQLA 1NAFA 1SQBK 3MD0A 2OARA 5AW3B 3HD7B 1NTKK 1HJBA 5KJ7D 1L4AC 1LTJB 3P7KA 3B5ND 1GL2D 1FZBA 2GUSA 1SFCC 1JY3P 3C9IA 1L0LK 3RK3B 1WT6A 3VMYA 1T3JA 1NTMK 4I2LC 1IFNA 2N1TC 2YKOA 3O8ZA 1NU1K 2M3BA 4HYTB 1RE3C 1A02J 5AW2B 3RL0B 3MGNA 1N7LA 3EFGA 1LWUA 3HUSC 3UIAA 3RK2D 3HTKA 4Y99C 1HWTC 2I1KA 3VMZA 2OYHB 3GHGA 3N7NA 5KLVK 5AW4B 5AW9B 2WZ7A 1S9KE 1SP4A 3U1AA 1QL2A 3HD7C 1FZCA 4GIFA 1X8YA 2XNXA 1JOCA 2NPSA 4C7NB 2YKPA 1GW4A 2Z4EA 2C0WA 3VP8A 1LTBC 1FZEA 1GU4A 1RE4A 1NHLA 1GU5A 3HE5B 1SQPK 2QM7A 2NPSD 1T8ZA 1FZGA 3B8EB 1HBWA 1KILB 5AW6B 3KDPB 2YNYA 1L4AA 1T2KD 3IR9A 3BVHA 4W80A 1SQXK 2HLOA 1J1EB 1SFCA 2ZFCA 3M9HA 1RY3A 1MFZA 2I1JA 2N1TA 2PP6A 4WY4B 3T97A 2WPQA 1URQB 4GKGA 1L4AD 2OYIB 2HPCB 5AVZB 4IFDK 1RE3A 5APSA 4EIJA 1FZAA 1LTSC 1SFCD 3HE4B 5AVVB 2XDJA 5CJ4A 3HUSA 1KFMA 4C46A 4ZKPA 3KPEA 2H7HA 2N1TD 2Q9IA 2C9LY 2WT7B 1YTZI 4O9BA 1AFOA 3HD7A 2FKWB 2HYNA 3CLQA 1LTJA 1J1DB 1SLQA 2O01H 1N73C 4DOJA 1LT9B 2CPSA 1N7SB 1T2KC 3OJAB 2E42A 1RE4C 2IFNA 1CW5A 3A3YB 3LW5H 2WTYA 3BRTB 3U1CA 3HD7D 2YKQA 1RF0C 1FZFA 1NOHA 1VPCA 1JNMA 5APVA 2POHA 3A2AA 2PAJA 2J59M 3V5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJP A;  1N7L A;  2KYV A;  2HYN A;  2KB7 P;  2M3B A;  1FJK A;  1ZLL A; 
#chains in the Genus database with same CATH topology
 2YIU B;  2WPS A;  3BCC G;  2OTJ P;  1K73 Q;  3L71 J;  3KHU A;  3KZI H;  4I7Z B;  4KHX A;  5KKZ B;  2G3A A;  2ZYD A;  2KP8 A;  1GK4 A;  3RL0 D;  3VOP A;  1AQ5 A;  2B88 A;  2LXC B;  1FBM A;  3L37 A;  4OWF A;  2FFD C;  3U59 A;  4BXL A;  4N78 E;  4DZO A;  1JY3 N;  3BCC E;  2XU6 A;  1HTL C;  5KTB A;  1SQQ J;  1EZV G;  1NKN A;  3V4Q A;  1Q81 Q;  2BCC E;  2R32 A;  4JPZ B;  3F89 A;  1MZ9 A;  1N86 A;  2ZT9 B;  1L0N D;  3JSV C;  1S1C X;  1KIL A;  3MP7 B;  1NTZ D;  3L74 J;  5APY A;  3H1J E;  2RH0 A;  3L72 G;  5APU A;  1ZV8 A;  2WSF H;  1X9V A;  3IAO A;  1S9K D;  2KB7 P;  2Z5I A;  2AXT H;  5KAF E;  4KJM A;  3L70 J;  1BGY D;  1VL2 A;  1DD3 A;  2W6A A;  2A45 H;  2KUB A;  2ZVO B;  1L0N K;  2A45 G;  3L72 E;  1KB9 D;  5AW5 B;  3KXD A;  3O6Q A;  3L35 A;  3Q5R A;  3TDK A;  3W67 A;  5CCG C;  4L73 A;  4MN4 C;  3L36 A;  1UII A;  1HGV A;  2QVA A;  1KIL C;  5AVY B;  3Q5S A;  3S9O A;  5AVR B;  1LTI C;  2FYN B;  2J5U A;  1FJP A;  3H1K D;  4JYC A;  2B89 A;  1X0T A;  4WY4 C;  2HFE D;  1PL5 A;  1QVG O;  2O01 N;  3EWK A;  1KQG B;  3HUS B;  2KSE A;  1IO4 A;  3A0H E;  2O1J A;  4JF7 A;  1P84 H;  1QGK B;  3L70 D;  1S4X A;  1IFI A;  2IBZ G;  1LTT C;  1KB9 I;  5TIS E;  3AEB C;  1LNQ A;  4OGQ D;  3AE3 C;  2Z5H A;  3WUU A;  1GMJ A;  3D70 A;  1S72 P;  3BAT A;  1W5C E;  2YIU C;  2VRS A;  3RL0 g;  1ZR4 A;  1YBK A;  2IBZ E;  1USD A;  1FDM A;  1M57 D;  3M9Q A;  1VQ5 P;  3RK2 B;  3H25 A;  1LP1 B;  4H44 D;  3E1R A;  4PV1 B;  1FC2 C;  3MIW A;  1NO4 A;  4U3F J;  2O1K A;  1ZXG A;  1UIX A;  3CC2 P;  5E79 H;  4N78 D;  4NPE A;  5KLV J;  1GL2 C;  3H6P A;  4EYY Q;  3HE4 A;  1Q82 Q;  5AVT B;  2DW3 A;  2BCC D;  3GHG B;  2RN0 A;  1URQ D;  3A0B H;  3V2R A;  3AED C;  5CBN A;  1G2C B;  1OXZ A;  3NXS A;  1N73 B;  2Q3I A;  1AVO A;  4ZKU A;  2W6B A;  3H1J D;  1G1J A;  2WSC H;  3P8M C;  5AW1 B;  1JCD A;  4WB4 A;  4EOT A;  1KMI Z;  2WIT A;  5AVW B;  3A0B E;  1LTG C;  1BCC E;  2JO1 A;  3V2N A;  2Q1K A;  2WSS H;  4ASW A;  1HF9 A;  1S5L X;  1FJK A;  2IYO A;  1ZLL A;  2O3J A;  3RGU A;  1SFC B;  5GTI E;  2AEJ A;  2PGD A;  4GOF A;  3TK1 A;  4IL6 H;  3M0D A;  2NPS C;  1KYO H;  3PTZ A;  4LC1 A;  3GMA A;  5CHX A;  1T3U A;  5KLV D;  1VQL P;  2QRX A;  1NAF A;  1BE3 J;  2FYN C;  3IN6 A;  3PH0 A;  5KJ7 D;  1L4A C;  1IZN B;  3B5N D;  1FZB A;  2GUS A;  1SQB J;  3C9I A;  3CX5 D;  3Q1M A;  1LP1 A;  4I2L C;  1PP9 J;  1IFN A;  5M1B A;  2M3B A;  1RE3 C;  1L0L J;  1Q7Y Q;  3HUS C;  1OX3 A;  4RKU J;  3VMZ A;  1OIP A;  2OYH B;  1M56 D;  3GHG A;  1NVO A;  3N7N A;  5KLV K;  5AW4 B;  5AW9 B;  1SP4 A;  1NTK G;  1X8Y A;  5KAI H;  4WWI A;  2OQQ A;  1OW8 A;  4EDF A;  2C0W A;  1KOR A;  2JWA A;  1NTM G;  2E5T A;  1FZE A;  1GU4 A;  1NU1 G;  2A06 G;  3Q2Y A;  1GU5 A;  1NTK E;  1HBW A;  2KK7 A;  1OZH A;  1ZME C;  1T2K D;  3IR9 A;  3BVH A;  4YPC A;  1SFC A;  1KQF B;  1NTM E;  4PV1 C;  3L73 G;  1NU1 E;  2A06 E;  2PP6 A;  1PP9 D;  1URQ B;  2OYI B;  1SQX J;  5AVZ B;  2KLU A;  2JKV A;  5C39 A;  2XDJ A;  1SQV D;  4K3A A;  2N1T D;  2C9L Y;  2QSI A;  1YTZ I;  4O9B A;  3L73 E;  2HYN A;  1P84 I;  1N73 C;  2CPS A;  2B87 B;  3OJA B;  2MKV A;  3D6Y A;  3A3Y B;  4BRY B;  3LW5 H;  1VQN P;  4Z1M H;  2NRG A;  2LR2 A;  2WTY A;  3BRT B;  3HD7 D;  2YKQ A;  2K9J A;  1VPC A;  1BCC D;  5APV A;  2Q6Q A;  3MZW B;  5B66 E;  4DT0 A;  2Y9Y A;  3OW2 O;  2D2C B;  1HH0 A;  2QJY B;  2V7Q J;  1SQV K;  2AXC A;  5KLI B;  1J1D C;  5BVZ A;  2RKL A;  3L71 G;  2KXP B;  3R4Y A;  4M3L A;  5APQ A;  1VQK P;  4N3Y B;  1N2D C;  1VF5 D;  2LXB A;  1T6A A;  3QWO C;  4PD4 D;  2QIW A;  4PJ0 E;  1KB9 H;  4QMA A;  3EQ2 A;  3CCR P;  1CSB A;  2AEM A;  3MUD C;  4JBZ A;  1SQQ G;  1R5L A;  3L71 E;  3B4S A;  1MFT A;  1K9M Q;  3H1I G;  1JY2 O;  1ZR2 A;  4XA4 A;  3A5T A;  1EC5 A;  3V2Q A;  4BWN A;  3HTK B;  3L74 G;  2OYH C;  1CI6 A;  3B71 A;  1YTZ T;  2HR3 A;  2ZJS E;  5AVX B;  4OGQ C;  1FZC B;  3H1I E;  2WSE J;  4I6M C;  4W7Y A;  2FFD A;  4R4L A;  5APX A;  2E74 B;  2B87 A;  2JJL A;  3P32 A;  3AEF C;  3I56 P;  4BRY A;  2ZAE B;  2M8R A;  3VYI A;  4OH8 B;  1OW7 A;  4H44 C;  1L0N J;  4R4M A;  3M9B A;  4LGD E;  1NTZ J;  4PD4 I;  3K5B A;  1GD2 E;  1DH3 A;  1NJI Q;  4ZNC A;  1N7S D;  5CCH A;  4ZMD A;  3JC2 2;  3CCV P;  1URQ C;  2N1T B;  2OYI C;  2L91 A;  1KV4 A;  1QX8 A;  3CXH D;  1SVF A;  2IX7 C;  3RK3 D;  5TJH A;  4GOE A;  4Y99 B;  3TGU J;  1BGY J;  1PZQ A;  3A7O A;  2E75 D;  1NAY A;  3L75 E;  3OA7 A;  5AW7 B;  1S5L H;  2Q7C A;  4NPF X;  2H43 A;  2FBW C;  3I5C A;  2FYZ A;  1GL2 B;  3KZI E;  5CCG A;  2E43 A;  2FXM A;  1FU1 A;  3NFQ A;  2JP3 A;  2KS1 B;  3H1K J;  3PP5 A;  3SWY A;  5CCH C;  2D2C C;  2FXP A;  2QJY C;  1ZRT E;  1XTC C;  2KIK A;  5KLI C;  2L5G B;  3CCQ P;  2WVR A;  1YIJ P;  1U57 A;  1JM0 A;  4UB8 H;  4WY4 A;  1EZV E;  2I8D A;  3NTN A;  3WMM 0;  3FXE A;  3TSI A;  5KJ7 C;  1YI2 P;  3LIE A;  3B5N C;  4LLH A;  1K05 A;  1CZQ A;  1OW6 A;  1LT1 A;  1IK7 A;  3TGU D;  1FDI A;  4U3F G;  4YTP C;  2JEE A;  2NPS B;  2K3R A;  1NTZ K;  1H89 A;  2YXR B;  1A02 F;  3CCS P;  1OVV A;  1D7M A;  5AW0 B;  3GW6 A;  1LTA C;  3S4R A;  3JCU H;  2AXT E;  1PPJ D;  5K5G B;  5BU5 A;  3CX5 H;  1L4A B;  3RBZ A;  2FXO A;  1PGQ A;  2IZ0 A;  1K8A Q;  3SWK A;  1FOS F;  2ZXE B;  1JUN A;  1FZC C;  3H1H D;  5AVS B;  3BAS A;  2E74 C;  2KYV A;  2YMY A;  3CC4 P;  2BCC J;  1GL2 A;  1KQL A;  1VQ9 P;  3CCL P;  2OAR A;  2H89 C;  1HJB A;  1S3J A;  3P7K A;  2R3S A;  4UB6 H;  1JY3 P;  3H1J J;  1YJ9 P;  3RK3 B;  1T3J A;  2N1T C;  1SQP D;  1U7J A;  3H1L D;  1KD1 Q;  1BE3 G;  1KIL E;  2ZVN B;  1QVF O;  3G4S P;  3RL0 B;  3EFG A;  1P84 E;  2FYU G;  1VQM P;  3UIA A;  4Y99 C;  1HWT C;  1SQB G;  1RHZ B;  3U1A A;  3HD7 C;  3L75 D;  3CWB G;  3VMA A;  3CCE P;  2JDI H;  2NPS A;  4C7N B;  2YKP A;  1L0L G;  1GW4 A;  2Z4E A;  3VP8 A;  3BCC D;  1LTB C;  2FYU E;  1NHL A;  4YXD C;  2Y0D A;  1SQP K;  1T8Z A;  3CWB E;  2YNY A;  1L4A A;  1ZRT D;  2SPZ A;  4W80 A;  5E79 E;  4L75 A;  1J1E B;  1EZV D;  4GKG A;  2HPC B;  1X22 A;  2QJK C;  1RE3 A;  4EIJ A;  3C1L A;  3I55 P;  1LTS C;  1FDO A;  3HUS A;  4ZKP A;  3KPE A;  2H7H A;  1YIT P;  2WT7 B;  4XFJ A;  1M1K Q;  1AFO A;  1YQ4 C;  3L72 D;  1J1D B;  2KZJ A;  2UWJ E;  4DOJ A;  1SQX G;  1Q86 Q;  3CCM P;  2IFN A;  4PD4 H;  3U1C A;  3MHV A;  1RF0 C;  1NOH A;  3G6E P;  2POH A;  2PAJ A;  1E5W A;  4IL6 E;  1AV1 A;  2XKM A;  1KYO E;  2IZ1 A;  4RES B;  1Y47 A;  1IJD B;  3TNU B;  2NZ2 A;  1YQ3 C;  1DEE G;  1W2E A;  1BSN A;  1USE A;  3AE8 C;  4C7R A;  1LT9 C;  4C7N A;  5B5E H;  1MKM A;  2GA1 A;  1SQV J;  1ZOY C;  1N7S C;  2W90 A;  2G8Y A;  2KSJ A;  2K9Y A;  2V7Q H;  3FWN A;  3V6I A;  1FE6 A;  1DEB A;  4OGQ B;  1G2C A;  3TYY A;  1IFJ A;  3D71 A;  3HRN A;  1N73 A;  4TT3 H;  3RK3 C;  2WPV B;  2QE7 H;  5GTH H;  1BCC J;  3AE7 C;  3E1I A;  1KIL D;  4H44 B;  3RL0 C;  2E75 C;  2MJZ A;  4JYB A;  2HPC A;  1LWU B;  2IBZ D;  1NH4 A;  4D6T G;  5KAI E;  3CX5 I;  4XE5 B;  2WT7 A;  4A7P A;  2WWW A;  3FWL A;  2OGU A;  5AVU B;  3CXH H;  3H32 B;  2CPB A;  1YJW P;  2P2U A;  1JCC A;  2M5A B;  1RF1 C;  2J58 A;  5AW8 B;  4D6T E;  2GUV A;  5H2F H;  2E5Y A;  1YYC A;  2QG4 A;  1VQP P;  1X79 B;  2Y0E A;  2WSE H;  2RMZ A;  1N8R Q;  1J1E C;  3CD6 P;  3AE9 C;  3MUD A;  2QM8 A;  1L0N G;  3WU2 H;  3T97 B;  1JO5 A;  5H2F E;  1OVR A;  1IFM A;  3VN0 A;  2IBZ I;  3II6 A;  1WRG A;  4AQR D;  2OYH A;  4I1L A;  3NMD A;  2M3E A;  1ZN5 A;  3GF3 A;  3AE4 C;  1L0N E;  2WPR A;  3B5N B;  1QL1 A;  1VQ8 P;  2IPP A;  1H88 A;  3FXD A;  1NTK J;  4YXW H;  2ZT9 D;  1BGY G;  2W83 C;  1BDD A;  1HUC A;  2R5B A;  4NPD A;  4AUW A;  1KYO D;  1NTM J;  2IDB A;  1NU1 J;  2C0X A;  1IK9 A;  1KZU B;  1M8O B;  3CC7 P;  2B9B A;  2OYO A;  1URQ A;  1BGY E;  2ZYA A;  3H32 A;  2P67 A;  2OYI A;  1S2E A;  1E79 H;  3H1K G;  1KB9 E;  2KNC B;  3L73 J;  2KOG A;  1NYH A;  2W8Z A;  1SQQ E;  4L74 A;  2YO2 A;  3AEE C;  3OAK A;  3S1K A;  5CJ0 A;  4TLF A;  3BRV B;  2E76 D;  3H1K E;  3R2P A;  3VMX A;  1NWQ A;  1FOS E;  3L74 E;  5APW A;  4KT0 J;  1NTK D;  3L70 G;  1Y8A A;  4AYC A;  1LWU C;  1HGZ A;  3ITK A;  3W68 A;  1IC2 A;  2OTK E;  4GOD A;  1NTM D;  1NU1 D;  1DIP A;  1KFN A;  2A06 D;  3E7K A;  1GK6 A;  3IF4 A;  3L70 E;  4H0L D;  5KJ7 A;  2YXQ B;  3B5N A;  4RO0 A;  1WMK A;  3ABV C;  3TF5 A;  1Z56 A;  5CBO A;  4H13 D;  3SFD C;  3MD0 A;  3L73 D;  2QEX P;  4U7J A;  5AW3 B;  1EDK A;  3HD7 B;  3Q3D A;  1NTK K;  1NGM B;  1LTJ B;  1VQ4 P;  2JWD A;  2BCC G;  3VMY A;  1WT6 A;  3SSU A;  1DD4 A;  2W6J H;  1NTM K;  1NU1 K;  1RH5 B;  4HYT B;  1EXJ A;  1A02 J;  3MGN A;  1N7L A;  3RK2 D;  3HTK A;  2FY8 A;  2QJP B;  3H1J G;  1S5L E;  2KNC A;  4PV1 D;  3H1I J;  5EFW B;  3SFE C;  3H1H J;  1KC8 Q;  1FZC A;  1VF5 B;  4GIF A;  2XNX A;  3CXH I;  2QJK B;  2BEZ F;  5KAF H;  1OFC X;  1EDL A;  3HE5 B;  1VQO P;  4L76 A;  4WVZ A;  2Y0C A;  3F5H A;  4UB8 E;  5AW6 B;  3FGA D;  5L8R J;  3G71 P;  1SS1 A;  3CMA P;  5KLV G;  1PV3 A;  2HLO A;  1SQP J;  3H1L J;  3L71 D;  2I1J A;  2N9Y B;  1FS0 E;  2N1T A;  2P58 A;  2O01 J;  4U3F E;  5APS A;  1SFC D;  3HE4 B;  1JMB A;  3AEA C;  5KLV E;  3L75 J;  2E76 B;  1JB0 J;  2K88 A;  1SQQ D;  1QEX A;  3AE6 C;  3H1I D;  3HD7 A;  4EI2 A;  1LTJ A;  3CLQ A;  5DJU B;  3BCC J;  3JCU E;  1W2B O;  1LT9 B;  3A0H H;  1N7S B;  1T2K C;  2E42 A;  3CX5 E;  3L74 D;  1CW5 A;  3WUT A;  1FZF A;  3PHL A;  2V4H A;  3A2A A;  5TIS H;  2KS1 A;  2J59 M;  3CME P;  3V5B A;  3G9R A;  3AE2 C;  2ZXX A;  4JQ0 D;  4H0L B;  2KZI A;  3L4F A;  5CMZ A;  1PGJ A;  4H13 B;  1SQQ K;  1NKZ B;  2E75 B;  1M1J B;  3PJS K;  1GW3 A;  3PRJ A;  4UB6 E;  1GDT A;  1PP9 G;  3L72 J;  3HE5 A;  1LTJ C;  1DX7 A;  3KQG A;  2WSF J;  1BE3 E;  4RJT A;  2PRR A;  4I7Z C;  4IOI H;  1SQV G;  5KKZ C;  1IFP A;  1JTH B;  1L2P A;  3V4W A;  1RF1 B;  3MTU E;  5BU8 B;  1SQB E;  2WQY C;  4N6J A;  2JR8 A;  3AEG C;  2H88 C;  1JY2 N;  1RF0 A;  1PP9 E;  2BAS A;  1H0T B;  3RBX A;  2KLV A;  1KTM A;  2QJP C;  1L0L E;  2WMM A;  1MV8 A;  1SQV E;  3LID A;  3WUV A;  2GM4 A;  2ZT9 C;  1VF5 C;  1BCC G;  4CPG A;  1G1I A;  2R44 A;  2YO3 A;  2AEF A;  1LT9 A;  5GTI H;  1RQV A;  1AQT A;  2PFX A;  1N7S A;  4IFF A;  2K1A A;  3P8C E;  2HOD B;  2R5D A;  1H8A A;  1M7L A;  4HJG H;  2BEQ D;  1KQS O;  1KN7 A;  2N9B A;  4W7Z A;  1EXI A;  1AA0 A;  3ZDM A;  2KI7 B;  3M0A A;  2YMK A;  4U3F D;  5CCH D;  1M1J A;  3CPW O;  1OWA A;  1PFI A;  2D2C D;  3M06 A;  5APT A;  1SQX E;  1Y9B A;  1XTG B;  2E76 C;  2P7J A;  3IFM A;  1EZV I;  4WBA A;  4PD4 E;  1ZP0 C;  2R3C A;  3GG2 A;  1HVV A;  1JEK A;  2FYU J;  1JTH A;  1JY3 O;  1VQ7 P;  3M91 A;  1RF1 A;  1M90 Q;  1U7M A;  3CWB J;  2XZR A;  1VDF A;  2K9J B;  2ITA A;  4IFM A;  2XV5 A;  3V2P A;  3GF7 A;  1H0T A;  2K37 A;  4H0L C;  1IFD A;  1EDJ A;  4Y28 J;  1J2J B;  5B5E E;  1QLE D;  1EQ7 A;  5CCG D;  1GTW A;  2M0B A;  4H13 C;  3VP9 A;  2P1J A;  3M0D C;  1JY2 P;  1M1J C;  1LGH B;  1P84 D;  1AJY A;  2A45 I;  1EDI A;  2HOD A;  1FAV A;  2WSC J;  1VQ6 P;  2CK3 H;  3CL3 D;  4WY4 D;  2LKM A;  5GTH E;  4GT1 A;  1BE3 D;  1AVY A;  3Q5P A;  2E74 D;  2C9N Y;  3KYQ A;  2P10 A;  2H8P D;  2IFM A;  2FYU D;  4HKZ H;  5AVQ B;  1HJ0 A;  3RK2 C;  4GDO A;  1SQB D;  1GZL A;  3N4X A;  3VTP C;  4HH2 A;  3SWF A;  3CWB D;  2OTL P;  3FX0 A;  2QA4 P;  3CI9 A;  1RQU A;  1R5S A;  1L0L D;  3CXH E;  4K35 A;  2Q5U A;  3RK3 E;  1PGO A;  1CI6 B;  3GHG C;  3TNU A;  3G3Z A;  1YJN P;  2IYP A;  4DCK A;  1MUU A;  2W27 A;  3CCU P;  5B66 H;  2ZYG A;  1NTZ G;  3AE1 C;  2HG5 D;  3GLM A;  2FFD B;  3PLN A;  3P8C D;  1JMM A;  2FYU K;  4B86 A;  1LJ2 A;  1SQB K;  3CCJ P;  3WU2 E;  1GL2 D;  1NTZ E;  1SFC C;  5DJT B;  1L0L K;  1YHQ P;  4ASV A;  1BDC A;  4PJ0 H;  1OVU A;  3TGU G;  3O8Z A;  2YKO A;  3QH9 A;  3C8V A;  1K04 A;  1TU3 F;  3AE5 C;  4HB1 A;  5AW2 B;  1LWU A;  1SQX D;  2I1K A;  1S9K E;  2WZ7 A;  1Q2N A;  1R8E A;  4OVN F;  1QL2 A;  1PPJ G;  3TGU E;  1JOC A;  2XND H;  4D6T J;  2M5A A;  1RE4 A;  2Y9Z A;  2QM7 A;  2NPS D;  1FZG A;  3H1H G;  4IL6 X;  3B8E B;  1KIL B;  1PPJ E;  3KDP B;  1ZW0 A;  1SQX K;  2ZFC A;  3M9H A;  1RY3 A;  1MFZ A;  4WY4 B;  3T97 A;  2WPQ A;  1PGP A;  1L4A D;  3EFF K;  1OMI A;  4IFD K;  1KYO I;  3H1H E;  1FZA A;  5AVV B;  5CJ4 A;  1KFM A;  4C46 A;  3LW5 J;  1Q90 D;  1SQP G;  3H1L G;  2Q9I A;  3USS A;  4DJG A;  3AEC C;  2FKW B;  1SLQ A;  2O01 H;  2Q3E A;  3O6Q B;  3D6Z A;  4D6T D;  1RE4 C;  1PIX A;  3L75 G;  1SQP E;  3H1L E;  1JNM A;  1BSH A; 
#chains in the Genus database with same CATH homology
 1E5W A;  2WPS A;  2XKM A;  4RES B;  4KHX A;  1IJD B;  1HH0 A;  3TNU B;  3L4F A;  5CMZ A;  1SQV K;  2KP8 A;  1W2E A;  1GK4 A;  3RL0 D;  4C7R A;  1SQQ K;  1J1D C;  3VOP A;  1AQ5 A;  1NKZ B;  5BVZ A;  1LT9 C;  1FBM A;  3L37 A;  4C7N A;  2FFD C;  1M1J B;  3U59 A;  1GW3 A;  1N7S C;  4N78 E;  4DZO A;  2KSJ A;  1JY3 N;  4M3L A;  5APQ A;  2XU6 A;  1HTL C;  5KTB A;  4N3Y B;  1N2D C;  1GDT A;  1NKN A;  3V4Q A;  2R32 A;  1MZ9 A;  3HE5 A;  1N86 A;  1DEB A;  1G2C A;  1LTJ C;  3TYY A;  1IFJ A;  1DX7 A;  1KIL A;  3KQG A;  3EQ2 A;  3HRN A;  1N73 A;  3RK3 C;  1CSB A;  1JTH B;  5APY A;  3V4W A;  1RF1 B;  3MTU E;  5BU8 B;  4N6J A;  3E1I A;  1KIL D;  1JY2 O;  1JY2 N;  5APU A;  3RL0 C;  2MJZ A;  1ZR2 A;  4JYB A;  1RF0 A;  4XA4 A;  2BAS A;  3A5T A;  2HPC A;  1ZV8 A;  2KLV A;  3V2Q A;  1LWU B;  2WSF H;  1NH4 A;  3HTK B;  1X9V A;  2OYH C;  1CI6 A;  1S9K D;  2KB7 P;  1MV8 A;  3LID A;  2Z5I A;  1YTZ T;  2GM4 A;  5AVX B;  4XE5 B;  2WT7 A;  2WWW A;  1FZC B;  5AVU B;  1G1I A;  2W6A A;  3H32 B;  2A45 H;  2YO3 A;  1L0N K;  2A45 G;  4I6M C;  2CPB A;  5AW5 B;  1LT9 A;  2P2U A;  4W7Y A;  2FFD A;  1JCC A;  5APX A;  1N7S A;  2JJL A;  3L35 A;  4IFF A;  3P8C E;  3P32 A;  1RF1 C;  2J58 A;  5AW8 B;  2HOD B;  5CCG C;  2R5D A;  2M8R A;  2GUV A;  1H8A A;  3L36 A;  3VYI A;  4OH8 B;  1M7L A;  1HGV A;  3M9B A;  1YYC A;  1KIL C;  4LGD E;  5AVY B;  1GD2 E;  5AVR B;  1LTI C;  1DH3 A;  1X79 B;  1N7S D;  2WSE H;  1FJP A;  5CCH A;  1J1E C;  4JYC A;  2N9B A;  4W7Z A;  3MUD A;  2QM8 A;  4WY4 C;  2HFE D;  1URQ C;  2N1T B;  2OYI C;  3M0A A;  1JO5 A;  5CCH D;  1M1J A;  1SVF A;  1OWA A;  2IX7 C;  1PFI A;  1IFM A;  3VN0 A;  3M06 A;  3II6 A;  1WRG A;  3RK3 D;  5APT A;  4AQR D;  3HUS B;  1XTG B;  1IO4 A;  2O1J A;  2P7J A;  4Y99 B;  2OYH A;  4I1L A;  3IFM A;  3A7O A;  3NMD A;  4JF7 A;  1ZN5 A;  4WBA A;  2R3C A;  1HVV A;  3OA7 A;  1IFI A;  1LTT C;  2WPR A;  5AW7 B;  2Q7C A;  2H43 A;  3B5N B;  3I5C A;  1JTH A;  1GL2 B;  2FYZ A;  1JY3 O;  1QL1 A;  3M91 A;  2IPP A;  1H88 A;  1RF1 A;  5CCG A;  2XZR A;  2Z5H A;  2E43 A;  1VDF A;  2FXM A;  4IFM A;  1FU1 A;  3NFQ A;  3BAT A;  2XV5 A;  1HUC A;  3V2P A;  2VRS A;  2R5B A;  1ZR4 A;  4AUW A;  3PP5 A;  3SWY A;  5CCH C;  1IFD A;  1J2J B;  1FDM A;  3M9Q A;  1EQ7 A;  1XTC C;  5CCG D;  3RK2 B;  1GTW A;  2C0X A;  1IK9 A;  1KZU B;  2L5G B;  3VP9 A;  2P1J A;  3M0D C;  3MIW A;  1NO4 A;  1JY2 P;  2O1K A;  4WY4 A;  1URQ A;  1M1J C;  3NTN A;  1LGH B;  3H32 A;  2P67 A;  3WMM 0;  2OYI A;  3TSI A;  4N78 D;  5KJ7 C;  3LIE A;  3B5N C;  1GL2 C;  3H6P A;  3HE4 A;  2A45 I;  4LLH A;  5AVT B;  2HOD A;  1FAV A;  1CZQ A;  3GHG B;  3CL3 D;  2KOG A;  4WY4 D;  1URQ D;  2LKM A;  3V2R A;  4GT1 A;  1G2C B;  2YO2 A;  1OXZ A;  3OAK A;  2JEE A;  2NPS B;  5CJ0 A;  2C9N Y;  3KYQ A;  3BRV B;  3NXS A;  2H8P D;  2IFM A;  1NTZ K;  1N73 B;  1H89 A;  2Q3I A;  5AVQ B;  3RK2 C;  1A02 F;  4ZKU A;  3R2P A;  2W6B A;  3VMX A;  1NWQ A;  1FOS E;  1G1J A;  1GZL A;  2WSC H;  3P8M C;  5APW A;  5AW0 B;  5AW1 B;  3N4X A;  1JCD A;  1LTA C;  4WB4 A;  4EOT A;  2WIT A;  5AVW B;  3VTP C;  4AYC A;  4HH2 A;  3SWF A;  1LWU C;  1HGZ A;  1LTG C;  3V2N A;  3CI9 A;  5BU5 A;  1L4A B;  1IC2 A;  1FJK A;  1ZLL A;  2Q5U A;  3GHG C;  1CI6 B;  1SFC B;  3TNU A;  3G3Z A;  1FOS F;  1KFN A;  1MUU A;  2ZXE B;  1JUN A;  1FZC C;  2W27 A;  3TK1 A;  3M0D A;  2NPS C;  1GK6 A;  2HG5 D;  5AVS B;  3BAS A;  2FFD B;  4LC1 A;  5KJ7 A;  5CHX A;  3P8C D;  2KYV A;  2YMY A;  1T3U A;  3B5N A;  1GL2 A;  1JMM A;  1Z56 A;  2FYU K;  4B86 A;  1KQL A;  1NAF A;  1SQB K;  3MD0 A;  2OAR A;  5AW3 B;  3HD7 B;  1NTK K;  1HJB A;  5KJ7 D;  1L4A C;  1LTJ B;  3P7K A;  3B5N D;  1GL2 D;  1FZB A;  2GUS A;  1SFC C;  1JY3 P;  3C9I A;  1L0L K;  3RK3 B;  1WT6 A;  3VMY A;  1T3J A;  1NTM K;  4I2L C;  1IFN A;  2N1T C;  2YKO A;  3O8Z A;  1NU1 K;  2M3B A;  4HYT B;  1RE3 C;  1A02 J;  5AW2 B;  3RL0 B;  3MGN A;  1N7L A;  3EFG A;  1LWU A;  3HUS C;  3UIA A;  3RK2 D;  3HTK A;  4Y99 C;  1HWT C;  2I1K A;  3VMZ A;  2OYH B;  3GHG A;  3N7N A;  5KLV K;  5AW4 B;  5AW9 B;  2WZ7 A;  1S9K E;  1SP4 A;  3U1A A;  1QL2 A;  3HD7 C;  1FZC A;  4GIF A;  1X8Y A;  2XNX A;  1JOC A;  2NPS A;  4C7N B;  2YKP A;  1GW4 A;  2Z4E A;  2C0W A;  3VP8 A;  1LTB C;  1FZE A;  1GU4 A;  1RE4 A;  1NHL A;  1GU5 A;  3HE5 B;  1SQP K;  2QM7 A;  2NPS D;  1T8Z A;  1FZG A;  3B8E B;  1HBW A;  1KIL B;  5AW6 B;  3KDP B;  2YNY A;  1L4A A;  1T2K D;  3IR9 A;  3BVH A;  4W80 A;  1SQX K;  2HLO A;  1J1E B;  1SFC A;  2ZFC A;  3M9H A;  1RY3 A;  1MFZ A;  2I1J A;  2N1T A;  2PP6 A;  4WY4 B;  3T97 A;  2WPQ A;  1URQ B;  4GKG A;  1L4A D;  2OYI B;  2HPC B;  5AVZ B;  4IFD K;  1RE3 A;  5APS A;  4EIJ A;  1FZA A;  1LTS C;  1SFC D;  3HE4 B;  5AVV B;  2XDJ A;  5CJ4 A;  3HUS A;  1KFM A;  4C46 A;  4ZKP A;  3KPE A;  2H7H A;  2N1T D;  2Q9I A;  2C9L Y;  2WT7 B;  1YTZ I;  4O9B A;  1AFO A;  3HD7 A;  2FKW B;  2HYN A;  3CLQ A;  1LTJ A;  1J1D B;  1SLQ A;  2O01 H;  1N73 C;  4DOJ A;  1LT9 B;  2CPS A;  1N7S B;  1T2K C;  3OJA B;  2E42 A;  1RE4 C;  2IFN A;  1CW5 A;  3A3Y B;  3LW5 H;  2WTY A;  3BRT B;  3U1C A;  3HD7 D;  2YKQ A;  1RF0 C;  1FZF A;  1NOH A;  1VPC A;  1JNM A;  5APV A;  2POH A;  3A2A A;  2PAJ A;  2J59 M;  3V5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...