2KNCB

Platelet integrin alfaiib-beta3 transmembrane-cytoplasmic heterocomplex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
GAMGSKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of an integrin alphaIIb beta3 transmembrane-cytoplasmic heterocomplex provides insight into integrin activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-IIb
total genus 20
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08725 Integrin_b_cyt Integrin beta cytoplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2kncB00
3TDKA 4RJTA 2L91A 1KYOD 1ZRTD 2K9JB 3L73D 2KS1A 1NTKD 1BE3D 3PTZA 3CXHD 3PRJA 3CWBD 2Y0EA 4EDFA 3PLNA 2IBZD 2QJPB 2QG4A 2O3JA 4PD4D 3TGUD 2QJYB 3L70D 3KHUA 2A06D 5KLIB 1SQBD 2RMZA 1SQQD 1SQPD 1NTMD 1SQXD 2FYUD 3H1ID 2Y0DA 3L74D 4U3FD 1L0LD 1EZVD 4D6TD 2QJKB 1P84D 3FWLA 3TF5A 3L71D 3PHLA 3H1KD 5KLVD 1KB9D 1PPJD 2RN0A 1L0ND 1NU1D 1PP9D 3H1JD 5KKZB 1BCCD 3GG2A 1SQVD 2JWAA 2KNCB 2N9YB 1NTZD 2Y0CA 2Q3EA 2YIUB 3GW6A 3BCCD 5TJHA 2FYNB 3VMAA 2BCCD 4A7PA 3ITKA 3L72D 1BGYD 3H1HD 3L75D 3H1LD 3CX5D
chains in the Genus database with same CATH superfamily
4PD4I 3H1JJ 4RJTA 2L91A 2ZT9C 2FFDC 1S9KD 1NO4A 2C0XA 3L73D 4PV1D 1LP1A 1KFNA 1L4AB 1MV8A 1OFCX 2BCCG 2WT7B 4EOTA 2E75D 1M1JC 1SQXK 1YBKA 3L73G 1KC8Q 1YQ4C 2QG4A 1KYOH 4H0LD 2QJYB 2AXTE 2KIKA 3L70D 4WWIA 2BASA 1H0TB 4RKUJ 3H1HG 5KLIB 1SQXD 1JOCA 1SQPD 3BCCJ 1OZHA 3FXEA 2NZ2A 1AQ5A 3M0AA 3U59A 1BDCA 1DIPA 1YIJP 1JTHB 3KQGA 1M1KQ 3F89A 1NJIQ 1YJWP 1KD1Q 2R3CA 3HD7C 5E79H 3GMAA 2YIUB 2MKVA 3L4FA 3MHVA 3E1IA 5EFWB 4D6TG 1P84I 1Y47A 4WB4A 4YPCA 5TJHA 4ZKPA 5APQA 1IJDB 5CCGA 1VQLP 4BRYB 1FOSF 3H1KJ 5CHXA 2WSSH 5CMZA 1VQ6P 2QSIA 2QE7H 1JTHA 2ZT9B 3H1LD 1G1JA 2PAJA 3B5NC 1S5LH 2KNCA 1NTKK 2XZRA 3MGNA 4OGQB 1BE3D 1BE3E 2UWJE 5CCHC 3FGAD 2JJLA 2IBZE 5AW9B 2Y9YA 1M7LA 1VQ5P 2FYUK 2QJPC 1KMIZ 1ZW0A 2QVAA 3AE1C 3PH0A 4JYCA 4DCKA 2C9NY 4JF7A 5B66E 4WBAA 1VF5D 1T2KC 3TNUA 5KAIH 5AW4B 1SQQD 3VP8A 2O1KA 1IFJA 2L5GB 3D6YA 3MZWB 2O1JA 1JMBA 5AVSB 3RK3D 1S72P 1PP9J 4R4LA 1BDDA 3M0DA 2KYVA 4W7ZA 2WPSA 2ZT9D 1PV3A 4YXWH 1SFCD 2MJZA 3VMYA 4C46A 2AEJA 1FZCA 4H13D 1FZCC 4NPEA 3KDPB 3EWKA 1NHLA 1P84E 1H8AA 3OW2O 1RF1B 3A2AA 4WY4B 3CX5D 2KLUA 1RF1A 1KYOD 1L0NK 1QGKB 1UIXA 2FFDB 2K1AA 3L75G 1BGYG 1FZGA 1PGQA 2YXRB 3GHGC 3CWBD 1CZQA 1KILB 2YO3A 1KTMA 3E7KA 1VDFA 3WMM0 1PFIA 1YI2P 2N1TB 4NPFX 3CCEP 2A06E 5AW6B 5AVYB 5CCHA 2B88A 1NYHA 3VTPC 1PPJG 2GA1A 2OYOA 1LP1B 2WSCJ 1W2EA 5CJ0A 2IBZI 1L0NJ 5BVZA 4IFFA 2W27A 5AW0B 3RBXA 3V2NA 4UB6H 2IYOA 5CBOA 1IO4A 2JDIH 3IF4A 1L4AD 1HWTC 3AE8C 1LGHB 2IYPA 1Q90D 4IFMA 1SLQA 2N1TD 2J5UA 2QRXA 2XNDH 2YKPA 1FZAA 1SS1A 2BEZF 3GG2A 4U3FJ 1LT1A 2ITAA 1LTBC 1ZR2A 2FYNC 3MUDA 2R5DA 4BRYA 1VQMP 4PJ0E 1YQ3C 3M9HA 1SQBJ 4GOFA 1NAFA 2GUVA 4EYYQ 1T3UA 1NU1J 1S4XA 2JEEA 1LTJB 2KLVA 2XNXA 1OIPA 4WY4D 5AVXB 3M9QA 5KAFE 3U1AA 1KV4A 3B71A 1XTGB 3PLNA 2N9BA 4PD4D 5AVTB 1FE6A 1EZVI 3T97A 1M1JA 2E5TA 3FWNA 2E74D 1SQQJ 1M90Q 5KJ7C 1DX7A 2Q5UA 3H1ID 3L70E 1KB9H 5APTA 1GZLA 1EZVE 4Y99C 1BGYE 1MFZA 4C7NA 2FFDA 1NU1K 2WSCH 1OW6A 4GT1A 1A02J 3D70A 5CJ4A 1OVUA 2C9LY 2I1JA 4AQRD 2D2CD 3H1JD 4PV1C 4B86A 3B8EB 1EQ7A 1SQQG 5KKZB 2A06G 1YJ9P 2KSJA 3GW6A 3CCRP 1QX8A 1L0LG 5L8RJ 4IL6E 5AW2B 1K05A 2V4HA 1X9VA 1VQKP 3BRTB 3H1HD 1NH4A 2GM4A 4ASWA 1USDA 1BCCJ 1SQXE 3CL3D 1LTGC 4HB1A 3RK2C 2ZAEB 3CMAP 5KTBA 1AVOA 3A0HE 3L72J 1RE4C 1NTKJ 2P7JA 1N2DC 2Q3IA 4W80A 1Q81Q 1NTZG 4GDOA 2OYHB 2HPCA 1PIXA 4MN4C 1K9MQ 1ZV8A 1R5SA 2WZ7A 2YKQA 3RK3E 3HUSA 1IFPA 1E5WA 4IL6X 3Q2YA 1L0NE 1SQVG 1AA0A 2AEMA 3GHGA 3HE5A 3AE7C 3L71D 2I8DA 2NRGA 1KQSO 1JUNA 3I56P 2YIUC 1N86A 2QA4P 3KZIE 5AVRB 4W7YA 4WY4A 1SFCB 3A0HH 3CXHH 3H1IG 2OYIC 4JBZA 1JY2P 3CX5E 3HE4B 4U7JA 2YKOA 1VQ4P 1R8EA 1HJ0A 2M0BA 4O9BA 1PGJA 2KOGA 3OJAB 4KT0J 3CD6P 1GL2C 2Z5IA 1ZRTE 1AJYA 1RE3C 1T3JA 2B87B 1NTKG 4ZKUA 3U1CA 1NTMJ 3GF3A 2O3JA 4HJGH 1URQB 4LC1A 5AVUB 3RL0B 1GK6A 3AE4C 3RL0g 3R4YA 5TISE 3T97B 1N73A 1VQ9P 3AEEC 1AQTA 2E75C 2FYUD 2YMKA 3C1LA 3I5CA 2V7QH 3MP7B 2IFNA 1XTCC 2R3SA 1JY3O 1CI6B 1IFIA 3II6A 3CXHE 1KQLA 1RE3A 3K5BA 2DW3A 3H6PA 2H8PD 4D6TE 1FU1A 2WPQA 3UIAA 1LT9B 2RKLA 4UB8H 4UB6E 5KKZC 4LGDE 2OTJP 1USEA 1RF0A 2KNCB 5DJUB 1RHZB 3HD7D 2IFMA 3BRVB 4WY4C 2PFXA 1ZR4A 3QWOC 3JCUE 1CI6A 1J1DB 1Y9BA 2QM8A 3KPEA 4XE5B 1LWUC 2FYUE 2M8RA 3Q1MA 3CC4P 3CC2P 3H1JE 4AUWA 1QL2A 3R2PA 2Q9IA 3HUSC 1KILC 1OX3A 4L75A 2K37A 3SFEC 4YTPC 2QEXP 3D6ZA 3VMZA 1LTTC 1N73B 2H43A 3VOPA 5AVZB 2N1TC 1ZN5A 2RH0A 3CCQP 1P84H 1ZMEC 2GUSA 3WUUA 2JR8A 1NU1G 1IFDA 1NKNA 2ZVNB 5APXA 1SQPJ 1E79H 3L74D 1RY3A 2KI7B 4N6JA 2ZYAA 2R32A 5M1BA 3TGUJ 1KILD 1IC2A 2W6JH 3AEFC 1PPJD 1LT9C 1YTZI 4RESB 1NTMG 3EFFK 1BSHA 5B5EH 2WSEJ 4I6MC 1JM0A 2OTKE 3L73J 2Y0CA 3M9BA 4JYBA 3BASA 1N7SD 3BATA 2IPPA 2HYNA 2M5AA 3GF7A 4TT3H 1CSBA 5KJ7D 3HE5B 3L75D 5GTIH 3EQ2A 2LXCB 3AE2C 2KZJA 3M91A 3H1HE 3OAKA 4IL6H 4PD4H 3L71E 5APVA 5AVVB 3S1KA 1FS0E 1NTKD 4H44B 1J1EB 2HODB 3O8ZA 4EI2A 3I55P 1QL1A 3IN6A 4PJ0H 2OARA 2IBZD 1ZOYC 1SVFA 3L72E 4N78E 5KLIC 3A3YB 3Q5RA 1K8AQ 4K35A 1RQVA 2LKMA 3V2QA 1DD4A 1FC2C 2KS1B 2Z4EA 1URQA 4D6TD 2XKMA 3P8CE 1PP9E 1GW3A 3H1KD 1R5LA 2M5AB 1FDMA 1G1IA 1Q7YQ 4NPDA 1SQVE 1SQVD 2AEFA 1YITP 3JCUH 3TGUG 3O6QB 1MFTA 1HVVA 2IZ1A 3IR9A 3CXHI 2Y9ZA 3RK3C 1SQPG 1U7MA 2E74B 2W6AA 2WSFJ 3KZIH 3SFDC 4XA4A 1IK7A 3O6QA 4XFJA 2OTLP 4OGQC 5KLVE 1HF9A 4R4MA 1LWUB 3P8CD 1HGVA 4K3AA 1VQOP 3V2PA 5GTHH 3SWKA 3USSA 1QVGO 5BU5A 1LJ2A 1JY3P 2CK3H 2H89C 2P10A 3AEAC 2NPSC 1YJNP 1N8RQ 3S9OA 4JPZB 1YHQP 4JQ0D 2YMYA 2R5BA 3PJSK 4L74A 2V7QJ 1L0LE 1L0LD 4U3FE 5APUA 2Q1KA 4ZNCA 1KQGB 3FWLA 1VPCA 2FBWC 4H13C 2BEQD 2QJKC 4HKZH 4ASVA 2Z5HA 2WT7A 1FDIA 4GIFA 2E42A 1SQXG 4D6TJ 1JNMA 3LIDA 1KQFB 4H0LC 5KAFH 4I7ZB 2Q3EA 1VF5B 1NTMK 3BCCD 4UB8E 3A0BH 3AE5C 1LTSC 1SFCC 1RF0C 3RK3B 1LT9A 2BCCD 1RQUA 4A7PA 1HJBA 2OYIB 1EXIA 2H7HA 1SQBG 2P2UA 1RH5B 1D7MA 1LTAC 3C8VA 3CCUP 1NWQA 2W83C 1KILE 1GL2B 2K9JB 1HTLC 1PPJE 3H1HJ 5APYA 3VMXA 2A45G 2O01J 1NTZE 1OMIA 2D2CB 3PRJA 4H44C 1AVYA 1GW4A 1OVRA 1T8ZA 4I1LA 4N3YB 3AE9C 1SQQK 3M0DC 2H88C 4HH2A 4L73A 1M1JB 2BCCJ 2CPSA 4OGQD 3RBZA 5APWA 1KILA 3L37A 2RMZA 1VQ8P 1L0NG 2XU6A 3LW5J 2Y0DA 3H1JG 3H1IJ 2R44A 3L74E 1LWUA 1NGMB 3C9IA 1GL2A 2K9JA 1OW8A 1URQD 1EZVD 3KYQA 2QJKB 4H13B 2NPSA 2RN0A 3NMDA 5AW3B 3CCSP 3RGUA 1U57A 5C39A 1LTJA 2OYIA 2LR2A 1NU1E 1HUCA 1VF5C 1YTZT 1T2KD 1BGYJ 1SQVJ 2Q6QA 2G8YA 2FYNB 3B5ND 1DD3A 1JB0J 2B9BA 3CC7P 5CCHD 5GTHE 4IOIH 3SSUA 1OW7A 1W2BO 1NTZJ 3HD7A 1KB9E 3HUSB 3CWBG 2JP3A 3L72G 3N4XA 1N73C 1HBWA 1JMMA 4EDFA 2JWDA 3GLMA 1UIIA 1SQPK 1BCCG 1N7SB 1M57D 2E76B 1BSNA 1PP9G 2YNYA 3NFQA 2K9YA 1YYCA 2KSEA 2HLOA 5AVWB 5CBNA 2FXMA 1S5LX 2ZYDA 1KFMA 1L0LJ 3MTUE 5KLVK 3CCJP 3VMAA 1FJKA 3H1KE 5B66H 1PP9D 1SFCA 1KN7A 1BCCD 1S2EA 3AEGC 2JO1A 2ZVOB 1JCDA 2HFED 4H0LB 4CPGA 5KLVJ 1QVFO 1VQNP 3MIWA 3HTKB 2P58A 5K5GB 2FYUG 1W5CE 4ZMDA 1FAVA 3L72D 1BGYD 2HR3A 2ZJSE 3JC22 3A5TA 1K73Q 2K88A 2FY8A 1BE3J 2FKWB 1J1EC 2IDBA 1EC5A 3Q5SA 2KP8A 3W67A 5AW8B 2E43A 3FX0A 3WUTA 2D2CC 3V2RA 3E1RA 3GHGB 4BWNA 2HPCB 1X79B 2OYHC 1JY2O 3WU2E 3H25A 1AFOA 1NTME 1N7SC 2XV5A 2BCCE 1PZQA 2OGUA 3FXDA 4YXDC 2W6BA 1N7SA 1H88A 3BCCG 1SQVK 3TF5A 2XDJA 2WTYA 1GMJA 4U3FG 3JSVC 4L76A 2KUBA 1EDJA 1GK4A 3L71G 4BXLA 2CPBA 5KAIE 2PRRA 2FXOA 4GOEA 3LIEA 2NPSD 2WWWA 3ITKA 1EXJA 1HH0A 2QM7A 1BE3G 1ZXGA 2OQQA 1WRGA 3H1LE 3WU2H 2WVRA 4LLHA 3CI9A 4AYCA 1NAYA 5TISH 3CPWO 3P7KA 1JO5A 1IK9A 2M3BA 3VYIA 2FYUJ 3L35A 3OA7A 1Q2NA 1LTJC 3G9RA 3IFMA 4KHXA 3ZDMA 1L4AC 3CCMP 1G2CB 2LXBA 3L75J 1L0LK 5APSA 1SQBE 1GD2E 3B4SA 4C7NB 1SQBK 2B87A 2AXCA 1K04A 1KB9I 2E75B 2ZFCA 1S1CX 1QLED 2QIWA 3VP9A 1JCCA 2KZIA 2YO2A 2WMMA 3AEDC 3S4RA 2PP6A 3PHLA 1M8OB 1FBMA 2O01N 3TGUE 4PV1B 2HG5D 2J59M 3L70J 3HD7B 3L70G 1QEXA 1SQPE 1NTZD 1X22A 3PP5A 4I7ZC 5AVQB 1GU4A 1OVVA 1H89A 3SWFA 3G4SP 3Q5PA 2IX7C 2W8ZA 1IZNB 1IFNA 2WITA 1VQ7P 4C7RA 2KB7P 1SQQE 3V6IA 2C0WA 3WUVA 1DH3A 3L73E 3M06A 3RK2B 1KORA 3NTNA 1NKZB 1FDOA 1FZFA 1KZUB 3D71A 1CW5A 3AEBC 2AXTH 1EDIA 2Y0EA 1Y8AA 3EFGA 2N1TA 3HRNA 4RO0A 2QJPB 3RK2D 3TYYA 5B5EE 3AE6C 3CWBE 2JKVA 2P1JA 1KYOI 2M3EA 3TGUD 1GTWA 1FOSE 3G6EP 2A06D 3CCLP 1EDLA 3A7OA 2POHA 5AW1B 5H2FH 1SP4A 3H1KG 4U3FD 3N7NA 3P32A 5AW5B 3RL0D 3V4QA 2J58A 1P84D 1TU3F 5AW7B 4DJGA 4DT0A 3B5NA 1G2CA 2A45H 4TLFA 1EDKA 1RE4A 5KLVD 3CCVP 1J2JB 5GTIE 3G3ZA 1M56D 1FZEA 1BCCE 4QMAA 4PD4E 2W90A 3HTKA 2JWAA 3L71J 2N9YB 5CCGC 3AECC 2IBZG 3HE4A 1FZCB 1S5LE 2I1KA 4H44D 1S3JA 4OH8B 1NTZK 1VQPP 2WSFH 4HYTB 3TDKA 2PGDA 3LW5H 3Q3DA 4Z1MH 3PTZA 2KS1A 3CLQA 4I2LC 1NVOA 3L36A 3CXHD 2YXQB 1S9KE 1JEKA 3V5BA 2ZXEB 1T6AA 3CMEP 1GU5A 4OVNF 2QJYC 1ZP0C 3ABVC 3RL0C 2O01H 1SQXJ 1URQC 2E76C 2P67A 1MUUA 1LTIC 3BCCE 3KHUA 3P8MC 1NTMD 1AV1A 3A0BE 1L4AA 3W68A 1L2PA 1N7LA 2A45I 4WVZA 5DJTB 3TNUB 5KJ7A 2IZ0A 2ZYGA 1OXZA 3SWYA 1HGZA 1NTKE 4GKGA 2KK7A 3AE3C 5CCGD 3L74G 3G71P 1VL2A 1NU1D 3V4WA 2HODA 4DZOA 5KLVG 3CX5I 1EZVG 3NXSA 4DOJA 2FXPA 2VRSA 1MZ9A 2E74C 1WMKA 5E79E 1U7JA 3L75E 3MUDC 1MKMA 3B5NB 2WPVB 1X8YA 3QH9A 2ZXXA 1J1DC 1FZBA 1LNQA 1ZRTD 3H1LJ 4OWFA 1GDTA 2SPZA 1DEBA 1A02F 5H2FE 2FYZA 1PGOA 2NPSB 2WSEH 1Q82Q 1ZLLA 3VN0A 2Q7CA 4M3LA 4KJMA 3IAOA 2E5YA 3H1LG 3CWBJ 3TK1A 4IFDK 1SQBD 4GODA 1NOHA 3CX5H 2G3AA 4Y99B 2WPRA 2OYHA 3BVHA 1GL2D 1H0TA 1KYOE 1Z56A 3MD0A 4Y28J 1KB9D 1WT6A 1X0TA 1L0ND 2B89A 2K3RA 3H32B 1PL5A 2WQYC 5BU8B 1OWAA 1JY3N 4EIJA 1Q86Q 1PGPA 1IFMA 3H1IE 3L74J 3TSIA 4N78D 2KXPB 3H32A 2E76D 1DEEG 1RF1C 1JY2N 1FJPA 3KXDA 3F5HA
chains in the Genus database with same CATH topology
3TDKA 4RJTA 2L91A 1KYOD 1ZRTD 2K9JB 3L73D 2KS1A 1NTKD 1BE3D 3PTZA 3CXHD 3PRJA 3CWBD 2Y0EA 4EDFA 3PLNA 2IBZD 2QJPB 2QG4A 2O3JA 4PD4D 3TGUD 2QJYB 3L70D 3KHUA 2A06D 5KLIB 1SQBD 2RMZA 1SQQD 1SQPD 1NTMD 1SQXD 2FYUD 3H1ID 2Y0DA 3L74D 4U3FD 1L0LD 1EZVD 4D6TD 2QJKB 1P84D 3FWLA 3TF5A 3L71D 3PHLA 3H1KD 5KLVD 1KB9D 1PPJD 2RN0A 1L0ND 1NU1D 1PP9D 3H1JD 5KKZB 1BCCD 3GG2A 1SQVD 2JWAA 2KNCB 2N9YB 1NTZD 2Y0CA 2Q3EA 2YIUB 3GW6A 3BCCD 5TJHA 2FYNB 3VMAA 2BCCD 4A7PA 3ITKA 3L72D 1BGYD 3H1HD 3L75D 3H1LD 3CX5D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TDK A;  4RJT A;  2L91 A;  1KYO D;  1ZRT D;  2K9J B;  3L73 D;  2KS1 A;  1NTK D;  1BE3 D;  3PTZ A;  3CXH D;  3PRJ A;  3CWB D;  2Y0E A;  4EDF A;  3PLN A;  2IBZ D;  2QJP B;  2QG4 A;  2O3J A;  4PD4 D;  3TGU D;  2QJY B;  3L70 D;  3KHU A;  2A06 D;  5KLI B;  1SQB D;  2RMZ A;  1SQQ D;  1SQP D;  1NTM D;  1SQX D;  2FYU D;  3H1I D;  2Y0D A;  3L74 D;  4U3F D;  1L0L D;  1EZV D;  4D6T D;  2QJK B;  1P84 D;  3FWL A;  3TF5 A;  3L71 D;  3PHL A;  3H1K D;  5KLV D;  1KB9 D;  1PPJ D;  2RN0 A;  1L0N D;  1NU1 D;  1PP9 D;  3H1J D;  5KKZ B;  1BCC D;  3GG2 A;  1SQV D;  2JWA A;  2KNC B;  2N9Y B;  1NTZ D;  2Y0C A;  2Q3E A;  2YIU B;  3GW6 A;  3BCC D;  5TJH A;  2FYN B;  3VMA A;  2BCC D;  4A7P A;  3ITK A;  3L72 D;  1BGY D;  3H1H D;  3L75 D;  3H1L D;  3CX5 D; 
#chains in the Genus database with same CATH topology
 4PD4 I;  3H1J J;  4RJT A;  2L91 A;  2ZT9 C;  2FFD C;  1S9K D;  1NO4 A;  2C0X A;  3L73 D;  4PV1 D;  1LP1 A;  1KFN A;  1L4A B;  1MV8 A;  1OFC X;  2BCC G;  2WT7 B;  4EOT A;  2E75 D;  1M1J C;  1SQX K;  1YBK A;  3L73 G;  1KC8 Q;  1YQ4 C;  2QG4 A;  1KYO H;  4H0L D;  2QJY B;  2AXT E;  2KIK A;  3L70 D;  4WWI A;  2BAS A;  1H0T B;  4RKU J;  3H1H G;  5KLI B;  1SQX D;  1JOC A;  1SQP D;  3BCC J;  1OZH A;  3FXE A;  2NZ2 A;  1AQ5 A;  3M0A A;  3U59 A;  1BDC A;  1DIP A;  1YIJ P;  1JTH B;  3KQG A;  1M1K Q;  3F89 A;  1NJI Q;  1YJW P;  1KD1 Q;  2R3C A;  3HD7 C;  5E79 H;  3GMA A;  2YIU B;  2MKV A;  3L4F A;  3MHV A;  3E1I A;  5EFW B;  4D6T G;  1P84 I;  1Y47 A;  4WB4 A;  4YPC A;  5TJH A;  4ZKP A;  5APQ A;  1IJD B;  5CCG A;  1VQL P;  4BRY B;  1FOS F;  3H1K J;  5CHX A;  2WSS H;  5CMZ A;  1VQ6 P;  2QSI A;  2QE7 H;  1JTH A;  2ZT9 B;  3H1L D;  1G1J A;  2PAJ A;  3B5N C;  1S5L H;  2KNC A;  1NTK K;  2XZR A;  3MGN A;  4OGQ B;  1BE3 D;  1BE3 E;  2UWJ E;  5CCH C;  3FGA D;  2JJL A;  2IBZ E;  5AW9 B;  2Y9Y A;  1M7L A;  1VQ5 P;  2FYU K;  2QJP C;  1KMI Z;  1ZW0 A;  2QVA A;  3AE1 C;  3PH0 A;  4JYC A;  4DCK A;  2C9N Y;  4JF7 A;  5B66 E;  4WBA A;  1VF5 D;  1T2K C;  3TNU A;  5KAI H;  5AW4 B;  1SQQ D;  3VP8 A;  2O1K A;  1IFJ A;  2L5G B;  3D6Y A;  3MZW B;  2O1J A;  1JMB A;  5AVS B;  3RK3 D;  1S72 P;  1PP9 J;  4R4L A;  1BDD A;  3M0D A;  2KYV A;  4W7Z A;  2WPS A;  2ZT9 D;  1PV3 A;  4YXW H;  1SFC D;  2MJZ A;  3VMY A;  4C46 A;  2AEJ A;  1FZC A;  4H13 D;  1FZC C;  4NPE A;  3KDP B;  3EWK A;  1NHL A;  1P84 E;  1H8A A;  3OW2 O;  1RF1 B;  3A2A A;  4WY4 B;  3CX5 D;  2KLU A;  1RF1 A;  1KYO D;  1L0N K;  1QGK B;  1UIX A;  2FFD B;  2K1A A;  3L75 G;  1BGY G;  1FZG A;  1PGQ A;  2YXR B;  3GHG C;  3CWB D;  1CZQ A;  1KIL B;  2YO3 A;  1KTM A;  3E7K A;  1VDF A;  3WMM 0;  1PFI A;  1YI2 P;  2N1T B;  4NPF X;  3CCE P;  2A06 E;  5AW6 B;  5AVY B;  5CCH A;  2B88 A;  1NYH A;  3VTP C;  1PPJ G;  2GA1 A;  2OYO A;  1LP1 B;  2WSC J;  1W2E A;  5CJ0 A;  2IBZ I;  1L0N J;  5BVZ A;  4IFF A;  2W27 A;  5AW0 B;  3RBX A;  3V2N A;  4UB6 H;  2IYO A;  5CBO A;  1IO4 A;  2JDI H;  3IF4 A;  1L4A D;  1HWT C;  3AE8 C;  1LGH B;  2IYP A;  1Q90 D;  4IFM A;  1SLQ A;  2N1T D;  2J5U A;  2QRX A;  2XND H;  2YKP A;  1FZA A;  1SS1 A;  2BEZ F;  3GG2 A;  4U3F J;  1LT1 A;  2ITA A;  1LTB C;  1ZR2 A;  2FYN C;  3MUD A;  2R5D A;  4BRY A;  1VQM P;  4PJ0 E;  1YQ3 C;  3M9H A;  1SQB J;  4GOF A;  1NAF A;  2GUV A;  4EYY Q;  1T3U A;  1NU1 J;  1S4X A;  2JEE A;  1LTJ B;  2KLV A;  2XNX A;  1OIP A;  4WY4 D;  5AVX B;  3M9Q A;  5KAF E;  3U1A A;  1KV4 A;  3B71 A;  1XTG B;  3PLN A;  2N9B A;  4PD4 D;  5AVT B;  1FE6 A;  1EZV I;  3T97 A;  1M1J A;  2E5T A;  3FWN A;  2E74 D;  1SQQ J;  1M90 Q;  5KJ7 C;  1DX7 A;  2Q5U A;  3H1I D;  3L70 E;  1KB9 H;  5APT A;  1GZL A;  1EZV E;  4Y99 C;  1BGY E;  1MFZ A;  4C7N A;  2FFD A;  1NU1 K;  2WSC H;  1OW6 A;  4GT1 A;  1A02 J;  3D70 A;  5CJ4 A;  1OVU A;  2C9L Y;  2I1J A;  4AQR D;  2D2C D;  3H1J D;  4PV1 C;  4B86 A;  3B8E B;  1EQ7 A;  1SQQ G;  5KKZ B;  2A06 G;  1YJ9 P;  2KSJ A;  3GW6 A;  3CCR P;  1QX8 A;  1L0L G;  5L8R J;  4IL6 E;  5AW2 B;  1K05 A;  2V4H A;  1X9V A;  1VQK P;  3BRT B;  3H1H D;  1NH4 A;  2GM4 A;  4ASW A;  1USD A;  1BCC J;  1SQX E;  3CL3 D;  1LTG C;  4HB1 A;  3RK2 C;  2ZAE B;  3CMA P;  5KTB A;  1AVO A;  3A0H E;  3L72 J;  1RE4 C;  1NTK J;  2P7J A;  1N2D C;  2Q3I A;  4W80 A;  1Q81 Q;  1NTZ G;  4GDO A;  2OYH B;  2HPC A;  1PIX A;  4MN4 C;  1K9M Q;  1ZV8 A;  1R5S A;  2WZ7 A;  2YKQ A;  3RK3 E;  3HUS A;  1IFP A;  1E5W A;  4IL6 X;  3Q2Y A;  1L0N E;  1SQV G;  1AA0 A;  2AEM A;  3GHG A;  3HE5 A;  3AE7 C;  3L71 D;  2I8D A;  2NRG A;  1KQS O;  1JUN A;  3I56 P;  2YIU C;  1N86 A;  2QA4 P;  3KZI E;  5AVR B;  4W7Y A;  4WY4 A;  1SFC B;  3A0H H;  3CXH H;  3H1I G;  2OYI C;  4JBZ A;  1JY2 P;  3CX5 E;  3HE4 B;  4U7J A;  2YKO A;  1VQ4 P;  1R8E A;  1HJ0 A;  2M0B A;  4O9B A;  1PGJ A;  2KOG A;  3OJA B;  4KT0 J;  3CD6 P;  1GL2 C;  2Z5I A;  1ZRT E;  1AJY A;  1RE3 C;  1T3J A;  2B87 B;  1NTK G;  4ZKU A;  3U1C A;  1NTM J;  3GF3 A;  2O3J A;  4HJG H;  1URQ B;  4LC1 A;  5AVU B;  3RL0 B;  1GK6 A;  3AE4 C;  3RL0 g;  3R4Y A;  5TIS E;  3T97 B;  1N73 A;  1VQ9 P;  3AEE C;  1AQT A;  2E75 C;  2FYU D;  2YMK A;  3C1L A;  3I5C A;  2V7Q H;  3MP7 B;  2IFN A;  1XTC C;  2R3S A;  1JY3 O;  1CI6 B;  1IFI A;  3II6 A;  3CXH E;  1KQL A;  1RE3 A;  3K5B A;  2DW3 A;  3H6P A;  2H8P D;  4D6T E;  1FU1 A;  2WPQ A;  3UIA A;  1LT9 B;  2RKL A;  4UB8 H;  4UB6 E;  5KKZ C;  4LGD E;  2OTJ P;  1USE A;  1RF0 A;  2KNC B;  5DJU B;  1RHZ B;  3HD7 D;  2IFM A;  3BRV B;  4WY4 C;  2PFX A;  1ZR4 A;  3QWO C;  3JCU E;  1CI6 A;  1J1D B;  1Y9B A;  2QM8 A;  3KPE A;  4XE5 B;  1LWU C;  2FYU E;  2M8R A;  3Q1M A;  3CC4 P;  3CC2 P;  3H1J E;  4AUW A;  1QL2 A;  3R2P A;  2Q9I A;  3HUS C;  1KIL C;  1OX3 A;  4L75 A;  2K37 A;  3SFE C;  4YTP C;  2QEX P;  3D6Z A;  3VMZ A;  1LTT C;  1N73 B;  2H43 A;  3VOP A;  5AVZ B;  2N1T C;  1ZN5 A;  2RH0 A;  3CCQ P;  1P84 H;  1ZME C;  2GUS A;  3WUU A;  2JR8 A;  1NU1 G;  1IFD A;  1NKN A;  2ZVN B;  5APX A;  1SQP J;  1E79 H;  3L74 D;  1RY3 A;  2KI7 B;  4N6J A;  2ZYA A;  2R32 A;  5M1B A;  3TGU J;  1KIL D;  1IC2 A;  2W6J H;  3AEF C;  1PPJ D;  1LT9 C;  1YTZ I;  4RES B;  1NTM G;  3EFF K;  1BSH A;  5B5E H;  2WSE J;  4I6M C;  1JM0 A;  2OTK E;  3L73 J;  2Y0C A;  3M9B A;  4JYB A;  3BAS A;  1N7S D;  3BAT A;  2IPP A;  2HYN A;  2M5A A;  3GF7 A;  4TT3 H;  1CSB A;  5KJ7 D;  3HE5 B;  3L75 D;  5GTI H;  3EQ2 A;  2LXC B;  3AE2 C;  2KZJ A;  3M91 A;  3H1H E;  3OAK A;  4IL6 H;  4PD4 H;  3L71 E;  5APV A;  5AVV B;  3S1K A;  1FS0 E;  1NTK D;  4H44 B;  1J1E B;  2HOD B;  3O8Z A;  4EI2 A;  3I55 P;  1QL1 A;  3IN6 A;  4PJ0 H;  2OAR A;  2IBZ D;  1ZOY C;  1SVF A;  3L72 E;  4N78 E;  5KLI C;  3A3Y B;  3Q5R A;  1K8A Q;  4K35 A;  1RQV A;  2LKM A;  3V2Q A;  1DD4 A;  1FC2 C;  2KS1 B;  2Z4E A;  1URQ A;  4D6T D;  2XKM A;  3P8C E;  1PP9 E;  1GW3 A;  3H1K D;  1R5L A;  2M5A B;  1FDM A;  1G1I A;  1Q7Y Q;  4NPD A;  1SQV E;  1SQV D;  2AEF A;  1YIT P;  3JCU H;  3TGU G;  3O6Q B;  1MFT A;  1HVV A;  2IZ1 A;  3IR9 A;  3CXH I;  2Y9Z A;  3RK3 C;  1SQP G;  1U7M A;  2E74 B;  2W6A A;  2WSF J;  3KZI H;  3SFD C;  4XA4 A;  1IK7 A;  3O6Q A;  4XFJ A;  2OTL P;  4OGQ C;  5KLV E;  1HF9 A;  4R4M A;  1LWU B;  3P8C D;  1HGV A;  4K3A A;  1VQO P;  3V2P A;  5GTH H;  3SWK A;  3USS A;  1QVG O;  5BU5 A;  1LJ2 A;  1JY3 P;  2CK3 H;  2H89 C;  2P10 A;  3AEA C;  2NPS C;  1YJN P;  1N8R Q;  3S9O A;  4JPZ B;  1YHQ P;  4JQ0 D;  2YMY A;  2R5B A;  3PJS K;  4L74 A;  2V7Q J;  1L0L E;  1L0L D;  4U3F E;  5APU A;  2Q1K A;  4ZNC A;  1KQG B;  3FWL A;  1VPC A;  2FBW C;  4H13 C;  2BEQ D;  2QJK C;  4HKZ H;  4ASV A;  2Z5H A;  2WT7 A;  1FDI A;  4GIF A;  2E42 A;  1SQX G;  4D6T J;  1JNM A;  3LID A;  1KQF B;  4H0L C;  5KAF H;  4I7Z B;  2Q3E A;  1VF5 B;  1NTM K;  3BCC D;  4UB8 E;  3A0B H;  3AE5 C;  1LTS C;  1SFC C;  1RF0 C;  3RK3 B;  1LT9 A;  2BCC D;  1RQU A;  4A7P A;  1HJB A;  2OYI B;  1EXI A;  2H7H A;  1SQB G;  2P2U A;  1RH5 B;  1D7M A;  1LTA C;  3C8V A;  3CCU P;  1NWQ A;  2W83 C;  1KIL E;  1GL2 B;  2K9J B;  1HTL C;  1PPJ E;  3H1H J;  5APY A;  3VMX A;  2A45 G;  2O01 J;  1NTZ E;  1OMI A;  2D2C B;  3PRJ A;  4H44 C;  1AVY A;  1GW4 A;  1OVR A;  1T8Z A;  4I1L A;  4N3Y B;  3AE9 C;  1SQQ K;  3M0D C;  2H88 C;  4HH2 A;  4L73 A;  1M1J B;  2BCC J;  2CPS A;  4OGQ D;  3RBZ A;  5APW A;  1KIL A;  3L37 A;  2RMZ A;  1VQ8 P;  1L0N G;  2XU6 A;  3LW5 J;  2Y0D A;  3H1J G;  3H1I J;  2R44 A;  3L74 E;  1LWU A;  1NGM B;  3C9I A;  1GL2 A;  2K9J A;  1OW8 A;  1URQ D;  1EZV D;  3KYQ A;  2QJK B;  4H13 B;  2NPS A;  2RN0 A;  3NMD A;  5AW3 B;  3CCS P;  3RGU A;  1U57 A;  5C39 A;  1LTJ A;  2OYI A;  2LR2 A;  1NU1 E;  1HUC A;  1VF5 C;  1YTZ T;  1T2K D;  1BGY J;  1SQV J;  2Q6Q A;  2G8Y A;  2FYN B;  3B5N D;  1DD3 A;  1JB0 J;  2B9B A;  3CC7 P;  5CCH D;  5GTH E;  4IOI H;  3SSU A;  1OW7 A;  1W2B O;  1NTZ J;  3HD7 A;  1KB9 E;  3HUS B;  3CWB G;  2JP3 A;  3L72 G;  3N4X A;  1N73 C;  1HBW A;  1JMM A;  4EDF A;  2JWD A;  3GLM A;  1UII A;  1SQP K;  1BCC G;  1N7S B;  1M57 D;  2E76 B;  1BSN A;  1PP9 G;  2YNY A;  3NFQ A;  2K9Y A;  1YYC A;  2KSE A;  2HLO A;  5AVW B;  5CBN A;  2FXM A;  1S5L X;  2ZYD A;  1KFM A;  1L0L J;  3MTU E;  5KLV K;  3CCJ P;  3VMA A;  1FJK A;  3H1K E;  5B66 H;  1PP9 D;  1SFC A;  1KN7 A;  1BCC D;  1S2E A;  3AEG C;  2JO1 A;  2ZVO B;  1JCD A;  2HFE D;  4H0L B;  4CPG A;  5KLV J;  1QVF O;  1VQN P;  3MIW A;  3HTK B;  2P58 A;  5K5G B;  2FYU G;  1W5C E;  4ZMD A;  1FAV A;  3L72 D;  1BGY D;  2HR3 A;  2ZJS E;  3JC2 2;  3A5T A;  1K73 Q;  2K88 A;  2FY8 A;  1BE3 J;  2FKW B;  1J1E C;  2IDB A;  1EC5 A;  3Q5S A;  2KP8 A;  3W67 A;  5AW8 B;  2E43 A;  3FX0 A;  3WUT A;  2D2C C;  3V2R A;  3E1R A;  3GHG B;  4BWN A;  2HPC B;  1X79 B;  2OYH C;  1JY2 O;  3WU2 E;  3H25 A;  1AFO A;  1NTM E;  1N7S C;  2XV5 A;  2BCC E;  1PZQ A;  2OGU A;  3FXD A;  4YXD C;  2W6B A;  1N7S A;  1H88 A;  3BCC G;  1SQV K;  3TF5 A;  2XDJ A;  2WTY A;  1GMJ A;  4U3F G;  3JSV C;  4L76 A;  2KUB A;  1EDJ A;  1GK4 A;  3L71 G;  4BXL A;  2CPB A;  5KAI E;  2PRR A;  2FXO A;  4GOE A;  3LIE A;  2NPS D;  2WWW A;  3ITK A;  1EXJ A;  1HH0 A;  2QM7 A;  1BE3 G;  1ZXG A;  2OQQ A;  1WRG A;  3H1L E;  3WU2 H;  2WVR A;  4LLH A;  3CI9 A;  4AYC A;  1NAY A;  5TIS H;  3CPW O;  3P7K A;  1JO5 A;  1IK9 A;  2M3B A;  3VYI A;  2FYU J;  3L35 A;  3OA7 A;  1Q2N A;  1LTJ C;  3G9R A;  3IFM A;  4KHX A;  3ZDM A;  1L4A C;  3CCM P;  1G2C B;  2LXB A;  3L75 J;  1L0L K;  5APS A;  1SQB E;  1GD2 E;  3B4S A;  4C7N B;  1SQB K;  2B87 A;  2AXC A;  1K04 A;  1KB9 I;  2E75 B;  2ZFC A;  1S1C X;  1QLE D;  2QIW A;  3VP9 A;  1JCC A;  2KZI A;  2YO2 A;  2WMM A;  3AED C;  3S4R A;  2PP6 A;  3PHL A;  1M8O B;  1FBM A;  2O01 N;  3TGU E;  4PV1 B;  2HG5 D;  2J59 M;  3L70 J;  3HD7 B;  3L70 G;  1QEX A;  1SQP E;  1NTZ D;  1X22 A;  3PP5 A;  4I7Z C;  5AVQ B;  1GU4 A;  1OVV A;  1H89 A;  3SWF A;  3G4S P;  3Q5P A;  2IX7 C;  2W8Z A;  1IZN B;  1IFN A;  2WIT A;  1VQ7 P;  4C7R A;  2KB7 P;  1SQQ E;  3V6I A;  2C0W A;  3WUV A;  1DH3 A;  3L73 E;  3M06 A;  3RK2 B;  1KOR A;  3NTN A;  1NKZ B;  1FDO A;  1FZF A;  1KZU B;  3D71 A;  1CW5 A;  3AEB C;  2AXT H;  1EDI A;  2Y0E A;  1Y8A A;  3EFG A;  2N1T A;  3HRN A;  4RO0 A;  2QJP B;  3RK2 D;  3TYY A;  5B5E E;  3AE6 C;  3CWB E;  2JKV A;  2P1J A;  1KYO I;  2M3E A;  3TGU D;  1GTW A;  1FOS E;  3G6E P;  2A06 D;  3CCL P;  1EDL A;  3A7O A;  2POH A;  5AW1 B;  5H2F H;  1SP4 A;  3H1K G;  4U3F D;  3N7N A;  3P32 A;  5AW5 B;  3RL0 D;  3V4Q A;  2J58 A;  1P84 D;  1TU3 F;  5AW7 B;  4DJG A;  4DT0 A;  3B5N A;  1G2C A;  2A45 H;  4TLF A;  1EDK A;  1RE4 A;  5KLV D;  3CCV P;  1J2J B;  5GTI E;  3G3Z A;  1M56 D;  1FZE A;  1BCC E;  4QMA A;  4PD4 E;  2W90 A;  3HTK A;  2JWA A;  3L71 J;  2N9Y B;  5CCG C;  3AEC C;  2IBZ G;  3HE4 A;  1FZC B;  1S5L E;  2I1K A;  4H44 D;  1S3J A;  4OH8 B;  1NTZ K;  1VQP P;  2WSF H;  4HYT B;  3TDK A;  2PGD A;  3LW5 H;  3Q3D A;  4Z1M H;  3PTZ A;  2KS1 A;  3CLQ A;  4I2L C;  1NVO A;  3L36 A;  3CXH D;  2YXQ B;  1S9K E;  1JEK A;  3V5B A;  2ZXE B;  1T6A A;  3CME P;  1GU5 A;  4OVN F;  2QJY C;  1ZP0 C;  3ABV C;  3RL0 C;  2O01 H;  1SQX J;  1URQ C;  2E76 C;  2P67 A;  1MUU A;  1LTI C;  3BCC E;  3KHU A;  3P8M C;  1NTM D;  1AV1 A;  3A0B E;  1L4A A;  3W68 A;  1L2P A;  1N7L A;  2A45 I;  4WVZ A;  5DJT B;  3TNU B;  5KJ7 A;  2IZ0 A;  2ZYG A;  1OXZ A;  3SWY A;  1HGZ A;  1NTK E;  4GKG A;  2KK7 A;  3AE3 C;  5CCG D;  3L74 G;  3G71 P;  1VL2 A;  1NU1 D;  3V4W A;  2HOD A;  4DZO A;  5KLV G;  3CX5 I;  1EZV G;  3NXS A;  4DOJ A;  2FXP A;  2VRS A;  1MZ9 A;  2E74 C;  1WMK A;  5E79 E;  1U7J A;  3L75 E;  3MUD C;  1MKM A;  3B5N B;  2WPV B;  1X8Y A;  3QH9 A;  2ZXX A;  1J1D C;  1FZB A;  1LNQ A;  1ZRT D;  3H1L J;  4OWF A;  1GDT A;  2SPZ A;  1DEB A;  1A02 F;  5H2F E;  2FYZ A;  1PGO A;  2NPS B;  2WSE H;  1Q82 Q;  1ZLL A;  3VN0 A;  2Q7C A;  4M3L A;  4KJM A;  3IAO A;  2E5Y A;  3H1L G;  3CWB J;  3TK1 A;  4IFD K;  1SQB D;  4GOD A;  1NOH A;  3CX5 H;  2G3A A;  4Y99 B;  2WPR A;  2OYH A;  3BVH A;  1GL2 D;  1H0T A;  1KYO E;  1Z56 A;  3MD0 A;  4Y28 J;  1KB9 D;  1WT6 A;  1X0T A;  1L0N D;  2B89 A;  2K3R A;  3H32 B;  1PL5 A;  2WQY C;  5BU8 B;  1OWA A;  1JY3 N;  4EIJ A;  1Q86 Q;  1PGP A;  1IFM A;  3H1I E;  3L74 J;  3TSI A;  4N78 D;  2KXP B;  3H32 A;  2E76 D;  1DEE G;  1RF1 C;  1JY2 N;  1FJP A;  3KXD A;  3F5H A; 
#chains in the Genus database with same CATH homology
 3TDK A;  4RJT A;  2L91 A;  1KYO D;  1ZRT D;  2K9J B;  3L73 D;  2KS1 A;  1NTK D;  1BE3 D;  3PTZ A;  3CXH D;  3PRJ A;  3CWB D;  2Y0E A;  4EDF A;  3PLN A;  2IBZ D;  2QJP B;  2QG4 A;  2O3J A;  4PD4 D;  3TGU D;  2QJY B;  3L70 D;  3KHU A;  2A06 D;  5KLI B;  1SQB D;  2RMZ A;  1SQQ D;  1SQP D;  1NTM D;  1SQX D;  2FYU D;  3H1I D;  2Y0D A;  3L74 D;  4U3F D;  1L0L D;  1EZV D;  4D6T D;  2QJK B;  1P84 D;  3FWL A;  3TF5 A;  3L71 D;  3PHL A;  3H1K D;  5KLV D;  1KB9 D;  1PPJ D;  2RN0 A;  1L0N D;  1NU1 D;  1PP9 D;  3H1J D;  5KKZ B;  1BCC D;  3GG2 A;  1SQV D;  2JWA A;  2KNC B;  2N9Y B;  1NTZ D;  2Y0C A;  2Q3E A;  2YIU B;  3GW6 A;  3BCC D;  5TJH A;  2FYN B;  3VMA A;  2BCC D;  4A7P A;  3ITK A;  3L72 D;  1BGY D;  3H1H D;  3L75 D;  3H1L D;  3CX5 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...