2KNCB

Platelet integrin alfaiib-beta3 transmembrane-cytoplasmic heterocomplex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
GAMGSKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Structure of an integrin alphaIIb beta3 transmembrane-cytoplasmic heterocomplex provides insight into integrin activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 20
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08725 Integrin_b_cyt Integrin beta cytoplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2kncB00
2RMZA 2BCCD 1BGYD 3L71D 1ZRTD 2Y0CA 3PTZA 3L75D 3PRJA 5KKZB 3H1KD 2RN0A 4A7PA 3CX5D 3TDKA 1KYOD 3CWBD 2QJPB 1SQVD 1SQQD 1EZVD 1NTKD 2A06D 1KB9D 3GW6A 4U3FD 3GG2A 3TGUD 4PD4D 2JWAA 2YIUB 2QG4A 2O3JA 3L73D 2KNCB 1NTZD 2N9YB 2Y0DA 2FYUD 2Q3EA 3H1HD 3L74D 3KHUA 1SQXD 2KS1A 3VMAA 1PPJD 3BCCD 1L0ND 3TF5A 5KLIB 5KLVD 3PHLA 3H1ID 2IBZD 1BCCD 3H1LD 3H1JD 4EDFA 2FYNB 1BE3D 4D6TD 1SQPD 2L91A 3CXHD 1NU1D 1PP9D 3ITKA 3FWLA 4RJTA 2Y0EA 3L70D 1NTMD 3PLNA 1SQBD 2K9JB 1P84D 1L0LD 3L72D 2QJYB 2QJKB 5TJHA
chains in the Genus database with same CATH superfamily
1L0LJ 2QEXP 1FJPA 3PRJA 1M1JB 1PP9E 2POHA 3HE4A 3CWBD 1S9KD 1RE3C 2E43A 3RK2D 4PJ0H 3AEBC 2IDBA 1E5WA 1K8AQ 2O01N 3MTUE 3VTPC 3MIWA 2FBWC 2H88C 2Z5HA 4DT0A 3GHGA 1N73B 1IFDA 1SFCA 3CC7P 1EDLA 3AEDC 1IO4A 2FYUJ 3V2NA 1U57A 4I2LC 3IAOA 2QSIA 3RL0B 1VF5D 1GL2A 2YKQA 5KLVE 3WU2E 1PL5A 3NXSA 4H13D 2KZIA 2CK3H 3H1KG 1T6AA 2OYOA 4L74A 2LXBA 5EFWB 3CCMP 3T97B 2Y9ZA 1L4AB 3AE5C 1L0NE 4HKZH 1JCCA 1SLQA 1YIJP 1VQ4P 1HBWA 1YTZI 3RK3C 3B71A 2W90A 2UWJE 1NKZB 2WPRA 4Y28J 1Q81Q 2Y0CA 1PGJA 3IFMA 1M56D 3H1KD 1KFNA 1DD4A 5GTIE 4OGQD 4EYYQ 5AVSB 3BATA 3CX5D 3L70E 1SQXG 4CPGA 3CPWO 1KB9I 3CC2P 3VMXA 2BASA 1USEA 2NZ2A 3TNUA 3Q5SA 3N7NA 2OYIA 2GUVA 2H8PD 3CXHH 2E74B 1LJ2A 1MUUA 1SQXD 3SFEC 3C8VA 1SQQE 1M1KQ 1EDIA 1NTKE 3VP8A 2MKVA 1EXJA 2IX7C 3B5ND 2XZRA 3KZIE 3ABVC 3M91A 1T2KD 1KILC 3Q2YA 1RE4A 3W68A 4D6TD 3FXDA 2AEJA 5CJ4A 3O6QB 4L76A 5APQA 3P8CD 1OVRA 3FWLA 3AEEC 1NU1K 5CCHA 1RH5B 4H0LB 1FZCB 1VQLP 1SP4A 1NYHA 1FS0E 3RL0g 1KORA 2LXCB 3Q5PA 4PV1B 1CW5A 2WVRA 3MUDA 1IFPA 3F5HA 1LGHB 1M8OB 1SQPE 1QGKB 3CCEP 5CMZA 1M57D 1PP9J 5E79H 2NPSB 1CSBA 1SFCD 4W80A 2XU6A 1T2KC 4K35A 3CWBE 3OA7A 2OGUA 1RHZB 2K9JA 4WB4A 1GL2D 1SQVJ 1PV3A 2W8ZA 2XDJA 2J58A 4IFDK 1HH0A 1IFNA 2ZT9B 4PD4D 3VP9A 5CCGC 5APVA 1K04A 5B66E 3V5BA 3RK3E 4Y99C 3GMAA 3A0BH 1MV8A 2IZ1A 3TF5A 2OYHA 3M0DA 4MN4C 1P84H 5AW9B 4OVNF 1J1EC 1T3UA 5KLVJ 2L5GB 2NRGA 3MGNA 3L73E 2G3AA 5TISE 3TYYA 1X8YA 2JKVA 3H1JJ 1LT1A 5APWA 4B86A 2C9LY 3C1LA 4R4MA 1H8AA 1KQGB 4H44C 1SQBJ 1OW6A 3HTKA 3L72J 2J59M 3CCRP 1VQMP 3NTNA 1DX7A 3E1IA 5KJ7A 3F89A 3RK3B 1S72P 1JY2O 2WSEJ 2HPCB 1KILE 3U59A 4JPZB 1JY3N 1L0LE 2FY8A 3W67A 1NVOA 2WSCJ 5AVWB 4DCKA 1NU1G 2IYPA 1VL2A 4ASVA 1QL1A 2N9YB 1W2BO 4GIFA 1YJ9P 3FXEA 1NTZK 1FOSF 1USDA 4C7NB 1SQXE 3SFDC 1NTKJ 3RBZA 1JUNA 2QRXA 3BCCJ 3CMAP 1URQA 3A0HH 2YXRB 4BRYB 4L75A 2P1JA 2R32A 2OARA 3L75G 2WQYC 1JY3P 1LTBC 1NU1D 5H2FE 2FYUE 2GM4A 3AE2C 2H7HA 1KILB 5APTA 3HUSA 1PZQA 3BASA 3M06A 1KYOH 4WVZA 4JBZA 1XTGB 1IC2A 1N7SA 3CXHI 2E42A 1AFOA 2R44A 3AE9C 1ZR2A 4U7JA 2FKWB 1KB9H 3EQ2A 1LNQA 3L75D 1YQ3C 4NPEA 4DOJA 3CCSP 1FU1A 3H1HG 1DIPA 3II6A 3BRVB 1EDKA 1A02J 3L35A 1YBKA 1H0TB 2JDIH 3K5BA 3CWBJ 2FXOA 3U1AA 2K37A 3AE8C 2LR2A 2P67A 3NMDA 2M5AB 4XA4A 2QG4A 1LT9A 2KNCB 1H88A 1RQUA 3H1HD 1KFMA 3KHUA 1JTHB 3CCUP 1KV4A 1X9VA 2QE7H 2FYNC 1NJIQ 2BCCG 4Y99B 5AW6B 4EDFA 2IFNA 3KQGA 1VQ7P 3CXHD 3CD6P 5B5EE 1J1EB 4WY4D 1HVVA 2YMYA 4YXDC 2OTKE 5KKZC 2WT7B 4I7ZB 5KAIE 2BCCD 5AVYB 1LTJA 1VQ8P 1VQKP 2Z4EA 4H44B 3JC22 3IR9A 1JEKA 2KS1B 3H1KJ 3AEFC 2W6BA 5AVVB 3G71P 5AW3B 2KXPB 2N1TA 1OW7A 2NPSC 4WY4C 1URQD 4NPFX 2K88A 2HODA 1BSNA 1YJNP 3CCQP 1EC5A 1NTZD 1YJWP 2JEEA 5KTBA 1EDJA 1X79B 1N7LA 2ZT9C 4EI2A 3LIDA 3FWNA 1SQVE 4L73A 1VDFA 2FFDA 1RF0A 2GA1A 1FE6A 4IL6E 1LP1B 1SQXJ 5C39A 1NO4A 1YI2P 1N7SD 3BRTB 2KP8A 4LLHA 2Q6QA 1IK7A 1LWUA 4UB8H 1IZNB 1BGYG 3U1CA 1XTCC 3HD7A 2QM8A 4R4LA 3VMYA 1DEBA 3QWOC 2P2UA 2Q7CA 2L91A 2R5DA 3G6EP 2FYZA 1J1DC 4XFJA 4GODA 2M3BA 2IBZI 1FZAA 2BEQD 2KYVA 5AVRB 2PAJA 1P84D 1NTMK 3I55P 2KZJA 1FDIA 4M3LA 2QJKB 1ZR4A 4N78D 5CHXA 1PGPA 3H1JE 3VN0A 1BGYD 1ZRTD 1HJ0A 2V4HA 3RK2C 2QJPC 3WU2H 2Q9IA 1OWAA 1PGOA 2B87B 3L75E 1KZUB 1U7MA 2M3EA 3HE5A 3TDKA 3IN6A 3V2RA 3Q1MA 1SQBE 1PPJG 2ZAEB 2KUBA 3AE7C 3AE1C 3H1IG 3L72E 5KAFE 2IBZG 4OWFA 4DZOA 1AV1A 3GF7A 1Q2NA 1KYOI 3KDPB 1OZHA 2O01H 1VF5C 2Y0DA 1DH3A 2Q3EA 1JO5A 1ZMEC 1M1JA 2K9YA 4H13C 5GTIH 1K05A 1HGZA 1PPJD 3VMAA 1SS1A 3AE3C 3P7KA 2WSEH 1ZOYC 2A06E 4U3FE 4N3YB 3H1ID 2IBZD 2MJZA 4D6TG 2E5YA 2KB7P 3H32B 3M9BA 4UB6E 4YXWH 2FYNB 2M8RA 1QLED 4KT0J 3CLQA 1K73Q 1OMIA 1S3JA 5CBNA 2ITAA 2QJYC 3Q3DA 1L2PA 3BCCE 1N73A 2B88A 2N1TD 4OGQC 1Q7YQ 1AA0A 2RH0A 2C0XA 5AVTB 4GT1A 3TGUG 1M90Q 1S1CX 2O1JA 2ZYGA 1NAFA 1SQVK 3R2PA 3KZIH 5KKZB 2RN0A 5K5GB 2ZVNB 1GTWA 3L74G 1KYOD 3L37A 3T97A 4ZKPA 3R4YA 1L4AA 1NHLA 4C46A 1KB9D 1OIPA 2YO2A 5CJ0A 3TGUD 1NGMB 3H1LG 1BE3G 3HD7D 1MFZA 5KLVK 1EZVI 1DEEG 3B5NC 4WY4B 5AVQB 2ZYAA 3S1KA 3L74D 1NTMG 2KK7A 1S9KE 4JQ0D 1YYCA 3MHVA 3E7KA 2E76D 1L0NK 1CZQA 1RF1C 5CBOA 1GW4A 1X22A 3H1LD 3L71G 1BE3D 2AEFA 5BVZA 3ITKA 4JYCA 4IFMA 1NU1J 1GW3A 1W2EA 1NTMD 3PLNA 1Q90D 5B66H 1WT6A 1EZVG 1J1DB 2FXPA 1GDTA 2QIWA 3GHGC 1S2EA 1SFCC 1JY2N 1GU5A 1Z56A 2KI7B 3L71D 3PTZA 4I7ZC 1OX3A 1NWQA 1GL2C 1Y47A 1LTGC 3M9QA 3L75J 4AUWA 2WPSA 5TISH 2OTLP 4GOFA 3O6QA 3RK2B 2QJPB 1EZVD 1FZCA 4N6JA 2AXCA 3MD0A 2QVAA 1SQQK 3GG2A 1NTKK 1G2CB 3WUUA 1FZFA 2KIKA 3H1KE 2JJLA 1JY2P 3CX5E 1GU4A 1JMMA 3A3YB 2PP6A 2WSFJ 1VF5B 3H1HJ 2NPSA 2V7QH 3IF4A 2BEZF 1PPJE 5BU5A 2GUSA 3PH0A 4U3FJ 4KJMA 2DW3A 4H13B 3H1IE 1GZLA 1RE3A 5CCHD 1PP9D 5GTHE 3G9RA 2KOGA 1YITP 1SQPK 2O1KA 1S5LE 2OYIC 2LKMA 1ZV8A 1L4AD 1W5CE 1JOCA 2QJYB 1OFCX 1ZP0C 4D6TE 1VQ9P 1G1JA 4OGQB 1LTIC 1ZW0A 2BCCJ 3S4RA 2QJKC 2C0WA 3P8CE 1BSHA 1JY3O 5H2FH 3AECC 1RE4C 3V2PA 4C7RA 1L0NG 2B9BA 3D6ZA 2FXMA 1UIIA 2HG5D 3SWFA 2YNYA 1BCCG 2IPPA 1OVUA 1CI6B 2SPZA 3TGUE 3QH9A 2O3JA 1GMJA 1WMKA 4RKUJ 1JCDA 1TU3F 4W7ZA 3L70G 3MUDC 2WWWA 1FBMA 3L74E 1L0ND 3B5NB 3USSA 3PJSK 2HPCA 3AE4C 2WZ7A 1IFJA 1GK4A 3M9HA 1BCCD 2J5UA 3JCUE 4PD4E 2H43A 3MP7B 3HE4B 2P7JA 1YHQP 1RF1B 5AW5B 2WTYA 4HB1A 4YTPC 4WWIA 3L70D 2AEMA 2JP3A 1U7JA 1SQQG 1BDDA 2D2CD 4H0LD 1NTKG 4C7NA 1N2DC 3TSIA 1FOSE 4WBAA 1L0LK 2XV5A 1KQSO 4GOEA 1KC8Q 3CCVP 5KJ7D 4PV1D 4K3AA 2OYHC 3M0DC 4BRYA 4KHXA 3GHGB 3L71E 3OW2O 1BGYJ 1SFCB 5B5EH 1VQ5P 1LTSC 5DJTB 1IFMA 1QVFO 1KILA 3CI9A 1GL2B 1SQQD 2YIUC 1FC2C 3AEGC 3FX0A 1AVYA 1NTKD 5AVZB 3GW6A 1VPCA 1SQXK 3D71A 1NTZG 2JWAA 5KAIH 2AXTE 1SQPG 3V4QA 1QX8A 2D2CC 5KLIC 2WMMA 4AYCA 2W6AA 3I5CA 1S4XA 1Q86Q 2FYUK 5KJ7C 3E1RA 4HH2A 3Q5RA 3PHLA 4HYTB 1H0TA 5APXA 2M0BA 1HTLC 3H1IJ 2E75D 2CPSA 3SWYA 2M5AA 1SQPD 1T8ZA 1R5LA 2KNCA 1RY3A 3D70A 3G3ZA 1FJKA 3TNUB 4PJ0E 1RF1A 3EFGA 2B89A 4ZKUA 5CCGA 1JTHA 1KTMA 4IL6H 1YQ4C 2ZXEB 2HYNA 2OYIB 4UB8E 3C9IA 2ZYDA 4Z1MH 3L73G 3CX5I 3JSVC 4D6TJ 1NU1E 1URQC 2WPVB 1QL2A 1D7MA 2Y9YA 3A5TA 2KSJA 3RK3D 2E75C 2I8DA 2P58A 1UIXA 3HUSC 4HJGH 1T3JA 3HRNA 3N4XA 2WT7A 2I1JA 1BDCA 3L36A 1MKMA 1N7SC 3RGUA 3TGUJ 2VRSA 3VOPA 3RBXA 1N86A 3L73D 2IZ0A 4BWNA 1VQOP 2JO1A 2YXQB 5APYA 1KMIZ 2KS1A 3L74J 3VYIA 1L0LG 1JNMA 1JB0J 2WSSH 1FZEA 5KAFH 2Q1KA 3CC4P 2XKMA 3CCJP 1A02F 2HR3A 2P10A 5AW7B 1BCCE 1K9MQ 2W83C 3H1LJ 1BE3J 3V4WA 3H1HE 2R5BA 3KYQA 1LT9C 2N9BA 1IJDB 3WUTA 1KILD 2K9JB 2WSFH 3VMZA 1NTMJ 2WSCH 1L0LD 1RQVA 1LP1A 4TT3H 3LW5J 2K3RA 3P32A 3B8EB 3CXHE 4UB6H 2Z5IA 2KSEA 1HF9A 2H89C 3L71J 2XNDH 2FYUG 1Q82Q 4ZNCA 2E5TA 3SWKA 1NKNA 4EIJA 2OYHB 1YTZT 2C9NY 2A45H 1SVFA 2ZXXA 4PD4I 1MZ9A 3A7OA 4LC1A 4OH8B 2BCCE 1NOHA 2YIUB 5APUA 3MZWB 2RKLA 3GF3A 2YMKA 3I56P 1VQNP 4BXLA 2FYUD 1LTJC 2B87A 5AW1B 1FZBA 2QA4P 2PGDA 2ZVOB 2D2CB 4DJGA 5KLIB 5CCGD 3V6IA 3HTKB 4IL6X 2HLOA 1HUCA 1PIXA 1AJYA 2OTJP 2N1TC 1AQ5A 5E79E 1NTZE 2R3SA 2IFMA 1J2JB 1G1IA 3SSUA 1SQBK 1GD2E 4QMAA 2OQQA 2RMZA 1HWTC 2FFDC 3GLMA 1RF0C 1KD1Q 2W27A 3H32A 3PP5A 3P8MC 1LWUC 4H44D 2XNXA 3A0BE 2CPBA 3HD7C 1X0TA 5APSA 4JF7A 2HFED 3M0AA 1P84E 1HJBA 1EQ7A 1URQB 3CMEP 1JMBA 3KXDA 3AEAC 4N78E 1FDOA 1GK6A 1BGYE 1ZRTE 4EOTA 2E75B 4O9BA 2E76C 1IK9A 3HUSB 3LIEA 1N8RQ 2YKPA 5AW8B 1N7SB 3CL3D 1WRGA 1EXIA 1L0NJ 2ZJSE 3A2AA 1JM0A 5BU8B 5AVXB 1PP9G 1BCCJ 4GKGA 2O01J 5AW2B 3UIAA 4WY4A 3CX5H 1Y8AA 3S9OA 1SQVG 1OW8A 3L70J 2YKOA 1KN7A 3RL0D 2IBZE 1M1JC 1QVGO 1LT9B 1FAVA 1KQFB 1FZGA 3CCLP 4A7PA 5GTHH 3OJAB 4ASWA 1LTTC 1AQTA 1SQVD 1S5LH 3V2QA 4IFFA 5KLVG 3A0HE 1OVVA 4RO0A 3L4FA 1SQQJ 3AE6C 5AVUB 1HGVA 3H1JG 1R8EA 1N73C 3EFFK 1VQ6P 2PFXA 3RL0C 5DJUB 2YO3A 3ZDMA 1KYOE 1SQBG 1VQPP 4YPCA 4I1LA 5CCHC 3KPEA 1ZLLA 3WMM0 4I6MC 5KLVD 1KB9E 3L72G 1Y9BA 3G4SP 3H25A 1NH4A 1LTJB 3BVHA 2K1AA 2A45I 3H1JD 1OXZA 1L4AC 2QM7A 2G8YA 1G2CA 3O8ZA 2KLUA 1NTZJ 2E74D 3WUVA 1SQPJ 1R5SA 2Y0EA 2N1TB 1SQBD 1M7LA 4TLFA 2A06G 4GDOA 4U3FG 4LGDE 3L72D 2HODB 3NFQA 5AW0B 3H1LE 3FGAD 1DD3A 3D6YA 1BE3E 1PGQA 1PFIA 3JCUH 4PD4H 2IYOA 2Q5UA 1MFTA 4W7YA 2JWDA 1NTME 2FFDB 2A45G 1FDMA 3BCCG 1ZN5A 4NPDA 2ZFCA 1LWUB 2A06D 4U3FD 3HD7B 3EWKA 2E74C 2JR8A 2R3CA 2WPQA 2W6JH 1IFIA 1AVOA 3LW5H 5AW4B 1H89A 4XE5B 3B4SA 3L73J 2NPSD 4ZMDA 2E76B 3OAKA 3BCCD 1EZVE 3TK1A 3H6PA 1KQLA 2ZT9D 1LTAC 4H0LC 3HE5B 1FZCC 1QEXA 1CI6A 4IOIH 2AXTH 2PRRA 1E79H 2KLVA 2Q3IA 5L8RJ 2WITA 4RJTA 1P84I 4PV1C 5M1BA 3CWBG 1NAYA 1ZXGA 1S5LX 4AQRD 2I1KA 4JYBA 2V7QJ 4RESB 3B5NA 5TJHA
chains in the Genus database with same CATH topology
2RMZA 2BCCD 1BGYD 3L71D 1ZRTD 2Y0CA 3PTZA 3L75D 3PRJA 5KKZB 3H1KD 2RN0A 4A7PA 3CX5D 3TDKA 1KYOD 3CWBD 2QJPB 1SQVD 1SQQD 1EZVD 1NTKD 2A06D 1KB9D 3GW6A 4U3FD 3GG2A 3TGUD 4PD4D 2JWAA 2YIUB 2QG4A 2O3JA 3L73D 2KNCB 1NTZD 2N9YB 2Y0DA 2FYUD 2Q3EA 3H1HD 3L74D 3KHUA 1SQXD 2KS1A 3VMAA 1PPJD 3BCCD 1L0ND 3TF5A 5KLIB 5KLVD 3PHLA 3H1ID 2IBZD 1BCCD 3H1LD 3H1JD 4EDFA 2FYNB 1BE3D 4D6TD 1SQPD 2L91A 3CXHD 1NU1D 1PP9D 3ITKA 3FWLA 4RJTA 2Y0EA 3L70D 1NTMD 3PLNA 1SQBD 2K9JB 1P84D 1L0LD 3L72D 2QJYB 2QJKB 5TJHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RMZ A;  2BCC D;  1BGY D;  3L71 D;  1ZRT D;  2Y0C A;  3PTZ A;  3L75 D;  3PRJ A;  5KKZ B;  3H1K D;  2RN0 A;  4A7P A;  3CX5 D;  3TDK A;  1KYO D;  3CWB D;  2QJP B;  1SQV D;  1SQQ D;  1EZV D;  1NTK D;  2A06 D;  1KB9 D;  3GW6 A;  4U3F D;  3GG2 A;  3TGU D;  4PD4 D;  2JWA A;  2YIU B;  2QG4 A;  2O3J A;  3L73 D;  2KNC B;  1NTZ D;  2N9Y B;  2Y0D A;  2FYU D;  2Q3E A;  3H1H D;  3L74 D;  3KHU A;  1SQX D;  2KS1 A;  3VMA A;  1PPJ D;  3BCC D;  1L0N D;  3TF5 A;  5KLI B;  5KLV D;  3PHL A;  3H1I D;  2IBZ D;  1BCC D;  3H1L D;  3H1J D;  4EDF A;  2FYN B;  1BE3 D;  4D6T D;  1SQP D;  2L91 A;  3CXH D;  1NU1 D;  1PP9 D;  3ITK A;  3FWL A;  4RJT A;  2Y0E A;  3L70 D;  1NTM D;  3PLN A;  1SQB D;  2K9J B;  1P84 D;  1L0L D;  3L72 D;  2QJY B;  2QJK B;  5TJH A; 
#chains in the Genus database with same CATH topology
 1L0L J;  2QEX P;  1FJP A;  3PRJ A;  1M1J B;  1PP9 E;  2POH A;  3HE4 A;  3CWB D;  1S9K D;  1RE3 C;  2E43 A;  3RK2 D;  4PJ0 H;  3AEB C;  2IDB A;  1E5W A;  1K8A Q;  2O01 N;  3MTU E;  3VTP C;  3MIW A;  2FBW C;  2H88 C;  2Z5H A;  4DT0 A;  3GHG A;  1N73 B;  1IFD A;  1SFC A;  3CC7 P;  1EDL A;  3AED C;  1IO4 A;  2FYU J;  3V2N A;  1U57 A;  4I2L C;  3IAO A;  2QSI A;  3RL0 B;  1VF5 D;  1GL2 A;  2YKQ A;  5KLV E;  3WU2 E;  1PL5 A;  3NXS A;  4H13 D;  2KZI A;  2CK3 H;  3H1K G;  1T6A A;  2OYO A;  4L74 A;  2LXB A;  5EFW B;  3CCM P;  3T97 B;  2Y9Z A;  1L4A B;  3AE5 C;  1L0N E;  4HKZ H;  1JCC A;  1SLQ A;  1YIJ P;  1VQ4 P;  1HBW A;  1YTZ I;  3RK3 C;  3B71 A;  2W90 A;  2UWJ E;  1NKZ B;  2WPR A;  4Y28 J;  1Q81 Q;  2Y0C A;  1PGJ A;  3IFM A;  1M56 D;  3H1K D;  1KFN A;  1DD4 A;  5GTI E;  4OGQ D;  4EYY Q;  5AVS B;  3BAT A;  3CX5 D;  3L70 E;  1SQX G;  4CPG A;  3CPW O;  1KB9 I;  3CC2 P;  3VMX A;  2BAS A;  1USE A;  2NZ2 A;  3TNU A;  3Q5S A;  3N7N A;  2OYI A;  2GUV A;  2H8P D;  3CXH H;  2E74 B;  1LJ2 A;  1MUU A;  1SQX D;  3SFE C;  3C8V A;  1SQQ E;  1M1K Q;  1EDI A;  1NTK E;  3VP8 A;  2MKV A;  1EXJ A;  2IX7 C;  3B5N D;  2XZR A;  3KZI E;  3ABV C;  3M91 A;  1T2K D;  1KIL C;  3Q2Y A;  1RE4 A;  3W68 A;  4D6T D;  3FXD A;  2AEJ A;  5CJ4 A;  3O6Q B;  4L76 A;  5APQ A;  3P8C D;  1OVR A;  3FWL A;  3AEE C;  1NU1 K;  5CCH A;  1RH5 B;  4H0L B;  1FZC B;  1VQL P;  1SP4 A;  1NYH A;  1FS0 E;  3RL0 g;  1KOR A;  2LXC B;  3Q5P A;  4PV1 B;  1CW5 A;  2WVR A;  3MUD A;  1IFP A;  3F5H A;  1LGH B;  1M8O B;  1SQP E;  1QGK B;  3CCE P;  5CMZ A;  1M57 D;  1PP9 J;  5E79 H;  2NPS B;  1CSB A;  1SFC D;  4W80 A;  2XU6 A;  1T2K C;  4K35 A;  3CWB E;  3OA7 A;  2OGU A;  1RHZ B;  2K9J A;  4WB4 A;  1GL2 D;  1SQV J;  1PV3 A;  2W8Z A;  2XDJ A;  2J58 A;  4IFD K;  1HH0 A;  1IFN A;  2ZT9 B;  4PD4 D;  3VP9 A;  5CCG C;  5APV A;  1K04 A;  5B66 E;  3V5B A;  3RK3 E;  4Y99 C;  3GMA A;  3A0B H;  1MV8 A;  2IZ1 A;  3TF5 A;  2OYH A;  3M0D A;  4MN4 C;  1P84 H;  5AW9 B;  4OVN F;  1J1E C;  1T3U A;  5KLV J;  2L5G B;  2NRG A;  3MGN A;  3L73 E;  2G3A A;  5TIS E;  3TYY A;  1X8Y A;  2JKV A;  3H1J J;  1LT1 A;  5APW A;  4B86 A;  2C9L Y;  3C1L A;  4R4M A;  1H8A A;  1KQG B;  4H44 C;  1SQB J;  1OW6 A;  3HTK A;  3L72 J;  2J59 M;  3CCR P;  1VQM P;  3NTN A;  1DX7 A;  3E1I A;  5KJ7 A;  3F89 A;  3RK3 B;  1S72 P;  1JY2 O;  2WSE J;  2HPC B;  1KIL E;  3U59 A;  4JPZ B;  1JY3 N;  1L0L E;  2FY8 A;  3W67 A;  1NVO A;  2WSC J;  5AVW B;  4DCK A;  1NU1 G;  2IYP A;  1VL2 A;  4ASV A;  1QL1 A;  2N9Y B;  1W2B O;  4GIF A;  1YJ9 P;  3FXE A;  1NTZ K;  1FOS F;  1USD A;  4C7N B;  1SQX E;  3SFD C;  1NTK J;  3RBZ A;  1JUN A;  2QRX A;  3BCC J;  3CMA P;  1URQ A;  3A0H H;  2YXR B;  4BRY B;  4L75 A;  2P1J A;  2R32 A;  2OAR A;  3L75 G;  2WQY C;  1JY3 P;  1LTB C;  1NU1 D;  5H2F E;  2FYU E;  2GM4 A;  3AE2 C;  2H7H A;  1KIL B;  5APT A;  3HUS A;  1PZQ A;  3BAS A;  3M06 A;  1KYO H;  4WVZ A;  4JBZ A;  1XTG B;  1IC2 A;  1N7S A;  3CXH I;  2E42 A;  1AFO A;  2R44 A;  3AE9 C;  1ZR2 A;  4U7J A;  2FKW B;  1KB9 H;  3EQ2 A;  1LNQ A;  3L75 D;  1YQ3 C;  4NPE A;  4DOJ A;  3CCS P;  1FU1 A;  3H1H G;  1DIP A;  3II6 A;  3BRV B;  1EDK A;  1A02 J;  3L35 A;  1YBK A;  1H0T B;  2JDI H;  3K5B A;  3CWB J;  2FXO A;  3U1A A;  2K37 A;  3AE8 C;  2LR2 A;  2P67 A;  3NMD A;  2M5A B;  4XA4 A;  2QG4 A;  1LT9 A;  2KNC B;  1H88 A;  1RQU A;  3H1H D;  1KFM A;  3KHU A;  1JTH B;  3CCU P;  1KV4 A;  1X9V A;  2QE7 H;  2FYN C;  1NJI Q;  2BCC G;  4Y99 B;  5AW6 B;  4EDF A;  2IFN A;  3KQG A;  1VQ7 P;  3CXH D;  3CD6 P;  5B5E E;  1J1E B;  4WY4 D;  1HVV A;  2YMY A;  4YXD C;  2OTK E;  5KKZ C;  2WT7 B;  4I7Z B;  5KAI E;  2BCC D;  5AVY B;  1LTJ A;  1VQ8 P;  1VQK P;  2Z4E A;  4H44 B;  3JC2 2;  3IR9 A;  1JEK A;  2KS1 B;  3H1K J;  3AEF C;  2W6B A;  5AVV B;  3G71 P;  5AW3 B;  2KXP B;  2N1T A;  1OW7 A;  2NPS C;  4WY4 C;  1URQ D;  4NPF X;  2K88 A;  2HOD A;  1BSN A;  1YJN P;  3CCQ P;  1EC5 A;  1NTZ D;  1YJW P;  2JEE A;  5KTB A;  1EDJ A;  1X79 B;  1N7L A;  2ZT9 C;  4EI2 A;  3LID A;  3FWN A;  1SQV E;  4L73 A;  1VDF A;  2FFD A;  1RF0 A;  2GA1 A;  1FE6 A;  4IL6 E;  1LP1 B;  1SQX J;  5C39 A;  1NO4 A;  1YI2 P;  1N7S D;  3BRT B;  2KP8 A;  4LLH A;  2Q6Q A;  1IK7 A;  1LWU A;  4UB8 H;  1IZN B;  1BGY G;  3U1C A;  1XTC C;  3HD7 A;  2QM8 A;  4R4L A;  3VMY A;  1DEB A;  3QWO C;  2P2U A;  2Q7C A;  2L91 A;  2R5D A;  3G6E P;  2FYZ A;  1J1D C;  4XFJ A;  4GOD A;  2M3B A;  2IBZ I;  1FZA A;  2BEQ D;  2KYV A;  5AVR B;  2PAJ A;  1P84 D;  1NTM K;  3I55 P;  2KZJ A;  1FDI A;  4M3L A;  2QJK B;  1ZR4 A;  4N78 D;  5CHX A;  1PGP A;  3H1J E;  3VN0 A;  1BGY D;  1ZRT D;  1HJ0 A;  2V4H A;  3RK2 C;  2QJP C;  3WU2 H;  2Q9I A;  1OWA A;  1PGO A;  2B87 B;  3L75 E;  1KZU B;  1U7M A;  2M3E A;  3HE5 A;  3TDK A;  3IN6 A;  3V2R A;  3Q1M A;  1SQB E;  1PPJ G;  2ZAE B;  2KUB A;  3AE7 C;  3AE1 C;  3H1I G;  3L72 E;  5KAF E;  2IBZ G;  4OWF A;  4DZO A;  1AV1 A;  3GF7 A;  1Q2N A;  1KYO I;  3KDP B;  1OZH A;  2O01 H;  1VF5 C;  2Y0D A;  1DH3 A;  2Q3E A;  1JO5 A;  1ZME C;  1M1J A;  2K9Y A;  4H13 C;  5GTI H;  1K05 A;  1HGZ A;  1PPJ D;  3VMA A;  1SS1 A;  3AE3 C;  3P7K A;  2WSE H;  1ZOY C;  2A06 E;  4U3F E;  4N3Y B;  3H1I D;  2IBZ D;  2MJZ A;  4D6T G;  2E5Y A;  2KB7 P;  3H32 B;  3M9B A;  4UB6 E;  4YXW H;  2FYN B;  2M8R A;  1QLE D;  4KT0 J;  3CLQ A;  1K73 Q;  1OMI A;  1S3J A;  5CBN A;  2ITA A;  2QJY C;  3Q3D A;  1L2P A;  3BCC E;  1N73 A;  2B88 A;  2N1T D;  4OGQ C;  1Q7Y Q;  1AA0 A;  2RH0 A;  2C0X A;  5AVT B;  4GT1 A;  3TGU G;  1M90 Q;  1S1C X;  2O1J A;  2ZYG A;  1NAF A;  1SQV K;  3R2P A;  3KZI H;  5KKZ B;  2RN0 A;  5K5G B;  2ZVN B;  1GTW A;  3L74 G;  1KYO D;  3L37 A;  3T97 A;  4ZKP A;  3R4Y A;  1L4A A;  1NHL A;  4C46 A;  1KB9 D;  1OIP A;  2YO2 A;  5CJ0 A;  3TGU D;  1NGM B;  3H1L G;  1BE3 G;  3HD7 D;  1MFZ A;  5KLV K;  1EZV I;  1DEE G;  3B5N C;  4WY4 B;  5AVQ B;  2ZYA A;  3S1K A;  3L74 D;  1NTM G;  2KK7 A;  1S9K E;  4JQ0 D;  1YYC A;  3MHV A;  3E7K A;  2E76 D;  1L0N K;  1CZQ A;  1RF1 C;  5CBO A;  1GW4 A;  1X22 A;  3H1L D;  3L71 G;  1BE3 D;  2AEF A;  5BVZ A;  3ITK A;  4JYC A;  4IFM A;  1NU1 J;  1GW3 A;  1W2E A;  1NTM D;  3PLN A;  1Q90 D;  5B66 H;  1WT6 A;  1EZV G;  1J1D B;  2FXP A;  1GDT A;  2QIW A;  3GHG C;  1S2E A;  1SFC C;  1JY2 N;  1GU5 A;  1Z56 A;  2KI7 B;  3L71 D;  3PTZ A;  4I7Z C;  1OX3 A;  1NWQ A;  1GL2 C;  1Y47 A;  1LTG C;  3M9Q A;  3L75 J;  4AUW A;  2WPS A;  5TIS H;  2OTL P;  4GOF A;  3O6Q A;  3RK2 B;  2QJP B;  1EZV D;  1FZC A;  4N6J A;  2AXC A;  3MD0 A;  2QVA A;  1SQQ K;  3GG2 A;  1NTK K;  1G2C B;  3WUU A;  1FZF A;  2KIK A;  3H1K E;  2JJL A;  1JY2 P;  3CX5 E;  1GU4 A;  1JMM A;  3A3Y B;  2PP6 A;  2WSF J;  1VF5 B;  3H1H J;  2NPS A;  2V7Q H;  3IF4 A;  2BEZ F;  1PPJ E;  5BU5 A;  2GUS A;  3PH0 A;  4U3F J;  4KJM A;  2DW3 A;  4H13 B;  3H1I E;  1GZL A;  1RE3 A;  5CCH D;  1PP9 D;  5GTH E;  3G9R A;  2KOG A;  1YIT P;  1SQP K;  2O1K A;  1S5L E;  2OYI C;  2LKM A;  1ZV8 A;  1L4A D;  1W5C E;  1JOC A;  2QJY B;  1OFC X;  1ZP0 C;  4D6T E;  1VQ9 P;  1G1J A;  4OGQ B;  1LTI C;  1ZW0 A;  2BCC J;  3S4R A;  2QJK C;  2C0W A;  3P8C E;  1BSH A;  1JY3 O;  5H2F H;  3AEC C;  1RE4 C;  3V2P A;  4C7R A;  1L0N G;  2B9B A;  3D6Z A;  2FXM A;  1UII A;  2HG5 D;  3SWF A;  2YNY A;  1BCC G;  2IPP A;  1OVU A;  1CI6 B;  2SPZ A;  3TGU E;  3QH9 A;  2O3J A;  1GMJ A;  1WMK A;  4RKU J;  1JCD A;  1TU3 F;  4W7Z A;  3L70 G;  3MUD C;  2WWW A;  1FBM A;  3L74 E;  1L0N D;  3B5N B;  3USS A;  3PJS K;  2HPC A;  3AE4 C;  2WZ7 A;  1IFJ A;  1GK4 A;  3M9H A;  1BCC D;  2J5U A;  3JCU E;  4PD4 E;  2H43 A;  3MP7 B;  3HE4 B;  2P7J A;  1YHQ P;  1RF1 B;  5AW5 B;  2WTY A;  4HB1 A;  4YTP C;  4WWI A;  3L70 D;  2AEM A;  2JP3 A;  1U7J A;  1SQQ G;  1BDD A;  2D2C D;  4H0L D;  1NTK G;  4C7N A;  1N2D C;  3TSI A;  1FOS E;  4WBA A;  1L0L K;  2XV5 A;  1KQS O;  4GOE A;  1KC8 Q;  3CCV P;  5KJ7 D;  4PV1 D;  4K3A A;  2OYH C;  3M0D C;  4BRY A;  4KHX A;  3GHG B;  3L71 E;  3OW2 O;  1BGY J;  1SFC B;  5B5E H;  1VQ5 P;  1LTS C;  5DJT B;  1IFM A;  1QVF O;  1KIL A;  3CI9 A;  1GL2 B;  1SQQ D;  2YIU C;  1FC2 C;  3AEG C;  3FX0 A;  1AVY A;  1NTK D;  5AVZ B;  3GW6 A;  1VPC A;  1SQX K;  3D71 A;  1NTZ G;  2JWA A;  5KAI H;  2AXT E;  1SQP G;  3V4Q A;  1QX8 A;  2D2C C;  5KLI C;  2WMM A;  4AYC A;  2W6A A;  3I5C A;  1S4X A;  1Q86 Q;  2FYU K;  5KJ7 C;  3E1R A;  4HH2 A;  3Q5R A;  3PHL A;  4HYT B;  1H0T A;  5APX A;  2M0B A;  1HTL C;  3H1I J;  2E75 D;  2CPS A;  3SWY A;  2M5A A;  1SQP D;  1T8Z A;  1R5L A;  2KNC A;  1RY3 A;  3D70 A;  3G3Z A;  1FJK A;  3TNU B;  4PJ0 E;  1RF1 A;  3EFG A;  2B89 A;  4ZKU A;  5CCG A;  1JTH A;  1KTM A;  4IL6 H;  1YQ4 C;  2ZXE B;  2HYN A;  2OYI B;  4UB8 E;  3C9I A;  2ZYD A;  4Z1M H;  3L73 G;  3CX5 I;  3JSV C;  4D6T J;  1NU1 E;  1URQ C;  2WPV B;  1QL2 A;  1D7M A;  2Y9Y A;  3A5T A;  2KSJ A;  3RK3 D;  2E75 C;  2I8D A;  2P58 A;  1UIX A;  3HUS C;  4HJG H;  1T3J A;  3HRN A;  3N4X A;  2WT7 A;  2I1J A;  1BDC A;  3L36 A;  1MKM A;  1N7S C;  3RGU A;  3TGU J;  2VRS A;  3VOP A;  3RBX A;  1N86 A;  3L73 D;  2IZ0 A;  4BWN A;  1VQO P;  2JO1 A;  2YXQ B;  5APY A;  1KMI Z;  2KS1 A;  3L74 J;  3VYI A;  1L0L G;  1JNM A;  1JB0 J;  2WSS H;  1FZE A;  5KAF H;  2Q1K A;  3CC4 P;  2XKM A;  3CCJ P;  1A02 F;  2HR3 A;  2P10 A;  5AW7 B;  1BCC E;  1K9M Q;  2W83 C;  3H1L J;  1BE3 J;  3V4W A;  3H1H E;  2R5B A;  3KYQ A;  1LT9 C;  2N9B A;  1IJD B;  3WUT A;  1KIL D;  2K9J B;  2WSF H;  3VMZ A;  1NTM J;  2WSC H;  1L0L D;  1RQV A;  1LP1 A;  4TT3 H;  3LW5 J;  2K3R A;  3P32 A;  3B8E B;  3CXH E;  4UB6 H;  2Z5I A;  2KSE A;  1HF9 A;  2H89 C;  3L71 J;  2XND H;  2FYU G;  1Q82 Q;  4ZNC A;  2E5T A;  3SWK A;  1NKN A;  4EIJ A;  2OYH B;  1YTZ T;  2C9N Y;  2A45 H;  1SVF A;  2ZXX A;  4PD4 I;  1MZ9 A;  3A7O A;  4LC1 A;  4OH8 B;  2BCC E;  1NOH A;  2YIU B;  5APU A;  3MZW B;  2RKL A;  3GF3 A;  2YMK A;  3I56 P;  1VQN P;  4BXL A;  2FYU D;  1LTJ C;  2B87 A;  5AW1 B;  1FZB A;  2QA4 P;  2PGD A;  2ZVO B;  2D2C B;  4DJG A;  5KLI B;  5CCG D;  3V6I A;  3HTK B;  4IL6 X;  2HLO A;  1HUC A;  1PIX A;  1AJY A;  2OTJ P;  2N1T C;  1AQ5 A;  5E79 E;  1NTZ E;  2R3S A;  2IFM A;  1J2J B;  1G1I A;  3SSU A;  1SQB K;  1GD2 E;  4QMA A;  2OQQ A;  2RMZ A;  1HWT C;  2FFD C;  3GLM A;  1RF0 C;  1KD1 Q;  2W27 A;  3H32 A;  3PP5 A;  3P8M C;  1LWU C;  4H44 D;  2XNX A;  3A0B E;  2CPB A;  3HD7 C;  1X0T A;  5APS A;  4JF7 A;  2HFE D;  3M0A A;  1P84 E;  1HJB A;  1EQ7 A;  1URQ B;  3CME P;  1JMB A;  3KXD A;  3AEA C;  4N78 E;  1FDO A;  1GK6 A;  1BGY E;  1ZRT E;  4EOT A;  2E75 B;  4O9B A;  2E76 C;  1IK9 A;  3HUS B;  3LIE A;  1N8R Q;  2YKP A;  5AW8 B;  1N7S B;  3CL3 D;  1WRG A;  1EXI A;  1L0N J;  2ZJS E;  3A2A A;  1JM0 A;  5BU8 B;  5AVX B;  1PP9 G;  1BCC J;  4GKG A;  2O01 J;  5AW2 B;  3UIA A;  4WY4 A;  3CX5 H;  1Y8A A;  3S9O A;  1SQV G;  1OW8 A;  3L70 J;  2YKO A;  1KN7 A;  3RL0 D;  2IBZ E;  1M1J C;  1QVG O;  1LT9 B;  1FAV A;  1KQF B;  1FZG A;  3CCL P;  4A7P A;  5GTH H;  3OJA B;  4ASW A;  1LTT C;  1AQT A;  1SQV D;  1S5L H;  3V2Q A;  4IFF A;  5KLV G;  3A0H E;  1OVV A;  4RO0 A;  3L4F A;  1SQQ J;  3AE6 C;  5AVU B;  1HGV A;  3H1J G;  1R8E A;  1N73 C;  3EFF K;  1VQ6 P;  2PFX A;  3RL0 C;  5DJU B;  2YO3 A;  3ZDM A;  1KYO E;  1SQB G;  1VQP P;  4YPC A;  4I1L A;  5CCH C;  3KPE A;  1ZLL A;  3WMM 0;  4I6M C;  5KLV D;  1KB9 E;  3L72 G;  1Y9B A;  3G4S P;  3H25 A;  1NH4 A;  1LTJ B;  3BVH A;  2K1A A;  2A45 I;  3H1J D;  1OXZ A;  1L4A C;  2QM7 A;  2G8Y A;  1G2C A;  3O8Z A;  2KLU A;  1NTZ J;  2E74 D;  3WUV A;  1SQP J;  1R5S A;  2Y0E A;  2N1T B;  1SQB D;  1M7L A;  4TLF A;  2A06 G;  4GDO A;  4U3F G;  4LGD E;  3L72 D;  2HOD B;  3NFQ A;  5AW0 B;  3H1L E;  3FGA D;  1DD3 A;  3D6Y A;  1BE3 E;  1PGQ A;  1PFI A;  3JCU H;  4PD4 H;  2IYO A;  2Q5U A;  1MFT A;  4W7Y A;  2JWD A;  1NTM E;  2FFD B;  2A45 G;  1FDM A;  3BCC G;  1ZN5 A;  4NPD A;  2ZFC A;  1LWU B;  2A06 D;  4U3F D;  3HD7 B;  3EWK A;  2E74 C;  2JR8 A;  2R3C A;  2WPQ A;  2W6J H;  1IFI A;  1AVO A;  3LW5 H;  5AW4 B;  1H89 A;  4XE5 B;  3B4S A;  3L73 J;  2NPS D;  4ZMD A;  2E76 B;  3OAK A;  3BCC D;  1EZV E;  3TK1 A;  3H6P A;  1KQL A;  2ZT9 D;  1LTA C;  4H0L C;  3HE5 B;  1FZC C;  1QEX A;  1CI6 A;  4IOI H;  2AXT H;  2PRR A;  1E79 H;  2KLV A;  2Q3I A;  5L8R J;  2WIT A;  4RJT A;  1P84 I;  4PV1 C;  5M1B A;  3CWB G;  1NAY A;  1ZXG A;  1S5L X;  4AQR D;  2I1K A;  4JYB A;  2V7Q J;  4RES B;  3B5N A;  5TJH A; 
#chains in the Genus database with same CATH homology
 2RMZ A;  2BCC D;  1BGY D;  3L71 D;  1ZRT D;  2Y0C A;  3PTZ A;  3L75 D;  3PRJ A;  5KKZ B;  3H1K D;  2RN0 A;  4A7P A;  3CX5 D;  3TDK A;  1KYO D;  3CWB D;  2QJP B;  1SQV D;  1SQQ D;  1EZV D;  1NTK D;  2A06 D;  1KB9 D;  3GW6 A;  4U3F D;  3GG2 A;  3TGU D;  4PD4 D;  2JWA A;  2YIU B;  2QG4 A;  2O3J A;  3L73 D;  2KNC B;  1NTZ D;  2N9Y B;  2Y0D A;  2FYU D;  2Q3E A;  3H1H D;  3L74 D;  3KHU A;  1SQX D;  2KS1 A;  3VMA A;  1PPJ D;  3BCC D;  1L0N D;  3TF5 A;  5KLI B;  5KLV D;  3PHL A;  3H1I D;  2IBZ D;  1BCC D;  3H1L D;  3H1J D;  4EDF A;  2FYN B;  1BE3 D;  4D6T D;  1SQP D;  2L91 A;  3CXH D;  1NU1 D;  1PP9 D;  3ITK A;  3FWL A;  4RJT A;  2Y0E A;  3L70 D;  1NTM D;  3PLN A;  1SQB D;  2K9J B;  1P84 D;  1L0L D;  3L72 D;  2QJY B;  2QJK B;  5TJH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...