2KNCB

Platelet integrin alfaiib-beta3 transmembrane-cytoplasmic heterocomplex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
GAMGSKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of an integrin alphaIIb beta3 transmembrane-cytoplasmic heterocomplex provides insight into integrin activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-IIb
total genus 20
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08725 Integrin_b_cyt Integrin beta cytoplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2kncB00
3L71D 2RN0A 4RJTA 1NTMD 5KLVD 1SQQD 2Q3EA 3PTZA 2O3JA 1SQVD 3BCCD 3TDKA 3PLNA 2K9JB 2QG4A 3CWBD 1KB9D 2KNCB 3FWLA 1NTKD 2JWAA 2BCCD 2QJKB 1NTZD 2KS1A 3H1HD 3KHUA 3L74D 3PHLA 3L75D 2N9YB 1KYOD 3PRJA 4U3FD 1SQBD 1SQPD 3GW6A 3ITKA 4D6TD 4EDFA 3H1KD 3GG2A 1L0LD 5KKZB 1PPJD 1ZRTD 1BCCD 3H1JD 2Y0DA 1NU1D 1EZVD 2QJYB 2YIUB 3L72D 3TGUD 4A7PA 3L73D 2FYUD 3CX5D 2L91A 1SQXD 4PD4D 2Y0CA 3CXHD 2RMZA 3L70D 3VMAA 3TF5A 1L0ND 1P84D 1BE3D 1BGYD 2A06D 3H1LD 5TJHA 5KLIB 2IBZD 2QJPB 2Y0EA 1PP9D 2FYNB 3H1ID
chains in the Genus database with same CATH superfamily
1EDKA 2K9JA 1KQFB 1NTMK 3KYQA 4I7ZC 2NPSD 5CCGD 1EC5A 3RK2D 1SQQD 1OFCX 1SQXK 1QEXA 5B66H 1BSHA 2PAJA 1KILC 1GL2D 4EIJA 1S9KE 1OW8A 1MFTA 1SQBG 2IDBA 1MFZA 1W5CE 2NPSC 5CCGC 1PGJA 2HFED 2WZ7A 1RE3A 3ITKA 2QIWA 4JBZA 3WU2H 2JJLA 5AW8B 4PD4E 1SLQA 2E5YA 2CK3H 3G9RA 3H1JD 3V2RA 1URQD 2W8ZA 3L73G 3QH9A 5CBOA 5KAFH 3U1CA 1FU1A 1NTZE 3FWNA 1VQPP 5DJTB 2YXQB 2FYUD 3C8VA 3IF4A 3KZIE 2OTKE 3L75E 1Q81Q 1AQTA 2QJYC 2RMZA 4N6JA 5CJ4A 2GUSA 4IOIH 5M1BA 1RF0A 1URQB 1JM0A 3GMAA 3CWBG 3Q5SA 3V2PA 2C0XA 2FYNB 1Q86Q 1VF5C 5AVYB 1DX7A 5BU5A 3CCSP 1W2BO 1IC2A 1PGOA 2E5TA 3RBXA 5B5EE 4WY4A 2IYOA 5EFWB 1NTMD 2J5UA 4IFDK 2I1KA 2JDIH 3O8ZA 2POHA 1VL2A 1SFCD 1Z56A 1R8EA 1KB9H 3D70A 3FWLA 1HBWA 1E5WA 3HUSC 1H8AA 5KTBA 4D6TJ 3AEBC 2HPCA 1KN7A 3GLMA 3M0DC 1NTZK 3H32A 1SQBD 5KLIC 3V4QA 3VYIA 4H13D 1SQPK 4IL6H 1LTJB 2YKOA 4JPZB 5APSA 3QWOC 4W7ZA 1LP1B 1J1DB 1KYOE 2R44A 3L73D 4JYCA 2M8RA 1X8YA 1OW6A 1FZCB 1H89A 2OYHB 3AE7C 3KQGA 5KKZC 1OVRA 1KQGB 2R3SA 1NTKK 1VQ4P 1L2PA 1FAVA 1IFNA 2AEJA 4ZKUA 1PZQA 2G8YA 3AE1C 3P8MC 1N7SA 1MV8A 2RKLA 4OGQB 3L71J 3U1AA 2KNCA 2WMMA 1SQPJ 2FFDC 1LT9A 2P10A 3FXDA 1QL2A 3M0DA 3VTPC 3L73J 1S5LX 2ZYAA 4YXWH 5KLVD 1FOSE 1VQKP 1SQVK 4K3AA 4NPEA 1PIXA 1AJYA 3KPEA 5KJ7A 3RL0D 3C9IA 5AW3B 5KLVE 2OYIB 3VP9A 2UWJE 3CX5E 5TISH 2FBWC 2NZ2A 1N7SD 2HYNA 1MZ9A 1NTME 1OVVA 4WY4C 2A45I 1HVVA 3G3ZA 4PJ0H 1BE3G 1VDFA 3OA7A 3CXHE 3TNUB 1S4XA 2OGUA 3TNUA 4N78E 5GTHH 3RBZA 5KLVK 1HTLC 3AE3C 4DCKA 1SQBE 2IZ1A 3Q5PA 1LNQA 2AXTE 4N78D 1SFCB 1XTCC 2XV5A 3JCUH 3RGUA 1EDIA 2XZRA 1SQVE 2RH0A 2W90A 2FYZA 1JOCA 3AE5C 3BCCE 4H13B 1X22A 3MHVA 5AVRB 3H1KJ 1N73B 1FZCC 2KXPB 2P1JA 1RE3C 2KB7P 1L4AA 2FYUG 2P58A 2YO2A 1GK6A 2PFXA 4GIFA 3USSA 3V4WA 1NTMJ 3L71G 1OMIA 1YHQP 2WPVB 3CMEP 1A02J 1SQXJ 3HE4A 5APWA 4BXLA 5KLVG 5CMZA 2M5AB 1P84H 3V2NA 2B87A 2FXPA 2JO1A 4PV1C 5AVQB 1K73Q 2HLOA 2D2CC 3L75J 3MIWA 1EXIA 1JB0J 3LW5H 1GL2A 2JR8A 4C7NB 3S1KA 3E1RA 2QSIA 3I56P 3P8CD 1DEBA 1SQQK 2FYUJ 1GK4A 2W27A 1KQLA 1RH5B 2O1JA 3BRVB 1X79B 3GHGC 4H0LD 3B5NA 1BE3E 5AW9B 4BRYB 3CCQP 3CX5D 2PRRA 1JY3O 4D6TG 1HJ0A 4Y99B 1BE3D 4GDOA 2WPQA 2M5AA 3FX0A 1D7MA 1NTKG 1SQQE 3KZIH 2KSEA 3CWBE 4RESB 2JWDA 3K5BA 1L0LK 1AV1A 2H88C 2IZ0A 3JSVC 1FS0E 2N1TA 3A0HH 4JQ0D 1LTBC 1Y47A 3UIAA 1S9KD 1T2KC 1K9MQ 4UB8H 3WUTA 2QE7H 2IYPA 1IFPA 1NKZB 1NTZG 5B5EH 1LTSC 2C9LY 2LXBA 2WQYC 3RK2C 1JY3N 3H25A 2ZXXA 1NOHA 3HD7B 1L4AC 4Y28J 2XNDH 1NTZJ 2LKMA 3H1KD 3L70E 5AW7B 1T3JA 2N1TD 1YIJP 3Q2YA 1Q7YQ 5AW5B 1A02F 2V7QJ 3CMAP 5AW1B 3VP8A 2V4HA 2ZT9C 3BASA 5L8RJ 3TGUG 2SPZA 2Y9ZA 4JYBA 3VN0A 5KAIH 1JO5A 2E76D 3AEEC 1BSNA 3O6QA 3G71P 3P8CE 1VQMP 2QJPB 2XDJA 2Y0EA 2A06G 3RK3D 4U3FD 4O9BA 2ZYGA 3RL0C 2WWWA 2QRXA 4RJTA 1SQVG 3BCCG 1M1JA 1QX8A 3GF7A 4U3FE 1NU1K 3FGAD 3CXHI 1LT9B 4NPFX 1SQVD 2M3BA 3BCCD 1YJ9P 1S1CX 1L4AB 3L74G 3B8EB 3PLNA 1N7SB 3ZDMA 2Q1KA 1USEA 3MZWB 1H88A 4L74A 2R5DA 4WB4A 1YTZT 2W6JH 5AVXB 4OWFA 3V2QA 1KYOD 2K3RA 3KXDA 3RL0B 3VMZA 5KJ7D 4LC1A 3ABVC 1GZLA 1HUCA 1SQBK 2A06E 2QJKC 3F5HA 1TU3F 3OW2O 5TISE 1EXJA 2BEZF 1LWUC 1NKNA 2ITAA 1J1EB 2V7QH 1M57D 1GU5A 4IFMA 2NPSA 5CCGA 4BWNA 1H0TA 1S2EA 1NU1J 2LXCB 1DD3A 1L0NG 1JCDA 1LTJA 2WSCH 3P32A 3AECC 1S5LH 1M1KQ 1VQOP 1VQ8P 1AQ5A 1KILA 1L0ND 2WPRA 1IZNB 5H2FE 3OAKA 1IK7A 3D6YA 1FC2C 3AEGC 3B71A 2R32A 3GHGB 4XA4A 5AVVB 1WT6A 1YJWP 1NGMB 5AVUB 2K37A 1GW4A 1ZOYC 3F89A 1URQA 1AVYA 2FKWB 3HE5A 1RHZB 1QLED 2D2CB 2H8PD 1PV3A 3WUUA 3CWBD 1KC8Q 1PFIA 3RK3E 2O01H 1JMBA 3L74D 3B4SA 4H44D 2WT7B 1VQNP 2KLUA 4IL6X 4HH2A 1QGKB 4MN4C 1NTKJ 2KI7B 3AEFC 3IAOA 4KT0J 1OW7A 2P7JA 3MUDA 5E79E 1P84E 1ZRTD 3FXEA 2MJZA 1M56D 4WY4D 4A7PA 1SQQJ 2FYUK 1KB9I 1ZRTE 1KD1Q 1FE6A 1SQXD 2Z5IA 3E1IA 1G1JA 4OGQC 3H1KE 3L70D 2JKVA 3V6IA 5CBNA 3TF5A 1G2CB 2A06D 2YMYA 1HJBA 1MKMA 1OIPA 2H7HA 3H1LG 2HR3A 2A45H 2BCCG 1ZV8A 3MP7B 4HJGH 2AEMA 1Q82Q 2GA1A 3CC2P 1JEKA 1FDIA 2E75C 4L73A 2Q3EA 1L0NE 3PTZA 1GU4A 1J1EC 2H89C 4WY4B 1FZEA 2PP6A 3A0HE 2ZJSE 3KHUA 3WU2E 5BVZA 1IFDA 1VQ7P 2I1JA 1EDJA 1J2JB 2YNYA 1RF1C 5KAFE 1N73C 1BCCJ 2AEFA 3H1HG 1G2CA 1U7JA 2IX7C 1ZN5A 4H44B 3SFDC 4GODA 2FY8A 3RK2B 1H0TB 2G3AA 2NPSB 1LT1A 3MUDC 2D2CD 3IN6A 3L74E 3C1LA 4UB6E 4JF7A 1VQ9P 2N9BA 2N1TC 3CWBJ 5AW2B 1P84D 1QVFO 1FDMA 1BGYJ 1OWAA 4YXDC 1LTJC 2K1AA 1CSBA 3Q3DA 4W80A 2BEQD 3TYYA 1RQVA 4I1LA 1J1DC 1YBKA 2Y9YA 3JC22 2ZXEB 3TGUJ 2FYNC 5DJUB 3TSIA 2O3JA 4QMAA 1N7LA 3CX5I 3GHGA 1GW3A 4KJMA 4Y99C 1IFJA 1FZFA 2KS1A 3A0BH 5CJ0A 3HUSA 2E74D 1ZR4A 5AVSB 2Q7CA 1SQPD 3RL0g 2QJPC 1YQ4C 1BGYG 3SWFA 3AE4C 1JUNA 5CCHC 1SQBJ 4OVNF 3T97B 1WMKA 1YI2P 1L4AD 1N8RQ 1HF9A 2E74C 4R4MA 1EQ7A 2E75B 4R4LA 1FOSF 4RO0A 1NAYA 3CCMP 2OTLP 4N3YB 3L72J 3HTKA 2OYOA 3AE8C 3I5CA 3LIEA 1JNMA 3RK3B 1M1JC 2NRGA 1PP9D 3D71A 1KYOI 1KILD 2BCCE 2E76B 4GOFA 4W7YA 1N2DC 2QM7A 1CI6B 2E74B 1P84I 4PV1D 5H2FH 1HGZA 1KORA 1QL1A 3NFQA 4KHXA 1KILE 4ZNCA 2FFDB 1RF0C 1EZVG 3M9BA 1S72P 2M0BA 1IJDB 3PRJA 1M1JB 4H0LC 5B66E 3CCUP 1VF5B 3AEDC 3HD7D 1NH4A 2I8DA 2R5BA 4EI2A 1NYHA 1R5SA 1L0LD 1Y8AA 3B5NB 4WWIA 3A3YB 4BRYA 2QJYB 2P67A 3TGUD 2M3EA 3WUVA 1L0LE 3L70G 2ZVNB 3PJSK 1URQC 4DT0A 4PD4H 4EOTA 2L91A 5APQA 2E42A 2Z4EA 3VMAA 2ZYDA 2WSCJ 2K9YA 3H1KG 3II6A 3M9HA 4YPCA 1G1IA 1KV4A 1BCCG 2FXOA 3SWYA 3HE4B 2Q5UA 2XU6A 1SFCC 2WTYA 1R5LA 3Q5RA 4B86A 1T6AA 3KDPB 2KP8A 4IFFA 3AE2C 5C39A 1VQLP 1UIIA 3CCLP 2CPSA 2O01J 2E76C 2W83C 4L76A 1KZUB 1K05A 5AW0B 1N73A 3HRNA 1KB9D 1X0TA 1PP9E 3N4XA 2MKVA 4U7JA 2QJKB 5KKZB 3OJAB 3VMYA 1KQSO 3CPWO 4PD4I 3LIDA 1N86A 1VPCA 2FXMA 1GDTA 3GG2A 3G4SP 3D6ZA 1SQXE 2PGDA 1PP9G 2IBZE 2OYHC 2IFNA 4I6MC 3M06A 4I2LC 4AUWA 2WT7A 1U57A 1M8OB 2HODA 1SQPE 3A7OA 1FBMA 1RQUA 1SQPG 1MUUA 2IPPA 5AW6B 3BATA 2XKMA 3HE5B 4UB6H 4C7NA 1LTGC 2OQQA 1YYCA 4PV1B 2WSSH 3H1HE 1DEEG 1ZXGA 3AE6C 1JTHB 3H1IE 5AW4B 2B87B 2J58A 1OZHA 1LWUB 1OXZA 2Q3IA 3L35A 3TDKA 2VRSA 3H1JG 3R2PA 1EDLA 3H1ID 1JCCA 1T3UA 4OH8B 2Q9IA 1FZAA 1IFMA 2BCCD 3CLQA 2O01N 2E75D 3PHLA 3I55P 2W6BA 5K5GB 4TT3H 2OYHA 1KMIZ 4Z1MH 3H1LE 1SS1A 2IBZG 1VQ5P 1EZVD 2P2UA 1BDDA 1LTIC 1LT9C 2YIUB 2WVRA 3HTKB 1SFCA 2OTJP 2BCCJ 1KFNA 1NTMG 3CXHH 3G6EP 2Y0CA 1GTWA 1NJIQ 2KLVA 5GTHE 1RF1B 4K35A 1L0LG 2ZAEB 3BVHA 5GTIH 1AFOA 3TGUE 3EFGA 1U7MA 2AXCA 2O1KA 1UIXA 2C0WA 3L71D 1LWUA 4HYTB 1N7SC 5APUA 1E79H 3HUSB 3LW5J 1USDA 1SVFA 3VMXA 2ZVOB 4AYCA 2OYIA 4C46A 1CW5A 4LGDE 3L71E 3O6QB 2KNCB 1M7LA 3CCEP 1PL5A 2JWAA 3L72G 2HODB 1NAFA 1KFMA 1RE4C 2IFMA 3H1HD 4L75A 4XFJA 3V5BA 2YXRB 1YQ3C 1RF1A 3M91A 4NPDA 3S9OA 4TLFA 5AVTB 1NHLA 3WMM0 1S5LE 1FZCA 1K8AQ 4C7RA 3Q1MA 3HD7A 3IFMA 4H44C 4M3LA 4PD4D 1NO4A 1M90Q 1OX3A 3H1JE 1HH0A 3IR9A 3E7KA 4HKZH 2KZJA 1CZQA 2KSJA 3H1LD 4RKUJ 2JEEA 3CC4P 3H1IG 2IBZD 1T2KD 1EZVE 1LP1A 1GD2E 1L0NJ 2N1TB 2YKPA 2WSEJ 2WSFH 3CL3D 3N7NA 2Z5HA 4ZMDA 3CCRP 3MGNA 1LJ2A 3NMDA 1T8ZA 2B89A 4ZKPA 1XTGB 1JTHA 3CD6P 1GMJA 2QG4A 1JY2O 2YKQA 3H1IJ 4I7ZB 1AA0A 4U3FG 1NWQA 3P7KA 3RK3C 1HWTC 4UB8E 5BU8B 2N9YB 2J59M 3EFFK 4LLHA 3GW6A 3L74J 1KTMA 2GM4A 2WSEH 2WSFJ 3L4FA 3SSUA 5CCHA 2OYIC 1Q90D 5APTA 1YJNP 1DIPA 1Q2NA 1GL2B 4H13C 1HGVA 1SQVJ 1ZLLA 3BCCJ 5KJ7C 1JY2N 1NVOA 1RY3A 1YITP 1BGYE 3S4RA 1JMMA 1FDOA 3NXSA 1JY2P 3U59A 3GF3A 1IO4A 3TK1A 4H0LB 3CC7P 4U3FJ 1BGYD 5KLIB 2FFDA 1BE3J 1L0NK 2CPBA 1FZBA 3MD0A 3VOPA 5CCHD 1BDCA 5KAIE 3L72D 2LR2A 3L37A 1EZVI 2KYVA 4HB1A 3AEAC 3PH0A 1K04A 1KB9E 1LGHB 2RN0A 1PP9J 1DD4A 1PGQA 1SQXG 3B5ND 3L72E 3R4YA 5KLVJ 3CCJP 3EWKA 2HG5D 1VF5D 2B9BA 2K9JB 2OARA 2ZFCA 4IL6E 5APXA 1Y9BA 3W68A 4EYYQ 2JP3A 1ZMEC 2ZT9D 2E43A 3B5NC 4YTPC 1KYOH 1NU1E 4DOJA 4WBAA 4D6TD 1NU1G 1SQQG 1AVOA 1QVGO 1SP4A 2WPSA 1BCCD 2BASA 2Y0DA 1NU1D 4ASWA 3CI9A 4D6TE 4CPGA 1KILB 1FJPA 2KOGA 1JY3P 2KS1B 1BCCE 3H6PA 4XE5B 3CXHD 2L5GB 2YIUC 2KK7A 5AVWB 1PGPA 3SWKA 2QA4P 3HD7C 2KUBA 3M9QA 3PP5A 5TJHA 1X9VA 2WITA 5CHXA 1LTAC 3H1JJ 2KIKA 2YO3A 5GTIE 4WVZA 4GT1A 1NTKE 3A0BE 3EQ2A 3M0AA 1W2EA 5AVZB 3SFEC 3CX5H 3L70J 1CI6A 3H1HJ 4ASVA 2H43A 5APYA 2QM8A 2W6AA 1IFIA 3L75G 1LTTC 1NTKD 4PJ0E 1FJKA 1NTZD 1S3JA 1ZW0A 1IK9A 2DW3A 2QVAA 2FYUE 3L75D 4GKGA 2R3CA 3L73E 2QEXP 3A2AA 1ZR2A 1L0LJ 4EDFA 1YTZI 1RE4A 2YMKA 2ZT9B 1PPJD 3MTUE 4OGQD 3NTNA 1ZP0C 2AXTH 5E79H 3H32B 1PPJG 3JCUE 2C9NY 2IBZI 1WRGA 1PPJE 2B88A 3H1LJ 4GOEA 3T97A 2HPCB 2K88A 3L36A 1VQ6P 4DZOA 2KZIA 2GUVA 2A45G 4AQRD 4DJGA 1OVUA 3AE9C 3CCVP 1FZGA 2XNXA 3A5TA 3BRTB 5APVA 2Q6QA 3W67A 1GL2C 1DH3A
chains in the Genus database with same CATH topology
3L71D 2RN0A 4RJTA 1NTMD 5KLVD 1SQQD 2Q3EA 3PTZA 2O3JA 1SQVD 3BCCD 3TDKA 3PLNA 2K9JB 2QG4A 3CWBD 1KB9D 2KNCB 3FWLA 1NTKD 2JWAA 2BCCD 2QJKB 1NTZD 2KS1A 3H1HD 3KHUA 3L74D 3PHLA 3L75D 2N9YB 1KYOD 3PRJA 4U3FD 1SQBD 1SQPD 3GW6A 3ITKA 4D6TD 4EDFA 3H1KD 3GG2A 1L0LD 5KKZB 1PPJD 1ZRTD 1BCCD 3H1JD 2Y0DA 1NU1D 1EZVD 2QJYB 2YIUB 3L72D 3TGUD 4A7PA 3L73D 2FYUD 3CX5D 2L91A 1SQXD 4PD4D 2Y0CA 3CXHD 2RMZA 3L70D 3VMAA 3TF5A 1L0ND 1P84D 1BE3D 1BGYD 2A06D 3H1LD 5TJHA 5KLIB 2IBZD 2QJPB 2Y0EA 1PP9D 2FYNB 3H1ID
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L71 D;  2RN0 A;  4RJT A;  1NTM D;  5KLV D;  1SQQ D;  2Q3E A;  3PTZ A;  2O3J A;  1SQV D;  3BCC D;  3TDK A;  3PLN A;  2K9J B;  2QG4 A;  3CWB D;  1KB9 D;  2KNC B;  3FWL A;  1NTK D;  2JWA A;  2BCC D;  2QJK B;  1NTZ D;  2KS1 A;  3H1H D;  3KHU A;  3L74 D;  3PHL A;  3L75 D;  2N9Y B;  1KYO D;  3PRJ A;  4U3F D;  1SQB D;  1SQP D;  3GW6 A;  3ITK A;  4D6T D;  4EDF A;  3H1K D;  3GG2 A;  1L0L D;  5KKZ B;  1PPJ D;  1ZRT D;  1BCC D;  3H1J D;  2Y0D A;  1NU1 D;  1EZV D;  2QJY B;  2YIU B;  3L72 D;  3TGU D;  4A7P A;  3L73 D;  2FYU D;  3CX5 D;  2L91 A;  1SQX D;  4PD4 D;  2Y0C A;  3CXH D;  2RMZ A;  3L70 D;  3VMA A;  3TF5 A;  1L0N D;  1P84 D;  1BE3 D;  1BGY D;  2A06 D;  3H1L D;  5TJH A;  5KLI B;  2IBZ D;  2QJP B;  2Y0E A;  1PP9 D;  2FYN B;  3H1I D; 
#chains in the Genus database with same CATH topology
 1EDK A;  2K9J A;  1KQF B;  1NTM K;  3KYQ A;  4I7Z C;  2NPS D;  5CCG D;  1EC5 A;  3RK2 D;  1SQQ D;  1OFC X;  1SQX K;  1QEX A;  5B66 H;  1BSH A;  2PAJ A;  1KIL C;  1GL2 D;  4EIJ A;  1S9K E;  1OW8 A;  1MFT A;  1SQB G;  2IDB A;  1MFZ A;  1W5C E;  2NPS C;  5CCG C;  1PGJ A;  2HFE D;  2WZ7 A;  1RE3 A;  3ITK A;  2QIW A;  4JBZ A;  3WU2 H;  2JJL A;  5AW8 B;  4PD4 E;  1SLQ A;  2E5Y A;  2CK3 H;  3G9R A;  3H1J D;  3V2R A;  1URQ D;  2W8Z A;  3L73 G;  3QH9 A;  5CBO A;  5KAF H;  3U1C A;  1FU1 A;  1NTZ E;  3FWN A;  1VQP P;  5DJT B;  2YXQ B;  2FYU D;  3C8V A;  3IF4 A;  3KZI E;  2OTK E;  3L75 E;  1Q81 Q;  1AQT A;  2QJY C;  2RMZ A;  4N6J A;  5CJ4 A;  2GUS A;  4IOI H;  5M1B A;  1RF0 A;  1URQ B;  1JM0 A;  3GMA A;  3CWB G;  3Q5S A;  3V2P A;  2C0X A;  2FYN B;  1Q86 Q;  1VF5 C;  5AVY B;  1DX7 A;  5BU5 A;  3CCS P;  1W2B O;  1IC2 A;  1PGO A;  2E5T A;  3RBX A;  5B5E E;  4WY4 A;  2IYO A;  5EFW B;  1NTM D;  2J5U A;  4IFD K;  2I1K A;  2JDI H;  3O8Z A;  2POH A;  1VL2 A;  1SFC D;  1Z56 A;  1R8E A;  1KB9 H;  3D70 A;  3FWL A;  1HBW A;  1E5W A;  3HUS C;  1H8A A;  5KTB A;  4D6T J;  3AEB C;  2HPC A;  1KN7 A;  3GLM A;  3M0D C;  1NTZ K;  3H32 A;  1SQB D;  5KLI C;  3V4Q A;  3VYI A;  4H13 D;  1SQP K;  4IL6 H;  1LTJ B;  2YKO A;  4JPZ B;  5APS A;  3QWO C;  4W7Z A;  1LP1 B;  1J1D B;  1KYO E;  2R44 A;  3L73 D;  4JYC A;  2M8R A;  1X8Y A;  1OW6 A;  1FZC B;  1H89 A;  2OYH B;  3AE7 C;  3KQG A;  5KKZ C;  1OVR A;  1KQG B;  2R3S A;  1NTK K;  1VQ4 P;  1L2P A;  1FAV A;  1IFN A;  2AEJ A;  4ZKU A;  1PZQ A;  2G8Y A;  3AE1 C;  3P8M C;  1N7S A;  1MV8 A;  2RKL A;  4OGQ B;  3L71 J;  3U1A A;  2KNC A;  2WMM A;  1SQP J;  2FFD C;  1LT9 A;  2P10 A;  3FXD A;  1QL2 A;  3M0D A;  3VTP C;  3L73 J;  1S5L X;  2ZYA A;  4YXW H;  5KLV D;  1FOS E;  1VQK P;  1SQV K;  4K3A A;  4NPE A;  1PIX A;  1AJY A;  3KPE A;  5KJ7 A;  3RL0 D;  3C9I A;  5AW3 B;  5KLV E;  2OYI B;  3VP9 A;  2UWJ E;  3CX5 E;  5TIS H;  2FBW C;  2NZ2 A;  1N7S D;  2HYN A;  1MZ9 A;  1NTM E;  1OVV A;  4WY4 C;  2A45 I;  1HVV A;  3G3Z A;  4PJ0 H;  1BE3 G;  1VDF A;  3OA7 A;  3CXH E;  3TNU B;  1S4X A;  2OGU A;  3TNU A;  4N78 E;  5GTH H;  3RBZ A;  5KLV K;  1HTL C;  3AE3 C;  4DCK A;  1SQB E;  2IZ1 A;  3Q5P A;  1LNQ A;  2AXT E;  4N78 D;  1SFC B;  1XTC C;  2XV5 A;  3JCU H;  3RGU A;  1EDI A;  2XZR A;  1SQV E;  2RH0 A;  2W90 A;  2FYZ A;  1JOC A;  3AE5 C;  3BCC E;  4H13 B;  1X22 A;  3MHV A;  5AVR B;  3H1K J;  1N73 B;  1FZC C;  2KXP B;  2P1J A;  1RE3 C;  2KB7 P;  1L4A A;  2FYU G;  2P58 A;  2YO2 A;  1GK6 A;  2PFX A;  4GIF A;  3USS A;  3V4W A;  1NTM J;  3L71 G;  1OMI A;  1YHQ P;  2WPV B;  3CME P;  1A02 J;  1SQX J;  3HE4 A;  5APW A;  4BXL A;  5KLV G;  5CMZ A;  2M5A B;  1P84 H;  3V2N A;  2B87 A;  2FXP A;  2JO1 A;  4PV1 C;  5AVQ B;  1K73 Q;  2HLO A;  2D2C C;  3L75 J;  3MIW A;  1EXI A;  1JB0 J;  3LW5 H;  1GL2 A;  2JR8 A;  4C7N B;  3S1K A;  3E1R A;  2QSI A;  3I56 P;  3P8C D;  1DEB A;  1SQQ K;  2FYU J;  1GK4 A;  2W27 A;  1KQL A;  1RH5 B;  2O1J A;  3BRV B;  1X79 B;  3GHG C;  4H0L D;  3B5N A;  1BE3 E;  5AW9 B;  4BRY B;  3CCQ P;  3CX5 D;  2PRR A;  1JY3 O;  4D6T G;  1HJ0 A;  4Y99 B;  1BE3 D;  4GDO A;  2WPQ A;  2M5A A;  3FX0 A;  1D7M A;  1NTK G;  1SQQ E;  3KZI H;  2KSE A;  3CWB E;  4RES B;  2JWD A;  3K5B A;  1L0L K;  1AV1 A;  2H88 C;  2IZ0 A;  3JSV C;  1FS0 E;  2N1T A;  3A0H H;  4JQ0 D;  1LTB C;  1Y47 A;  3UIA A;  1S9K D;  1T2K C;  1K9M Q;  4UB8 H;  3WUT A;  2QE7 H;  2IYP A;  1IFP A;  1NKZ B;  1NTZ G;  5B5E H;  1LTS C;  2C9L Y;  2LXB A;  2WQY C;  3RK2 C;  1JY3 N;  3H25 A;  2ZXX A;  1NOH A;  3HD7 B;  1L4A C;  4Y28 J;  2XND H;  1NTZ J;  2LKM A;  3H1K D;  3L70 E;  5AW7 B;  1T3J A;  2N1T D;  1YIJ P;  3Q2Y A;  1Q7Y Q;  5AW5 B;  1A02 F;  2V7Q J;  3CMA P;  5AW1 B;  3VP8 A;  2V4H A;  2ZT9 C;  3BAS A;  5L8R J;  3TGU G;  2SPZ A;  2Y9Z A;  4JYB A;  3VN0 A;  5KAI H;  1JO5 A;  2E76 D;  3AEE C;  1BSN A;  3O6Q A;  3G71 P;  3P8C E;  1VQM P;  2QJP B;  2XDJ A;  2Y0E A;  2A06 G;  3RK3 D;  4U3F D;  4O9B A;  2ZYG A;  3RL0 C;  2WWW A;  2QRX A;  4RJT A;  1SQV G;  3BCC G;  1M1J A;  1QX8 A;  3GF7 A;  4U3F E;  1NU1 K;  3FGA D;  3CXH I;  1LT9 B;  4NPF X;  1SQV D;  2M3B A;  3BCC D;  1YJ9 P;  1S1C X;  1L4A B;  3L74 G;  3B8E B;  3PLN A;  1N7S B;  3ZDM A;  2Q1K A;  1USE A;  3MZW B;  1H88 A;  4L74 A;  2R5D A;  4WB4 A;  1YTZ T;  2W6J H;  5AVX B;  4OWF A;  3V2Q A;  1KYO D;  2K3R A;  3KXD A;  3RL0 B;  3VMZ A;  5KJ7 D;  4LC1 A;  3ABV C;  1GZL A;  1HUC A;  1SQB K;  2A06 E;  2QJK C;  3F5H A;  1TU3 F;  3OW2 O;  5TIS E;  1EXJ A;  2BEZ F;  1LWU C;  1NKN A;  2ITA A;  1J1E B;  2V7Q H;  1M57 D;  1GU5 A;  4IFM A;  2NPS A;  5CCG A;  4BWN A;  1H0T A;  1S2E A;  1NU1 J;  2LXC B;  1DD3 A;  1L0N G;  1JCD A;  1LTJ A;  2WSC H;  3P32 A;  3AEC C;  1S5L H;  1M1K Q;  1VQO P;  1VQ8 P;  1AQ5 A;  1KIL A;  1L0N D;  2WPR A;  1IZN B;  5H2F E;  3OAK A;  1IK7 A;  3D6Y A;  1FC2 C;  3AEG C;  3B71 A;  2R32 A;  3GHG B;  4XA4 A;  5AVV B;  1WT6 A;  1YJW P;  1NGM B;  5AVU B;  2K37 A;  1GW4 A;  1ZOY C;  3F89 A;  1URQ A;  1AVY A;  2FKW B;  3HE5 A;  1RHZ B;  1QLE D;  2D2C B;  2H8P D;  1PV3 A;  3WUU A;  3CWB D;  1KC8 Q;  1PFI A;  3RK3 E;  2O01 H;  1JMB A;  3L74 D;  3B4S A;  4H44 D;  2WT7 B;  1VQN P;  2KLU A;  4IL6 X;  4HH2 A;  1QGK B;  4MN4 C;  1NTK J;  2KI7 B;  3AEF C;  3IAO A;  4KT0 J;  1OW7 A;  2P7J A;  3MUD A;  5E79 E;  1P84 E;  1ZRT D;  3FXE A;  2MJZ A;  1M56 D;  4WY4 D;  4A7P A;  1SQQ J;  2FYU K;  1KB9 I;  1ZRT E;  1KD1 Q;  1FE6 A;  1SQX D;  2Z5I A;  3E1I A;  1G1J A;  4OGQ C;  3H1K E;  3L70 D;  2JKV A;  3V6I A;  5CBN A;  3TF5 A;  1G2C B;  2A06 D;  2YMY A;  1HJB A;  1MKM A;  1OIP A;  2H7H A;  3H1L G;  2HR3 A;  2A45 H;  2BCC G;  1ZV8 A;  3MP7 B;  4HJG H;  2AEM A;  1Q82 Q;  2GA1 A;  3CC2 P;  1JEK A;  1FDI A;  2E75 C;  4L73 A;  2Q3E A;  1L0N E;  3PTZ A;  1GU4 A;  1J1E C;  2H89 C;  4WY4 B;  1FZE A;  2PP6 A;  3A0H E;  2ZJS E;  3KHU A;  3WU2 E;  5BVZ A;  1IFD A;  1VQ7 P;  2I1J A;  1EDJ A;  1J2J B;  2YNY A;  1RF1 C;  5KAF E;  1N73 C;  1BCC J;  2AEF A;  3H1H G;  1G2C A;  1U7J A;  2IX7 C;  1ZN5 A;  4H44 B;  3SFD C;  4GOD A;  2FY8 A;  3RK2 B;  1H0T B;  2G3A A;  2NPS B;  1LT1 A;  3MUD C;  2D2C D;  3IN6 A;  3L74 E;  3C1L A;  4UB6 E;  4JF7 A;  1VQ9 P;  2N9B A;  2N1T C;  3CWB J;  5AW2 B;  1P84 D;  1QVF O;  1FDM A;  1BGY J;  1OWA A;  4YXD C;  1LTJ C;  2K1A A;  1CSB A;  3Q3D A;  4W80 A;  2BEQ D;  3TYY A;  1RQV A;  4I1L A;  1J1D C;  1YBK A;  2Y9Y A;  3JC2 2;  2ZXE B;  3TGU J;  2FYN C;  5DJU B;  3TSI A;  2O3J A;  4QMA A;  1N7L A;  3CX5 I;  3GHG A;  1GW3 A;  4KJM A;  4Y99 C;  1IFJ A;  1FZF A;  2KS1 A;  3A0B H;  5CJ0 A;  3HUS A;  2E74 D;  1ZR4 A;  5AVS B;  2Q7C A;  1SQP D;  3RL0 g;  2QJP C;  1YQ4 C;  1BGY G;  3SWF A;  3AE4 C;  1JUN A;  5CCH C;  1SQB J;  4OVN F;  3T97 B;  1WMK A;  1YI2 P;  1L4A D;  1N8R Q;  1HF9 A;  2E74 C;  4R4M A;  1EQ7 A;  2E75 B;  4R4L A;  1FOS F;  4RO0 A;  1NAY A;  3CCM P;  2OTL P;  4N3Y B;  3L72 J;  3HTK A;  2OYO A;  3AE8 C;  3I5C A;  3LIE A;  1JNM A;  3RK3 B;  1M1J C;  2NRG A;  1PP9 D;  3D71 A;  1KYO I;  1KIL D;  2BCC E;  2E76 B;  4GOF A;  4W7Y A;  1N2D C;  2QM7 A;  1CI6 B;  2E74 B;  1P84 I;  4PV1 D;  5H2F H;  1HGZ A;  1KOR A;  1QL1 A;  3NFQ A;  4KHX A;  1KIL E;  4ZNC A;  2FFD B;  1RF0 C;  1EZV G;  3M9B A;  1S72 P;  2M0B A;  1IJD B;  3PRJ A;  1M1J B;  4H0L C;  5B66 E;  3CCU P;  1VF5 B;  3AED C;  3HD7 D;  1NH4 A;  2I8D A;  2R5B A;  4EI2 A;  1NYH A;  1R5S A;  1L0L D;  1Y8A A;  3B5N B;  4WWI A;  3A3Y B;  4BRY A;  2QJY B;  2P67 A;  3TGU D;  2M3E A;  3WUV A;  1L0L E;  3L70 G;  2ZVN B;  3PJS K;  1URQ C;  4DT0 A;  4PD4 H;  4EOT A;  2L91 A;  5APQ A;  2E42 A;  2Z4E A;  3VMA A;  2ZYD A;  2WSC J;  2K9Y A;  3H1K G;  3II6 A;  3M9H A;  4YPC A;  1G1I A;  1KV4 A;  1BCC G;  2FXO A;  3SWY A;  3HE4 B;  2Q5U A;  2XU6 A;  1SFC C;  2WTY A;  1R5L A;  3Q5R A;  4B86 A;  1T6A A;  3KDP B;  2KP8 A;  4IFF A;  3AE2 C;  5C39 A;  1VQL P;  1UII A;  3CCL P;  2CPS A;  2O01 J;  2E76 C;  2W83 C;  4L76 A;  1KZU B;  1K05 A;  5AW0 B;  1N73 A;  3HRN A;  1KB9 D;  1X0T A;  1PP9 E;  3N4X A;  2MKV A;  4U7J A;  2QJK B;  5KKZ B;  3OJA B;  3VMY A;  1KQS O;  3CPW O;  4PD4 I;  3LID A;  1N86 A;  1VPC A;  2FXM A;  1GDT A;  3GG2 A;  3G4S P;  3D6Z A;  1SQX E;  2PGD A;  1PP9 G;  2IBZ E;  2OYH C;  2IFN A;  4I6M C;  3M06 A;  4I2L C;  4AUW A;  2WT7 A;  1U57 A;  1M8O B;  2HOD A;  1SQP E;  3A7O A;  1FBM A;  1RQU A;  1SQP G;  1MUU A;  2IPP A;  5AW6 B;  3BAT A;  2XKM A;  3HE5 B;  4UB6 H;  4C7N A;  1LTG C;  2OQQ A;  1YYC A;  4PV1 B;  2WSS H;  3H1H E;  1DEE G;  1ZXG A;  3AE6 C;  1JTH B;  3H1I E;  5AW4 B;  2B87 B;  2J58 A;  1OZH A;  1LWU B;  1OXZ A;  2Q3I A;  3L35 A;  3TDK A;  2VRS A;  3H1J G;  3R2P A;  1EDL A;  3H1I D;  1JCC A;  1T3U A;  4OH8 B;  2Q9I A;  1FZA A;  1IFM A;  2BCC D;  3CLQ A;  2O01 N;  2E75 D;  3PHL A;  3I55 P;  2W6B A;  5K5G B;  4TT3 H;  2OYH A;  1KMI Z;  4Z1M H;  3H1L E;  1SS1 A;  2IBZ G;  1VQ5 P;  1EZV D;  2P2U A;  1BDD A;  1LTI C;  1LT9 C;  2YIU B;  2WVR A;  3HTK B;  1SFC A;  2OTJ P;  2BCC J;  1KFN A;  1NTM G;  3CXH H;  3G6E P;  2Y0C A;  1GTW A;  1NJI Q;  2KLV A;  5GTH E;  1RF1 B;  4K35 A;  1L0L G;  2ZAE B;  3BVH A;  5GTI H;  1AFO A;  3TGU E;  3EFG A;  1U7M A;  2AXC A;  2O1K A;  1UIX A;  2C0W A;  3L71 D;  1LWU A;  4HYT B;  1N7S C;  5APU A;  1E79 H;  3HUS B;  3LW5 J;  1USD A;  1SVF A;  3VMX A;  2ZVO B;  4AYC A;  2OYI A;  4C46 A;  1CW5 A;  4LGD E;  3L71 E;  3O6Q B;  2KNC B;  1M7L A;  3CCE P;  1PL5 A;  2JWA A;  3L72 G;  2HOD B;  1NAF A;  1KFM A;  1RE4 C;  2IFM A;  3H1H D;  4L75 A;  4XFJ A;  3V5B A;  2YXR B;  1YQ3 C;  1RF1 A;  3M91 A;  4NPD A;  3S9O A;  4TLF A;  5AVT B;  1NHL A;  3WMM 0;  1S5L E;  1FZC A;  1K8A Q;  4C7R A;  3Q1M A;  3HD7 A;  3IFM A;  4H44 C;  4M3L A;  4PD4 D;  1NO4 A;  1M90 Q;  1OX3 A;  3H1J E;  1HH0 A;  3IR9 A;  3E7K A;  4HKZ H;  2KZJ A;  1CZQ A;  2KSJ A;  3H1L D;  4RKU J;  2JEE A;  3CC4 P;  3H1I G;  2IBZ D;  1T2K D;  1EZV E;  1LP1 A;  1GD2 E;  1L0N J;  2N1T B;  2YKP A;  2WSE J;  2WSF H;  3CL3 D;  3N7N A;  2Z5H A;  4ZMD A;  3CCR P;  3MGN A;  1LJ2 A;  3NMD A;  1T8Z A;  2B89 A;  4ZKP A;  1XTG B;  1JTH A;  3CD6 P;  1GMJ A;  2QG4 A;  1JY2 O;  2YKQ A;  3H1I J;  4I7Z B;  1AA0 A;  4U3F G;  1NWQ A;  3P7K A;  3RK3 C;  1HWT C;  4UB8 E;  5BU8 B;  2N9Y B;  2J59 M;  3EFF K;  4LLH A;  3GW6 A;  3L74 J;  1KTM A;  2GM4 A;  2WSE H;  2WSF J;  3L4F A;  3SSU A;  5CCH A;  2OYI C;  1Q90 D;  5APT A;  1YJN P;  1DIP A;  1Q2N A;  1GL2 B;  4H13 C;  1HGV A;  1SQV J;  1ZLL A;  3BCC J;  5KJ7 C;  1JY2 N;  1NVO A;  1RY3 A;  1YIT P;  1BGY E;  3S4R A;  1JMM A;  1FDO A;  3NXS A;  1JY2 P;  3U59 A;  3GF3 A;  1IO4 A;  3TK1 A;  4H0L B;  3CC7 P;  4U3F J;  1BGY D;  5KLI B;  2FFD A;  1BE3 J;  1L0N K;  2CPB A;  1FZB A;  3MD0 A;  3VOP A;  5CCH D;  1BDC A;  5KAI E;  3L72 D;  2LR2 A;  3L37 A;  1EZV I;  2KYV A;  4HB1 A;  3AEA C;  3PH0 A;  1K04 A;  1KB9 E;  1LGH B;  2RN0 A;  1PP9 J;  1DD4 A;  1PGQ A;  1SQX G;  3B5N D;  3L72 E;  3R4Y A;  5KLV J;  3CCJ P;  3EWK A;  2HG5 D;  1VF5 D;  2B9B A;  2K9J B;  2OAR A;  2ZFC A;  4IL6 E;  5APX A;  1Y9B A;  3W68 A;  4EYY Q;  2JP3 A;  1ZME C;  2ZT9 D;  2E43 A;  3B5N C;  4YTP C;  1KYO H;  1NU1 E;  4DOJ A;  4WBA A;  4D6T D;  1NU1 G;  1SQQ G;  1AVO A;  1QVG O;  1SP4 A;  2WPS A;  1BCC D;  2BAS A;  2Y0D A;  1NU1 D;  4ASW A;  3CI9 A;  4D6T E;  4CPG A;  1KIL B;  1FJP A;  2KOG A;  1JY3 P;  2KS1 B;  1BCC E;  3H6P A;  4XE5 B;  3CXH D;  2L5G B;  2YIU C;  2KK7 A;  5AVW B;  1PGP A;  3SWK A;  2QA4 P;  3HD7 C;  2KUB A;  3M9Q A;  3PP5 A;  5TJH A;  1X9V A;  2WIT A;  5CHX A;  1LTA C;  3H1J J;  2KIK A;  2YO3 A;  5GTI E;  4WVZ A;  4GT1 A;  1NTK E;  3A0B E;  3EQ2 A;  3M0A A;  1W2E A;  5AVZ B;  3SFE C;  3CX5 H;  3L70 J;  1CI6 A;  3H1H J;  4ASV A;  2H43 A;  5APY A;  2QM8 A;  2W6A A;  1IFI A;  3L75 G;  1LTT C;  1NTK D;  4PJ0 E;  1FJK A;  1NTZ D;  1S3J A;  1ZW0 A;  1IK9 A;  2DW3 A;  2QVA A;  2FYU E;  3L75 D;  4GKG A;  2R3C A;  3L73 E;  2QEX P;  3A2A A;  1ZR2 A;  1L0L J;  4EDF A;  1YTZ I;  1RE4 A;  2YMK A;  2ZT9 B;  1PPJ D;  3MTU E;  4OGQ D;  3NTN A;  1ZP0 C;  2AXT H;  5E79 H;  3H32 B;  1PPJ G;  3JCU E;  2C9N Y;  2IBZ I;  1WRG A;  1PPJ E;  2B88 A;  3H1L J;  4GOE A;  3T97 A;  2HPC B;  2K88 A;  3L36 A;  1VQ6 P;  4DZO A;  2KZI A;  2GUV A;  2A45 G;  4AQR D;  4DJG A;  1OVU A;  3AE9 C;  3CCV P;  1FZG A;  2XNX A;  3A5T A;  3BRT B;  5APV A;  2Q6Q A;  3W67 A;  1GL2 C;  1DH3 A; 
#chains in the Genus database with same CATH homology
 3L71 D;  2RN0 A;  4RJT A;  1NTM D;  5KLV D;  1SQQ D;  2Q3E A;  3PTZ A;  2O3J A;  1SQV D;  3BCC D;  3TDK A;  3PLN A;  2K9J B;  2QG4 A;  3CWB D;  1KB9 D;  2KNC B;  3FWL A;  1NTK D;  2JWA A;  2BCC D;  2QJK B;  1NTZ D;  2KS1 A;  3H1H D;  3KHU A;  3L74 D;  3PHL A;  3L75 D;  2N9Y B;  1KYO D;  3PRJ A;  4U3F D;  1SQB D;  1SQP D;  3GW6 A;  3ITK A;  4D6T D;  4EDF A;  3H1K D;  3GG2 A;  1L0L D;  5KKZ B;  1PPJ D;  1ZRT D;  1BCC D;  3H1J D;  2Y0D A;  1NU1 D;  1EZV D;  2QJY B;  2YIU B;  3L72 D;  3TGU D;  4A7P A;  3L73 D;  2FYU D;  3CX5 D;  2L91 A;  1SQX D;  4PD4 D;  2Y0C A;  3CXH D;  2RMZ A;  3L70 D;  3VMA A;  3TF5 A;  1L0N D;  1P84 D;  1BE3 D;  1BGY D;  2A06 D;  3H1L D;  5TJH A;  5KLI B;  2IBZ D;  2QJP B;  2Y0E A;  1PP9 D;  2FYN B;  3H1I D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...