2KNCB

Platelet integrin alfaiib-beta3 transmembrane-cytoplasmic heterocomplex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
GAMGSKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Integrin alpha-IIb
publication title Structure of an integrin alphaIIb beta3 transmembrane-cytoplasmic heterocomplex provides insight into integrin activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08725 Integrin_b_cyt Integrin beta cytoplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2kncB00
2RMZA 1NU1D 1PPJD 1ZRTD 3ITKA 3KHUA 2QG4A 1L0LD 3BCCD 1SQBD 4PD4D 2QJPB 3TDKA 1NTKD 1SQPD 2YIUB 2QJYB 3L74D 2O3JA 5KLVD 5TJHA 1SQVD 2Y0CA 4U3FD 1L0ND 2KNCB 1PP9D 3GW6A 3PRJA 4EDFA 3VMAA 2FYNB 2Y0EA 1BCCD 1P84D 3PTZA 3CWBD 1SQXD 3PLNA 2RN0A 3H1JD 3L71D 4D6TD 3L72D 3L75D 1KB9D 2KS1A 3TGUD 3CXHD 4A7PA 2BCCD 2QJKB 3H1KD 3H1LD 1NTZD 2IBZD 2Q3EA 1BE3D 3TF5A 2A06D 5KKZB 2Y0DA 3FWLA 5KLIB 1SQQD 3L70D 3PHLA 1KYOD 1BGYD 4RJTA 2FYUD 3H1ID 2JWAA 2K9JB 3H1HD 3L73D 3CX5D 2N9YB 2L91A 1NTMD 3GG2A 1EZVD
chains in the Genus database with same CATH superfamily
3AE1C 2KK7A 1YJNP 4W7YA 3WU2H 3L71J 3KPEA 1OW6A 4KJMA 1QX8A 2E42A 2H88C 1KQLA 4H44B 2E76B 3B5ND 4LGDE 2E74C 5AVUB 5GTHH 1L0ND 2C9NY 1N7LA 2Q3IA 1GW3A 1CW5A 1SS1A 2Y0EA 1ZW0A 4XE5B 3TK1A 4C7NB 3AECC 1KILE 1LWUB 5DJUB 2E75D 3QH9A 2KS1A 2R44A 2O01J 2WPVB 2OTLP 2WVRA 3RBZA 2Q5UA 3RGUA 2K9YA 3L73J 1RF1C 1BSHA 3Q2YA 3AE4C 1J1DC 1Q2NA 2Z5IA 1L0LJ 3C9IA 2YKPA 3L73D 4ZKUA 1RF1A 2N9YB 1LT1A 3LW5J 4EYYQ 2WZ7A 1IO4A 3W68A 1EZVD 2Y9ZA 3ITKA 1U7MA 1ZN5A 1IFIA 1WMKA 4I7ZB 1L0LD 1VQ8P 2E74D 1P84H 2O1JA 3C1LA 2BEZF 5KLVD 1JY3N 2A45G 3WU2E 2Q6QA 3FXEA 2LR2A 1DEEG 1FZFA 3NTNA 2G3AA 3RL0g 1WRGA 4YXWH 5GTHE 2WQYC 1KB9D 1SQQJ 3L70J 5K5GB 1PFIA 3P8MC 3CX5H 3P32A 2JJLA 3G4SP 1BE3E 3CWBE 2C9LY 3H25A 3FWLA 2QE7H 1QLED 1SQQD 3L70D 4WBAA 2HFED 1VPCA 2JKVA 1PIXA 3GG2A 1AV1A 1HVVA 1ZRTD 3G71P 3MZWB 1JTHB 1HJBA 1URQC 3CMEP 2WPQA 2W27A 2E74B 3TDKA 2XKMA 3EWKA 1LTJC 1H89A 3H1HE 2WSSH 1BE3G 3CWBG 1AQTA 2E5TA 2B87A 2KS1B 3PJSK 1NOHA 2FBWC 1R5LA 1IFNA 3BVHA 1LTJA 1SQBE 2YO2A 3PH0A 2FXMA 3CI9A 1FJPA 3PTZA 1VDFA 1S4XA 5AW5B 1J1EC 3U59A 1JEKA 2KSEA 3R2PA 2KLUA 2BASA 2HPCA 2KYVA 4UB8H 1RF1B 1R5SA 2V7QJ 2PRRA 1FZEA 1QEXA 2O01N 1J1DB 4K35A 3H1HG 1CZQA 1AVYA 3CCEP 4H13C 2G8YA 2KSJA 3V4WA 3V5BA 3AE8C 1VQ6P 1NGMB 3PHLA 1PP9J 4N78D 1X22A 3CD6P 3JSVC 3WMM0 4RJTA 2R3SA 1SQBG 1T3UA 3RBXA 5CCGD 1LP1A 1VQ7P 3OAKA 3CX5E 1NTZE 2H8PD 3MUDC 4DZOA 3L74J 1M57D 1S2EA 4WB4A 2J5UA 2KI7B 2D2CC 1GK4A 3OA7A 4KHXA 3BCCE 3NMDA 1BGYE 2WTYA 1DEBA 1SFCC 3FWNA 3MUDA 3L74D 2HODA 1GU5A 5KJ7A 1KQSO 1AVOA 2B89A 4XA4A 2FY8A 1FZGA 2WT7A 2CK3H 3I5CA 3O8ZA 2YIUC 3GW6A 2OYIB 2GA1A 1LTGC 1JCCA 1E5WA 3V6IA 1SFCA 1S9KE 1BCCE 4PD4E 1N86A 1NJIQ 1NTZG 4GOEA 3LIDA 1UIXA 4R4MA 1KFMA 1R8EA 2PP6A 3BCCG 4BRYB 1K04A 2AXTH 5BU5A 4PV1C 1RE4C 3TNUA 3A7OA 1BGYG 2LXBA 3T97A 3FX0A 5CJ4A 2BCCD 3MIWA 3P8CD 3D6YA 3AEBC 1HWTC 1X0TA 1RE4A 2WITA 1NTMK 4UB8E 5DJTB 1M90Q 1BCCG 1T3JA 5KJ7D 1YJ9P 4XFJA 2E5YA 3VTPC 3A0HH 2D2CD 1SQQK 1GW4A 2OQQA 2K9JA 1LTJB 1SQPK 2YMYA 3GF3A 2P58A 2YXRB 4OGQD 1KYOE 3RK3D 1IFDA 2C0WA 5APTA 1DD3A 2KIKA 2HPCB 2FFDB 1SQVE 3GF7A 5AVXB 4Y28J 2XZRA 1S3JA 2O1KA 3PRJA 3VMAA 4PJ0H 1J1EB 3L72J 1KTMA 2IZ0A 2UWJE 3H1LJ 4H44D 3RK2C 2J59M 1SQXE 4HB1A 1SLQA 1QL1A 4OWFA 1OW7A 2GUSA 3L72D 1M56D 2SPZA 1JUNA 1QVFO 1NO4A 3AEGC 1MFTA 2WPSA 3H1LD 1IZNB 2IBZD 2Q3EA 2CPSA 1QL2A 1SQVG 5H2FE 2Y0DA 4N6JA 2E43A 2K88A 2QJKC 3I55P 1M1JC 2HODB 5APXA 4YTPC 2AXTE 3V2QA 3LW5H 1RH5B 1ZOYC 3AEFC 1NAYA 4JQ0D 2D2CB 3M9BA 2ZYAA 2WT7B 4IFFA 2W83C 1SQXG 1IFJA 5AW2B 1M1JA 1MUUA 2WSCJ 4U3FJ 3GMAA 4OGQB 1JY2N 1HGVA 5CJ0A 2W6AA 2YIUB 2HLOA 3V2RA 2FXOA 3A0BE 3A2AA 2ZYGA 1OVVA 3CLQA 3K5BA 1SVFA 4O9BA 1VQKP 4BXLA 2Y0CA 4U3FD 1KILC 1L0NE 5B5EH 1VQPP 1KB9H 3CL3D 1G2CA 4D6TJ 1X8YA 3HE4A 1NTKE 2JP3A 2MJZA 3H1KJ 1KILA 1K8AQ 2RH0A 5C39A 2FYNC 1G1IA 2FKWB 3L71D 4D6TD 2JDIH 4LLHA 5AVRB 1EDLA 2M3EA 4WY4D 4PJ0E 4IOIH 3RL0D 1KN7A 3H1KD 3M06A 1EDJA 3KZIE 1LT9B 4RESB 2KLVA 3HD7C 1Y9BA 2FYUK 4KT0J 3HE5A 1L0NG 3VOPA 2N1TC 3BATA 4QMAA 4K3AA 1NU1K 1NTKG 2PGDA 1IFPA 1MZ9A 3AE2C 3HD7A 1EZVE 2GM4A 2N1TA 3CXHI 2MKVA 1W2EA 1L0LE 1FOSE 1L4AC 1Y8AA 2AEFA 1FAVA 2VRSA 3GHGC 3PP5A 4DCKA 2AEMA 1ZP0C 5KLVE 2NPSC 1BSNA 1KYOI 1L4AA 2Q1KA 1KD1Q 2IBZI 3GHGA 3ZDMA 1A02J 3Q1MA 3IR9A 2NPSA 1EZVG 2ITAA 1NKZB 1PL5A 1VF5C 4YXDC 1M1KQ 3HTKA 2RKLA 2V7QH 2QIWA 3IFMA 1L0LG 4ZMDA 5B5EE 4WY4B 1KB9E 1T2KC 3RL0B 2QJKB 5AW4B 3JCUH 4MN4C 1H88A 1ZLLA 4WWIA 1M1JB 1DD4A 5KLVG 1VQNP 4JYCA 5APQA 2L5GB 1NTMJ 5CBNA 1NKNA 1X9VA 2A06D 4U7JA 3CCQP 1PGQA 1M8OB 4ASWA 1Z56A 3VMXA 2I8DA 1SQPJ 1NTMD 5GTIH 1JOCA 1HF9A 3HUSC 1GL2C 1CSBA 1G2CB 3KDPB 1DIPA 2ZT9C 2YXQB 3KHUA 2QG4A 3HE4B 5TISH 3FXDA 1LGHB 2KUBA 2H89C 1SQPD 2NPSD 4Z1MH 1CI6A 3HUSA 1EC5A 1GL2A 3BASA 3CWBJ 3NXSA 3Q5RA 1FOSF 3L4FA 3M0AA 1BDCA 2FYNB 1J2JB 2J58A 3L75J 1FZCC 5APVA 1K73Q 1VF5D 3TGUJ 3FGAD 1YITP 3HE5B 3AE7C 1YJWP 3CWBD 5APUA 3WUTA 3E7KA 1URQA 4IFMA 2M3BA 3L75D 3CC7P 1FZCA 2WSEJ 3TGUD 3G6EP 1U7JA 3H1HJ 1P84E 1VQLP 2N9BA 3CCRP 3H1JE 3MTUE 4N78E 4OVNF 2KOGA 5AW1B 1S1CX 1GL2D 1SQBJ 3H1HD 1EXJA 3M0DC 3JCUE 1RQUA 5APSA 1BDDA 1PV3A 1QVGO 1FS0E 1S5LX 2QJYC 5KAIH 1YTZT 3USSA 2QRXA 2PFXA 1VQMP 1SQBD 2NPSB 1JB0J 3M0DA 4I2LC 1OXZA 2IYOA 2A45I 5GTIE 1URQD 5TJHA 2ZVNB 1K9MQ 1OFCX 1HH0A 3NFQA 3H1JG 2QEXP 1PP9D 3AE5C 2YKOA 1FDMA 1VF5B 4JPZB 3M9HA 3EFGA 3EFFK 2YMKA 4C7RA 3PLNA 4HJGH 1NTZJ 1YTZI 3A5TA 4NPEA 1NWQA 1T6AA 1BGYJ 2FYUJ 1EXIA 5CCHC 1IJDB 2BCCE 3H1IJ 1NTZD 5AVVB 3L74G 5AW6B 1JM0A 2Y9YA 1JO5A 4GDOA 1NU1J 2K1AA 5AVYB 3G9RA 4C46A 3B71A 1CI6B 1IK9A 4EOTA 5AVZB 1RQVA 1GL2B 1BGYD 2FYUD 4GKGA 3H1ID 5CCHA 4H13D 2OARA 4LC1A 1NU1D 4TLFA 3M91A 2WSCH 2B88A 1HTLC 4N3YB 1VQOP 2Q9IA 1JY3P 1S9KD 4PD4D 1FDIA 2B87B 3TSIA 2BCCG 3RK3E 2K3RA 1URQB 3E1RA 1GMJA 2IPPA 4L74A 2I1JA 3AEEC 3SFEC 3OW2O 1NHLA 1T8ZA 1JMMA 3U1CA 1SFCD 1LWUC 3VP9A 1S72P 2R5DA 3CCJP 1FE6A 1SP4A 4H0LC 2ZFCA 4OH8B 5AVWB 2ZVOB 1H0TA 2NZ2A 1KFNA 2OTJP 3BRTB 3H6PA 2IDBA 1LWUA 3L72E 1KZUB 4YPCA 1MV8A 1VQ9P 4DJGA 4L76A 3CXHD 1LNQA 3H1LE 2P67A 3AE6C 1N7SC 2IX7C 1RF0C 2M8RA 3KYQA 3AE9C 1AJYA 1NYHA 4PV1D 1N8RQ 2W6BA 3GLMA 2O01H 2WPRA 1LP1B 1KYOD 4H13B 4NPDA 1IFMA 1N7SA 4I7ZC 1RF0A 1RE3C 1PPJD 1NH4A 3G3ZA 3P7KA 2R32A 3F89A 3L72G 3C8VA 3B5NC 1NAFA 4Y99C 2R3CA 4CPGA 2OYHC 3H1LG 1YQ4C 1RE3A 5CBOA 2DW3A 2KZIA 2O3JA 3V2PA 2W8ZA 3II6A 1HJ0A 1SQBK 2QJPC 3B5NA 1SFCB 2LKMA 3CX5I 2E75C 2OYHA 1OMIA 2LXCB 1FJKA 1KQGB 3EQ2A 1LTTC 1JY2O 3A0HE 2WSFJ 1GK6A 3TNUB 3L71E 4D6TE 3T97B 3L36A 1NVOA 2QA4P 1N7SD 5AVSB 1ZMEC 3S1KA 2KNCA 3RK2D 4EIJA 5AW3B 2R5BA 4A7PA 2JWDA 1UIIA 3E1IA 3CCVP 4PV1B 1KV4A 3AE3C 4TT3H 1HUCA 1Q7YQ 2KP8A 4U3FG 3BRVB 4PD4I 1VQ4P 1L0NJ 1KC8Q 4RO0A 2JR8A 1NTZK 3IAOA 3JC22 2JWAA 5AW0B 3MHVA 2K9JB 1LJ2A 1AA0A 1PGOA 1X79B 1NTKJ 3V4QA 3CCLP 3L71G 2AEJA 4D6TG 1OVRA 1H0TB 1JTHA 1NTKD 2KB7P 2ZAEB 3H1KG 4ASVA 1N73C 3MP7B 3L73E 3D6ZA 5BVZA 3CPWO 2BEQD 3Q3DA 1OX3A 4H0LB 2XNXA 2PAJA 1FZAA 1OWAA 2QM7A 1N73A 1KILD 1VL2A 2W90A 1IC2A 1YYCA 2WSEH 2HYNA 1LTIC 1N7SB 3QWOC 3OJAB 3RK2B 4I1LA 5L8RJ 2V4HA 3L73G 4AQRD 1AFOA 3VN0A 1JNMA 4WVZA 3O6QA 5KLVJ 2A06E 1XTGB 1JY3O 1PGJA 3HD7D 4W7ZA 3UIAA 3B5NB 2L91A 4Y99B 3AEDC 2N1TD 3AEAC 1NTME 3KQGA 1OVUA 3SFDC 2OYHB 1OZHA 1W2BO 1K05A 1SQQE 3L70E 5KTBA 2QJPB 2P7JA 1SQVK 2H43A 3VYIA 1SQPE 5APWA 4HH2A 2OYIC 2IFNA 1YI2P 2I1KA 2E75B 1L4AD 1E79H 2A06G 1ZRTE 1W5CE 2KNCB 2OGUA 2JO1A 2M5AA 1SQXK 2QVAA 2OYIA 1KILB 2YO3A 1FZBA 1NTMG 2CPBA 2P10A 4UB6H 1D7MA 2RN0A 1BE3J 2JEEA 2W6JH 1SQQG 3L70G 3L75E 1U57A 5KAFH 4JYBA 1Y47A 3TGUE 4ZNCA 1SQPG 1EDIA 4BRYA 1ZR4A 1RY3A 3CMAP 1BE3D 2Z4EA 3TF5A 5CCGC 1MKMA 1HBWA 1T2KD 3Q5PA 3WUUA 4W80A 1TU3F 1YBKA 2NRGA 5BU8B 1A02F 4PD4H 3HD7B 4EI2A 2HG5D 5KKZC 2N1TB 5CCGA 5KLIC 1JY2P 2RMZA 1EQ7A 2HR3A 3D71A 1YQ3C 2KZJA 2ZJSE 2Q7CA 1N73B 3WUVA 3L75G 2YNYA 1USDA 2FFDC 3TGUG 3A3YB 1JMBA 1L0NK 3B4SA 2Z5HA 5M1BA 2ZT9D 2XDJA 4GT1A 1KQFB 3I56P 1L4AB 2P1JA 1GU4A 3SSUA 4JBZA 1S5LH 1PGPA 2WWWA 2QM8A 4GOFA 2P2UA 1NTKK 3GHGB 3L37A 3B8EB 2FFDA 1PP9E 1IK7A 3H1JJ 5CHXA 2IFMA 3V2NA 3CXHH 1EZVI 2IZ1A 2AXCA 3O6QB 1ZXGA 1P84D 1OW8A 3HTKB 1VQ5P 3L74E 1DX7A 4IL6H 4JF7A 3SWFA 3Q5SA 3H1JD 5E79H 1JCDA 3VP8A 4IL6X 2XV5A 1KYOH 3VMYA 4HKZH 2WMMA 2ZXEB 5TISE 3CCMP 1KMIZ 5B66H 2ZXXA 5KJ7C 4GIFA 3H32A 3MGNA 4UB6E 3CC4P 2XU6A 1XTCC 1ZR2A 1PP9G 2YKQA 5KAFE 3VMZA 3N7NA 2FYUE 3N4XA 3BCCJ 3H1IE 3CX5D 4AUWA 1L0LK 4OGQC 2M5AB 3P8CE 3RK3C 1NU1E 1KB9I 1FBMA 1M7LA 1RHZB 3BCCD 3HUSB 5KLVK 4L75A 2ZT9B 1GTWA 4RKUJ 1Q82Q 1BCCJ 2BCCJ 1Q86Q 5H2FH 1YHQP 2M0BA 1LTSC 4H44C 2E76C 4EDFA 1MFZA 3CCSP 2FYUG 1L2PA 2ZYDA 3H1IG 1BCCD 5AVTB 1FC2C 2XNDH 2WSFH 3S9OA 4R4LA 1NU1G 1AQ5A 4IFDK 1FZCB 1FU1A 1S5LE 3L35A 3HRNA 1LT9C 1Q90D 5KAIE 2OTKE 3F5HA 3SWYA 1Q81Q 1GDTA 3A0BH 3CXHE 4ZKPA 4GODA 4C7NA 3U1AA 4IL6E 1LT9A 5KKZB 3LIEA 5E79E 1OIPA 3ABVC 5KLIB 2C0XA 4DT0A 3KXDA 5CCHD 1HGZA 1H8AA 1N2DC 2POHA 1KORA 2IBZE 5B66E 5CMZA 3CC2P 3M9QA 1PPJE 2OYOA 1GD2E 1EDKA 1SQVJ 2KXPB 4DOJA 1YIJP 2FYZA 5AVQB 1G1JA 1P84I 3KZIH 3W67A 1GZLA 3S4RA 2QJYB 1DH3A 2E76D 1SQVD 1SQXJ 1ZV8A 1USEA 5EFWB 5AW7B 4HYTB 3R4YA 3H32B 2IBZG 4WY4C 3CCUP 1LTBC 1SQXD 1PPJG 3RL0C 1LTAC 2H7HA 2A45H 4AYCA 4U3FE 1FDOA 3IN6A 4H0LD 5AW8B 3D70A 2B9BA 2IYPA 2FXPA 3SWKA 4WY4A 5APYA 5AW9B 4BWNA 4B86A 4NPFX 4M3LA 1WT6A 3MD0A 2GUVA 3TYYA 4L73A 4I6MC 3RK3B 2QSIA 3IF4A 1PZQA 2K37A 3H1KE 1QGKB
chains in the Genus database with same CATH topology
2RMZA 1NU1D 1PPJD 1ZRTD 3ITKA 3KHUA 2QG4A 1L0LD 3BCCD 1SQBD 4PD4D 2QJPB 3TDKA 1NTKD 1SQPD 2YIUB 2QJYB 3L74D 2O3JA 5KLVD 5TJHA 1SQVD 2Y0CA 4U3FD 1L0ND 2KNCB 1PP9D 3GW6A 3PRJA 4EDFA 3VMAA 2FYNB 2Y0EA 1BCCD 1P84D 3PTZA 3CWBD 1SQXD 3PLNA 2RN0A 3H1JD 3L71D 4D6TD 3L72D 3L75D 1KB9D 2KS1A 3TGUD 3CXHD 4A7PA 2BCCD 2QJKB 3H1KD 3H1LD 1NTZD 2IBZD 2Q3EA 1BE3D 3TF5A 2A06D 5KKZB 2Y0DA 3FWLA 5KLIB 1SQQD 3L70D 3PHLA 1KYOD 1BGYD 4RJTA 2FYUD 3H1ID 2JWAA 2K9JB 3H1HD 3L73D 3CX5D 2N9YB 2L91A 1NTMD 3GG2A 1EZVD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RMZ A;  1NU1 D;  1PPJ D;  1ZRT D;  3ITK A;  3KHU A;  2QG4 A;  1L0L D;  3BCC D;  1SQB D;  4PD4 D;  2QJP B;  3TDK A;  1NTK D;  1SQP D;  2YIU B;  2QJY B;  3L74 D;  2O3J A;  5KLV D;  5TJH A;  1SQV D;  2Y0C A;  4U3F D;  1L0N D;  2KNC B;  1PP9 D;  3GW6 A;  3PRJ A;  4EDF A;  3VMA A;  2FYN B;  2Y0E A;  1BCC D;  1P84 D;  3PTZ A;  3CWB D;  1SQX D;  3PLN A;  2RN0 A;  3H1J D;  3L71 D;  4D6T D;  3L72 D;  3L75 D;  1KB9 D;  2KS1 A;  3TGU D;  3CXH D;  4A7P A;  2BCC D;  2QJK B;  3H1K D;  3H1L D;  1NTZ D;  2IBZ D;  2Q3E A;  1BE3 D;  3TF5 A;  2A06 D;  5KKZ B;  2Y0D A;  3FWL A;  5KLI B;  1SQQ D;  3L70 D;  3PHL A;  1KYO D;  1BGY D;  4RJT A;  2FYU D;  3H1I D;  2JWA A;  2K9J B;  3H1H D;  3L73 D;  3CX5 D;  2N9Y B;  2L91 A;  1NTM D;  3GG2 A;  1EZV D; 
#chains in the Genus database with same CATH topology
 3AE1 C;  2KK7 A;  1YJN P;  4W7Y A;  3WU2 H;  3L71 J;  3KPE A;  1OW6 A;  4KJM A;  1QX8 A;  2E42 A;  2H88 C;  1KQL A;  4H44 B;  2E76 B;  3B5N D;  4LGD E;  2E74 C;  5AVU B;  5GTH H;  1L0N D;  2C9N Y;  1N7L A;  2Q3I A;  1GW3 A;  1CW5 A;  1SS1 A;  2Y0E A;  1ZW0 A;  4XE5 B;  3TK1 A;  4C7N B;  3AEC C;  1KIL E;  1LWU B;  5DJU B;  2E75 D;  3QH9 A;  2KS1 A;  2R44 A;  2O01 J;  2WPV B;  2OTL P;  2WVR A;  3RBZ A;  2Q5U A;  3RGU A;  2K9Y A;  3L73 J;  1RF1 C;  1BSH A;  3Q2Y A;  3AE4 C;  1J1D C;  1Q2N A;  2Z5I A;  1L0L J;  3C9I A;  2YKP A;  3L73 D;  4ZKU A;  1RF1 A;  2N9Y B;  1LT1 A;  3LW5 J;  4EYY Q;  2WZ7 A;  1IO4 A;  3W68 A;  1EZV D;  2Y9Z A;  3ITK A;  1U7M A;  1ZN5 A;  1IFI A;  1WMK A;  4I7Z B;  1L0L D;  1VQ8 P;  2E74 D;  1P84 H;  2O1J A;  3C1L A;  2BEZ F;  5KLV D;  1JY3 N;  2A45 G;  3WU2 E;  2Q6Q A;  3FXE A;  2LR2 A;  1DEE G;  1FZF A;  3NTN A;  2G3A A;  3RL0 g;  1WRG A;  4YXW H;  5GTH E;  2WQY C;  1KB9 D;  1SQQ J;  3L70 J;  5K5G B;  1PFI A;  3P8M C;  3CX5 H;  3P32 A;  2JJL A;  3G4S P;  1BE3 E;  3CWB E;  2C9L Y;  3H25 A;  3FWL A;  2QE7 H;  1QLE D;  1SQQ D;  3L70 D;  4WBA A;  2HFE D;  1VPC A;  2JKV A;  1PIX A;  3GG2 A;  1AV1 A;  1HVV A;  1ZRT D;  3G71 P;  3MZW B;  1JTH B;  1HJB A;  1URQ C;  3CME P;  2WPQ A;  2W27 A;  2E74 B;  3TDK A;  2XKM A;  3EWK A;  1LTJ C;  1H89 A;  3H1H E;  2WSS H;  1BE3 G;  3CWB G;  1AQT A;  2E5T A;  2B87 A;  2KS1 B;  3PJS K;  1NOH A;  2FBW C;  1R5L A;  1IFN A;  3BVH A;  1LTJ A;  1SQB E;  2YO2 A;  3PH0 A;  2FXM A;  3CI9 A;  1FJP A;  3PTZ A;  1VDF A;  1S4X A;  5AW5 B;  1J1E C;  3U59 A;  1JEK A;  2KSE A;  3R2P A;  2KLU A;  2BAS A;  2HPC A;  2KYV A;  4UB8 H;  1RF1 B;  1R5S A;  2V7Q J;  2PRR A;  1FZE A;  1QEX A;  2O01 N;  1J1D B;  4K35 A;  3H1H G;  1CZQ A;  1AVY A;  3CCE P;  4H13 C;  2G8Y A;  2KSJ A;  3V4W A;  3V5B A;  3AE8 C;  1VQ6 P;  1NGM B;  3PHL A;  1PP9 J;  4N78 D;  1X22 A;  3CD6 P;  3JSV C;  3WMM 0;  4RJT A;  2R3S A;  1SQB G;  1T3U A;  3RBX A;  5CCG D;  1LP1 A;  1VQ7 P;  3OAK A;  3CX5 E;  1NTZ E;  2H8P D;  3MUD C;  4DZO A;  3L74 J;  1M57 D;  1S2E A;  4WB4 A;  2J5U A;  2KI7 B;  2D2C C;  1GK4 A;  3OA7 A;  4KHX A;  3BCC E;  3NMD A;  1BGY E;  2WTY A;  1DEB A;  1SFC C;  3FWN A;  3MUD A;  3L74 D;  2HOD A;  1GU5 A;  5KJ7 A;  1KQS O;  1AVO A;  2B89 A;  4XA4 A;  2FY8 A;  1FZG A;  2WT7 A;  2CK3 H;  3I5C A;  3O8Z A;  2YIU C;  3GW6 A;  2OYI B;  2GA1 A;  1LTG C;  1JCC A;  1E5W A;  3V6I A;  1SFC A;  1S9K E;  1BCC E;  4PD4 E;  1N86 A;  1NJI Q;  1NTZ G;  4GOE A;  3LID A;  1UIX A;  4R4M A;  1KFM A;  1R8E A;  2PP6 A;  3BCC G;  4BRY B;  1K04 A;  2AXT H;  5BU5 A;  4PV1 C;  1RE4 C;  3TNU A;  3A7O A;  1BGY G;  2LXB A;  3T97 A;  3FX0 A;  5CJ4 A;  2BCC D;  3MIW A;  3P8C D;  3D6Y A;  3AEB C;  1HWT C;  1X0T A;  1RE4 A;  2WIT A;  1NTM K;  4UB8 E;  5DJT B;  1M90 Q;  1BCC G;  1T3J A;  5KJ7 D;  1YJ9 P;  4XFJ A;  2E5Y A;  3VTP C;  3A0H H;  2D2C D;  1SQQ K;  1GW4 A;  2OQQ A;  2K9J A;  1LTJ B;  1SQP K;  2YMY A;  3GF3 A;  2P58 A;  2YXR B;  4OGQ D;  1KYO E;  3RK3 D;  1IFD A;  2C0W A;  5APT A;  1DD3 A;  2KIK A;  2HPC B;  2FFD B;  1SQV E;  3GF7 A;  5AVX B;  4Y28 J;  2XZR A;  1S3J A;  2O1K A;  3PRJ A;  3VMA A;  4PJ0 H;  1J1E B;  3L72 J;  1KTM A;  2IZ0 A;  2UWJ E;  3H1L J;  4H44 D;  3RK2 C;  2J59 M;  1SQX E;  4HB1 A;  1SLQ A;  1QL1 A;  4OWF A;  1OW7 A;  2GUS A;  3L72 D;  1M56 D;  2SPZ A;  1JUN A;  1QVF O;  1NO4 A;  3AEG C;  1MFT A;  2WPS A;  3H1L D;  1IZN B;  2IBZ D;  2Q3E A;  2CPS A;  1QL2 A;  1SQV G;  5H2F E;  2Y0D A;  4N6J A;  2E43 A;  2K88 A;  2QJK C;  3I55 P;  1M1J C;  2HOD B;  5APX A;  4YTP C;  2AXT E;  3V2Q A;  3LW5 H;  1RH5 B;  1ZOY C;  3AEF C;  1NAY A;  4JQ0 D;  2D2C B;  3M9B A;  2ZYA A;  2WT7 B;  4IFF A;  2W83 C;  1SQX G;  1IFJ A;  5AW2 B;  1M1J A;  1MUU A;  2WSC J;  4U3F J;  3GMA A;  4OGQ B;  1JY2 N;  1HGV A;  5CJ0 A;  2W6A A;  2YIU B;  2HLO A;  3V2R A;  2FXO A;  3A0B E;  3A2A A;  2ZYG A;  1OVV A;  3CLQ A;  3K5B A;  1SVF A;  4O9B A;  1VQK P;  4BXL A;  2Y0C A;  4U3F D;  1KIL C;  1L0N E;  5B5E H;  1VQP P;  1KB9 H;  3CL3 D;  1G2C A;  4D6T J;  1X8Y A;  3HE4 A;  1NTK E;  2JP3 A;  2MJZ A;  3H1K J;  1KIL A;  1K8A Q;  2RH0 A;  5C39 A;  2FYN C;  1G1I A;  2FKW B;  3L71 D;  4D6T D;  2JDI H;  4LLH A;  5AVR B;  1EDL A;  2M3E A;  4WY4 D;  4PJ0 E;  4IOI H;  3RL0 D;  1KN7 A;  3H1K D;  3M06 A;  1EDJ A;  3KZI E;  1LT9 B;  4RES B;  2KLV A;  3HD7 C;  1Y9B A;  2FYU K;  4KT0 J;  3HE5 A;  1L0N G;  3VOP A;  2N1T C;  3BAT A;  4QMA A;  4K3A A;  1NU1 K;  1NTK G;  2PGD A;  1IFP A;  1MZ9 A;  3AE2 C;  3HD7 A;  1EZV E;  2GM4 A;  2N1T A;  3CXH I;  2MKV A;  1W2E A;  1L0L E;  1FOS E;  1L4A C;  1Y8A A;  2AEF A;  1FAV A;  2VRS A;  3GHG C;  3PP5 A;  4DCK A;  2AEM A;  1ZP0 C;  5KLV E;  2NPS C;  1BSN A;  1KYO I;  1L4A A;  2Q1K A;  1KD1 Q;  2IBZ I;  3GHG A;  3ZDM A;  1A02 J;  3Q1M A;  3IR9 A;  2NPS A;  1EZV G;  2ITA A;  1NKZ B;  1PL5 A;  1VF5 C;  4YXD C;  1M1K Q;  3HTK A;  2RKL A;  2V7Q H;  2QIW A;  3IFM A;  1L0L G;  4ZMD A;  5B5E E;  4WY4 B;  1KB9 E;  1T2K C;  3RL0 B;  2QJK B;  5AW4 B;  3JCU H;  4MN4 C;  1H88 A;  1ZLL A;  4WWI A;  1M1J B;  1DD4 A;  5KLV G;  1VQN P;  4JYC A;  5APQ A;  2L5G B;  1NTM J;  5CBN A;  1NKN A;  1X9V A;  2A06 D;  4U7J A;  3CCQ P;  1PGQ A;  1M8O B;  4ASW A;  1Z56 A;  3VMX A;  2I8D A;  1SQP J;  1NTM D;  5GTI H;  1JOC A;  1HF9 A;  3HUS C;  1GL2 C;  1CSB A;  1G2C B;  3KDP B;  1DIP A;  2ZT9 C;  2YXQ B;  3KHU A;  2QG4 A;  3HE4 B;  5TIS H;  3FXD A;  1LGH B;  2KUB A;  2H89 C;  1SQP D;  2NPS D;  4Z1M H;  1CI6 A;  3HUS A;  1EC5 A;  1GL2 A;  3BAS A;  3CWB J;  3NXS A;  3Q5R A;  1FOS F;  3L4F A;  3M0A A;  1BDC A;  2FYN B;  1J2J B;  2J58 A;  3L75 J;  1FZC C;  5APV A;  1K73 Q;  1VF5 D;  3TGU J;  3FGA D;  1YIT P;  3HE5 B;  3AE7 C;  1YJW P;  3CWB D;  5APU A;  3WUT A;  3E7K A;  1URQ A;  4IFM A;  2M3B A;  3L75 D;  3CC7 P;  1FZC A;  2WSE J;  3TGU D;  3G6E P;  1U7J A;  3H1H J;  1P84 E;  1VQL P;  2N9B A;  3CCR P;  3H1J E;  3MTU E;  4N78 E;  4OVN F;  2KOG A;  5AW1 B;  1S1C X;  1GL2 D;  1SQB J;  3H1H D;  1EXJ A;  3M0D C;  3JCU E;  1RQU A;  5APS A;  1BDD A;  1PV3 A;  1QVG O;  1FS0 E;  1S5L X;  2QJY C;  5KAI H;  1YTZ T;  3USS A;  2QRX A;  2PFX A;  1VQM P;  1SQB D;  2NPS B;  1JB0 J;  3M0D A;  4I2L C;  1OXZ A;  2IYO A;  2A45 I;  5GTI E;  1URQ D;  5TJH A;  2ZVN B;  1K9M Q;  1OFC X;  1HH0 A;  3NFQ A;  3H1J G;  2QEX P;  1PP9 D;  3AE5 C;  2YKO A;  1FDM A;  1VF5 B;  4JPZ B;  3M9H A;  3EFG A;  3EFF K;  2YMK A;  4C7R A;  3PLN A;  4HJG H;  1NTZ J;  1YTZ I;  3A5T A;  4NPE A;  1NWQ A;  1T6A A;  1BGY J;  2FYU J;  1EXI A;  5CCH C;  1IJD B;  2BCC E;  3H1I J;  1NTZ D;  5AVV B;  3L74 G;  5AW6 B;  1JM0 A;  2Y9Y A;  1JO5 A;  4GDO A;  1NU1 J;  2K1A A;  5AVY B;  3G9R A;  4C46 A;  3B71 A;  1CI6 B;  1IK9 A;  4EOT A;  5AVZ B;  1RQV A;  1GL2 B;  1BGY D;  2FYU D;  4GKG A;  3H1I D;  5CCH A;  4H13 D;  2OAR A;  4LC1 A;  1NU1 D;  4TLF A;  3M91 A;  2WSC H;  2B88 A;  1HTL C;  4N3Y B;  1VQO P;  2Q9I A;  1JY3 P;  1S9K D;  4PD4 D;  1FDI A;  2B87 B;  3TSI A;  2BCC G;  3RK3 E;  2K3R A;  1URQ B;  3E1R A;  1GMJ A;  2IPP A;  4L74 A;  2I1J A;  3AEE C;  3SFE C;  3OW2 O;  1NHL A;  1T8Z A;  1JMM A;  3U1C A;  1SFC D;  1LWU C;  3VP9 A;  1S72 P;  2R5D A;  3CCJ P;  1FE6 A;  1SP4 A;  4H0L C;  2ZFC A;  4OH8 B;  5AVW B;  2ZVO B;  1H0T A;  2NZ2 A;  1KFN A;  2OTJ P;  3BRT B;  3H6P A;  2IDB A;  1LWU A;  3L72 E;  1KZU B;  4YPC A;  1MV8 A;  1VQ9 P;  4DJG A;  4L76 A;  3CXH D;  1LNQ A;  3H1L E;  2P67 A;  3AE6 C;  1N7S C;  2IX7 C;  1RF0 C;  2M8R A;  3KYQ A;  3AE9 C;  1AJY A;  1NYH A;  4PV1 D;  1N8R Q;  2W6B A;  3GLM A;  2O01 H;  2WPR A;  1LP1 B;  1KYO D;  4H13 B;  4NPD A;  1IFM A;  1N7S A;  4I7Z C;  1RF0 A;  1RE3 C;  1PPJ D;  1NH4 A;  3G3Z A;  3P7K A;  2R32 A;  3F89 A;  3L72 G;  3C8V A;  3B5N C;  1NAF A;  4Y99 C;  2R3C A;  4CPG A;  2OYH C;  3H1L G;  1YQ4 C;  1RE3 A;  5CBO A;  2DW3 A;  2KZI A;  2O3J A;  3V2P A;  2W8Z A;  3II6 A;  1HJ0 A;  1SQB K;  2QJP C;  3B5N A;  1SFC B;  2LKM A;  3CX5 I;  2E75 C;  2OYH A;  1OMI A;  2LXC B;  1FJK A;  1KQG B;  3EQ2 A;  1LTT C;  1JY2 O;  3A0H E;  2WSF J;  1GK6 A;  3TNU B;  3L71 E;  4D6T E;  3T97 B;  3L36 A;  1NVO A;  2QA4 P;  1N7S D;  5AVS B;  1ZME C;  3S1K A;  2KNC A;  3RK2 D;  4EIJ A;  5AW3 B;  2R5B A;  4A7P A;  2JWD A;  1UII A;  3E1I A;  3CCV P;  4PV1 B;  1KV4 A;  3AE3 C;  4TT3 H;  1HUC A;  1Q7Y Q;  2KP8 A;  4U3F G;  3BRV B;  4PD4 I;  1VQ4 P;  1L0N J;  1KC8 Q;  4RO0 A;  2JR8 A;  1NTZ K;  3IAO A;  3JC2 2;  2JWA A;  5AW0 B;  3MHV A;  2K9J B;  1LJ2 A;  1AA0 A;  1PGO A;  1X79 B;  1NTK J;  3V4Q A;  3CCL P;  3L71 G;  2AEJ A;  4D6T G;  1OVR A;  1H0T B;  1JTH A;  1NTK D;  2KB7 P;  2ZAE B;  3H1K G;  4ASV A;  1N73 C;  3MP7 B;  3L73 E;  3D6Z A;  5BVZ A;  3CPW O;  2BEQ D;  3Q3D A;  1OX3 A;  4H0L B;  2XNX A;  2PAJ A;  1FZA A;  1OWA A;  2QM7 A;  1N73 A;  1KIL D;  1VL2 A;  2W90 A;  1IC2 A;  1YYC A;  2WSE H;  2HYN A;  1LTI C;  1N7S B;  3QWO C;  3OJA B;  3RK2 B;  4I1L A;  5L8R J;  2V4H A;  3L73 G;  4AQR D;  1AFO A;  3VN0 A;  1JNM A;  4WVZ A;  3O6Q A;  5KLV J;  2A06 E;  1XTG B;  1JY3 O;  1PGJ A;  3HD7 D;  4W7Z A;  3UIA A;  3B5N B;  2L91 A;  4Y99 B;  3AED C;  2N1T D;  3AEA C;  1NTM E;  3KQG A;  1OVU A;  3SFD C;  2OYH B;  1OZH A;  1W2B O;  1K05 A;  1SQQ E;  3L70 E;  5KTB A;  2QJP B;  2P7J A;  1SQV K;  2H43 A;  3VYI A;  1SQP E;  5APW A;  4HH2 A;  2OYI C;  2IFN A;  1YI2 P;  2I1K A;  2E75 B;  1L4A D;  1E79 H;  2A06 G;  1ZRT E;  1W5C E;  2KNC B;  2OGU A;  2JO1 A;  2M5A A;  1SQX K;  2QVA A;  2OYI A;  1KIL B;  2YO3 A;  1FZB A;  1NTM G;  2CPB A;  2P10 A;  4UB6 H;  1D7M A;  2RN0 A;  1BE3 J;  2JEE A;  2W6J H;  1SQQ G;  3L70 G;  3L75 E;  1U57 A;  5KAF H;  4JYB A;  1Y47 A;  3TGU E;  4ZNC A;  1SQP G;  1EDI A;  4BRY A;  1ZR4 A;  1RY3 A;  3CMA P;  1BE3 D;  2Z4E A;  3TF5 A;  5CCG C;  1MKM A;  1HBW A;  1T2K D;  3Q5P A;  3WUU A;  4W80 A;  1TU3 F;  1YBK A;  2NRG A;  5BU8 B;  1A02 F;  4PD4 H;  3HD7 B;  4EI2 A;  2HG5 D;  5KKZ C;  2N1T B;  5CCG A;  5KLI C;  1JY2 P;  2RMZ A;  1EQ7 A;  2HR3 A;  3D71 A;  1YQ3 C;  2KZJ A;  2ZJS E;  2Q7C A;  1N73 B;  3WUV A;  3L75 G;  2YNY A;  1USD A;  2FFD C;  3TGU G;  3A3Y B;  1JMB A;  1L0N K;  3B4S A;  2Z5H A;  5M1B A;  2ZT9 D;  2XDJ A;  4GT1 A;  1KQF B;  3I56 P;  1L4A B;  2P1J A;  1GU4 A;  3SSU A;  4JBZ A;  1S5L H;  1PGP A;  2WWW A;  2QM8 A;  4GOF A;  2P2U A;  1NTK K;  3GHG B;  3L37 A;  3B8E B;  2FFD A;  1PP9 E;  1IK7 A;  3H1J J;  5CHX A;  2IFM A;  3V2N A;  3CXH H;  1EZV I;  2IZ1 A;  2AXC A;  3O6Q B;  1ZXG A;  1P84 D;  1OW8 A;  3HTK B;  1VQ5 P;  3L74 E;  1DX7 A;  4IL6 H;  4JF7 A;  3SWF A;  3Q5S A;  3H1J D;  5E79 H;  1JCD A;  3VP8 A;  4IL6 X;  2XV5 A;  1KYO H;  3VMY A;  4HKZ H;  2WMM A;  2ZXE B;  5TIS E;  3CCM P;  1KMI Z;  5B66 H;  2ZXX A;  5KJ7 C;  4GIF A;  3H32 A;  3MGN A;  4UB6 E;  3CC4 P;  2XU6 A;  1XTC C;  1ZR2 A;  1PP9 G;  2YKQ A;  5KAF E;  3VMZ A;  3N7N A;  2FYU E;  3N4X A;  3BCC J;  3H1I E;  3CX5 D;  4AUW A;  1L0L K;  4OGQ C;  2M5A B;  3P8C E;  3RK3 C;  1NU1 E;  1KB9 I;  1FBM A;  1M7L A;  1RHZ B;  3BCC D;  3HUS B;  5KLV K;  4L75 A;  2ZT9 B;  1GTW A;  4RKU J;  1Q82 Q;  1BCC J;  2BCC J;  1Q86 Q;  5H2F H;  1YHQ P;  2M0B A;  1LTS C;  4H44 C;  2E76 C;  4EDF A;  1MFZ A;  3CCS P;  2FYU G;  1L2P A;  2ZYD A;  3H1I G;  1BCC D;  5AVT B;  1FC2 C;  2XND H;  2WSF H;  3S9O A;  4R4L A;  1NU1 G;  1AQ5 A;  4IFD K;  1FZC B;  1FU1 A;  1S5L E;  3L35 A;  3HRN A;  1LT9 C;  1Q90 D;  5KAI E;  2OTK E;  3F5H A;  3SWY A;  1Q81 Q;  1GDT A;  3A0B H;  3CXH E;  4ZKP A;  4GOD A;  4C7N A;  3U1A A;  4IL6 E;  1LT9 A;  5KKZ B;  3LIE A;  5E79 E;  1OIP A;  3ABV C;  5KLI B;  2C0X A;  4DT0 A;  3KXD A;  5CCH D;  1HGZ A;  1H8A A;  1N2D C;  2POH A;  1KOR A;  2IBZ E;  5B66 E;  5CMZ A;  3CC2 P;  3M9Q A;  1PPJ E;  2OYO A;  1GD2 E;  1EDK A;  1SQV J;  2KXP B;  4DOJ A;  1YIJ P;  2FYZ A;  5AVQ B;  1G1J A;  1P84 I;  3KZI H;  3W67 A;  1GZL A;  3S4R A;  2QJY B;  1DH3 A;  2E76 D;  1SQV D;  1SQX J;  1ZV8 A;  1USE A;  5EFW B;  5AW7 B;  4HYT B;  3R4Y A;  3H32 B;  2IBZ G;  4WY4 C;  3CCU P;  1LTB C;  1SQX D;  1PPJ G;  3RL0 C;  1LTA C;  2H7H A;  2A45 H;  4AYC A;  4U3F E;  1FDO A;  3IN6 A;  4H0L D;  5AW8 B;  3D70 A;  2B9B A;  2IYP A;  2FXP A;  3SWK A;  4WY4 A;  5APY A;  5AW9 B;  4BWN A;  4B86 A;  4NPF X;  4M3L A;  1WT6 A;  3MD0 A;  2GUV A;  3TYY A;  4L73 A;  4I6M C;  3RK3 B;  2QSI A;  3IF4 A;  1PZQ A;  2K37 A;  3H1K E;  1QGK B; 
#chains in the Genus database with same CATH homology
 2RMZ A;  1NU1 D;  1PPJ D;  1ZRT D;  3ITK A;  3KHU A;  2QG4 A;  1L0L D;  3BCC D;  1SQB D;  4PD4 D;  2QJP B;  3TDK A;  1NTK D;  1SQP D;  2YIU B;  2QJY B;  3L74 D;  2O3J A;  5KLV D;  5TJH A;  1SQV D;  2Y0C A;  4U3F D;  1L0N D;  2KNC B;  1PP9 D;  3GW6 A;  3PRJ A;  4EDF A;  3VMA A;  2FYN B;  2Y0E A;  1BCC D;  1P84 D;  3PTZ A;  3CWB D;  1SQX D;  3PLN A;  2RN0 A;  3H1J D;  3L71 D;  4D6T D;  3L72 D;  3L75 D;  1KB9 D;  2KS1 A;  3TGU D;  3CXH D;  4A7P A;  2BCC D;  2QJK B;  3H1K D;  3H1L D;  1NTZ D;  2IBZ D;  2Q3E A;  1BE3 D;  3TF5 A;  2A06 D;  5KKZ B;  2Y0D A;  3FWL A;  5KLI B;  1SQQ D;  3L70 D;  3PHL A;  1KYO D;  1BGY D;  4RJT A;  2FYU D;  3H1I D;  2JWA A;  2K9J B;  3H1H D;  3L73 D;  3CX5 D;  2N9Y B;  2L91 A;  1NTM D;  3GG2 A;  1EZV D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...