2KNCB

Platelet integrin alfaiib-beta3 transmembrane-cytoplasmic heterocomplex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
b'GAMGSKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Structure of an integrin alphaIIb beta3 transmembrane-cytoplasmic heterocomplex provides insight into integrin activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 20
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08725 Integrin_b_cyt Integrin beta cytoplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2kncB00
3H1ID 2Q3EA 3PRJA 2RN0A 2FYUD 3CWBD 3CXHD 3L72D 1NU1D 1SQBD 2IBZD 2Y0EA 2QJYB 2N9YB 1SQPD 3H1HD 2O3JA 1NTMD 3CX5D 3GG2A 3TF5A 3PHLA 2KS1A 5KKZB 3TDKA 1NTZD 4D6TD 1SQVD 4EDFA 3TGUD 1P84D 1KB9D 3H1LD 1L0LD 3GW6A 2Y0CA 5KLIB 1PPJD 2JWAA 1BCCD 2K9JB 4A7PA 4U3FD 1EZVD 2QJPB 2KNCB 1KYOD 3FWLA 1BE3D 1L0ND 4RJTA 3L70D 3L75D 2A06D 2L91A 2YIUB 4PD4D 2Y0DA 3ITKA 1NTKD 3H1KD 2FYNB 3L73D 2QJKB 3L74D 1SQXD 1ZRTD 3PLNA 2BCCD 5TJHA 2QG4A 2RMZA 3KHUA 1BGYD 1PP9D 5KLVD 3BCCD 1SQQD 3L71D 3H1JD 3VMAA 3PTZA
chains in the Genus database with same CATH superfamily
1KILD 3P7KA 3RK2B 1RF0C 3MUDC 3W68A 3H1HD 1VQ9P 2AEMA 2KS1A 1H0TB 1NH4A 3KPEA 3L74J 2KXPB 1M56D 2PP6A 4PD4I 3WU2H 1P84D 3H1LD 4PV1C 3MZWB 3TGUG 3M9HA 3H1KG 2HPCB 2ITAA 1S5LH 2YNYA 2W27A 3M06A 1M90Q 1R5SA 1NAFA 1NGMB 3H1KD 1NYHA 1YBKA 1MUUA 2JO1A 1J1DC 2QJKC 5H2FH 2LR2A 1PP9D 3KZIH 1DD4A 2R44A 3B5NC 1JY2O 2ZYAA 2WSFJ 2JR8A 1NTMK 1P84I 1Y8AA 2IPPA 5KJ7D 1L0NJ 5APWA 3HD7B 1SFCD 4BWNA 1SQQJ 1W2BO 3G9RA 1G2CA 2N9YB 1SQPD 1ZV8A 3CWBG 1NTMD 2WSCH 2J5UA 1SQBE 1S1CX 3P8MC 3H32A 5KKZC 1LTJA 2E42A 3Q5RA 1WRGA 4R4MA 1DD3A 2FXPA 3L71E 3Q1MA 3WMM0 2B87B 2M5AB 2XNDH 3L75G 1JY2N 2AEFA 2QIWA 2GM4A 1N7SC 2V7QH 1QEXA 1X22A 4OGQC 1GK4A 2FFDA 3L75D 1PL5A 2N1TD 2SPZA 1ZLLA 2KZJA 3E7KA 1NTZE 3SWFA 1KYOH 5AW2B 1NVOA 1BE3E 4JQ0D 2ZJSE 1GL2C 5TJHA 3KDPB 2QG4A 1KILA 3KHUA 3KZIE 1VQ7P 3FGAD 4M3LA 2E75D 2W6BA 1EZVE 1L2PA 4CPGA 3R4YA 3E1IA 4IL6H 2E76B 1LWUC 5GTIE 2Q7CA 1H88A 4YTPC 2QEXP 5KLVJ 3GHGC 4EI2A 4H13B 2C0XA 4R4LA 2XU6A 1KMIZ 3H1JJ 5CCHD 1L0LG 4H0LD 4BXLA 1SVFA 3FXEA 2QJPC 5BVZA 2ZYGA 1KFNA 1L0LD 5DJTB 2KZIA 5AVVB 2FXMA 1DH3A 1L4AD 1VQ5P 3CCSP 1W2EA 2NPSD 3CL3D 3H6PA 4ZKUA 4W7ZA 4K35A 3RBXA 1NU1E 1U57A 3G71P 1SQVJ 3D6YA 2NZ2A 1PGJA 1S4XA 4PV1B 3PP5A 1YI2P 1FJKA 3BATA 3II6A 4EIJA 1BE3G 2YIUC 3M0DA 3JC22 1NTKG 2OYOA 3L70E 1X9VA 4PD4H 1VF5C 4JYBA 1MV8A 2LXCB 1M1KQ 3EQ2A 1NTZK 3L73G 3L74G 5KJ7A 1H8AA 4LC1A 2FKWB 1SFCA 2R5DA 1ZMEC 3HUSA 3CLQA 1CI6A 4DJGA 1OW7A 1QL2A 1J2JB 5CCGC 2Q9IA 2YXRB 3WUTA 2E5YA 2O3JA 1KD1Q 1PZQA 1VQMP 3CX5D 3PHLA 2WTYA 3NFQA 1H89A 2BCCE 2IZ0A 3TDKA 2OQQA 2Q6QA 1CW5A 4UB8E 4WVZA 1MFTA 1PP9J 4N78D 3OA7A 4AYCA 3VP8A 1BSHA 3AE9C 3TNUB 2AXCA 1T8ZA 1MFZA 1LT9C 3GW6A 1VDFA 3H1IE 3O6QA 1FBMA 1USEA 1JY3N 4A7PA 4L74A 2D2CD 3Q2YA 2K9YA 4RKUJ 3BVHA 2OGUA 4C46A 3CCMP 3V2RA 5AVRB 3FWNA 3C1LA 3RL0C 5CHXA 1GTWA 3VOPA 1NTMJ 4ZMDA 1L0NG 1NHLA 3L70G 1HGVA 4GT1A 2G3AA 1OIPA 1SQQG 1JCDA 1Q81Q 3MTUE 3CI9A 1YJWP 1NWQA 3CCQP 1M7LA 4N3YB 4PD4E 2OYIA 1BGYD 3CX5I 1PFIA 1SQQD 2HG5D 2CPBA 3HTKB 1RE4A 4XA4A 2AEJA 1URQD 2K37A 4WY4A 2W90A 4JYCA 4H44D 1QX8A 1GW3A 5CCHA 2HODB 3ZDMA 1Y47A 2IBZD 1NAYA 2OYHC 3D70A 3L72G 1S5LX 3ABVC 1LWUB 2AXTH 1L4AA 2NPSA 1PPJG 3V2NA 1VQNP 3BCCE 3GHGB 2O01J 1OWAA 1JNMA 1RE3C 2QA4P 1IJDB 4HJGH 1S9KE 1PPJD 3JCUH 4LLHA 2FYNC 5APTA 4RO0A 2Y9YA 2QJPB 3U1CA 1OVUA 4ZNCA 1M1JA 4HKZH 2FYUK 1KQGB 3PJSK 5KAFH 2P7JA 5GTHH 1QGKB 3TGUE 3W67A 1RY3A 2IBZI 3E1RA 3NMDA 2WQYC 3TK1A 1IC2A 5KLVD 1SQXG 3H1KE 2ZVOB 4C7NA 1LT1A 3NTNA 3H1JD 3IAOA 3EWKA 3PTZA 2Q3EA 5E79H 2RN0A 2V4HA 2E76C 3CCEP 4BRYB 4WBAA 2ZXXA 3JSVC 3L71J 2BASA 5CJ0A 4LGDE 3AE7C 3AEBC 2XDJA 1ZRTE 3H1HG 4GKGA 3HE5B 3VMXA 4YXWH 3MIWA 2RH0A 2Z5IA 1N7SD 2AXTE 4XE5B 1FE6A 5AVSB 1SQVD 4I2LC 1PGPA 3HE4A 2M0BA 1N73A 1LNQA 4OH8B 3V4WA 1LTTC 5APVA 3H1LG 3RBZA 2PAJA 3JCUE 2IFMA 2E74D 1NTZJ 3CWBE 3MD0A 1T3UA 2WZ7A 2R5BA 2YO3A 1GL2D 4IL6X 4UB6E 1SP4A 2N1TB 1JB0J 3VN0A 5BU8B 1LT9B 5KAIH 1Q7YQ 1E5WA 2KIKA 5KAFE 4U3FJ 3EFGA 4OWFA 5M1BA 2O1JA 1U7JA 1URQA 2ZVNB 3AEFC 3L75E 1HTLC 3RL0B 1FAVA 1CSBA 2HLOA 1GZLA 1Q86Q 4MN4C 3IF4A 1Q2NA 1PP9G 1VQKP 2IDBA 3A0HH 4TLFA 2CK3H 1JUNA 5AW0B 3A5TA 1E79H 2LXBA 2GUSA 5E79E 1S2EA 3SWYA 1D7MA 1IFNA 1Q82Q 4QMAA 5APSA 3AEGC 3VYIA 1W5CE 3CC2P 1LP1B 5KLIC 3P8CE 1AV1A 1YQ3C 1SQPG 5B5EE 4ASWA 1NTMG 3CMAP 1IFMA 1RQUA 3GMAA 3CX5H 3I56P 1BGYJ 4L75A 1KB9D 2OYHB 3CCLP 2H8PD 2KSJA 1QVGO 2W83C 1YJNP 1LTJC 2Y0CA 4U7JA 3B5NA 1BCCD 4D6TJ 2R32A 1JO5A 1L0LE 2WPSA 4RJTA 4I7ZB 3WU2E 1KTMA 2WITA 3C8VA 5KAIE 1R8EA 2FYNB 1S72P 4N6JA 1HUCA 1FZCA 1WMKA 1EDJA 3LIEA 2OTKE 2P10A 1IZNB 5CCGD 1AQTA 3RK2D 2DW3A 2WT7B 2WSFH 1KC8Q 1S5LE 3L35A 5AVWB 2R3SA 2C9LY 1KB9I 4XFJA 1NTKE 5H2FE 1N7SA 1IFDA 3T97A 1AFOA 1FDMA 1JTHB 3V2PA 3L73E 3L74E 2KNCA 1RF1B 4GODA 3RK3D 2FYUJ 1FC2C 4NPFX 3AE8C 3CX5E 4Z1MH 1LJ2A 4WY4D 1CZQA 2KP8A 2ZT9B 1GL2A 3BRVB 3LW5J 1ZN5A 1FS0E 1R5LA 3CXHH 2IYOA 1PIXA 1QL1A 1OFCX 2E43A 3FWLA 3AE3C 2KS1B 2JKVA 2XZRA 3MGNA 3GF3A 3ITKA 2RKLA 1SQBK 2FY8A 2Z5HA 2YKOA 2B88A 3H25A 1YIJP 1HJ0A 3AE4C 3M0DC 4WWIA 3HD7D 1WT6A 3L71D 2JEEA 2H89C 1HJBA 4NPDA 5AVZB 3G3ZA 1KYOE 1L0NE 2ZYDA 1ZR2A 5KJ7C 1SQQE 1ZXGA 1JM0A 2P67A 1SFCC 3V4QA 3BCCJ 3HUSC 3BRTB 1A02J 4KHXA 1LGHB 2K9JA 1VQPP 5AW4B 1NKNA 3A2AA 1NTKK 1VQ6P 1NTZD 2IBZE 4IL6E 3KQGA 5AVUB 2UWJE 1N7LA 4U3FG 3B8EB 2FXOA 1JOCA 5KLIB 2WPQA 1SLQA 1LTIC 1G2CB 3CXHE 3OAKA 3L72E 4U3FD 1EZVD 4B86A 3TGUJ 2W6AA 4IFDK 1Z56A 4WB4A 1PPJE 2N1TC 3H32B 1LTJB 1FZGA 5CCGA 1FZAA 1JY2P 2QM8A 1P84H 1RQVA 1IFPA 2E76D 2YO2A 1KQLA 4TT3H 1Q90D 1H0TA 3O8ZA 2E75C 2QJYC 4H13D 5CJ4A 1NU1K 1BGYG 2FFDB 2WWWA 4K3AA 1BCCJ 5BU5A 2N9BA 1RE4C 2I8DA 3FXDA 1KQFB 3TYYA 3AEEC 1EDIA 1NU1D 2QRXA 2A45I 4GOFA 3H1JE 5C39A 1GW4A 1N2DC 5CCHC 1EZVI 1KILB 1SS1A 2HPCA 2IBZG 1SQXE 4H0LC 2YMYA 2YMKA 3G6EP 4AUWA 4D6TD 3Q3DA 1HBWA 3A7OA 1PGOA 3D71A 1G1JA 4PV1D 1L4AC 1KILE 2QM7A 3M9QA 3A0BH 1SQVE 2ZAEB 4L76A 5CMZA 1GMJA 3V6IA 3CC7P 3PH0A 1XTCC 3F5HA 3H1HE 1MKMA 1AA0A 2A06D 1USDA 3F89A 4I7ZC 1ZW0A 3QWOC 1X79B 2HYNA 1T2KC 3HD7A 2XV5A 1M1JC 1P84E 5AVQB 3H1LE 4HB1A 1PV3A 2BCCD 5B66H 5AW3B 3GF7A 4JBZA 2Z4EA 2KSEA 3I5CA 3B5ND 2WMMA 4DZOA 2WSEJ 3S9OA 5KLVG 3H1ID 1FU1A 2B87A 3H1JG 2FYUD 2M5AA 2WPRA 3RL0g 5APXA 1K05A 1OVVA 3IFMA 4ASVA 2IFNA 1XTGB 3C9IA 2O01H 1PP9E 4AQRD 5AW9B 1RF1C 1SFCB 3HUSB 1CI6B 1SQBJ 4EDFA 1SQXK 1QLED 3SFEC 1NJIQ 1VQ8P 1SQVG 5APUA 2ZT9C 3L4FA 2IX7C 3A0BE 3M9BA 1EDLA 3CMEP 2Q5UA 3AECC 3AE2C 1KFMA 1SQPE 4GOEA 1KQSO 4OGQD 1NTME 2C9NY 5APQA 4JF7A 1K04A 3Q5PA 3CCUP 4EYYQ 1KV4A 2MKVA 3AE1C 1JY3P 1J1EC 2YXQB 3O6QB 2ZXEB 3N7NA 1BE3J 2B89A 1EQ7A 5B66E 3RGUA 2QSIA 3BCCD 4PJ0H 1UIXA 1NTKJ 1URQC 2BEQD 2QVAA 2HR3A 2FYZA 1NO4A 1RF0A 4H44C 1EDKA 3MUDA 4Y99C 3L73J 5GTHE 1S9KD 3AEAC 1LTBC 2MJZA 4HH2A 2E75B 2QJYB 1IFJA 3IN6A 5AW8B 3M91A 2OYIB 3RK3B 1YTZT 3TSIA 1Y9BA 3MP7B 4YPCA 4WY4B 2OARA 2WSCJ 2J59M 3TGUD 3HRNA 2H43A 1DEBA 2PFXA 4H0LB 3RK3E 2PGDA 2E5TA 3CD6P 2KI7B 3OJAB 3U1AA 5TISH 1T6AA 2M8RA 3AE6C 1QVFO 5AW1B 1BCCG 1NU1J 2A45H 1PGQA 2V7QJ 1AJYA 2JWDA 1L4AB 2NPSB 1YJ9P 3P32A 1SQPK 4DCKA 5GTIH 1JMMA 1ZRTD 1VQLP 1JCCA 2CPSA 1T3JA 1VF5D 3L70J 1K73Q 3KYQA 4IFMA 4PJ0E 3AE5C 1FZCC 2I1JA 3Q5SA 3VMAA 1M1JB 2OTLP 3G4SP 2FFDC 3TNUA 1AQ5A 2O1KA 2BEZF 1OW8A 2VRSA 3CWBD 1LTGC 2PRRA 2J58A 2Y0EA 3I55P 2O01N 3TF5A 1LTSC 1JMBA 2Q1KA 1KILC 2H88C 3A0HE 4C7NB 2WSSH 2BCCJ 4Y28J 3L72J 4NPEA 3L37A 1BDCA 3U59A 3N4XA 4O9BA 5KTBA 5AVYB 2YKPA 2E74C 1M8OB 3H1IJ 1HVVA 2FBWC 3HTKA 5TISE 3L36A 3RL0D 2HODA 2Y0DA 4U3FE 3K5BA 1BSNA 5DJUB 2H7HA 1G1IA 2D2CB 1DEEG 2NRGA 1FJPA 3HE4B 4N78E 1N73B 2JDIH 1FOSF 1OXZA 3P8CD 4YXDC 4KJMA 1YITP 1LWUA 3VMYA 1SQBG 1OMIA 1L0LK 3GHGA 1JEKA 1J1EB 1OVRA 1UIIA 3EFFK 5AVTB 1SQXJ 3CPWO 4UB8H 3L71G 2KYVA 2W8ZA 3WUUA 3VMZA 1VQ4P 3NXSA 1SQBD 4ZKPA 1URQB 4W7YA 1GK6A 4OVNF 1EXIA 2Q3IA 4H44B 4Y99B 2B9BA 2IYPA 2LKMA 1BGYE 1GU4A 1FZFA 3LW5H 3SFDC 1NTZG 1OX3A 3H1HJ 2XNXA 4D6TE 1T2KD 3A3YB 2A45G 1A02F 4DOJA 1FZEA 2GUVA 1BE3D 3H1LJ 1EZVG 1N86A 4JPZB 1NTKD 3USSA 3CCJP 4BRYA 4C7RA 1JY3O 1J1DB 3L73D 2QJKB 3BASA 2A06E 3L74D 1K8AQ 3PLNA 1YQ4C 1DIPA 3B5NB 4KT0J 3RK2C 1RHZB 2I1KA 3D6ZA 3S1KA 3HE5A 2G8YA 2GA1A 3IR9A 3MHVA 3H1KJ 1ZP0C 1RH5B 3VTPC 3R2PA 1YTZI 2OTJP 2K88A 5L8RJ 1MZ9A 1OZHA 1FZCB 1EXJA 1NOHA 3SWKA 1NU1G 1VL2A 2ZT9D 1NKZB 2N1TA 2C0WA 2FYUE 2OYIC 5KKZB 3RK3C 5APYA 1LT9A 1FOSE 2JJLA 3GLMA 5KLVE 1IK7A 2ZFCA 4WY4C 3B4SA 3V2QA 4D6TG 1SQPJ 3QH9A 1HWTC 1FDIA 1OW6A 1L0NK 3SSUA 1SQQK 1K9MQ 2JWAA 1N7SB 4IFFA 2P58A 3T97B 4OGQB 1HF9A 4I6MC 1VQOP 2JP3A 4IOIH 3CWBJ 2KNCB 1KYOD 1IK9A 2KB7P 1L0ND 3L70D 1GU5A 1X8YA 4RESB 2L91A 1KORA 1HH0A 2E74B 2NPSC 2QE7H 1GD2E 2A06G 5AW5B 1EC5A 2IZ1A 1M57D 1GL2B 1KB9H 1LP1A 2P1JA 2RMZA 3L75J 4GIFA 3AEDC 3HD7C 2BCCG 1TU3F 3B71A 2POHA 5AW7B 4DT0A 2OYHA 2K1AA 3PRJA 1ZOYC 1KZUB 1GDTA 1X0TA 3CXHD 1YYCA 3L72D 2W6JH 3H1IG 1YHQP 2FYUG 2M3EA 1DX7A 1BDDA 2KUBA 3GG2A 4GDOA 1VPCA 3KXDA 4HYTB 1KYOI 3M0AA 1RE3A 1AVYA 1IFIA 4UB6H 4EOTA 3V5BA 5K5GB 1IO4A 3CCRP 1KN7A 2P2UA 2R3CA 1N8RQ 1S3JA 5KLVK 5AW6B 3FX0A 3UIAA 2KLVA 5EFWB 4I1LA 3OW2O 2L5GB 3CCVP 2K9JB 2M3BA 5CBOA 2WT7A 5AVXB 1FDOA 1L0LJ 2XKMA 1AVOA 2YIUB 4PD4D 3VP9A 2KK7A 1ZR4A 2YKQA 2WPVB 1FZBA 3CXHI 3S4RA 1VF5B 2WVRA 2D2CC 1SQXD 1KB9E 3WUVA 2K3RA 1N73C 3CC4P 1JTHA 4W80A 2WSEH 1U7MA 4L73A 3LIDA 1RF1A 4H13C 1SQVK 5CBNA 1BCCE 2KOGA 1HGZA 2Y9ZA 1LTAC 5B5EH 3BCCG 2KLUA 2HFED
chains in the Genus database with same CATH topology
3H1ID 2Q3EA 3PRJA 2RN0A 2FYUD 3CWBD 3CXHD 3L72D 1NU1D 1SQBD 2IBZD 2Y0EA 2QJYB 2N9YB 1SQPD 3H1HD 2O3JA 1NTMD 3CX5D 3GG2A 3TF5A 3PHLA 2KS1A 5KKZB 3TDKA 1NTZD 4D6TD 1SQVD 4EDFA 3TGUD 1P84D 1KB9D 3H1LD 1L0LD 3GW6A 2Y0CA 5KLIB 1PPJD 2JWAA 1BCCD 2K9JB 4A7PA 4U3FD 1EZVD 2QJPB 2KNCB 1KYOD 3FWLA 1BE3D 1L0ND 4RJTA 3L70D 3L75D 2A06D 2L91A 2YIUB 4PD4D 2Y0DA 3ITKA 1NTKD 3H1KD 2FYNB 3L73D 2QJKB 3L74D 1SQXD 1ZRTD 3PLNA 2BCCD 5TJHA 2QG4A 2RMZA 3KHUA 1BGYD 1PP9D 5KLVD 3BCCD 1SQQD 3L71D 3H1JD 3VMAA 3PTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1I D;  2Q3E A;  3PRJ A;  2RN0 A;  2FYU D;  3CWB D;  3CXH D;  3L72 D;  1NU1 D;  1SQB D;  2IBZ D;  2Y0E A;  2QJY B;  2N9Y B;  1SQP D;  3H1H D;  2O3J A;  1NTM D;  3CX5 D;  3GG2 A;  3TF5 A;  3PHL A;  2KS1 A;  5KKZ B;  3TDK A;  1NTZ D;  4D6T D;  1SQV D;  4EDF A;  3TGU D;  1P84 D;  1KB9 D;  3H1L D;  1L0L D;  3GW6 A;  2Y0C A;  5KLI B;  1PPJ D;  2JWA A;  1BCC D;  2K9J B;  4A7P A;  4U3F D;  1EZV D;  2QJP B;  2KNC B;  1KYO D;  3FWL A;  1BE3 D;  1L0N D;  4RJT A;  3L70 D;  3L75 D;  2A06 D;  2L91 A;  2YIU B;  4PD4 D;  2Y0D A;  3ITK A;  1NTK D;  3H1K D;  2FYN B;  3L73 D;  2QJK B;  3L74 D;  1SQX D;  1ZRT D;  3PLN A;  2BCC D;  5TJH A;  2QG4 A;  2RMZ A;  3KHU A;  1BGY D;  1PP9 D;  5KLV D;  3BCC D;  1SQQ D;  3L71 D;  3H1J D;  3VMA A;  3PTZ A; 
#chains in the Genus database with same CATH topology
 1KIL D;  3P7K A;  3RK2 B;  1RF0 C;  3MUD C;  3W68 A;  3H1H D;  1VQ9 P;  2AEM A;  2KS1 A;  1H0T B;  1NH4 A;  3KPE A;  3L74 J;  2KXP B;  1M56 D;  2PP6 A;  4PD4 I;  3WU2 H;  1P84 D;  3H1L D;  4PV1 C;  3MZW B;  3TGU G;  3M9H A;  3H1K G;  2HPC B;  2ITA A;  1S5L H;  2YNY A;  2W27 A;  3M06 A;  1M90 Q;  1R5S A;  1NAF A;  1NGM B;  3H1K D;  1NYH A;  1YBK A;  1MUU A;  2JO1 A;  1J1D C;  2QJK C;  5H2F H;  2LR2 A;  1PP9 D;  3KZI H;  1DD4 A;  2R44 A;  3B5N C;  1JY2 O;  2ZYA A;  2WSF J;  2JR8 A;  1NTM K;  1P84 I;  1Y8A A;  2IPP A;  5KJ7 D;  1L0N J;  5APW A;  3HD7 B;  1SFC D;  4BWN A;  1SQQ J;  1W2B O;  3G9R A;  1G2C A;  2N9Y B;  1SQP D;  1ZV8 A;  3CWB G;  1NTM D;  2WSC H;  2J5U A;  1SQB E;  1S1C X;  3P8M C;  3H32 A;  5KKZ C;  1LTJ A;  2E42 A;  3Q5R A;  1WRG A;  4R4M A;  1DD3 A;  2FXP A;  3L71 E;  3Q1M A;  3WMM 0;  2B87 B;  2M5A B;  2XND H;  3L75 G;  1JY2 N;  2AEF A;  2QIW A;  2GM4 A;  1N7S C;  2V7Q H;  1QEX A;  1X22 A;  4OGQ C;  1GK4 A;  2FFD A;  3L75 D;  1PL5 A;  2N1T D;  2SPZ A;  1ZLL A;  2KZJ A;  3E7K A;  1NTZ E;  3SWF A;  1KYO H;  5AW2 B;  1NVO A;  1BE3 E;  4JQ0 D;  2ZJS E;  1GL2 C;  5TJH A;  3KDP B;  2QG4 A;  1KIL A;  3KHU A;  3KZI E;  1VQ7 P;  3FGA D;  4M3L A;  2E75 D;  2W6B A;  1EZV E;  1L2P A;  4CPG A;  3R4Y A;  3E1I A;  4IL6 H;  2E76 B;  1LWU C;  5GTI E;  2Q7C A;  1H88 A;  4YTP C;  2QEX P;  5KLV J;  3GHG C;  4EI2 A;  4H13 B;  2C0X A;  4R4L A;  2XU6 A;  1KMI Z;  3H1J J;  5CCH D;  1L0L G;  4H0L D;  4BXL A;  1SVF A;  3FXE A;  2QJP C;  5BVZ A;  2ZYG A;  1KFN A;  1L0L D;  5DJT B;  2KZI A;  5AVV B;  2FXM A;  1DH3 A;  1L4A D;  1VQ5 P;  3CCS P;  1W2E A;  2NPS D;  3CL3 D;  3H6P A;  4ZKU A;  4W7Z A;  4K35 A;  3RBX A;  1NU1 E;  1U57 A;  3G71 P;  1SQV J;  3D6Y A;  2NZ2 A;  1PGJ A;  1S4X A;  4PV1 B;  3PP5 A;  1YI2 P;  1FJK A;  3BAT A;  3II6 A;  4EIJ A;  1BE3 G;  2YIU C;  3M0D A;  3JC2 2;  1NTK G;  2OYO A;  3L70 E;  1X9V A;  4PD4 H;  1VF5 C;  4JYB A;  1MV8 A;  2LXC B;  1M1K Q;  3EQ2 A;  1NTZ K;  3L73 G;  3L74 G;  5KJ7 A;  1H8A A;  4LC1 A;  2FKW B;  1SFC A;  2R5D A;  1ZME C;  3HUS A;  3CLQ A;  1CI6 A;  4DJG A;  1OW7 A;  1QL2 A;  1J2J B;  5CCG C;  2Q9I A;  2YXR B;  3WUT A;  2E5Y A;  2O3J A;  1KD1 Q;  1PZQ A;  1VQM P;  3CX5 D;  3PHL A;  2WTY A;  3NFQ A;  1H89 A;  2BCC E;  2IZ0 A;  3TDK A;  2OQQ A;  2Q6Q A;  1CW5 A;  4UB8 E;  4WVZ A;  1MFT A;  1PP9 J;  4N78 D;  3OA7 A;  4AYC A;  3VP8 A;  1BSH A;  3AE9 C;  3TNU B;  2AXC A;  1T8Z A;  1MFZ A;  1LT9 C;  3GW6 A;  1VDF A;  3H1I E;  3O6Q A;  1FBM A;  1USE A;  1JY3 N;  4A7P A;  4L74 A;  2D2C D;  3Q2Y A;  2K9Y A;  4RKU J;  3BVH A;  2OGU A;  4C46 A;  3CCM P;  3V2R A;  5AVR B;  3FWN A;  3C1L A;  3RL0 C;  5CHX A;  1GTW A;  3VOP A;  1NTM J;  4ZMD A;  1L0N G;  1NHL A;  3L70 G;  1HGV A;  4GT1 A;  2G3A A;  1OIP A;  1SQQ G;  1JCD A;  1Q81 Q;  3MTU E;  3CI9 A;  1YJW P;  1NWQ A;  3CCQ P;  1M7L A;  4N3Y B;  4PD4 E;  2OYI A;  1BGY D;  3CX5 I;  1PFI A;  1SQQ D;  2HG5 D;  2CPB A;  3HTK B;  1RE4 A;  4XA4 A;  2AEJ A;  1URQ D;  2K37 A;  4WY4 A;  2W90 A;  4JYC A;  4H44 D;  1QX8 A;  1GW3 A;  5CCH A;  2HOD B;  3ZDM A;  1Y47 A;  2IBZ D;  1NAY A;  2OYH C;  3D70 A;  3L72 G;  1S5L X;  3ABV C;  1LWU B;  2AXT H;  1L4A A;  2NPS A;  1PPJ G;  3V2N A;  1VQN P;  3BCC E;  3GHG B;  2O01 J;  1OWA A;  1JNM A;  1RE3 C;  2QA4 P;  1IJD B;  4HJG H;  1S9K E;  1PPJ D;  3JCU H;  4LLH A;  2FYN C;  5APT A;  4RO0 A;  2Y9Y A;  2QJP B;  3U1C A;  1OVU A;  4ZNC A;  1M1J A;  4HKZ H;  2FYU K;  1KQG B;  3PJS K;  5KAF H;  2P7J A;  5GTH H;  1QGK B;  3TGU E;  3W67 A;  1RY3 A;  2IBZ I;  3E1R A;  3NMD A;  2WQY C;  3TK1 A;  1IC2 A;  5KLV D;  1SQX G;  3H1K E;  2ZVO B;  4C7N A;  1LT1 A;  3NTN A;  3H1J D;  3IAO A;  3EWK A;  3PTZ A;  2Q3E A;  5E79 H;  2RN0 A;  2V4H A;  2E76 C;  3CCE P;  4BRY B;  4WBA A;  2ZXX A;  3JSV C;  3L71 J;  2BAS A;  5CJ0 A;  4LGD E;  3AE7 C;  3AEB C;  2XDJ A;  1ZRT E;  3H1H G;  4GKG A;  3HE5 B;  3VMX A;  4YXW H;  3MIW A;  2RH0 A;  2Z5I A;  1N7S D;  2AXT E;  4XE5 B;  1FE6 A;  5AVS B;  1SQV D;  4I2L C;  1PGP A;  3HE4 A;  2M0B A;  1N73 A;  1LNQ A;  4OH8 B;  3V4W A;  1LTT C;  5APV A;  3H1L G;  3RBZ A;  2PAJ A;  3JCU E;  2IFM A;  2E74 D;  1NTZ J;  3CWB E;  3MD0 A;  1T3U A;  2WZ7 A;  2R5B A;  2YO3 A;  1GL2 D;  4IL6 X;  4UB6 E;  1SP4 A;  2N1T B;  1JB0 J;  3VN0 A;  5BU8 B;  1LT9 B;  5KAI H;  1Q7Y Q;  1E5W A;  2KIK A;  5KAF E;  4U3F J;  3EFG A;  4OWF A;  5M1B A;  2O1J A;  1U7J A;  1URQ A;  2ZVN B;  3AEF C;  3L75 E;  1HTL C;  3RL0 B;  1FAV A;  1CSB A;  2HLO A;  1GZL A;  1Q86 Q;  4MN4 C;  3IF4 A;  1Q2N A;  1PP9 G;  1VQK P;  2IDB A;  3A0H H;  4TLF A;  2CK3 H;  1JUN A;  5AW0 B;  3A5T A;  1E79 H;  2LXB A;  2GUS A;  5E79 E;  1S2E A;  3SWY A;  1D7M A;  1IFN A;  1Q82 Q;  4QMA A;  5APS A;  3AEG C;  3VYI A;  1W5C E;  3CC2 P;  1LP1 B;  5KLI C;  3P8C E;  1AV1 A;  1YQ3 C;  1SQP G;  5B5E E;  4ASW A;  1NTM G;  3CMA P;  1IFM A;  1RQU A;  3GMA A;  3CX5 H;  3I56 P;  1BGY J;  4L75 A;  1KB9 D;  2OYH B;  3CCL P;  2H8P D;  2KSJ A;  1QVG O;  2W83 C;  1YJN P;  1LTJ C;  2Y0C A;  4U7J A;  3B5N A;  1BCC D;  4D6T J;  2R32 A;  1JO5 A;  1L0L E;  2WPS A;  4RJT A;  4I7Z B;  3WU2 E;  1KTM A;  2WIT A;  3C8V A;  5KAI E;  1R8E A;  2FYN B;  1S72 P;  4N6J A;  1HUC A;  1FZC A;  1WMK A;  1EDJ A;  3LIE A;  2OTK E;  2P10 A;  1IZN B;  5CCG D;  1AQT A;  3RK2 D;  2DW3 A;  2WT7 B;  2WSF H;  1KC8 Q;  1S5L E;  3L35 A;  5AVW B;  2R3S A;  2C9L Y;  1KB9 I;  4XFJ A;  1NTK E;  5H2F E;  1N7S A;  1IFD A;  3T97 A;  1AFO A;  1FDM A;  1JTH B;  3V2P A;  3L73 E;  3L74 E;  2KNC A;  1RF1 B;  4GOD A;  3RK3 D;  2FYU J;  1FC2 C;  4NPF X;  3AE8 C;  3CX5 E;  4Z1M H;  1LJ2 A;  4WY4 D;  1CZQ A;  2KP8 A;  2ZT9 B;  1GL2 A;  3BRV B;  3LW5 J;  1ZN5 A;  1FS0 E;  1R5L A;  3CXH H;  2IYO A;  1PIX A;  1QL1 A;  1OFC X;  2E43 A;  3FWL A;  3AE3 C;  2KS1 B;  2JKV A;  2XZR A;  3MGN A;  3GF3 A;  3ITK A;  2RKL A;  1SQB K;  2FY8 A;  2Z5H A;  2YKO A;  2B88 A;  3H25 A;  1YIJ P;  1HJ0 A;  3AE4 C;  3M0D C;  4WWI A;  3HD7 D;  1WT6 A;  3L71 D;  2JEE A;  2H89 C;  1HJB A;  4NPD A;  5AVZ B;  3G3Z A;  1KYO E;  1L0N E;  2ZYD A;  1ZR2 A;  5KJ7 C;  1SQQ E;  1ZXG A;  1JM0 A;  2P67 A;  1SFC C;  3V4Q A;  3BCC J;  3HUS C;  3BRT B;  1A02 J;  4KHX A;  1LGH B;  2K9J A;  1VQP P;  5AW4 B;  1NKN A;  3A2A A;  1NTK K;  1VQ6 P;  1NTZ D;  2IBZ E;  4IL6 E;  3KQG A;  5AVU B;  2UWJ E;  1N7L A;  4U3F G;  3B8E B;  2FXO A;  1JOC A;  5KLI B;  2WPQ A;  1SLQ A;  1LTI C;  1G2C B;  3CXH E;  3OAK A;  3L72 E;  4U3F D;  1EZV D;  4B86 A;  3TGU J;  2W6A A;  4IFD K;  1Z56 A;  4WB4 A;  1PPJ E;  2N1T C;  3H32 B;  1LTJ B;  1FZG A;  5CCG A;  1FZA A;  1JY2 P;  2QM8 A;  1P84 H;  1RQV A;  1IFP A;  2E76 D;  2YO2 A;  1KQL A;  4TT3 H;  1Q90 D;  1H0T A;  3O8Z A;  2E75 C;  2QJY C;  4H13 D;  5CJ4 A;  1NU1 K;  1BGY G;  2FFD B;  2WWW A;  4K3A A;  1BCC J;  5BU5 A;  2N9B A;  1RE4 C;  2I8D A;  3FXD A;  1KQF B;  3TYY A;  3AEE C;  1EDI A;  1NU1 D;  2QRX A;  2A45 I;  4GOF A;  3H1J E;  5C39 A;  1GW4 A;  1N2D C;  5CCH C;  1EZV I;  1KIL B;  1SS1 A;  2HPC A;  2IBZ G;  1SQX E;  4H0L C;  2YMY A;  2YMK A;  3G6E P;  4AUW A;  4D6T D;  3Q3D A;  1HBW A;  3A7O A;  1PGO A;  3D71 A;  1G1J A;  4PV1 D;  1L4A C;  1KIL E;  2QM7 A;  3M9Q A;  3A0B H;  1SQV E;  2ZAE B;  4L76 A;  5CMZ A;  1GMJ A;  3V6I A;  3CC7 P;  3PH0 A;  1XTC C;  3F5H A;  3H1H E;  1MKM A;  1AA0 A;  2A06 D;  1USD A;  3F89 A;  4I7Z C;  1ZW0 A;  3QWO C;  1X79 B;  2HYN A;  1T2K C;  3HD7 A;  2XV5 A;  1M1J C;  1P84 E;  5AVQ B;  3H1L E;  4HB1 A;  1PV3 A;  2BCC D;  5B66 H;  5AW3 B;  3GF7 A;  4JBZ A;  2Z4E A;  2KSE A;  3I5C A;  3B5N D;  2WMM A;  4DZO A;  2WSE J;  3S9O A;  5KLV G;  3H1I D;  1FU1 A;  2B87 A;  3H1J G;  2FYU D;  2M5A A;  2WPR A;  3RL0 g;  5APX A;  1K05 A;  1OVV A;  3IFM A;  4ASV A;  2IFN A;  1XTG B;  3C9I A;  2O01 H;  1PP9 E;  4AQR D;  5AW9 B;  1RF1 C;  1SFC B;  3HUS B;  1CI6 B;  1SQB J;  4EDF A;  1SQX K;  1QLE D;  3SFE C;  1NJI Q;  1VQ8 P;  1SQV G;  5APU A;  2ZT9 C;  3L4F A;  2IX7 C;  3A0B E;  3M9B A;  1EDL A;  3CME P;  2Q5U A;  3AEC C;  3AE2 C;  1KFM A;  1SQP E;  4GOE A;  1KQS O;  4OGQ D;  1NTM E;  2C9N Y;  5APQ A;  4JF7 A;  1K04 A;  3Q5P A;  3CCU P;  4EYY Q;  1KV4 A;  2MKV A;  3AE1 C;  1JY3 P;  1J1E C;  2YXQ B;  3O6Q B;  2ZXE B;  3N7N A;  1BE3 J;  2B89 A;  1EQ7 A;  5B66 E;  3RGU A;  2QSI A;  3BCC D;  4PJ0 H;  1UIX A;  1NTK J;  1URQ C;  2BEQ D;  2QVA A;  2HR3 A;  2FYZ A;  1NO4 A;  1RF0 A;  4H44 C;  1EDK A;  3MUD A;  4Y99 C;  3L73 J;  5GTH E;  1S9K D;  3AEA C;  1LTB C;  2MJZ A;  4HH2 A;  2E75 B;  2QJY B;  1IFJ A;  3IN6 A;  5AW8 B;  3M91 A;  2OYI B;  3RK3 B;  1YTZ T;  3TSI A;  1Y9B A;  3MP7 B;  4YPC A;  4WY4 B;  2OAR A;  2WSC J;  2J59 M;  3TGU D;  3HRN A;  2H43 A;  1DEB A;  2PFX A;  4H0L B;  3RK3 E;  2PGD A;  2E5T A;  3CD6 P;  2KI7 B;  3OJA B;  3U1A A;  5TIS H;  1T6A A;  2M8R A;  3AE6 C;  1QVF O;  5AW1 B;  1BCC G;  1NU1 J;  2A45 H;  1PGQ A;  2V7Q J;  1AJY A;  2JWD A;  1L4A B;  2NPS B;  1YJ9 P;  3P32 A;  1SQP K;  4DCK A;  5GTI H;  1JMM A;  1ZRT D;  1VQL P;  1JCC A;  2CPS A;  1T3J A;  1VF5 D;  3L70 J;  1K73 Q;  3KYQ A;  4IFM A;  4PJ0 E;  3AE5 C;  1FZC C;  2I1J A;  3Q5S A;  3VMA A;  1M1J B;  2OTL P;  3G4S P;  2FFD C;  3TNU A;  1AQ5 A;  2O1K A;  2BEZ F;  1OW8 A;  2VRS A;  3CWB D;  1LTG C;  2PRR A;  2J58 A;  2Y0E A;  3I55 P;  2O01 N;  3TF5 A;  1LTS C;  1JMB A;  2Q1K A;  1KIL C;  2H88 C;  3A0H E;  4C7N B;  2WSS H;  2BCC J;  4Y28 J;  3L72 J;  4NPE A;  3L37 A;  1BDC A;  3U59 A;  3N4X A;  4O9B A;  5KTB A;  5AVY B;  2YKP A;  2E74 C;  1M8O B;  3H1I J;  1HVV A;  2FBW C;  3HTK A;  5TIS E;  3L36 A;  3RL0 D;  2HOD A;  2Y0D A;  4U3F E;  3K5B A;  1BSN A;  5DJU B;  2H7H A;  1G1I A;  2D2C B;  1DEE G;  2NRG A;  1FJP A;  3HE4 B;  4N78 E;  1N73 B;  2JDI H;  1FOS F;  1OXZ A;  3P8C D;  4YXD C;  4KJM A;  1YIT P;  1LWU A;  3VMY A;  1SQB G;  1OMI A;  1L0L K;  3GHG A;  1JEK A;  1J1E B;  1OVR A;  1UII A;  3EFF K;  5AVT B;  1SQX J;  3CPW O;  4UB8 H;  3L71 G;  2KYV A;  2W8Z A;  3WUU A;  3VMZ A;  1VQ4 P;  3NXS A;  1SQB D;  4ZKP A;  1URQ B;  4W7Y A;  1GK6 A;  4OVN F;  1EXI A;  2Q3I A;  4H44 B;  4Y99 B;  2B9B A;  2IYP A;  2LKM A;  1BGY E;  1GU4 A;  1FZF A;  3LW5 H;  3SFD C;  1NTZ G;  1OX3 A;  3H1H J;  2XNX A;  4D6T E;  1T2K D;  3A3Y B;  2A45 G;  1A02 F;  4DOJ A;  1FZE A;  2GUV A;  1BE3 D;  3H1L J;  1EZV G;  1N86 A;  4JPZ B;  1NTK D;  3USS A;  3CCJ P;  4BRY A;  4C7R A;  1JY3 O;  1J1D B;  3L73 D;  2QJK B;  3BAS A;  2A06 E;  3L74 D;  1K8A Q;  3PLN A;  1YQ4 C;  1DIP A;  3B5N B;  4KT0 J;  3RK2 C;  1RHZ B;  2I1K A;  3D6Z A;  3S1K A;  3HE5 A;  2G8Y A;  2GA1 A;  3IR9 A;  3MHV A;  3H1K J;  1ZP0 C;  1RH5 B;  3VTP C;  3R2P A;  1YTZ I;  2OTJ P;  2K88 A;  5L8R J;  1MZ9 A;  1OZH A;  1FZC B;  1EXJ A;  1NOH A;  3SWK A;  1NU1 G;  1VL2 A;  2ZT9 D;  1NKZ B;  2N1T A;  2C0W A;  2FYU E;  2OYI C;  5KKZ B;  3RK3 C;  5APY A;  1LT9 A;  1FOS E;  2JJL A;  3GLM A;  5KLV E;  1IK7 A;  2ZFC A;  4WY4 C;  3B4S A;  3V2Q A;  4D6T G;  1SQP J;  3QH9 A;  1HWT C;  1FDI A;  1OW6 A;  1L0N K;  3SSU A;  1SQQ K;  1K9M Q;  2JWA A;  1N7S B;  4IFF A;  2P58 A;  3T97 B;  4OGQ B;  1HF9 A;  4I6M C;  1VQO P;  2JP3 A;  4IOI H;  3CWB J;  2KNC B;  1KYO D;  1IK9 A;  2KB7 P;  1L0N D;  3L70 D;  1GU5 A;  1X8Y A;  4RES B;  2L91 A;  1KOR A;  1HH0 A;  2E74 B;  2NPS C;  2QE7 H;  1GD2 E;  2A06 G;  5AW5 B;  1EC5 A;  2IZ1 A;  1M57 D;  1GL2 B;  1KB9 H;  1LP1 A;  2P1J A;  2RMZ A;  3L75 J;  4GIF A;  3AED C;  3HD7 C;  2BCC G;  1TU3 F;  3B71 A;  2POH A;  5AW7 B;  4DT0 A;  2OYH A;  2K1A A;  3PRJ A;  1ZOY C;  1KZU B;  1GDT A;  1X0T A;  3CXH D;  1YYC A;  3L72 D;  2W6J H;  3H1I G;  1YHQ P;  2FYU G;  2M3E A;  1DX7 A;  1BDD A;  2KUB A;  3GG2 A;  4GDO A;  1VPC A;  3KXD A;  4HYT B;  1KYO I;  3M0A A;  1RE3 A;  1AVY A;  1IFI A;  4UB6 H;  4EOT A;  3V5B A;  5K5G B;  1IO4 A;  3CCR P;  1KN7 A;  2P2U A;  2R3C A;  1N8R Q;  1S3J A;  5KLV K;  5AW6 B;  3FX0 A;  3UIA A;  2KLV A;  5EFW B;  4I1L A;  3OW2 O;  2L5G B;  3CCV P;  2K9J B;  2M3B A;  5CBO A;  2WT7 A;  5AVX B;  1FDO A;  1L0L J;  2XKM A;  1AVO A;  2YIU B;  4PD4 D;  3VP9 A;  2KK7 A;  1ZR4 A;  2YKQ A;  2WPV B;  1FZB A;  3CXH I;  3S4R A;  1VF5 B;  2WVR A;  2D2C C;  1SQX D;  1KB9 E;  3WUV A;  2K3R A;  1N73 C;  3CC4 P;  1JTH A;  4W80 A;  2WSE H;  1U7M A;  4L73 A;  3LID A;  1RF1 A;  4H13 C;  1SQV K;  5CBN A;  1BCC E;  2KOG A;  1HGZ A;  2Y9Z A;  1LTA C;  5B5E H;  3BCC G;  2KLU A;  2HFE D; 
#chains in the Genus database with same CATH homology
 3H1I D;  2Q3E A;  3PRJ A;  2RN0 A;  2FYU D;  3CWB D;  3CXH D;  3L72 D;  1NU1 D;  1SQB D;  2IBZ D;  2Y0E A;  2QJY B;  2N9Y B;  1SQP D;  3H1H D;  2O3J A;  1NTM D;  3CX5 D;  3GG2 A;  3TF5 A;  3PHL A;  2KS1 A;  5KKZ B;  3TDK A;  1NTZ D;  4D6T D;  1SQV D;  4EDF A;  3TGU D;  1P84 D;  1KB9 D;  3H1L D;  1L0L D;  3GW6 A;  2Y0C A;  5KLI B;  1PPJ D;  2JWA A;  1BCC D;  2K9J B;  4A7P A;  4U3F D;  1EZV D;  2QJP B;  2KNC B;  1KYO D;  3FWL A;  1BE3 D;  1L0N D;  4RJT A;  3L70 D;  3L75 D;  2A06 D;  2L91 A;  2YIU B;  4PD4 D;  2Y0D A;  3ITK A;  1NTK D;  3H1K D;  2FYN B;  3L73 D;  2QJK B;  3L74 D;  1SQX D;  1ZRT D;  3PLN A;  2BCC D;  5TJH A;  2QG4 A;  2RMZ A;  3KHU A;  1BGY D;  1PP9 D;  5KLV D;  3BCC D;  1SQQ D;  3L71 D;  3H1J D;  3VMA A;  3PTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...