2KNCB

Platelet integrin alfaiib-beta3 transmembrane-cytoplasmic heterocomplex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
79
structure length
79
Chain Sequence
GAMGSKGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNITYRGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Structure of an integrin alphaIIb beta3 transmembrane-cytoplasmic heterocomplex provides insight into integrin activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 20
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08725 Integrin_b_cyt Integrin beta cytoplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 2kncB00
2QJKB 1EZVD 1SQBD 2IBZD 3PLNA 3PHLA 2RN0A 1NTMD 2RMZA 3H1HD 1L0ND 1SQVD 3L74D 1BCCD 2Q3EA 2O3JA 1NU1D 5TJHA 3TGUD 3L75D 1BGYD 2A06D 2QG4A 1ZRTD 3PTZA 5KKZB 2KS1A 3VMAA 3TF5A 2QJPB 1KB9D 3GW6A 4D6TD 3L71D 1L0LD 3ITKA 1NTKD 2FYUD 3H1KD 2YIUB 2K9JB 4EDFA 3CXHD 3H1JD 1PPJD 2Y0EA 3CX5D 5KLIB 4U3FD 2JWAA 2Y0DA 1SQPD 4PD4D 3GG2A 2KNCB 3L70D 2QJYB 4RJTA 3PRJA 3BCCD 1NTZD 5KLVD 3TDKA 1P84D 2FYNB 1SQQD 1SQXD 3H1ID 3L72D 4A7PA 2Y0CA 3CWBD 3H1LD 3L73D 1KYOD 2N9YB 2BCCD 1PP9D 3FWLA 3KHUA 1BE3D 2L91A
chains in the Genus database with same CATH superfamily
2OQQA 2W27A 3CLQA 1LP1A 3O6QA 1N7LA 3NTNA 5BU5A 1X9VA 3PLNA 3G4SP 1KTMA 5M1BA 4JYBA 2CPBA 5CCHC 3E1RA 2J58A 3II6A 5B5EE 2A06G 3Q3DA 3RK3C 2IFNA 2WSSH 3IF4A 1RF0C 1J1EC 2AEMA 3H1JG 3IN6A 4AYCA 1Q90D 5APTA 3HD7D 5KAFE 2HG5D 2WTYA 2KK7A 1EXIA 2JKVA 4OGQD 1EDLA 1SQQE 2VRSA 2YIUB 4EDFA 2E76C 2RH0A 3CWBE 3L36A 1KYOE 1NWQA 1IO4A 1KQGB 4YTPC 1SQXG 4C7NB 3V6IA 1EDJA 4PD4D 1PFIA 3RK2B 2C0WA 3RGUA 1S1CX 2PAJA 2IZ0A 5CBOA 1VQ6P 1R5LA 4JBZA 4H44B 2FYNB 1SQQD 1OVVA 3CWBD 3BVHA 1KYOD 2N1TD 3NMDA 1OW8A 1NTMG 3EFFK 2IFMA 1L4AD 1EZVD 1JUNA 1SQVJ 2A06E 2QE7H 2OTKE 3H25A 2KP8A 2QIWA 3PJSK 1S2EA 4C46A 3AE3C 2FXMA 4DZOA 1M90Q 2PRRA 1QLED 4L73A 1NVOA 1SQBK 2A45I 2QA4P 4NPDA 3D71A 2A06D 1H89A 3AE8C 1OWAA 1J1DB 2IZ1A 4KT0J 2D2CB 1G2CA 1BGYJ 3Q2YA 1P84E 3F89A 4YXDC 3B5ND 4NPEA 1SQXE 3AEDC 3U1CA 3H1JD 3HTKA 1YI2P 1LT9A 5KLIB 5APQA 1JOCA 3WUTA 5APSA 3A0BE 1P84D 3V2RA 1SQXD 1T2KC 4IL6H 1NTME 3Q1MA 2YMYA 1BSNA 2IBZG 3IAOA 1YJNP 1SFCC 1FZBA 1PIXA 2PGDA 1AFOA 3BCCJ 3RK3B 1KD1Q 1GL2A 4DCKA 5KLVK 4IFDK 4BRYB 2CK3H 1L0NG 1SQVG 1VQ4P 5AW3B 1VQKP 1S5LE 1LT1A 5AW4B 3H1KG 3TGUG 4DOJA 1PP9J 5AVYB 1NTMD 1FC2C 1SP4A 2E75D 2JDIH 4WB4A 4ZMDA 2XDJA 2OARA 3C9IA 3AEGC 3CL3D 1ZLLA 2E76B 2FBWC 1LGHB 3PH0A 3HE5B 1HJBA 3OJAB 1HGZA 5CCHD 3JSVC 2MJZA 2KSEA 1ZXGA 3E1IA 3D6ZA 2E74D 2GUVA 3CCJP 1KN7A 3RK3D 2P10A 5APWA 2P2UA 2LXCB 5KTBA 2H7HA 4DT0A 2LR2A 1JY2P 4U7JA 1H88A 1NH4A 2ZAEB 1YBKA 2WSEH 1SQQK 1NKZB 4I7ZC 2IBZE 4W80A 4OVNF 4ZKPA 4IFMA 5AVUB 1JMMA 2KXPB 2JWDA 2Z4EA 1T3JA 2O1KA 2O1JA 2Y0CA 1L0NE 1SQVE 3L70J 4N6JA 2WT7B 1NTZK 3Q5PA 1LJ2A 3TGUE 2FFDC 1LTGC 3JCUE 1Y47A 5GTHE 1YYCA 5DJTB 2IBZD 4WY4C 4GODA 3N4XA 2XZRA 3CCLP 3KZIH 4H0LC 3IFMA 1L0ND 1SQVD 3H32A 2M0BA 2KLVA 4LLHA 1Z56A 3GMAA 1FZCA 3V5BA 5L8RJ 3TGUD 3P32A 1FS0E 3LIDA 2KS1B 1TU3F 1N2DC 1M1JA 2QJKC 5BVZA 3TSIA 1W2EA 1X22A 5AVSB 1SS1A 2W6JH 5B5EH 5AVZB 3D6YA 1NU1K 2WQYC 2C9LY 1FOSF 1KILA 1YQ3C 4U3FJ 4C7RA 2IYOA 1S3JA 1VQNP 5AW1B 1SFCB 3T97A 4PD4H 2O01J 2R44A 1VQOP 3L72G 5KAFH 2HODB 1ZR4A 3CCVP 1FAVA 1HGVA 4RO0A 4TT3H 2YXQB 5KJ7C 1PGJA 2BCCJ 1M56D 2WWWA 1SQPK 2NPSC 2PP6A 1NGMB 1KYOH 2E5YA 2Q1KA 1N7SC 1ZW0A 2OYHA 2ZYDA 1PP9E 1JCCA 2O01N 1N86A 3HD7A 3GF3A 3L37A 3P8CD 1JNMA 2R3CA 4UB6E 3PHLA 1KC8Q 1H0TB 3K5BA 3MUDC 4YPCA 3BRVB 2IPPA 1GK4A 1NO4A 3OA7A 1VF5C 5E79E 3RK2C 3AE4C 1BSHA 1N73C 1NTKG 2FYNC 3F5HA 1CZQA 3AE9C 2QM7A 2H89C 3QH9A 4I7ZB 2ZYAA 2HYNA 4I2LC 2ZFCA 4U3FG 4I1LA 2M5AB 3GW6A 2N1TA 3VP8A 3L72E 2Y0EA 1NAFA 1L4AA 1K73Q 3UIAA 4AQRD 2FFDB 3H1JJ 4O9BA 2C9NY 3L73G 3B8EB 1GK6A 4WY4B 1FOSE 2BCCG 1P84H 2W83C 1PV3A 3GF7A 1LTJC 3D70A 1JO5A 4H0LB 1QL1A 2ZT9B 3A7OA 3L72D 1DX7A 1FJKA 2K9JA 2N9YB 1AV1A 1NYHA 2KI7B 3HE4B 4Z1MH 3EFGA 3A2AA 2L91A 2QJKB 3A0BH 3SWYA 2QJYC 1IFDA 1SQVK 2YO2A 3M9QA 3KZIE 5DJUB 3CC2P 1JCDA 1Y9BA 1VQ7P 1NTKE 1RF1C 1AVYA 4LC1A 4WY4D 4XA4A 1NTMJ 3P8MC 3VMXA 4D6TG 1S5LH 4U3FE 3CCRP 5AW2B 2P58A 3U59A 1PPJG 3S1KA 1ZR2A 1EC5A 3W68A 3VMAA 1FJPA 1RE4A 5GTIE 1OFCX 2NPSB 1BDDA 1PZQA 1MUUA 1NTKD 5TISE 1T8ZA 1N7SB 1JY3N 3L73E 1CI6B 3VMZA 4U3FD 1QVGO 2BCCE 4PD4E 5AVVB 4DJGA 3GG2A 3G71P 2B89A 5APYA 3Q5RA 1VQ8P 2Z5HA 5KKZC 5AW5B 2KNCB 3MD0A 3M06A 2FKWB 1IC2A 4M3LA 2WVRA 4L74A 3OW2O 2FY8A 3KPEA 3L73D 5CCHA 2BCCD 2M8RA 1VF5B 5KJ7D 3MTUE 2CPSA 1ZN5A 2I8DA 1VQMP 3KHUA 3CCSP 1EZVE 2YNYA 1N73B 3TNUA 1JY3O 4BRYA 5CJ0A 4H13C 1IFPA 3CMAP 1N7SD 3LIEA 3A3YB 1HBWA 2GUSA 2KLUA 4D6TE 2W6BA 2BASA 1M7LA 3JCUH 2K3RA 1M8OB 1PPJE 5GTHH 1GW4A 1WT6A 2W90A 1L0NJ 4RESB 3KYQA 1JB0J 3M0AA 3TYYA 3L71J 3HE5A 1X8YA 3AECC 1DIPA 3H1KJ 3TGUJ 4EIJA 1G1IA 1GDTA 3OAKA 1LTJB 4D6TD 3RK2D 2KUBA 4B86A 3H1JE 1AJYA 1KFMA 3V2QA 1NHLA 1PPJD 4H44D 1IFJA 1Q82Q 1XTGB 1AVOA 1AA0A 3M0DC 2OYIA 1LP1B 2WMMA 1GZLA 1L0LK 1FDIA 4HYTB 2QJYB 3AE5C 1S4XA 5B66E 3P7KA 4A7PA 1GL2C 5APXA 1RF1B 3SSUA 1Q2NA 3W67A 5H2FE 5K5GB 4PJ0E 2KZJA 1KV4A 2WT7A 1USEA 1Q81Q 3CC4P 2Q6QA 3SWKA 4CPGA 3MZWB 5BU8B 3RBZA 4WVZA 1LTSC 2D2CD 4GT1A 2NZ2A 1L2PA 2WPSA 3CI9A 4EYYQ 1FU1A 1WMKA 3L71G 4UB6H 1AQ5A 3GLMA 1JEKA 3WMM0 5KKZB 2KS1A 3AE2C 1A02F 2LXBA 3RK3E 2LKMA 2KZIA 2ITAA 5E79H 3H6PA 1FE6A 1GD2E 1MV8A 2HR3A 5CCGC 1SFCA 4ASWA 1LTBC 1JMBA 4H13B 4L76A 3CCEP 1AQTA 3V4QA 1D7MA 1T3UA 3S9OA 1URQC 2B87B 2HPCB 3LW5H 1SQBJ 2K37A 1FZEA 1KQSO 2IX7C 3L72J 3ABVC 2WITA 1GTWA 2E76D 1IFNA 2R5BA 1G2CB 2V7QJ 1CW5A 1VQ9P 3LW5J 5CMZA 2UWJE 1LWUC 4JQ0D 1OVUA 2N9BA 1Y8AA 3GHGA 3L71E 3QWOC 2JP3A 3H1KE 4K3AA 1H0TA 4PD4I 2P1JA 3WUUA 2XNXA 1RY3A 2KIKA 4H13D 2KSJA 2QG4A 1YHQP 4ASVA 4RKUJ 3SWFA 2ZT9C 1LTIC 2A45G 1W2BO 3L71D 1KYOI 1YJ9P 1VL2A 3H1KD 2OTJP 1GL2B 1EZVI 2Y0DA 3BATA 2IYPA 1QEXA 5KLVJ 2W6AA 1NTKJ 3CMEP 2O01H 5GTIH 1LTAC 2WSCH 4IOIH 1DD4A 2FFDA 1RH5B 5TISH 1FZGA 4WY4A 5AW9B 1UIXA 1SQBG 1BE3J 1GMJA 2WSCJ 5CBNA 1YTZT 1EQ7A 1SQXK 3P8CE 1FZFA 3L73J 3L74J 1BCCJ 3HE4A 2E43A 4IL6X 3L75G 2HLOA 1RE3A 1Q86Q 1VQPP 1OW6A 4L75A 4JF7A 1OZHA 3CXHE 2Y9ZA 3KDPB 4WWIA 4TLFA 2M3BA 5APVA 1VPCA 1T2KD 2K1AA 1NTMK 1Q7YQ 1SFCD 3AEAC 1J2JB 1P84I 2B88A 1SVFA 2N1TC 1E79H 3N7NA 3HUSC 3C1LA 1QX8A 5AW7B 1U57A 5KJ7A 1L4AC 3CXHD 1URQB 1HJ0A 4GOEA 3VTPC 1OVRA 3AE1C 2NPSA 5KLVG 1KQLA 4D6TJ 3A0HE 2KYVA 1NTZJ 2H88C 1N7SA 1YITP 1CI6A 1U7MA 3I55P 4EI2A 1SQBE 2BEZF 2Y9YA 1IFIA 4Y28J 4HJGH 3CC7P 2KNCA 1BE3G 1LWUB 5CCGD 3SFEC 2XV5A 1G1JA 3L75E 3L74G 1BCCG 4C7NA 3RL0C 3B5NC 5B66H 1SQBD 1KILB 2RN0A 1N73A 2AEFA 1NAYA 3WU2E 5H2FH 3T97B 4PJ0H 1U7JA 2JJLA 3CX5E 3FXDA 3L75D 2FYZA 3E7KA 3AEFC 1L0NK 4N78E 3KQGA 1DH3A 2FYUJ 1YQ4C 2M3EA 1UIIA 3MP7B 2Z5IA 3FGAD 3FXEA 5KLVE 1HUCA 2OYHB 3VMYA 3CX5D 3USSA 3CCQP 1LTJA 1S9KE 3G3ZA 1NTZG 2W8ZA 3HD7B 4H0LD 4N78D 2ZT9D 3ZDMA 2IBZI 1FDOA 4OGQB 1BE3E 2E75C 2QSIA 1USDA 1JTHB 3H1LJ 5KLVD 2Q5UA 2POHA 2YMKA 4GOFA 1IK9A 3L74E 4W7ZA 1S9KD 1BCCE 3EWKA 1DEEG 3MGNA 4UB8E 3A5TA 2L5GB 4R4MA 2E74C 3H1HG 1BE3D 1RF1A 5AW8B 4PV1C 3MIWA 1NU1G 2ZVOB 1NKNA 3O8ZA 2N1TB 3HUSB 4ZNCA 3L74D 1BCCD 1KB9E 1EDKA 2Q3EA 1EDIA 1L4AB 1IZNB 5APUA 2Q3IA 1X0TA 1HF9A 4MN4C 2NPSD 1R8EA 1KMIZ 1RF0A 1T6AA 2FYUG 4GDOA 1YIJP 3VP9A 1HWTC 4OWFA 2I1JA 3TF5A 1KB9D 1SQPG 1X79B 1NTZE 4R4LA 1OMIA 1XTCC 2K9JB 2DW3A 3SFDC 2OYIC 1DEBA 3S4RA 5AVRB 3R2PA 3M9BA 3H1IJ 3H1LG 3U1AA 3RL0B 3B5NB 3CCUP 1VF5D 1IK7A 2QJPC 1NTZD 2E42A 1LT9C 4BXLA 1VQLP 3H1HE 3BASA 3TK1A 3CXHI 2FXPA 2ZXXA 3O6QB 1NU1E 3B4SA 5KAIE 2B87A 1RHZB 2KB7P 2HPCA 4YXWH 1GU4A 3L35A 3M9HA 4Y99C 1VDFA 2OYOA 3Q5SA 3H1HD 1A02J 3V4WA 1WRGA 3G6EP 1QL2A 2FYUE 2YO3A 3RL0D 2O3JA 1NU1D 2JEEA 2IDBA 4HKZH 1NOHA 3B71A 2Q7CA 1SQPE 2OTLP 2R5DA 3VN0A 2E75B 2YXRB 3FWNA 1K8AQ 3M0DA 1MFZA 2AXTE 1ZP0C 3CXHH 3KXDA 2FYUD 1GW3A 3EQ2A 1S5LX 2ZXEB 3NXSA 3H1LE 2A45H 3VOPA 1SQPD 3MHVA 3H1IG 3M91A 2E74B 1LTTC 3TNUB 1S72P 1H8AA 1ZV8A 1NTKK 1J1EB 4PV1B 3CD6P 2WZ7A 1OXZA 3PRJA 3TDKA 4LGDE 4I6MC 4NPFX 3H1LD 1YJWP 3A0HH 4JYCA 3CX5I 3JC22 3WUVA 1K05A 2H8PD 3L4FA 2HFED 1ZMEC 1OIPA 2ZVNB 2HODA 1ZRTE 1HH0A 1PL5A 1QGKB 1BGYG 2KOGA 2Q9IA 1GU5A 3GHGC 2V7QH 4KHXA 1BDCA 2QRXA 3RL0g 5TJHA 1FDMA 2BEQD 4PV1D 5AVXB 5AW0B 2OYIB 1ZRTD 3CCMP 2J59M 3PTZA 2I1KA 1L0LJ 5CCGA 3L75J 3WU2H 3VYIA 2QJPB 3HTKB 1FZCC 4AUWA 1LT9B 2ZYGA 1FBMA 3CX5H 3H1IE 2G3AA 1M1JC 1K04A 4HH2A 2YKOA 3BCCG 1KORA 2XKMA 2WSEJ 1HVVA 1OW7A 1URQA 1JM0A 1KILC 1W5CE 5AW6B 4XE5B 4Y99B 1PP9G 3V2PA 1KB9I 2XU6A 3H1ID 2M5AA 1CSBA 2NRGA 1M1KQ 5CHXA 1KFNA 3BRTB 2H43A 1QVFO 1LWUA 2WPQA 1PGPA 3NFQA 1SLQA 1BGYE 2OGUA 4GKGA 1DD3A 5AVQB 4EOTA 2WSFH 1RE3C 1MKMA 4KJMA 1FZAA 1M57D 2OYHC 1IFMA 1KQFB 4UB8H 3HD7C 2AXCA 3AE7C 2QM8A 2WSFJ 4OGQC 1VQ5P 1BGYD 5EFWB 2GM4A 1L0LG 2JO1A 1KZUB 4GIFA 2JR8A 3HRNA 1GL2D 1MFTA 2C0XA 1KB9H 4QMAA 1EXJA 2FYUK 4OH8B 2PFXA 3BCCE 2GA1A 3ITKA 5AVWB 2V4HA 1JY2N 3L70G 2YKPA 2P67A 3V2NA 1YTZI 4IL6E 1HTLC 1PGQA 4HB1A 3PP5A 3AE6C 1SQQJ 2AEJA 3CWBJ 1OX3A 3BCCD 1IJDB 3GHGB 3CPWO 1JTHA 2R32A 2YIUC 3AEEC 3I56P 1JY3P 3G9RA 2K88A 2QVAA 1PP9D 1PGOA 1JY2O 2R3SA 4W7YA 1E5WA 3H32B 2B9BA 4H44C 2MKVA 4N3YB 1FZCB 2RMZA 4BWNA 2P7JA 2YKQA 1N8RQ 1ZOYC 5KAIH 1L0LE 2J5UA 1M1JB 3MUDA 1RQVA 3HUSA 4XFJA 3H1HJ 2WPRA 4K35A 1URQD 2ZJSE 1R5SA 4WBAA 1MZ9A 2RKLA 1NU1J 3AEBC 3L70E 3IR9A 3C8VA 5C39A 1LNQA 2G8YA 1L0LD 1NJIQ 2FXOA 1K9MQ 1KILE 2XNDH 2JWAA 1SQQG 3RBXA 2E5TA 1RE4C 1J1DC 1SQXJ 3CWBG 2AXTH 2SPZA 3L70D 3I5CA 4RJTA 2D2CC 2K9YA 1SQPJ 5CJ4A 5AVTB 3B5NA 2WPVB 3FX0A 1EZVG 2QEXP 1KILD 4JPZB 5KLIC 3R4YA 4IFFA 4ZKUA 1RQUA 3FWLA
chains in the Genus database with same CATH topology
2QJKB 1EZVD 1SQBD 2IBZD 3PLNA 3PHLA 2RN0A 1NTMD 2RMZA 3H1HD 1L0ND 1SQVD 3L74D 1BCCD 2Q3EA 2O3JA 1NU1D 5TJHA 3TGUD 3L75D 1BGYD 2A06D 2QG4A 1ZRTD 3PTZA 5KKZB 2KS1A 3VMAA 3TF5A 2QJPB 1KB9D 3GW6A 4D6TD 3L71D 1L0LD 3ITKA 1NTKD 2FYUD 3H1KD 2YIUB 2K9JB 4EDFA 3CXHD 3H1JD 1PPJD 2Y0EA 3CX5D 5KLIB 4U3FD 2JWAA 2Y0DA 1SQPD 4PD4D 3GG2A 2KNCB 3L70D 2QJYB 4RJTA 3PRJA 3BCCD 1NTZD 5KLVD 3TDKA 1P84D 2FYNB 1SQQD 1SQXD 3H1ID 3L72D 4A7PA 2Y0CA 3CWBD 3H1LD 3L73D 1KYOD 2N9YB 2BCCD 1PP9D 3FWLA 3KHUA 1BE3D 2L91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJK B;  1EZV D;  1SQB D;  2IBZ D;  3PLN A;  3PHL A;  2RN0 A;  1NTM D;  2RMZ A;  3H1H D;  1L0N D;  1SQV D;  3L74 D;  1BCC D;  2Q3E A;  2O3J A;  1NU1 D;  5TJH A;  3TGU D;  3L75 D;  1BGY D;  2A06 D;  2QG4 A;  1ZRT D;  3PTZ A;  5KKZ B;  2KS1 A;  3VMA A;  3TF5 A;  2QJP B;  1KB9 D;  3GW6 A;  4D6T D;  3L71 D;  1L0L D;  3ITK A;  1NTK D;  2FYU D;  3H1K D;  2YIU B;  2K9J B;  4EDF A;  3CXH D;  3H1J D;  1PPJ D;  2Y0E A;  3CX5 D;  5KLI B;  4U3F D;  2JWA A;  2Y0D A;  1SQP D;  4PD4 D;  3GG2 A;  2KNC B;  3L70 D;  2QJY B;  4RJT A;  3PRJ A;  3BCC D;  1NTZ D;  5KLV D;  3TDK A;  1P84 D;  2FYN B;  1SQQ D;  1SQX D;  3H1I D;  3L72 D;  4A7P A;  2Y0C A;  3CWB D;  3H1L D;  3L73 D;  1KYO D;  2N9Y B;  2BCC D;  1PP9 D;  3FWL A;  3KHU A;  1BE3 D;  2L91 A; 
#chains in the Genus database with same CATH topology
 2OQQ A;  2W27 A;  3CLQ A;  1LP1 A;  3O6Q A;  1N7L A;  3NTN A;  5BU5 A;  1X9V A;  3PLN A;  3G4S P;  1KTM A;  5M1B A;  4JYB A;  2CPB A;  5CCH C;  3E1R A;  2J58 A;  3II6 A;  5B5E E;  2A06 G;  3Q3D A;  3RK3 C;  2IFN A;  2WSS H;  3IF4 A;  1RF0 C;  1J1E C;  2AEM A;  3H1J G;  3IN6 A;  4AYC A;  1Q90 D;  5APT A;  3HD7 D;  5KAF E;  2HG5 D;  2WTY A;  2KK7 A;  1EXI A;  2JKV A;  4OGQ D;  1EDL A;  1SQQ E;  2VRS A;  2YIU B;  4EDF A;  2E76 C;  2RH0 A;  3CWB E;  3L36 A;  1KYO E;  1NWQ A;  1IO4 A;  1KQG B;  4YTP C;  1SQX G;  4C7N B;  3V6I A;  1EDJ A;  4PD4 D;  1PFI A;  3RK2 B;  2C0W A;  3RGU A;  1S1C X;  2PAJ A;  2IZ0 A;  5CBO A;  1VQ6 P;  1R5L A;  4JBZ A;  4H44 B;  2FYN B;  1SQQ D;  1OVV A;  3CWB D;  3BVH A;  1KYO D;  2N1T D;  3NMD A;  1OW8 A;  1NTM G;  3EFF K;  2IFM A;  1L4A D;  1EZV D;  1JUN A;  1SQV J;  2A06 E;  2QE7 H;  2OTK E;  3H25 A;  2KP8 A;  2QIW A;  3PJS K;  1S2E A;  4C46 A;  3AE3 C;  2FXM A;  4DZO A;  1M90 Q;  2PRR A;  1QLE D;  4L73 A;  1NVO A;  1SQB K;  2A45 I;  2QA4 P;  4NPD A;  3D71 A;  2A06 D;  1H89 A;  3AE8 C;  1OWA A;  1J1D B;  2IZ1 A;  4KT0 J;  2D2C B;  1G2C A;  1BGY J;  3Q2Y A;  1P84 E;  3F89 A;  4YXD C;  3B5N D;  4NPE A;  1SQX E;  3AED C;  3U1C A;  3H1J D;  3HTK A;  1YI2 P;  1LT9 A;  5KLI B;  5APQ A;  1JOC A;  3WUT A;  5APS A;  3A0B E;  1P84 D;  3V2R A;  1SQX D;  1T2K C;  4IL6 H;  1NTM E;  3Q1M A;  2YMY A;  1BSN A;  2IBZ G;  3IAO A;  1YJN P;  1SFC C;  1FZB A;  1PIX A;  2PGD A;  1AFO A;  3BCC J;  3RK3 B;  1KD1 Q;  1GL2 A;  4DCK A;  5KLV K;  4IFD K;  4BRY B;  2CK3 H;  1L0N G;  1SQV G;  1VQ4 P;  5AW3 B;  1VQK P;  1S5L E;  1LT1 A;  5AW4 B;  3H1K G;  3TGU G;  4DOJ A;  1PP9 J;  5AVY B;  1NTM D;  1FC2 C;  1SP4 A;  2E75 D;  2JDI H;  4WB4 A;  4ZMD A;  2XDJ A;  2OAR A;  3C9I A;  3AEG C;  3CL3 D;  1ZLL A;  2E76 B;  2FBW C;  1LGH B;  3PH0 A;  3HE5 B;  1HJB A;  3OJA B;  1HGZ A;  5CCH D;  3JSV C;  2MJZ A;  2KSE A;  1ZXG A;  3E1I A;  3D6Z A;  2E74 D;  2GUV A;  3CCJ P;  1KN7 A;  3RK3 D;  2P10 A;  5APW A;  2P2U A;  2LXC B;  5KTB A;  2H7H A;  4DT0 A;  2LR2 A;  1JY2 P;  4U7J A;  1H88 A;  1NH4 A;  2ZAE B;  1YBK A;  2WSE H;  1SQQ K;  1NKZ B;  4I7Z C;  2IBZ E;  4W80 A;  4OVN F;  4ZKP A;  4IFM A;  5AVU B;  1JMM A;  2KXP B;  2JWD A;  2Z4E A;  1T3J A;  2O1K A;  2O1J A;  2Y0C A;  1L0N E;  1SQV E;  3L70 J;  4N6J A;  2WT7 B;  1NTZ K;  3Q5P A;  1LJ2 A;  3TGU E;  2FFD C;  1LTG C;  3JCU E;  1Y47 A;  5GTH E;  1YYC A;  5DJT B;  2IBZ D;  4WY4 C;  4GOD A;  3N4X A;  2XZR A;  3CCL P;  3KZI H;  4H0L C;  3IFM A;  1L0N D;  1SQV D;  3H32 A;  2M0B A;  2KLV A;  4LLH A;  1Z56 A;  3GMA A;  1FZC A;  3V5B A;  5L8R J;  3TGU D;  3P32 A;  1FS0 E;  3LID A;  2KS1 B;  1TU3 F;  1N2D C;  1M1J A;  2QJK C;  5BVZ A;  3TSI A;  1W2E A;  1X22 A;  5AVS B;  1SS1 A;  2W6J H;  5B5E H;  5AVZ B;  3D6Y A;  1NU1 K;  2WQY C;  2C9L Y;  1FOS F;  1KIL A;  1YQ3 C;  4U3F J;  4C7R A;  2IYO A;  1S3J A;  1VQN P;  5AW1 B;  1SFC B;  3T97 A;  4PD4 H;  2O01 J;  2R44 A;  1VQO P;  3L72 G;  5KAF H;  2HOD B;  1ZR4 A;  3CCV P;  1FAV A;  1HGV A;  4RO0 A;  4TT3 H;  2YXQ B;  5KJ7 C;  1PGJ A;  2BCC J;  1M56 D;  2WWW A;  1SQP K;  2NPS C;  2PP6 A;  1NGM B;  1KYO H;  2E5Y A;  2Q1K A;  1N7S C;  1ZW0 A;  2OYH A;  2ZYD A;  1PP9 E;  1JCC A;  2O01 N;  1N86 A;  3HD7 A;  3GF3 A;  3L37 A;  3P8C D;  1JNM A;  2R3C A;  4UB6 E;  3PHL A;  1KC8 Q;  1H0T B;  3K5B A;  3MUD C;  4YPC A;  3BRV B;  2IPP A;  1GK4 A;  1NO4 A;  3OA7 A;  1VF5 C;  5E79 E;  3RK2 C;  3AE4 C;  1BSH A;  1N73 C;  1NTK G;  2FYN C;  3F5H A;  1CZQ A;  3AE9 C;  2QM7 A;  2H89 C;  3QH9 A;  4I7Z B;  2ZYA A;  2HYN A;  4I2L C;  2ZFC A;  4U3F G;  4I1L A;  2M5A B;  3GW6 A;  2N1T A;  3VP8 A;  3L72 E;  2Y0E A;  1NAF A;  1L4A A;  1K73 Q;  3UIA A;  4AQR D;  2FFD B;  3H1J J;  4O9B A;  2C9N Y;  3L73 G;  3B8E B;  1GK6 A;  4WY4 B;  1FOS E;  2BCC G;  1P84 H;  2W83 C;  1PV3 A;  3GF7 A;  1LTJ C;  3D70 A;  1JO5 A;  4H0L B;  1QL1 A;  2ZT9 B;  3A7O A;  3L72 D;  1DX7 A;  1FJK A;  2K9J A;  2N9Y B;  1AV1 A;  1NYH A;  2KI7 B;  3HE4 B;  4Z1M H;  3EFG A;  3A2A A;  2L91 A;  2QJK B;  3A0B H;  3SWY A;  2QJY C;  1IFD A;  1SQV K;  2YO2 A;  3M9Q A;  3KZI E;  5DJU B;  3CC2 P;  1JCD A;  1Y9B A;  1VQ7 P;  1NTK E;  1RF1 C;  1AVY A;  4LC1 A;  4WY4 D;  4XA4 A;  1NTM J;  3P8M C;  3VMX A;  4D6T G;  1S5L H;  4U3F E;  3CCR P;  5AW2 B;  2P58 A;  3U59 A;  1PPJ G;  3S1K A;  1ZR2 A;  1EC5 A;  3W68 A;  3VMA A;  1FJP A;  1RE4 A;  5GTI E;  1OFC X;  2NPS B;  1BDD A;  1PZQ A;  1MUU A;  1NTK D;  5TIS E;  1T8Z A;  1N7S B;  1JY3 N;  3L73 E;  1CI6 B;  3VMZ A;  4U3F D;  1QVG O;  2BCC E;  4PD4 E;  5AVV B;  4DJG A;  3GG2 A;  3G71 P;  2B89 A;  5APY A;  3Q5R A;  1VQ8 P;  2Z5H A;  5KKZ C;  5AW5 B;  2KNC B;  3MD0 A;  3M06 A;  2FKW B;  1IC2 A;  4M3L A;  2WVR A;  4L74 A;  3OW2 O;  2FY8 A;  3KPE A;  3L73 D;  5CCH A;  2BCC D;  2M8R A;  1VF5 B;  5KJ7 D;  3MTU E;  2CPS A;  1ZN5 A;  2I8D A;  1VQM P;  3KHU A;  3CCS P;  1EZV E;  2YNY A;  1N73 B;  3TNU A;  1JY3 O;  4BRY A;  5CJ0 A;  4H13 C;  1IFP A;  3CMA P;  1N7S D;  3LIE A;  3A3Y B;  1HBW A;  2GUS A;  2KLU A;  4D6T E;  2W6B A;  2BAS A;  1M7L A;  3JCU H;  2K3R A;  1M8O B;  1PPJ E;  5GTH H;  1GW4 A;  1WT6 A;  2W90 A;  1L0N J;  4RES B;  3KYQ A;  1JB0 J;  3M0A A;  3TYY A;  3L71 J;  3HE5 A;  1X8Y A;  3AEC C;  1DIP A;  3H1K J;  3TGU J;  4EIJ A;  1G1I A;  1GDT A;  3OAK A;  1LTJ B;  4D6T D;  3RK2 D;  2KUB A;  4B86 A;  3H1J E;  1AJY A;  1KFM A;  3V2Q A;  1NHL A;  1PPJ D;  4H44 D;  1IFJ A;  1Q82 Q;  1XTG B;  1AVO A;  1AA0 A;  3M0D C;  2OYI A;  1LP1 B;  2WMM A;  1GZL A;  1L0L K;  1FDI A;  4HYT B;  2QJY B;  3AE5 C;  1S4X A;  5B66 E;  3P7K A;  4A7P A;  1GL2 C;  5APX A;  1RF1 B;  3SSU A;  1Q2N A;  3W67 A;  5H2F E;  5K5G B;  4PJ0 E;  2KZJ A;  1KV4 A;  2WT7 A;  1USE A;  1Q81 Q;  3CC4 P;  2Q6Q A;  3SWK A;  4CPG A;  3MZW B;  5BU8 B;  3RBZ A;  4WVZ A;  1LTS C;  2D2C D;  4GT1 A;  2NZ2 A;  1L2P A;  2WPS A;  3CI9 A;  4EYY Q;  1FU1 A;  1WMK A;  3L71 G;  4UB6 H;  1AQ5 A;  3GLM A;  1JEK A;  3WMM 0;  5KKZ B;  2KS1 A;  3AE2 C;  1A02 F;  2LXB A;  3RK3 E;  2LKM A;  2KZI A;  2ITA A;  5E79 H;  3H6P A;  1FE6 A;  1GD2 E;  1MV8 A;  2HR3 A;  5CCG C;  1SFC A;  4ASW A;  1LTB C;  1JMB A;  4H13 B;  4L76 A;  3CCE P;  1AQT A;  3V4Q A;  1D7M A;  1T3U A;  3S9O A;  1URQ C;  2B87 B;  2HPC B;  3LW5 H;  1SQB J;  2K37 A;  1FZE A;  1KQS O;  2IX7 C;  3L72 J;  3ABV C;  2WIT A;  1GTW A;  2E76 D;  1IFN A;  2R5B A;  1G2C B;  2V7Q J;  1CW5 A;  1VQ9 P;  3LW5 J;  5CMZ A;  2UWJ E;  1LWU C;  4JQ0 D;  1OVU A;  2N9B A;  1Y8A A;  3GHG A;  3L71 E;  3QWO C;  2JP3 A;  3H1K E;  4K3A A;  1H0T A;  4PD4 I;  2P1J A;  3WUU A;  2XNX A;  1RY3 A;  2KIK A;  4H13 D;  2KSJ A;  2QG4 A;  1YHQ P;  4ASV A;  4RKU J;  3SWF A;  2ZT9 C;  1LTI C;  2A45 G;  1W2B O;  3L71 D;  1KYO I;  1YJ9 P;  1VL2 A;  3H1K D;  2OTJ P;  1GL2 B;  1EZV I;  2Y0D A;  3BAT A;  2IYP A;  1QEX A;  5KLV J;  2W6A A;  1NTK J;  3CME P;  2O01 H;  5GTI H;  1LTA C;  2WSC H;  4IOI H;  1DD4 A;  2FFD A;  1RH5 B;  5TIS H;  1FZG A;  4WY4 A;  5AW9 B;  1UIX A;  1SQB G;  1BE3 J;  1GMJ A;  2WSC J;  5CBN A;  1YTZ T;  1EQ7 A;  1SQX K;  3P8C E;  1FZF A;  3L73 J;  3L74 J;  1BCC J;  3HE4 A;  2E43 A;  4IL6 X;  3L75 G;  2HLO A;  1RE3 A;  1Q86 Q;  1VQP P;  1OW6 A;  4L75 A;  4JF7 A;  1OZH A;  3CXH E;  2Y9Z A;  3KDP B;  4WWI A;  4TLF A;  2M3B A;  5APV A;  1VPC A;  1T2K D;  2K1A A;  1NTM K;  1Q7Y Q;  1SFC D;  3AEA C;  1J2J B;  1P84 I;  2B88 A;  1SVF A;  2N1T C;  1E79 H;  3N7N A;  3HUS C;  3C1L A;  1QX8 A;  5AW7 B;  1U57 A;  5KJ7 A;  1L4A C;  3CXH D;  1URQ B;  1HJ0 A;  4GOE A;  3VTP C;  1OVR A;  3AE1 C;  2NPS A;  5KLV G;  1KQL A;  4D6T J;  3A0H E;  2KYV A;  1NTZ J;  2H88 C;  1N7S A;  1YIT P;  1CI6 A;  1U7M A;  3I55 P;  4EI2 A;  1SQB E;  2BEZ F;  2Y9Y A;  1IFI A;  4Y28 J;  4HJG H;  3CC7 P;  2KNC A;  1BE3 G;  1LWU B;  5CCG D;  3SFE C;  2XV5 A;  1G1J A;  3L75 E;  3L74 G;  1BCC G;  4C7N A;  3RL0 C;  3B5N C;  5B66 H;  1SQB D;  1KIL B;  2RN0 A;  1N73 A;  2AEF A;  1NAY A;  3WU2 E;  5H2F H;  3T97 B;  4PJ0 H;  1U7J A;  2JJL A;  3CX5 E;  3FXD A;  3L75 D;  2FYZ A;  3E7K A;  3AEF C;  1L0N K;  4N78 E;  3KQG A;  1DH3 A;  2FYU J;  1YQ4 C;  2M3E A;  1UII A;  3MP7 B;  2Z5I A;  3FGA D;  3FXE A;  5KLV E;  1HUC A;  2OYH B;  3VMY A;  3CX5 D;  3USS A;  3CCQ P;  1LTJ A;  1S9K E;  3G3Z A;  1NTZ G;  2W8Z A;  3HD7 B;  4H0L D;  4N78 D;  2ZT9 D;  3ZDM A;  2IBZ I;  1FDO A;  4OGQ B;  1BE3 E;  2E75 C;  2QSI A;  1USD A;  1JTH B;  3H1L J;  5KLV D;  2Q5U A;  2POH A;  2YMK A;  4GOF A;  1IK9 A;  3L74 E;  4W7Z A;  1S9K D;  1BCC E;  3EWK A;  1DEE G;  3MGN A;  4UB8 E;  3A5T A;  2L5G B;  4R4M A;  2E74 C;  3H1H G;  1BE3 D;  1RF1 A;  5AW8 B;  4PV1 C;  3MIW A;  1NU1 G;  2ZVO B;  1NKN A;  3O8Z A;  2N1T B;  3HUS B;  4ZNC A;  3L74 D;  1BCC D;  1KB9 E;  1EDK A;  2Q3E A;  1EDI A;  1L4A B;  1IZN B;  5APU A;  2Q3I A;  1X0T A;  1HF9 A;  4MN4 C;  2NPS D;  1R8E A;  1KMI Z;  1RF0 A;  1T6A A;  2FYU G;  4GDO A;  1YIJ P;  3VP9 A;  1HWT C;  4OWF A;  2I1J A;  3TF5 A;  1KB9 D;  1SQP G;  1X79 B;  1NTZ E;  4R4L A;  1OMI A;  1XTC C;  2K9J B;  2DW3 A;  3SFD C;  2OYI C;  1DEB A;  3S4R A;  5AVR B;  3R2P A;  3M9B A;  3H1I J;  3H1L G;  3U1A A;  3RL0 B;  3B5N B;  3CCU P;  1VF5 D;  1IK7 A;  2QJP C;  1NTZ D;  2E42 A;  1LT9 C;  4BXL A;  1VQL P;  3H1H E;  3BAS A;  3TK1 A;  3CXH I;  2FXP A;  2ZXX A;  3O6Q B;  1NU1 E;  3B4S A;  5KAI E;  2B87 A;  1RHZ B;  2KB7 P;  2HPC A;  4YXW H;  1GU4 A;  3L35 A;  3M9H A;  4Y99 C;  1VDF A;  2OYO A;  3Q5S A;  3H1H D;  1A02 J;  3V4W A;  1WRG A;  3G6E P;  1QL2 A;  2FYU E;  2YO3 A;  3RL0 D;  2O3J A;  1NU1 D;  2JEE A;  2IDB A;  4HKZ H;  1NOH A;  3B71 A;  2Q7C A;  1SQP E;  2OTL P;  2R5D A;  3VN0 A;  2E75 B;  2YXR B;  3FWN A;  1K8A Q;  3M0D A;  1MFZ A;  2AXT E;  1ZP0 C;  3CXH H;  3KXD A;  2FYU D;  1GW3 A;  3EQ2 A;  1S5L X;  2ZXE B;  3NXS A;  3H1L E;  2A45 H;  3VOP A;  1SQP D;  3MHV A;  3H1I G;  3M91 A;  2E74 B;  1LTT C;  3TNU B;  1S72 P;  1H8A A;  1ZV8 A;  1NTK K;  1J1E B;  4PV1 B;  3CD6 P;  2WZ7 A;  1OXZ A;  3PRJ A;  3TDK A;  4LGD E;  4I6M C;  4NPF X;  3H1L D;  1YJW P;  3A0H H;  4JYC A;  3CX5 I;  3JC2 2;  3WUV A;  1K05 A;  2H8P D;  3L4F A;  2HFE D;  1ZME C;  1OIP A;  2ZVN B;  2HOD A;  1ZRT E;  1HH0 A;  1PL5 A;  1QGK B;  1BGY G;  2KOG A;  2Q9I A;  1GU5 A;  3GHG C;  2V7Q H;  4KHX A;  1BDC A;  2QRX A;  3RL0 g;  5TJH A;  1FDM A;  2BEQ D;  4PV1 D;  5AVX B;  5AW0 B;  2OYI B;  1ZRT D;  3CCM P;  2J59 M;  3PTZ A;  2I1K A;  1L0L J;  5CCG A;  3L75 J;  3WU2 H;  3VYI A;  2QJP B;  3HTK B;  1FZC C;  4AUW A;  1LT9 B;  2ZYG A;  1FBM A;  3CX5 H;  3H1I E;  2G3A A;  1M1J C;  1K04 A;  4HH2 A;  2YKO A;  3BCC G;  1KOR A;  2XKM A;  2WSE J;  1HVV A;  1OW7 A;  1URQ A;  1JM0 A;  1KIL C;  1W5C E;  5AW6 B;  4XE5 B;  4Y99 B;  1PP9 G;  3V2P A;  1KB9 I;  2XU6 A;  3H1I D;  2M5A A;  1CSB A;  2NRG A;  1M1K Q;  5CHX A;  1KFN A;  3BRT B;  2H43 A;  1QVF O;  1LWU A;  2WPQ A;  1PGP A;  3NFQ A;  1SLQ A;  1BGY E;  2OGU A;  4GKG A;  1DD3 A;  5AVQ B;  4EOT A;  2WSF H;  1RE3 C;  1MKM A;  4KJM A;  1FZA A;  1M57 D;  2OYH C;  1IFM A;  1KQF B;  4UB8 H;  3HD7 C;  2AXC A;  3AE7 C;  2QM8 A;  2WSF J;  4OGQ C;  1VQ5 P;  1BGY D;  5EFW B;  2GM4 A;  1L0L G;  2JO1 A;  1KZU B;  4GIF A;  2JR8 A;  3HRN A;  1GL2 D;  1MFT A;  2C0X A;  1KB9 H;  4QMA A;  1EXJ A;  2FYU K;  4OH8 B;  2PFX A;  3BCC E;  2GA1 A;  3ITK A;  5AVW B;  2V4H A;  1JY2 N;  3L70 G;  2YKP A;  2P67 A;  3V2N A;  1YTZ I;  4IL6 E;  1HTL C;  1PGQ A;  4HB1 A;  3PP5 A;  3AE6 C;  1SQQ J;  2AEJ A;  3CWB J;  1OX3 A;  3BCC D;  1IJD B;  3GHG B;  3CPW O;  1JTH A;  2R32 A;  2YIU C;  3AEE C;  3I56 P;  1JY3 P;  3G9R A;  2K88 A;  2QVA A;  1PP9 D;  1PGO A;  1JY2 O;  2R3S A;  4W7Y A;  1E5W A;  3H32 B;  2B9B A;  4H44 C;  2MKV A;  4N3Y B;  1FZC B;  2RMZ A;  4BWN A;  2P7J A;  2YKQ A;  1N8R Q;  1ZOY C;  5KAI H;  1L0L E;  2J5U A;  1M1J B;  3MUD A;  1RQV A;  3HUS A;  4XFJ A;  3H1H J;  2WPR A;  4K35 A;  1URQ D;  2ZJS E;  1R5S A;  4WBA A;  1MZ9 A;  2RKL A;  1NU1 J;  3AEB C;  3L70 E;  3IR9 A;  3C8V A;  5C39 A;  1LNQ A;  2G8Y A;  1L0L D;  1NJI Q;  2FXO A;  1K9M Q;  1KIL E;  2XND H;  2JWA A;  1SQQ G;  3RBX A;  2E5T A;  1RE4 C;  1J1D C;  1SQX J;  3CWB G;  2AXT H;  2SPZ A;  3L70 D;  3I5C A;  4RJT A;  2D2C C;  2K9Y A;  1SQP J;  5CJ4 A;  5AVT B;  3B5N A;  2WPV B;  3FX0 A;  1EZV G;  2QEX P;  1KIL D;  4JPZ B;  5KLI C;  3R4Y A;  4IFF A;  4ZKU A;  1RQU A;  3FWL A; 
#chains in the Genus database with same CATH homology
 2QJK B;  1EZV D;  1SQB D;  2IBZ D;  3PLN A;  3PHL A;  2RN0 A;  1NTM D;  2RMZ A;  3H1H D;  1L0N D;  1SQV D;  3L74 D;  1BCC D;  2Q3E A;  2O3J A;  1NU1 D;  5TJH A;  3TGU D;  3L75 D;  1BGY D;  2A06 D;  2QG4 A;  1ZRT D;  3PTZ A;  5KKZ B;  2KS1 A;  3VMA A;  3TF5 A;  2QJP B;  1KB9 D;  3GW6 A;  4D6T D;  3L71 D;  1L0L D;  3ITK A;  1NTK D;  2FYU D;  3H1K D;  2YIU B;  2K9J B;  4EDF A;  3CXH D;  3H1J D;  1PPJ D;  2Y0E A;  3CX5 D;  5KLI B;  4U3F D;  2JWA A;  2Y0D A;  1SQP D;  4PD4 D;  3GG2 A;  2KNC B;  3L70 D;  2QJY B;  4RJT A;  3PRJ A;  3BCC D;  1NTZ D;  5KLV D;  3TDK A;  1P84 D;  2FYN B;  1SQQ D;  1SQX D;  3H1I D;  3L72 D;  4A7P A;  2Y0C A;  3CWB D;  3H1L D;  3L73 D;  1KYO D;  2N9Y B;  2BCC D;  1PP9 D;  3FWL A;  3KHU A;  1BE3 D;  2L91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...