4OH8B

Crystal structure of the human mst1-rassf5 sarah heterodimer
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
46
structure length
46
Chain Sequence
VEWDAFSIPELQNFLTILEKEEQDKIQQVQKKYDKFRQKLEEALRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/apoptosis
molecule keywords Serine/threonine-protein kinase 4
publication title Structural basis of the heterodimerization of the MST and RASSF SARAH domains in the Hippo signalling pathway.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2014-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16517 Nore1-SARAH Novel Ras effector 1 C-terminal SARAH (Sav/Rassf/Hpo) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4oh8B00
2NPSB 1JTHB 1GL2C 2N1TA 1L4AA 1KILC 3RK2C 5CCHC 3RL0C 1GL2B 3HD7C 1KILB 2M8RA 1N7SC 3B5ND 3RL0B 3HD7B 2HG5D 5KJ7A 3VOPA 1N7SB 5CCGD 2NPSD 4WY4A 4W7YA 1SFCA 2N1TC 1L4AC 1GL2D 1KILD 1T3JA 3RK2D 2N1TB 5CCHD 1L4AB 3RL0D 3HD7D 4W7ZA 1N7SD 5KJ7C 3RK2B 2HFED 2WZ7A 4WY4C 1SFCC 4OH8B 3KYQA 3RK3C 4WY4B 1SFCB 2N1TD 1L4AD 4W80A 4N78E 3RK3B 1URQA 5KJ7D 4WY4D 1SFCD 1XTGB 2H8PD 4LGDE 3RK3D 3P8CE 3B5NA 1URQC 3M0DC 1URQB 5CCGA 2NPSA 1HVVA 1JTHA 2XDJA 1NHLA 1GL2A 1KILA 5CCHA 2KOGA 3HD7A 2YMYA 3B5NC 1N7SA 1URQD 3TSIA 4JF7A 3HTKB 3B5NB 5CCGC 2NPSC 2PP6A 3PP5A
chains in the Genus database with same CATH superfamily
4WVZA 4H13C 3BCCE 4UB6H 4AUWA 5CCHC 1SQQE 2JJLA 4H0LD 1KILB 4I7ZB 1KB9E 4C46A 3GF7A 1KQLA 1ZRTD 1NH4A 1OWAA 3AECC 3CMEP 1SQBG 1T8ZA 1KMIZ 1YQ4C 1HGVA 1SQVE 1T3JA 3BRVB 4L75A 1DH3A 2CPBA 3V2PA 5APVA 3RK2B 3L75D 3H1KG 3L73E 4OH8B 2WPQA 1HF9A 4PD4H 2L91A 4U3FG 4PD4I 1H0TA 3Q3DA 1MFZA 3HUSB 2FFDA 1LT9A 5AW4B 1AVOA 3MTUE 3GW6A 3H32A 3AE1C 3TGUG 1U7JA 1USDA 5AVXB 1MUUA 5AW7B 3P8CD 3CXHD 4I6MC 1HTLC 1PPJD 1KFMA 2Y9ZA 2O01N 1PP9J 4D6TE 1GL2A 3D71A 2Q1KA 1PGQA 2D2CB 1FE6A 1NO4A 1VQ4P 1J1EC 2P67A 3B5NB 2KS1A 1RF1B 3L71D 2NPSC 2PP6A 3AE5C 2RMZA 2GA1A 4LC1A 3EWKA 1BDDA 4Y28J 4RO0A 1LTBC 3FGAD 2GUVA 1JMMA 4NPEA 1CI6B 2E76D 3G9RA 4HKZH 5KJ7A 2NZ2A 1VF5B 3BATA 1LT1A 2R32A 1NU1K 2AXCA 3HD7D 1BSHA 4H13B 4IL6X 3H1LJ 4TT3H 3USSA 3MIWA 1YIJP 1VL2A 5M1BA 1SQPK 1K9MQ 4C7NA 2Z5HA 2WSFH 5AVTB 2OYHC 1OVVA 2YO2A 1NTMK 4RKUJ 1RE3C 3Q2YA 3CD6P 4KT0J 5KLVK 2OYOA 3GG2A 5APYA 4BRYA 1IFIA 4MN4C 1SQBJ 3P32A 1NTZK 1T3UA 2P10A 1G1IA 4CPGA 2QE7H 4H0LC 2H43A 2A06E 2N9BA 1JB0J 2WSEJ 4K3AA 1N7SA 1GMJA 3H1KJ 3H6PA 3H1JG 2R3CA 5KAIH 1HGZA 1K73Q 1L0NK 1JTHB 2BCCG 4ZMDA 2N1TA 4U3FJ 5AW8B 1SS1A 2AEMA 1LTJB 1SQXG 3CX5H 2KUBA 3CX5I 3RL0B 5AVQB 1HH0A 1ZLLA 1SFCA 1S2EA 3TGUJ 2W6JH 3RBXA 2C9LY 1J1EB 2QJYC 4GIFA 1NU1E 3E1IA 1KILD 3A2AA 3JSVC 2C0WA 2KLVA 3KHUA 1JOCA 3L70E 3TK1A 2J58A 4YXDC 1N7LA 1SQPE 1KFNA 5BVZA 1NTME 2Y9YA 5KAIE 1BGYD 2J5UA 3JCUH 4OVNF 4UB8H 2LXCB 1IK9A 5KLVE 4I2LC 1FZBA 5CJ4A 5AVSB 3IAOA 5CBOA 1Q81Q 1FDOA 1S3JA 1IFPA 1KQSO 1VQ5P 3CLQA 3SFDC 2XKMA 2JKVA 3RGUA 2E76C 3O6QB 2KK7A 5GTIH 1L0LG 1FZFA 1MZ9A 2FYUD 2WWWA 1OW8A 1J2JB 1IK7A 3A3YB 1KZUB 3V6IA 3AE2C 2D2CD 3BCCD 4DCKA 3HD7C 2QJPC 1SQQD 4HJGH 3B5ND 1IFMA 3FXEA 3JCUE 2Z5IA 4UB8E 1KB9D 2KXPB 4H0LB 2PRRA 3CCJP 1GD2E 1AA0A 3GLMA 4IFFA 1SQVD 3AEEC 1IFDA 1EDLA 3CC2P 3M9BA 1VF5D 2B88A 3SSUA 3CI9A 1GW3A 5CJ0A 1GDTA 3L73D 2P58A 1M57D 5GTIE 1W5CE 2R5BA 4R4LA 1OVUA 2W83C 3H1JJ 2HODB 2BCCJ 1KQFB 3PH0A 3L72J 2Q7CA 3RK3E 2K9JB 1OVRA 1X22A 3H1IG 1YJWP 1SQBK 1SQXJ 2KYVA 3HTKA 1PP9E 3MUDC 3L36A 4EYYQ 5CHXA 1L0NG 4DJGA 5APSA 1QVGO 3V2NA 4D6TD 4YTPC 5CCHA 2IBZI 1HJ0A 3LIDA 3WU2H 2C0XA 1W2EA 3HRNA 2W6BA 1JMBA 2POHA 1KILC 5AW1B 3D70A 1Q90D 1E5WA 3EFGA 2E76B 4BXLA 2I8DA 2OARA 3CC7P 3H1LE 2WSEH 3FX0A 3TNUB 1L4AB 4PV1B 1Y47A 3RL0D 3VMZA 1HBWA 1RH5B 2IBZE 3WU2E 3HUSC 1L0LJ 2M5AA 3RK3B 2Z4EA 1M1JC 1H8AA 1Y8AA 3FWLA 2BEZF 1CSBA 1P84E 2WT7A 1NU1J 1SQBE 2H7HA 2LKMA 2QEXP 3M0DC 1Y9BA 1URQB 2NPSA 2D2CC 3H1KE 4H44B 1LJ2A 1HUCA 3V4WA 3B5NC 3K5BA 4GODA 1RF1C 1JY3P 3I56P 4U3FE 1ZR4A 2A06D 3HE5A 4EI2A 2QVAA 2QG4A 4XFJA 1KQGB 1FC2C 3GF3A 3VMXA 3A0BH 1KC8Q 3TGUE 3NTNA 1PGOA 3V2QA 1VF5C 1NTZJ 2HPCB 5APQA 2P7JA 2LXBA 1YI2P 3H1IJ 1X9VA 2Y0CA 2OYHA 1Q7YQ 3T97A 2B87A 2WSCJ 1KV4A 2ZXXA 1RE3A 3PRJA 1L0NJ 3L74G 2M3BA 3TF5A 1SQPD 4WY4B 3MP7B 2B9BA 2K3RA 5B66H 1JEKA 1NTMD 4IOIH 4GKGA 5KLIC 2YXRB 1SQXK 2E74B 1S9KE 1NGMB 2JWDA 3A0BE 5APWA 1N73A 1YTZT 2QJKC 1E79H 3GHGB 3CWBJ 2OGUA 1EQ7A 4UB6E 5AVVB 1M1JB 2OQQA 2ZXEB 4JYBA 2Q6QA 4OWFA 2YNYA 2E43A 1WMKA 3ABVC 5BU8B 4K35A 4AYCA 2RN0A 2K88A 2V4HA 1YBKA 1LTJC 3Q5PA 5GTHH 2OYIB 1NAYA 3RL0C 1AJYA 2IDBA 2MKVA 1DEEG 2FYUG 1TU3F 3BRTB 1VPCA 1AQ5A 1LWUC 3KXDA 2KNCA 4PD4E 4DZOA 1FAVA 4JBZA 3HE4A 2YKPA 3FWNA 4JQ0D 4Y99B 1IC2A 1SQQG 1L0LK 1IFNA 1LGHB 3H1JE 2QRXA 3CCUP 1L4AD 2BCCE 4PV1D 1BCCJ 2AXTH 3L72E 1ZR2A 1NKZB 2PFXA 1IZNB 1VQMP 1SQXE 1OW7A 3Q5RA 1S5LH 1UIIA 1Q2NA 1JCDA 4O9BA 5GTHE 3A5TA 2Y0DA 1AV1A 3RK3D 1EZVG 3L73G 3KQGA 3C8VA 2WTYA 1X0TA 2ZVNB 2XV5A 1OW6A 1H88A 2K1AA 5KLIB 2MJZA 1EDJA 2VRSA 3HD7A 2E75B 1URQD 3TSIA 3L74J 1BDCA 4DOJA 2W27A 3P7KA 4HH2A 2QJKB 4H44D 3VN0A 3CMAP 1AVYA 1G2CA 1FZCA 2HG5D 5CCGD 1GZLA 2WPRA 4XE5B 3SWKA 3H1LD 3F5HA 3AE4C 1N8RQ 2IYOA 1BE3G 1OX3A 2FYNB 1L0LE 4NPFX 1NTKG 2WQYC 1JO5A 2IBZD 2FFDC 2CK3H 2FXPA 2XU6A 3BVHA 3PHLA 1ZMEC 2A45G 3CCVP 2YIUB 1OXZA 1LWUB 1KORA 2XNXA 1WT6A 3V4QA 1VQ7P 1G1JA 2ZT9B 1PZQA 3WUTA 4WY4D 5DJUB 3E1RA 1P84D 3B71A 2WSCH 1YITP 1SQBD 1LP1B 2E74D 3EFFK 1RY3A 5EFWB 1DEBA 1K8AQ 1PV3A 1KILA 3H1KD 1ZRTE 2E5TA 3CX5E 1OFCX 4U3FD 4I1LA 2H88C 1K04A 2AEJA 2R5DA 1MKMA 3H1HG 2R44A 1NTZE 1NVOA 4AQRD 3II6A 1ZXGA 3CPWO 2IZ0A 2R3SA 1BSNA 2O1JA 3N7NA 2O01J 1SP4A 3H1IE 2M3EA 1N2DC 5CBNA 3TGUD 2PAJA 1T2KD 2UWJE 2A06G 1USEA 1VDFA 1L4AC 4PV1C 4RESB 1L0NE 2ZAEB 3A7OA 3HUSA 4W7ZA 2Y0EA 3MZWB 3KDPB 2N9YB 4WBAA 5AVZB 2QM8A 3RK3C 2WPSA 4ASWA 3M0DA 1U57A 5H2FH 3SFEC 4ZKUA 2GUSA 4N3YB 1S4XA 3PJSK 3CWBE 2V7QJ 1JY3N 3I55P 3B5NA 1URQC 1RF1A 1L2PA 1J1DB 1M8OB 2WSSH 2G3AA 5K5GB 1M7LA 1NYHA 3RBZA 1H0TB 4WWIA 4H44C 2FFDB 1LT9B 3M0AA 2K37A 1KTMA 1CI6A 3CCRP 1BE3J 3H32B 1IO4A 3L37A 1YJNP 3L75G 2WITA 3M9HA 5CCGC 2QM7A 1PFIA 1NTKJ 3VYIA 4OGQB 1JY2P 3PP5A 3AEGC 1FZAA 5AVWB 1GL2B 2E75D 3VMAA 2JO1A 4YXWH 2FKWB 1QGKB 3AEFC 2KS1B 1QLED 5KAFH 3ITKA 2BEQD 1GK4A 3RL0g 2YXQB 1PPJG 1FJPA 1ZP0C 4PD4D 1NWQA 1UIXA 1BCCE 1RE4C 4WY4C 3NFQA 4EIJA 1CZQA 4B86A 3H1JD 3CCSP 3G4SP 3V5BA 3I5CA 3L71G 2BCCD 2E74C 3L72D 3H1HJ 1SQXD 1VQ9P 1FOSF 2OTKE 3Q5SA 2H8PD 3S9OA 1VQNP 1YJ9P 2FYUK 1NAFA 2C9NY 3L35A 4C7NB 3GHGC 1EC5A 5L8RJ 2HYNA 5AW0B 1KYOH 1HVVA 5KAFE 1JTHA 2ZT9D 1KYOI 2XDJA 1EDIA 3L74E 2JDIH 1SQQK 1LTJA 5AVRB 3JC22 1YTZI 3IR9A 3AE3C 2KLUA 1RF0C 1X79B 1JY3O 3H25A 1T2KC 1ZN5A 5APUA 3EQ2A 3SWYA 2YMKA 4BRYB 2IX7C 2OYIC 2Q9IA 1SQVK 2KP8A 2FY8A 1LWUA 3IN6A 2QSIA 1N7SB 2NRGA 2JP3A 2L5GB 1R5SA 2LR2A 2N1TB 4GDOA 1KN7A 4Y99C 1KYOE 3TDKA 2IYPA 1SVFA 3C1LA 1VQKP 1MV8A 2J59M 1L0LD 2K9YA 3LW5J 1M56D 2O01H 1CW5A 1SFCB 1JM0A 3L75J 1VQ6P 4U7JA 3AE7C 1NU1D 1LTIC 1EZVI 3W68A 3O6QA 1NKNA 5AW9B 2M0BA 3L70D 1RQUA 3B4SA 3M06A 3V2RA 4YPCA 4C7RA 1QEXA 4RJTA 2WMMA 5KKZB 2ZYAA 1A02F 2E75C 4IL6H 1NTKK 2FBWC 2PGDA 4JF7A 3G71P 3CX5D 5KLVD 2KB7P 2V7QH 2AEFA 4JYCA 3L71J 3AEAC 1NTZD 1BGYG 2YO3A 1VQLP 3H1ID 1EZVE 4OGQD 2YKOA 2CPSA 2FYZA 1GTWA 3CCMP 1GL2D 1M1KQ 5E79H 1FBMA 2HODA 1L0ND 2FYNC 5B66E 4ZKPA 1Q86Q 1OMIA 5CMZA 2K9JA 4IL6E 2A45H 5TISH 3P8MC 2A45I 2YIUC 1RHZB 3CC4P 3MHVA 2H89C 3W67A 2IPPA 2O1KA 2ZT9C 5KJ7D 3M9QA 3BCCG 1GK6A 3CCLP 1MFTA 1XTGB 1VQOP 3CWBD 1FU1A 1QVFO 2ZYGA 5B5EH 1BE3E 4LLHA 5E79E 1SQVG 3WMM0 1NTKE 2KSEA 1XTCC 2Q3EA 4XA4A 3HTKB 5AW5B 3VTPC 3L4FA 1ZV8A 4KHXA 5TISE 2ITAA 3TNUA 1PP9D 2XZRA 3CCEP 1R8EA 2KZJA 2WPVB 5AVYB 1IFJA 4A7PA 1L4AA 3G6EP 4N6JA 2ZFCA 2HR3A 4W7YA 4L74A 1R5LA 2AXTE 3A0HH 5B5EE 1Z56A 3GMAA 1N7SD 4HB1A 2HFED 1S5LE 4D6TG 4EDFA 1BCCD 1YQ3C 1OZHA 1YHQP 2E42A 2SPZA 4NPDA 1QL1A 3H1HE 2N1TD 4N78E 1URQA 1X8YA 3F89A 3KZIH 1QX8A 1LTAC 2QIWA 4ASVA 2FXMA 1DIPA 1N73C 1SFCD 1BGYJ 3R2PA 1J1DC 3AE8C 2P2UA 3G3ZA 3MGNA 3VP9A 4HYTB 3LW5H 2M5AB 5CCGA 1JY2N 1LT9C 2I1KA 1FS0E 3L72G 3MUDA 1JNMA 1NHLA 3L74D 3A0HE 4M3LA 2DW3A 2WT7B 2OTLP 4DT0A 2YMYA 2HPCA 3WUVA 4OGQC 2RKLA 1A02J 3CL3D 5C39A 1WRGA 2NPSB 2FYUJ 2P1JA 3KPEA 1GL2C 5AVUB 1FZGA 1S5LX 1SLQA 3KZIE 2I1JA 2G8YA 2JEEA 3BCCJ 3CXHH 1PGJA 3CXHI 2ZYDA 1RE4A 4WY4A 1SQQJ 2XNDH 1K05A 3HE5B 2JWAA 2IZ1A 3RK2D 5AW2B 3TYYA 1KYOD 5KJ7C 3L75E 1SQVJ 2WZ7A 1D7MA 1EXIA 3N4XA 2BASA 3E7KA 1DX7A 4KJMA 3GHGA 4EOTA 3L73J 4PJ0H 2OYHB 2HLOA 1EXJA 3PTZA 1AQTA 2KIKA 3T97B 2B87B 1LTSC 5AW3B 3U1AA 1PIXA 1M1JA 1FDMA 2GM4A 1GU5A 3P8CE 4IFMA 3CXHE 1RF0A 3Q1MA 1RQVA 1PPJE 5AW6B 1PGPA 1JUNA 1FJKA 2OYIA 1NU1G 3SWFA 1HWTC 2KZIA 3S4RA 2Q5UA 1S9KD 1N73B 2O3JA 2IFNA 3L70G 3L71E 4D6TJ 1SQPG 2W8ZA 3C9IA 1JY2O 4GT1A 3O8ZA 3MD0A 1NTMG 1EDKA 1ZW0A 1FZCC 1NJIQ 4PJ0E 1N7SC 2ZJSE 5APXA 5DJTB 3VOPA 1EZVD 1GU4A 4GOEA 3M91A 5KLVG 2N1TC 4H13D 4GOFA 3CCQP 5CCHD 2W90A 2QJYB 1M90Q 1NTZG 1OIPA 5H2FE 4Z1MH 1SFCC 3UIAA 3B8EB 4IFDK 4TLFA 1GW4A 4W80A 3U59A 1VQPP 4R4MA 2KNCB 2ZVOB 1LTGC 2E5YA 3HE4B 1FOSE 2RH0A 2OTJP 1N86A 5KKZC 3NMDA 4I7ZC 3D6ZA 1P84H 1BE3D 1P84I 1YYCA 5BU5A 1LNQA 2KSJA 1NTKD 1FZEA 1LTTC 4BWNA 3NXSA 3R4YA 3ZDMA 3CWBG 1H89A 1NOHA 3OAKA 4QMAA 1PL5A 1VQ8P 3QWOC 3RK2C 3U1CA 3IFMA 1S72P 3D6YA 2M8RA 2WSFJ 3AEDC 1S1CX 5APTA 3WUUA 3HD7B 2QJPB 3AEBC 2NPSD 3AE9C 1W2BO 1KILE 1JCCA 5TJHA 1PP9G 1AFOA 3OA7A 1IJDB 3VP8A 4L76A 1G2CB 1ZOYC 1FZCB 2QA4P 2IFMA 3KYQA 2JR8A 1LP1A 3VMYA 2Q3IA 3FXDA 3H1HD 3L70J 1SQPJ 1HJBA 1Q82Q 1BGYE 4N78D 2YKQA 3OJAB 1KB9H 1KB9I 1NTMJ 1DD4A 1BCCG 1QL2A 4LGDE 2W6AA 1U7MA 4WB4A 3S1KA 4ZNCA 4JPZB 3AE6C 5KLVJ 3H1LG 1KD1Q 1DD3A 4L73A 2KI7B 3OW2O 1FDIA 3QH9A 2KOGA 2B89A 2WVRA 3BASA 2FYUE 3LIEA 5KTBA 2FXOA 1T6AA 2IBZG 3PLNA 3IF4A
chains in the Genus database with same CATH topology
2XZRA 2W6BA 2R5DA 5AVYB 4AUWA 1IFJA 2POHA 1L4AA 4AQRD 1KILC 3II6A 5CCHC 5AW1B 2JJLA 2O1JA 3N7NA 1SP4A 1KILB 1N2DC 4C46A 4N6JA 2ZFCA 2PAJA 1T2KD 1KQLA 1NH4A 1OWAA 1E5WA 3EFGA 4W7YA 1T8ZA 2OARA 1VDFA 1L4AC 2WSEH 3TNUB 1HGVA 4RESB 1T3JA 3A7OA 3HUSA 3BRVB 1L4AB 3RL0D 1DH3A 3VMZA 2CPBA 1Z56A 4W7ZA 1HBWA 1N7SD 3V2PA 5APVA 3RK2B 2HFED 3KDPB 4OH8B 2E42A 4WBAA 5AVZB 2QM8A 3RK3C 1QL1A 2N1TD 2WPQA 3HUSC 2WPSA 4N78E 3RK3B 1URQA 2Z4EA 1X8YA 1MFZA 3HUSB 3M0DA 2FFDA 1M1JC 1H8AA 1LTAC 4ZKUA 1LT9A 2GUSA 4N3YB 5AW4B 2FXMA 1N73C 1CSBA 3MTUE 2WT7A 1SFCD 3R2PA 3H32A 1J1DC 2P2UA 2H7HA 2LKMA 1JY3N 5AVXB 3G3ZA 3MGNA 3VP9A 1MUUA 3B5NA 1URQC 1RF1A 5AW7B 1J1DB 3P8CD 4I6MC 1M7LA 3M0DC 1HTLC 4HYTB 3LW5H 1URQB 1JY2N 5CCGA 1KFMA 1LT9C 2I1KA 2NPSA 2FFDB 3MUDA 1JNMA 1NHLA 1LT9B 3M0AA 1GL2A 1CI6A 1HUCA 3V4WA 4M3LA 2WT7B 3H32B 2YMYA 1IO4A 3B5NC 3L37A 1RF1C 2HPCA 1JY3P 1NO4A 1ZR4A 2WITA 1J1EC 2P67A 3M9HA 3B5NB 5CCGC 1RF1B 2QM7A 3HE5A 1A02J 1PFIA 2NPSC 3CL3D 3VYIA 1WRGA 2PP6A 1JY2P 3PP5A 4LC1A 2NPSB 2P1JA 3KPEA 1GL2C 1FZAA 5AVUB 5AVWB 1FZGA 1SLQA 1LTBC 2GUVA 2I1JA 1GL2B 3VMXA 1JMMA 1CI6B 3NTNA 2JEEA 3V2QA 5KJ7A 2HPCB 5APQA 2FKWB 2P7JA 1RE4A 4WY4A 3BATA 3HE5B 1X9VA 2R32A 1GK4A 3RK2D 1NU1K 2OYHA 5AW2B 1FJPA 3T97A 3HD7D 3TYYA 1NWQA 5KJ7C 1RE3A 2WZ7A 1RE4C 3MIWA 4WY4C 1SQPK 3N4XA 2M3BA 3NFQA 4EIJA 1CZQA 4C7NA 2Z5HA 4B86A 4WY4B 2WSFH 5AVTB 3V5BA 3I5CA 2BASA 1DX7A 2OYHC 2YO2A 1NTMK 3GHGA 4EOTA 4GKGA 2OYHB 2HLOA 1RE3C 1SQXK 1LTSC 5AW3B 3U1AA 1S9KE 1FOSF 1M1JA 1FDMA 2H8PD 2GM4A 5APWA 1N73A 2FYUK 1NAFA 1YTZT 1GU5A 2C9NY 3P8CE 3L35A 4IFMA 4C7NB 5KLVK 1RF0A 3GHGC 5AW6B 5APYA 2HYNA 5AW0B 1IFIA 3P32A 1HVVA 3GHGB 1JTHA 1JUNA 1FJKA 2XDJA 1NTZK 1T3UA 2OYIA 1G1IA 1EQ7A 1SQQK 3SWFA 5AVVB 1LTJA 1M1JB 2ZXEB 1HWTC 4JYBA 5AVRB 1YTZI 2Q5UA 1S9KD 3IR9A 2H43A 1RF0C 2N9BA 2YNYA 1N73B 2E43A 1X79B 1N7SA 1JY3O 1T2KC 1ZN5A 2IFNA 3H6PA 5APUA 5BU8B 3C9IA 3EQ2A 2R3CA 3SWYA 1HGZA 4AYCA 1JY2O 4GT1A 3O8ZA 3MD0A 2IX7C 2OYIC 2Q9IA 1SQVK 1L0NK 1JTHB 2KP8A 2N1TA 5AW8B 1LTJC 1FZCC 1LWUA 2OYIB 3RL0C 1LTJB 1N7SC 3RL0B 5AVQB 5APXA 3VOPA 1HH0A 1N7SB 1ZLLA 1GU4A 1SFCA 3M91A 3BRTB 2N1TC 1VPCA 2C9LY 1J1EB 4GIFA 1AQ5A 2L5GB 1LWUC 3E1IA 1KILD 3A2AA 2N1TB 5CCHD 4DZOA 2C0WA 4Y99C 1FAVA 2KLVA 3HE4A 1SVFA 2YKPA 4Y99B 1IC2A 1MV8A 1JOCA 3TK1A 2J58A 1L0LK 1N7LA 1KFNA 2J59M 1IFNA 1LGHB 1SFCC 3UIAA 2O01H 3B8EB 4IFDK 5BVZA 1CW5A 1SFCB 1GW4A 1L4AD 4W80A 1ZR2A 3U59A 1NKZB 1LTIC 1LTGC 3HE4B 1JCDA 1FOSE 4O9BA 1IK9A 3A5TA 1NKNA 5AW9B 3RK3D 4I2LC 1FZBA 3M06A 5AVSB 5CJ4A 3V2RA 1N86A 3KQGA 4C7RA 2WTYA 3NMDA 3CLQA 2XKMA 2XV5A 1YYCA 5BU5A 1A02F 1H88A 2MJZA 1NTKK 2KSJA 2VRSA 3HD7A 1FZEA 1LTTC 3NXSA 1URQD 3TSIA 1FZFA 1MZ9A 4JF7A 2WWWA 1H89A 1NOHA 3OAKA 1J2JB 2KB7P 4DOJA 2W27A 3P7KA 4HH2A 3A3YB 1KZUB 3VN0A 4JYCA 3RK2C 3U1CA 3IFMA 2YO3A 3HD7C 1G2CA 2M8RA 1FZCA 3B5ND 1IFMA 5APTA 2Z5IA 3HD7B 2HG5D 2YKOA 5CCGD 2CPSA 1GZLA 2NPSD 2FYZA 2WPRA 4XE5B 1GD2E 1GTWA 1JCCA 1GL2D 1AFOA 1FBMA 2HODA 4IFFA 3OA7A 1IJDB 3VP8A 1IFDA 4ZKPA 1G2CB 3M9BA 1FZCB 2IFMA 5CMZA 3CI9A 1GW3A 5CJ0A 1GDTA 2A45H 3P8MC 3KYQA 2A45I 1JO5A 3VMYA 2FFDC 2R5BA 2Q3IA 2XU6A 3BVHA 1HJBA 4N78D 2HODB 2IPPA 2O1KA 2A45G 2YKQA 3OJAB 1OXZA 1LWUB 3M9QA 2XNXA 5KJ7D 1WT6A 1GK6A 3V4QA 1G1JA 2Q7CA 4WY4D 1XTGB 2WSCH 1QL2A 1SQBK 4LGDE 2KYVA 2W6AA 3HTKA 4WB4A 1FU1A 3L36A 4LLHA 5CHXA 1RY3A 1DEBA 5APSA 3WMM0 1KILA 3V2NA 5CCHA 2KOGA 3LIDA 3BASA 1XTCC 3LIEA 5KTBA 4XA4A 3HTKB 2C0XA 3VTPC 3L4FA 1ZV8A 4I1LA 4KHXA 1W2EA 5AW5B 3TNUA 3HRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPS B;  1JTH B;  1GL2 C;  2N1T A;  1L4A A;  1KIL C;  3RK2 C;  5CCH C;  3RL0 C;  1GL2 B;  3HD7 C;  1KIL B;  2M8R A;  1N7S C;  3B5N D;  3RL0 B;  3HD7 B;  2HG5 D;  5KJ7 A;  3VOP A;  1N7S B;  5CCG D;  2NPS D;  4WY4 A;  4W7Y A;  1SFC A;  2N1T C;  1L4A C;  1GL2 D;  1KIL D;  1T3J A;  3RK2 D;  2N1T B;  5CCH D;  1L4A B;  3RL0 D;  3HD7 D;  4W7Z A;  1N7S D;  5KJ7 C;  3RK2 B;  2HFE D;  2WZ7 A;  4WY4 C;  1SFC C;  4OH8 B;  3KYQ A;  3RK3 C;  4WY4 B;  1SFC B;  2N1T D;  1L4A D;  4W80 A;  4N78 E;  3RK3 B;  1URQ A;  5KJ7 D;  4WY4 D;  1SFC D;  1XTG B;  2H8P D;  4LGD E;  3RK3 D;  3P8C E;  3B5N A;  1URQ C;  3M0D C;  1URQ B;  5CCG A;  2NPS A;  1HVV A;  1JTH A;  2XDJ A;  1NHL A;  1GL2 A;  1KIL A;  5CCH A;  2KOG A;  3HD7 A;  2YMY A;  3B5N C;  1N7S A;  1URQ D;  3TSI A;  4JF7 A;  3HTK B;  3B5N B;  5CCG C;  2NPS C;  2PP6 A;  3PP5 A; 
#chains in the Genus database with same CATH topology
 4WVZ A;  4H13 C;  3BCC E;  4UB6 H;  4AUW A;  5CCH C;  1SQQ E;  2JJL A;  4H0L D;  1KIL B;  4I7Z B;  1KB9 E;  4C46 A;  3GF7 A;  1KQL A;  1ZRT D;  1NH4 A;  1OWA A;  3AEC C;  3CME P;  1SQB G;  1T8Z A;  1KMI Z;  1YQ4 C;  1HGV A;  1SQV E;  1T3J A;  3BRV B;  4L75 A;  1DH3 A;  2CPB A;  3V2P A;  5APV A;  3RK2 B;  3L75 D;  3H1K G;  3L73 E;  4OH8 B;  2WPQ A;  1HF9 A;  4PD4 H;  2L91 A;  4U3F G;  4PD4 I;  1H0T A;  3Q3D A;  1MFZ A;  3HUS B;  2FFD A;  1LT9 A;  5AW4 B;  1AVO A;  3MTU E;  3GW6 A;  3H32 A;  3AE1 C;  3TGU G;  1U7J A;  1USD A;  5AVX B;  1MUU A;  5AW7 B;  3P8C D;  3CXH D;  4I6M C;  1HTL C;  1PPJ D;  1KFM A;  2Y9Z A;  2O01 N;  1PP9 J;  4D6T E;  1GL2 A;  3D71 A;  2Q1K A;  1PGQ A;  2D2C B;  1FE6 A;  1NO4 A;  1VQ4 P;  1J1E C;  2P67 A;  3B5N B;  2KS1 A;  1RF1 B;  3L71 D;  2NPS C;  2PP6 A;  3AE5 C;  2RMZ A;  2GA1 A;  4LC1 A;  3EWK A;  1BDD A;  4Y28 J;  4RO0 A;  1LTB C;  3FGA D;  2GUV A;  1JMM A;  4NPE A;  1CI6 B;  2E76 D;  3G9R A;  4HKZ H;  5KJ7 A;  2NZ2 A;  1VF5 B;  3BAT A;  1LT1 A;  2R32 A;  1NU1 K;  2AXC A;  3HD7 D;  1BSH A;  4H13 B;  4IL6 X;  3H1L J;  4TT3 H;  3USS A;  3MIW A;  1YIJ P;  1VL2 A;  5M1B A;  1SQP K;  1K9M Q;  4C7N A;  2Z5H A;  2WSF H;  5AVT B;  2OYH C;  1OVV A;  2YO2 A;  1NTM K;  4RKU J;  1RE3 C;  3Q2Y A;  3CD6 P;  4KT0 J;  5KLV K;  2OYO A;  3GG2 A;  5APY A;  4BRY A;  1IFI A;  4MN4 C;  1SQB J;  3P32 A;  1NTZ K;  1T3U A;  2P10 A;  1G1I A;  4CPG A;  2QE7 H;  4H0L C;  2H43 A;  2A06 E;  2N9B A;  1JB0 J;  2WSE J;  4K3A A;  1N7S A;  1GMJ A;  3H1K J;  3H6P A;  3H1J G;  2R3C A;  5KAI H;  1HGZ A;  1K73 Q;  1L0N K;  1JTH B;  2BCC G;  4ZMD A;  2N1T A;  4U3F J;  5AW8 B;  1SS1 A;  2AEM A;  1LTJ B;  1SQX G;  3CX5 H;  2KUB A;  3CX5 I;  3RL0 B;  5AVQ B;  1HH0 A;  1ZLL A;  1SFC A;  1S2E A;  3TGU J;  2W6J H;  3RBX A;  2C9L Y;  1J1E B;  2QJY C;  4GIF A;  1NU1 E;  3E1I A;  1KIL D;  3A2A A;  3JSV C;  2C0W A;  2KLV A;  3KHU A;  1JOC A;  3L70 E;  3TK1 A;  2J58 A;  4YXD C;  1N7L A;  1SQP E;  1KFN A;  5BVZ A;  1NTM E;  2Y9Y A;  5KAI E;  1BGY D;  2J5U A;  3JCU H;  4OVN F;  4UB8 H;  2LXC B;  1IK9 A;  5KLV E;  4I2L C;  1FZB A;  5CJ4 A;  5AVS B;  3IAO A;  5CBO A;  1Q81 Q;  1FDO A;  1S3J A;  1IFP A;  1KQS O;  1VQ5 P;  3CLQ A;  3SFD C;  2XKM A;  2JKV A;  3RGU A;  2E76 C;  3O6Q B;  2KK7 A;  5GTI H;  1L0L G;  1FZF A;  1MZ9 A;  2FYU D;  2WWW A;  1OW8 A;  1J2J B;  1IK7 A;  3A3Y B;  1KZU B;  3V6I A;  3AE2 C;  2D2C D;  3BCC D;  4DCK A;  3HD7 C;  2QJP C;  1SQQ D;  4HJG H;  3B5N D;  1IFM A;  3FXE A;  3JCU E;  2Z5I A;  4UB8 E;  1KB9 D;  2KXP B;  4H0L B;  2PRR A;  3CCJ P;  1GD2 E;  1AA0 A;  3GLM A;  4IFF A;  1SQV D;  3AEE C;  1IFD A;  1EDL A;  3CC2 P;  3M9B A;  1VF5 D;  2B88 A;  3SSU A;  3CI9 A;  1GW3 A;  5CJ0 A;  1GDT A;  3L73 D;  2P58 A;  1M57 D;  5GTI E;  1W5C E;  2R5B A;  4R4L A;  1OVU A;  2W83 C;  3H1J J;  2HOD B;  2BCC J;  1KQF B;  3PH0 A;  3L72 J;  2Q7C A;  3RK3 E;  2K9J B;  1OVR A;  1X22 A;  3H1I G;  1YJW P;  1SQB K;  1SQX J;  2KYV A;  3HTK A;  1PP9 E;  3MUD C;  3L36 A;  4EYY Q;  5CHX A;  1L0N G;  4DJG A;  5APS A;  1QVG O;  3V2N A;  4D6T D;  4YTP C;  5CCH A;  2IBZ I;  1HJ0 A;  3LID A;  3WU2 H;  2C0X A;  1W2E A;  3HRN A;  2W6B A;  1JMB A;  2POH A;  1KIL C;  5AW1 B;  3D70 A;  1Q90 D;  1E5W A;  3EFG A;  2E76 B;  4BXL A;  2I8D A;  2OAR A;  3CC7 P;  3H1L E;  2WSE H;  3FX0 A;  3TNU B;  1L4A B;  4PV1 B;  1Y47 A;  3RL0 D;  3VMZ A;  1HBW A;  1RH5 B;  2IBZ E;  3WU2 E;  3HUS C;  1L0L J;  2M5A A;  3RK3 B;  2Z4E A;  1M1J C;  1H8A A;  1Y8A A;  3FWL A;  2BEZ F;  1CSB A;  1P84 E;  2WT7 A;  1NU1 J;  1SQB E;  2H7H A;  2LKM A;  2QEX P;  3M0D C;  1Y9B A;  1URQ B;  2NPS A;  2D2C C;  3H1K E;  4H44 B;  1LJ2 A;  1HUC A;  3V4W A;  3B5N C;  3K5B A;  4GOD A;  1RF1 C;  1JY3 P;  3I56 P;  4U3F E;  1ZR4 A;  2A06 D;  3HE5 A;  4EI2 A;  2QVA A;  2QG4 A;  4XFJ A;  1KQG B;  1FC2 C;  3GF3 A;  3VMX A;  3A0B H;  1KC8 Q;  3TGU E;  3NTN A;  1PGO A;  3V2Q A;  1VF5 C;  1NTZ J;  2HPC B;  5APQ A;  2P7J A;  2LXB A;  1YI2 P;  3H1I J;  1X9V A;  2Y0C A;  2OYH A;  1Q7Y Q;  3T97 A;  2B87 A;  2WSC J;  1KV4 A;  2ZXX A;  1RE3 A;  3PRJ A;  1L0N J;  3L74 G;  2M3B A;  3TF5 A;  1SQP D;  4WY4 B;  3MP7 B;  2B9B A;  2K3R A;  5B66 H;  1JEK A;  1NTM D;  4IOI H;  4GKG A;  5KLI C;  2YXR B;  1SQX K;  2E74 B;  1S9K E;  1NGM B;  2JWD A;  3A0B E;  5APW A;  1N73 A;  1YTZ T;  2QJK C;  1E79 H;  3GHG B;  3CWB J;  2OGU A;  1EQ7 A;  4UB6 E;  5AVV B;  1M1J B;  2OQQ A;  2ZXE B;  4JYB A;  2Q6Q A;  4OWF A;  2YNY A;  2E43 A;  1WMK A;  3ABV C;  5BU8 B;  4K35 A;  4AYC A;  2RN0 A;  2K88 A;  2V4H A;  1YBK A;  1LTJ C;  3Q5P A;  5GTH H;  2OYI B;  1NAY A;  3RL0 C;  1AJY A;  2IDB A;  2MKV A;  1DEE G;  2FYU G;  1TU3 F;  3BRT B;  1VPC A;  1AQ5 A;  1LWU C;  3KXD A;  2KNC A;  4PD4 E;  4DZO A;  1FAV A;  4JBZ A;  3HE4 A;  2YKP A;  3FWN A;  4JQ0 D;  4Y99 B;  1IC2 A;  1SQQ G;  1L0L K;  1IFN A;  1LGH B;  3H1J E;  2QRX A;  3CCU P;  1L4A D;  2BCC E;  4PV1 D;  1BCC J;  2AXT H;  3L72 E;  1ZR2 A;  1NKZ B;  2PFX A;  1IZN B;  1VQM P;  1SQX E;  1OW7 A;  3Q5R A;  1S5L H;  1UII A;  1Q2N A;  1JCD A;  4O9B A;  5GTH E;  3A5T A;  2Y0D A;  1AV1 A;  3RK3 D;  1EZV G;  3L73 G;  3KQG A;  3C8V A;  2WTY A;  1X0T A;  2ZVN B;  2XV5 A;  1OW6 A;  1H88 A;  2K1A A;  5KLI B;  2MJZ A;  1EDJ A;  2VRS A;  3HD7 A;  2E75 B;  1URQ D;  3TSI A;  3L74 J;  1BDC A;  4DOJ A;  2W27 A;  3P7K A;  4HH2 A;  2QJK B;  4H44 D;  3VN0 A;  3CMA P;  1AVY A;  1G2C A;  1FZC A;  2HG5 D;  5CCG D;  1GZL A;  2WPR A;  4XE5 B;  3SWK A;  3H1L D;  3F5H A;  3AE4 C;  1N8R Q;  2IYO A;  1BE3 G;  1OX3 A;  2FYN B;  1L0L E;  4NPF X;  1NTK G;  2WQY C;  1JO5 A;  2IBZ D;  2FFD C;  2CK3 H;  2FXP A;  2XU6 A;  3BVH A;  3PHL A;  1ZME C;  2A45 G;  3CCV P;  2YIU B;  1OXZ A;  1LWU B;  1KOR A;  2XNX A;  1WT6 A;  3V4Q A;  1VQ7 P;  1G1J A;  2ZT9 B;  1PZQ A;  3WUT A;  4WY4 D;  5DJU B;  3E1R A;  1P84 D;  3B71 A;  2WSC H;  1YIT P;  1SQB D;  1LP1 B;  2E74 D;  3EFF K;  1RY3 A;  5EFW B;  1DEB A;  1K8A Q;  1PV3 A;  1KIL A;  3H1K D;  1ZRT E;  2E5T A;  3CX5 E;  1OFC X;  4U3F D;  4I1L A;  2H88 C;  1K04 A;  2AEJ A;  2R5D A;  1MKM A;  3H1H G;  2R44 A;  1NTZ E;  1NVO A;  4AQR D;  3II6 A;  1ZXG A;  3CPW O;  2IZ0 A;  2R3S A;  1BSN A;  2O1J A;  3N7N A;  2O01 J;  1SP4 A;  3H1I E;  2M3E A;  1N2D C;  5CBN A;  3TGU D;  2PAJ A;  1T2K D;  2UWJ E;  2A06 G;  1USE A;  1VDF A;  1L4A C;  4PV1 C;  4RES B;  1L0N E;  2ZAE B;  3A7O A;  3HUS A;  4W7Z A;  2Y0E A;  3MZW B;  3KDP B;  2N9Y B;  4WBA A;  5AVZ B;  2QM8 A;  3RK3 C;  2WPS A;  4ASW A;  3M0D A;  1U57 A;  5H2F H;  3SFE C;  4ZKU A;  2GUS A;  4N3Y B;  1S4X A;  3PJS K;  3CWB E;  2V7Q J;  1JY3 N;  3I55 P;  3B5N A;  1URQ C;  1RF1 A;  1L2P A;  1J1D B;  1M8O B;  2WSS H;  2G3A A;  5K5G B;  1M7L A;  1NYH A;  3RBZ A;  1H0T B;  4WWI A;  4H44 C;  2FFD B;  1LT9 B;  3M0A A;  2K37 A;  1KTM A;  1CI6 A;  3CCR P;  1BE3 J;  3H32 B;  1IO4 A;  3L37 A;  1YJN P;  3L75 G;  2WIT A;  3M9H A;  5CCG C;  2QM7 A;  1PFI A;  1NTK J;  3VYI A;  4OGQ B;  1JY2 P;  3PP5 A;  3AEG C;  1FZA A;  5AVW B;  1GL2 B;  2E75 D;  3VMA A;  2JO1 A;  4YXW H;  2FKW B;  1QGK B;  3AEF C;  2KS1 B;  1QLE D;  5KAF H;  3ITK A;  2BEQ D;  1GK4 A;  3RL0 g;  2YXQ B;  1PPJ G;  1FJP A;  1ZP0 C;  4PD4 D;  1NWQ A;  1UIX A;  1BCC E;  1RE4 C;  4WY4 C;  3NFQ A;  4EIJ A;  1CZQ A;  4B86 A;  3H1J D;  3CCS P;  3G4S P;  3V5B A;  3I5C A;  3L71 G;  2BCC D;  2E74 C;  3L72 D;  3H1H J;  1SQX D;  1VQ9 P;  1FOS F;  2OTK E;  3Q5S A;  2H8P D;  3S9O A;  1VQN P;  1YJ9 P;  2FYU K;  1NAF A;  2C9N Y;  3L35 A;  4C7N B;  3GHG C;  1EC5 A;  5L8R J;  2HYN A;  5AW0 B;  1KYO H;  1HVV A;  5KAF E;  1JTH A;  2ZT9 D;  1KYO I;  2XDJ A;  1EDI A;  3L74 E;  2JDI H;  1SQQ K;  1LTJ A;  5AVR B;  3JC2 2;  1YTZ I;  3IR9 A;  3AE3 C;  2KLU A;  1RF0 C;  1X79 B;  1JY3 O;  3H25 A;  1T2K C;  1ZN5 A;  5APU A;  3EQ2 A;  3SWY A;  2YMK A;  4BRY B;  2IX7 C;  2OYI C;  2Q9I A;  1SQV K;  2KP8 A;  2FY8 A;  1LWU A;  3IN6 A;  2QSI A;  1N7S B;  2NRG A;  2JP3 A;  2L5G B;  1R5S A;  2LR2 A;  2N1T B;  4GDO A;  1KN7 A;  4Y99 C;  1KYO E;  3TDK A;  2IYP A;  1SVF A;  3C1L A;  1VQK P;  1MV8 A;  2J59 M;  1L0L D;  2K9Y A;  3LW5 J;  1M56 D;  2O01 H;  1CW5 A;  1SFC B;  1JM0 A;  3L75 J;  1VQ6 P;  4U7J A;  3AE7 C;  1NU1 D;  1LTI C;  1EZV I;  3W68 A;  3O6Q A;  1NKN A;  5AW9 B;  2M0B A;  3L70 D;  1RQU A;  3B4S A;  3M06 A;  3V2R A;  4YPC A;  4C7R A;  1QEX A;  4RJT A;  2WMM A;  5KKZ B;  2ZYA A;  1A02 F;  2E75 C;  4IL6 H;  1NTK K;  2FBW C;  2PGD A;  4JF7 A;  3G71 P;  3CX5 D;  5KLV D;  2KB7 P;  2V7Q H;  2AEF A;  4JYC A;  3L71 J;  3AEA C;  1NTZ D;  1BGY G;  2YO3 A;  1VQL P;  3H1I D;  1EZV E;  4OGQ D;  2YKO A;  2CPS A;  2FYZ A;  1GTW A;  3CCM P;  1GL2 D;  1M1K Q;  5E79 H;  1FBM A;  2HOD A;  1L0N D;  2FYN C;  5B66 E;  4ZKP A;  1Q86 Q;  1OMI A;  5CMZ A;  2K9J A;  4IL6 E;  2A45 H;  5TIS H;  3P8M C;  2A45 I;  2YIU C;  1RHZ B;  3CC4 P;  3MHV A;  2H89 C;  3W67 A;  2IPP A;  2O1K A;  2ZT9 C;  5KJ7 D;  3M9Q A;  3BCC G;  1GK6 A;  3CCL P;  1MFT A;  1XTG B;  1VQO P;  3CWB D;  1FU1 A;  1QVF O;  2ZYG A;  5B5E H;  1BE3 E;  4LLH A;  5E79 E;  1SQV G;  3WMM 0;  1NTK E;  2KSE A;  1XTC C;  2Q3E A;  4XA4 A;  3HTK B;  5AW5 B;  3VTP C;  3L4F A;  1ZV8 A;  4KHX A;  5TIS E;  2ITA A;  3TNU A;  1PP9 D;  2XZR A;  3CCE P;  1R8E A;  2KZJ A;  2WPV B;  5AVY B;  1IFJ A;  4A7P A;  1L4A A;  3G6E P;  4N6J A;  2ZFC A;  2HR3 A;  4W7Y A;  4L74 A;  1R5L A;  2AXT E;  3A0H H;  5B5E E;  1Z56 A;  3GMA A;  1N7S D;  4HB1 A;  2HFE D;  1S5L E;  4D6T G;  4EDF A;  1BCC D;  1YQ3 C;  1OZH A;  1YHQ P;  2E42 A;  2SPZ A;  4NPD A;  1QL1 A;  3H1H E;  2N1T D;  4N78 E;  1URQ A;  1X8Y A;  3F89 A;  3KZI H;  1QX8 A;  1LTA C;  2QIW A;  4ASV A;  2FXM A;  1DIP A;  1N73 C;  1SFC D;  1BGY J;  3R2P A;  1J1D C;  3AE8 C;  2P2U A;  3G3Z A;  3MGN A;  3VP9 A;  4HYT B;  3LW5 H;  2M5A B;  5CCG A;  1JY2 N;  1LT9 C;  2I1K A;  1FS0 E;  3L72 G;  3MUD A;  1JNM A;  1NHL A;  3L74 D;  3A0H E;  4M3L A;  2DW3 A;  2WT7 B;  2OTL P;  4DT0 A;  2YMY A;  2HPC A;  3WUV A;  4OGQ C;  2RKL A;  1A02 J;  3CL3 D;  5C39 A;  1WRG A;  2NPS B;  2FYU J;  2P1J A;  3KPE A;  1GL2 C;  5AVU B;  1FZG A;  1S5L X;  1SLQ A;  3KZI E;  2I1J A;  2G8Y A;  2JEE A;  3BCC J;  3CXH H;  1PGJ A;  3CXH I;  2ZYD A;  1RE4 A;  4WY4 A;  1SQQ J;  2XND H;  1K05 A;  3HE5 B;  2JWA A;  2IZ1 A;  3RK2 D;  5AW2 B;  3TYY A;  1KYO D;  5KJ7 C;  3L75 E;  1SQV J;  2WZ7 A;  1D7M A;  1EXI A;  3N4X A;  2BAS A;  3E7K A;  1DX7 A;  4KJM A;  3GHG A;  4EOT A;  3L73 J;  4PJ0 H;  2OYH B;  2HLO A;  1EXJ A;  3PTZ A;  1AQT A;  2KIK A;  3T97 B;  2B87 B;  1LTS C;  5AW3 B;  3U1A A;  1PIX A;  1M1J A;  1FDM A;  2GM4 A;  1GU5 A;  3P8C E;  4IFM A;  3CXH E;  1RF0 A;  3Q1M A;  1RQV A;  1PPJ E;  5AW6 B;  1PGP A;  1JUN A;  1FJK A;  2OYI A;  1NU1 G;  3SWF A;  1HWT C;  2KZI A;  3S4R A;  2Q5U A;  1S9K D;  1N73 B;  2O3J A;  2IFN A;  3L70 G;  3L71 E;  4D6T J;  1SQP G;  2W8Z A;  3C9I A;  1JY2 O;  4GT1 A;  3O8Z A;  3MD0 A;  1NTM G;  1EDK A;  1ZW0 A;  1FZC C;  1NJI Q;  4PJ0 E;  1N7S C;  2ZJS E;  5APX A;  5DJT B;  3VOP A;  1EZV D;  1GU4 A;  4GOE A;  3M91 A;  5KLV G;  2N1T C;  4H13 D;  4GOF A;  3CCQ P;  5CCH D;  2W90 A;  2QJY B;  1M90 Q;  1NTZ G;  1OIP A;  5H2F E;  4Z1M H;  1SFC C;  3UIA A;  3B8E B;  4IFD K;  4TLF A;  1GW4 A;  4W80 A;  3U59 A;  1VQP P;  4R4M A;  2KNC B;  2ZVO B;  1LTG C;  2E5Y A;  3HE4 B;  1FOS E;  2RH0 A;  2OTJ P;  1N86 A;  5KKZ C;  3NMD A;  4I7Z C;  3D6Z A;  1P84 H;  1BE3 D;  1P84 I;  1YYC A;  5BU5 A;  1LNQ A;  2KSJ A;  1NTK D;  1FZE A;  1LTT C;  4BWN A;  3NXS A;  3R4Y A;  3ZDM A;  3CWB G;  1H89 A;  1NOH A;  3OAK A;  4QMA A;  1PL5 A;  1VQ8 P;  3QWO C;  3RK2 C;  3U1C A;  3IFM A;  1S72 P;  3D6Y A;  2M8R A;  2WSF J;  3AED C;  1S1C X;  5APT A;  3WUU A;  3HD7 B;  2QJP B;  3AEB C;  2NPS D;  3AE9 C;  1W2B O;  1KIL E;  1JCC A;  5TJH A;  1PP9 G;  1AFO A;  3OA7 A;  1IJD B;  3VP8 A;  4L76 A;  1G2C B;  1ZOY C;  1FZC B;  2QA4 P;  2IFM A;  3KYQ A;  2JR8 A;  1LP1 A;  3VMY A;  2Q3I A;  3FXD A;  3H1H D;  3L70 J;  1SQP J;  1HJB A;  1Q82 Q;  1BGY E;  4N78 D;  2YKQ A;  3OJA B;  1KB9 H;  1KB9 I;  1NTM J;  1DD4 A;  1BCC G;  1QL2 A;  4LGD E;  2W6A A;  1U7M A;  4WB4 A;  3S1K A;  4ZNC A;  4JPZ B;  3AE6 C;  5KLV J;  3H1L G;  1KD1 Q;  1DD3 A;  4L73 A;  2KI7 B;  3OW2 O;  1FDI A;  3QH9 A;  2KOG A;  2B89 A;  2WVR A;  3BAS A;  2FYU E;  3LIE A;  5KTB A;  2FXO A;  1T6A A;  2IBZ G;  3PLN A;  3IF4 A; 
#chains in the Genus database with same CATH homology
 2XZR A;  2W6B A;  2R5D A;  5AVY B;  4AUW A;  1IFJ A;  2POH A;  1L4A A;  4AQR D;  1KIL C;  3II6 A;  5CCH C;  5AW1 B;  2JJL A;  2O1J A;  3N7N A;  1SP4 A;  1KIL B;  1N2D C;  4C46 A;  4N6J A;  2ZFC A;  2PAJ A;  1T2K D;  1KQL A;  1NH4 A;  1OWA A;  1E5W A;  3EFG A;  4W7Y A;  1T8Z A;  2OAR A;  1VDF A;  1L4A C;  2WSE H;  3TNU B;  1HGV A;  4RES B;  1T3J A;  3A7O A;  3HUS A;  3BRV B;  1L4A B;  3RL0 D;  1DH3 A;  3VMZ A;  2CPB A;  1Z56 A;  4W7Z A;  1HBW A;  1N7S D;  3V2P A;  5APV A;  3RK2 B;  2HFE D;  3KDP B;  4OH8 B;  2E42 A;  4WBA A;  5AVZ B;  2QM8 A;  3RK3 C;  1QL1 A;  2N1T D;  2WPQ A;  3HUS C;  2WPS A;  4N78 E;  3RK3 B;  1URQ A;  2Z4E A;  1X8Y A;  1MFZ A;  3HUS B;  3M0D A;  2FFD A;  1M1J C;  1H8A A;  1LTA C;  4ZKU A;  1LT9 A;  2GUS A;  4N3Y B;  5AW4 B;  2FXM A;  1N73 C;  1CSB A;  3MTU E;  2WT7 A;  1SFC D;  3R2P A;  3H32 A;  1J1D C;  2P2U A;  2H7H A;  2LKM A;  1JY3 N;  5AVX B;  3G3Z A;  3MGN A;  3VP9 A;  1MUU A;  3B5N A;  1URQ C;  1RF1 A;  5AW7 B;  1J1D B;  3P8C D;  4I6M C;  1M7L A;  3M0D C;  1HTL C;  4HYT B;  3LW5 H;  1URQ B;  1JY2 N;  5CCG A;  1KFM A;  1LT9 C;  2I1K A;  2NPS A;  2FFD B;  3MUD A;  1JNM A;  1NHL A;  1LT9 B;  3M0A A;  1GL2 A;  1CI6 A;  1HUC A;  3V4W A;  4M3L A;  2WT7 B;  3H32 B;  2YMY A;  1IO4 A;  3B5N C;  3L37 A;  1RF1 C;  2HPC A;  1JY3 P;  1NO4 A;  1ZR4 A;  2WIT A;  1J1E C;  2P67 A;  3M9H A;  3B5N B;  5CCG C;  1RF1 B;  2QM7 A;  3HE5 A;  1A02 J;  1PFI A;  2NPS C;  3CL3 D;  3VYI A;  1WRG A;  2PP6 A;  1JY2 P;  3PP5 A;  4LC1 A;  2NPS B;  2P1J A;  3KPE A;  1GL2 C;  1FZA A;  5AVU B;  5AVW B;  1FZG A;  1SLQ A;  1LTB C;  2GUV A;  2I1J A;  1GL2 B;  3VMX A;  1JMM A;  1CI6 B;  3NTN A;  2JEE A;  3V2Q A;  5KJ7 A;  2HPC B;  5APQ A;  2FKW B;  2P7J A;  1RE4 A;  4WY4 A;  3BAT A;  3HE5 B;  1X9V A;  2R32 A;  1GK4 A;  3RK2 D;  1NU1 K;  2OYH A;  5AW2 B;  1FJP A;  3T97 A;  3HD7 D;  3TYY A;  1NWQ A;  5KJ7 C;  1RE3 A;  2WZ7 A;  1RE4 C;  3MIW A;  4WY4 C;  1SQP K;  3N4X A;  2M3B A;  3NFQ A;  4EIJ A;  1CZQ A;  4C7N A;  2Z5H A;  4B86 A;  4WY4 B;  2WSF H;  5AVT B;  3V5B A;  3I5C A;  2BAS A;  1DX7 A;  2OYH C;  2YO2 A;  1NTM K;  3GHG A;  4EOT A;  4GKG A;  2OYH B;  2HLO A;  1RE3 C;  1SQX K;  1LTS C;  5AW3 B;  3U1A A;  1S9K E;  1FOS F;  1M1J A;  1FDM A;  2H8P D;  2GM4 A;  5APW A;  1N73 A;  2FYU K;  1NAF A;  1YTZ T;  1GU5 A;  2C9N Y;  3P8C E;  3L35 A;  4IFM A;  4C7N B;  5KLV K;  1RF0 A;  3GHG C;  5AW6 B;  5APY A;  2HYN A;  5AW0 B;  1IFI A;  3P32 A;  1HVV A;  3GHG B;  1JTH A;  1JUN A;  1FJK A;  2XDJ A;  1NTZ K;  1T3U A;  2OYI A;  1G1I A;  1EQ7 A;  1SQQ K;  3SWF A;  5AVV B;  1LTJ A;  1M1J B;  2ZXE B;  1HWT C;  4JYB A;  5AVR B;  1YTZ I;  2Q5U A;  1S9K D;  3IR9 A;  2H43 A;  1RF0 C;  2N9B A;  2YNY A;  1N73 B;  2E43 A;  1X79 B;  1N7S A;  1JY3 O;  1T2K C;  1ZN5 A;  2IFN A;  3H6P A;  5APU A;  5BU8 B;  3C9I A;  3EQ2 A;  2R3C A;  3SWY A;  1HGZ A;  4AYC A;  1JY2 O;  4GT1 A;  3O8Z A;  3MD0 A;  2IX7 C;  2OYI C;  2Q9I A;  1SQV K;  1L0N K;  1JTH B;  2KP8 A;  2N1T A;  5AW8 B;  1LTJ C;  1FZC C;  1LWU A;  2OYI B;  3RL0 C;  1LTJ B;  1N7S C;  3RL0 B;  5AVQ B;  5APX A;  3VOP A;  1HH0 A;  1N7S B;  1ZLL A;  1GU4 A;  1SFC A;  3M91 A;  3BRT B;  2N1T C;  1VPC A;  2C9L Y;  1J1E B;  4GIF A;  1AQ5 A;  2L5G B;  1LWU C;  3E1I A;  1KIL D;  3A2A A;  2N1T B;  5CCH D;  4DZO A;  2C0W A;  4Y99 C;  1FAV A;  2KLV A;  3HE4 A;  1SVF A;  2YKP A;  4Y99 B;  1IC2 A;  1MV8 A;  1JOC A;  3TK1 A;  2J58 A;  1L0L K;  1N7L A;  1KFN A;  2J59 M;  1IFN A;  1LGH B;  1SFC C;  3UIA A;  2O01 H;  3B8E B;  4IFD K;  5BVZ A;  1CW5 A;  1SFC B;  1GW4 A;  1L4A D;  4W80 A;  1ZR2 A;  3U59 A;  1NKZ B;  1LTI C;  1LTG C;  3HE4 B;  1JCD A;  1FOS E;  4O9B A;  1IK9 A;  3A5T A;  1NKN A;  5AW9 B;  3RK3 D;  4I2L C;  1FZB A;  3M06 A;  5AVS B;  5CJ4 A;  3V2R A;  1N86 A;  3KQG A;  4C7R A;  2WTY A;  3NMD A;  3CLQ A;  2XKM A;  2XV5 A;  1YYC A;  5BU5 A;  1A02 F;  1H88 A;  2MJZ A;  1NTK K;  2KSJ A;  2VRS A;  3HD7 A;  1FZE A;  1LTT C;  3NXS A;  1URQ D;  3TSI A;  1FZF A;  1MZ9 A;  4JF7 A;  2WWW A;  1H89 A;  1NOH A;  3OAK A;  1J2J B;  2KB7 P;  4DOJ A;  2W27 A;  3P7K A;  4HH2 A;  3A3Y B;  1KZU B;  3VN0 A;  4JYC A;  3RK2 C;  3U1C A;  3IFM A;  2YO3 A;  3HD7 C;  1G2C A;  2M8R A;  1FZC A;  3B5N D;  1IFM A;  5APT A;  2Z5I A;  3HD7 B;  2HG5 D;  2YKO A;  5CCG D;  2CPS A;  1GZL A;  2NPS D;  2FYZ A;  2WPR A;  4XE5 B;  1GD2 E;  1GTW A;  1JCC A;  1GL2 D;  1AFO A;  1FBM A;  2HOD A;  4IFF A;  3OA7 A;  1IJD B;  3VP8 A;  1IFD A;  4ZKP A;  1G2C B;  3M9B A;  1FZC B;  2IFM A;  5CMZ A;  3CI9 A;  1GW3 A;  5CJ0 A;  1GDT A;  2A45 H;  3P8M C;  3KYQ A;  2A45 I;  1JO5 A;  3VMY A;  2FFD C;  2R5B A;  2Q3I A;  2XU6 A;  3BVH A;  1HJB A;  4N78 D;  2HOD B;  2IPP A;  2O1K A;  2A45 G;  2YKQ A;  3OJA B;  1OXZ A;  1LWU B;  3M9Q A;  2XNX A;  5KJ7 D;  1WT6 A;  1GK6 A;  3V4Q A;  1G1J A;  2Q7C A;  4WY4 D;  1XTG B;  2WSC H;  1QL2 A;  1SQB K;  4LGD E;  2KYV A;  2W6A A;  3HTK A;  4WB4 A;  1FU1 A;  3L36 A;  4LLH A;  5CHX A;  1RY3 A;  1DEB A;  5APS A;  3WMM 0;  1KIL A;  3V2N A;  5CCH A;  2KOG A;  3LID A;  3BAS A;  1XTC C;  3LIE A;  5KTB A;  4XA4 A;  3HTK B;  2C0X A;  3VTP C;  3L4F A;  1ZV8 A;  4I1L A;  4KHX A;  1W2E A;  5AW5 B;  3TNU A;  3HRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...