4H13B

Crystal structure of the cytochrome b6f complex from mastigocladus laminosus with tds
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
total genus 42
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4h13B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h13B01
2ZT9B 3LW5J 4IL6X 2E76B 4KT0J 3C8VA 4OGQB 2QIWA 2K9YA 2E74B 2E75B 4I7ZB 1S5LX 1JB0J 4PV1B 4H0LB 4H13B 2QJKC 4H44B 2WSCJ 2YIUC 2WSFJ 4RKUJ 2WSEJ 5KLIC 5KKZC 2WPVB 1Q90D 2QSIA 1VF5B 5L8RJ 1ZRTE 2QJYC 4Y28J 2FYNC 2QJPC 2D2CB 2O01J
chains in the Genus database with same CATH superfamily
4JI4B 4B3RO 1DD4A 1WA8A 1FDIA 1USEA 2O57A 4PV1D 3JCZA 2HR3A 5LGUA 4DV1B 1IBLB 1KQSO 4HNAB 2Z0AA 2Y9ZA 2SPZA 1FXVA 1ZR2A 1K8AW 2W0XA 1YZBA 5CMZA 3RYCA 2B88A 1OVUA 2EIKC 2JVDA 4NXMB 5BMVA 2EJ7A 2P7TC 2BTOA 3E22A 4U3JA 4JAUA 3H32A 1Q81Q 2DWEC 3STZC 5E79H 1PL4A 2YXQB 1L8DA 1LT9C 2ZT9B 1AR4A 2R72A 3L72H 4I4TB 2K37A 2WPRA 1KFMA 1PPJG 4PA7A 3LNMB 2Q6QA 3OMAB 4BIOA 2YMYA 2IH3C 3N7NA 2B87B 4YJ3A 3AEGC 3P3PA 1IFJA 2VQEB 1L4AA 4JASA 1NU1D 1D5AA 1R3IC 2CUGA 2ZCEA 2W6JG 1QL2A 2RH0A 2UXDB 2M3EA 5FL7G 2PFXA 2F1MA 3L71J 3K04A 3T4ZA 3L74E 3T4DA 4ZKPA 2AZ0A 2YIAA 3A0BZ 1SQBG 2F93B 5B1BB 3JAKB 4X88A 3HUSA 3KPEA 2H8PC 3CD6P 3DC6A 1WN7A 5AW9B 3KXDA 2H43A 3ABLB 2LKMA 1QLEB 1K92A 4TV8A 1ZX3A 2P5OA 1YI2V 1VQ4P 4UV9A 1QVFO 3CPWU 1R1BA 3MTUE 4FZ0A 2E75C 2HFED 3SPJA 5B1AB 1KB9D 5DN6G 1S2EA 3L71E 3LDEA 1KKCA 4NTWA 5KJ7A 1GO3F 3VBBA 4TLFA 4K0KO 2JEEA 3W68A 1NWQA 1VQLP 1N33O 1PFIA 1AI7A 2KZJA 1NTMH 4LFBB 1FZGA 3A0HZ 1RF1C 4U3FG 2IH1C 2X6BA 3T1YO 4EI2A 2YKQA 3L72G 1N73B 1OCZC 1XTGB 1K04A 3RFRA 2JO1A 2GUZA 1T3UA 1D5NA 2LR2A 3LDDA 2P10A 4GOFA 2ZE8A 3N2KB 3UIAA 4FLWA 1VQPP 4LF8B 3DXRA 2KS1A 2NNUA 2N04A 1S5LZ 2IJHA 3RT3C 3I55V 1LJ2A 2R44A 3VMZA 1SQVK 3H1HD 1H8HG 2E3CA 3B5NC 4HH2A 1YITV 1AP5A 2ZE5A 5KX5A 5JH7A 3APQA 1J2JB 2ZYGA 3A7OA 4HB1A 1R3JC 3CHXA 1Z5VA 1WRGA 3RL0B 5B66H 3BHPA 4C7UA 1XL6A 3WG7C 2E76D 1NVPD 4LF7O 4EKWA 3IAOA 2H3OA 3PRJA 4I2LC 4P9OA 3ML0A 3ZMZA 2PZSA 3HTKB 1P84F 4RUFA 4JI5B 3K59A 3L70H 2EILB 1P84H 3E7KA 1SQPD 2ADPA 1FC2C 2OTJV 1FXKA 2PI4A 5IYZA 1EDJA 1V55C 3A0BE 3RYIA 3HE4A 1FJPA 3LSQA 4ICGA 5AVXB 1XTCC 1PL0A 2XNDH 3H1ID 3GLMA 3FB7C 1RQVA 2XZRA 2Y69B 5J9PC 4OH8B 3EXAA 5BZBA 5KHGA 2JR8A 4DO2A 3CWBJ 1ORQC 1ZL8A 1XNRO 3V2QA 1MA1A 4IYHA 1MV8A 4H13D 1V54C 5JQGA 1H0TA 1RQUA 2MKVA 4JQ0D 1NTMG 4AILC 2A06D 2L5GB 3L35A 2CTPA 1MFTA 2P67A 2HG5D 3L4FA 4L76A 2PYJA 3EWKA 2XAFA 3OAKA 5APSA 4D6TJ 1RE4A 1Q6IA 5D5QA 1PD3A 4RESB 1PNMA 3MHSC 1DF5A 4B3TB 1QR8A 1CPYA 4RWUA 4DV6O 2NPSC 3A0HE 2WLIB 2ZAEB 4WY4D 1VIBA 1K9MW 3LW5J 4MTFA 4LFAO 2V4DA 1SQXD 2F66C 2UXCB 3M0DA 3BRVB 1GU5A 4ZIBA 2V7QJ 3RGUA 1Q86W 3QF7A 2A45H 3JAWB 2H89C 2E75B 4J41A 3KYQA 4I50A 4CH4A 1NJIW 2R3SA 4LFCO 1EN4A 2Q0AA 1OFCX 4HKZH 2OCHA 4F6RA 3MP7B 2AXTZ 2BCCG 1XREA 2LW1A 1K5QA 1WPXA 2ZYAA 4YPCA 2V1DA 3F5WC 1SFCC 5EC2C 4UCOA 4LH7A 1RF1B 1OCZB 5L3BA 1KV4A 1Q8IA 4FFBA 3ZN1A 1P4RA 3ASOC 4X20B 3WFVA 2W83C 4W7ZA 1L0LG 3CCMV 2XNDG 1EBOA 2WLLA 1FAFA 1VQ7P 1K05A 1RE3A 3VYIA 4I1LA 1WAZA 2K1EA 1GL2D 1XHXA 1VF5B 2ZXWB 3CMAP 1ZUQA 4DV2O 1RY3A 2FKXA 5CA1A 2JJ1G 4F6EA 1X0TA 1HWTC 1WB8A 4KP4A 4I55A 1JY3O 3H1JH 2QA4V 3AE9C 1G8MA 1HNZO 4C46A 1SQGA 1UFIA 1OCOB 2EIMC 3E89A 3KHUA 4GIFA 1G2CA 2Y4TA 1KQSU 3A5TA 2A0LA 2WA4A 3ZRWA 3LIEA 5KA5A 3I56P 2V4HA 2IFMA 3ZHQA 1NTZJ 4Z1VA 1NOHA 1VQMP 4DR5O 1DEEG 1X9VA 1O9HA 2YEVB 4ZMDA 2DE0X 1MZFA 1KBHA 2A45G 2G3AA 2RJZA 3TK1A 1IFPA 1KZUB 2YNYA 3E1RA 1SQQK 5JWPA 4LF6B 5IWAO 4L8JA 1EN5A 4CC5A 2UU9O 1NT2B 3GHGC 5AW5B 1BCCG 2OYIA 1RPRA 1V54B 4CH5A 2DQ3A 2EX3A 4JI6O 1RP3B 1R3KC 2ZQMA 2QEXV 1FD9A 4QE7A 3HKEB 3OTOB 1SQBJ 4WY4A 5KLVK 4FVMA 4HYOA 1S72V 1NH4A 1KMIZ 1PPJE 1VQKV 3F7YC 1IFIA 2AXTE 1H38A 2G38A 2WT7B 1YJ9P 4J9YB 1KILE 3IAYA 2M7WA 5CBOA 1AVYA 2NPSB 3H1LD 1KC8Q 1JNMA 4PDRA 3FD9A 1R6TA 4LF4O 1K73Q 4O4LB 5A9GA 2M5AA 4RQFA 3DSQA 2QWNB 1Q5OA 5LA6B 1H88A 2FFDC 2QJKC 4AUWA 1TUBA 2JP3A 1SQBE 4YTPC 2FYUH 2B1GA 3H1JG 4WCEV 4DR3O 3BCCG 4FIPC 2YO3A 1KKDA 4PD4F 3L75D 4IIJA 1NHLA 3RVYA 3H1KD 4PD4H 4YXWG 4U3FJ 2AEMA 1FFXA 3L72J 1HW7A 3OR6C 4NB5A 5B1NA 3F5HA 1FZCB 2IBZH 1LUVA 2HVJC 1GL2A 4JI1B 1R5SA 4H0LB 2QR4A 5C39A 2WSEH 3ASOB 5CJ0A 1S5HC 1N34O 1H2LA 2WSFJ 3SWFA 2YXHA 4RUEA 2OGUA 1Q90D 2XOKG 5J2TB 1N8RW 4JI2B 2QWOB 3G71P 2BTQB 3V6IA 3CCEV 1AI6A 3OW2O 1OCCB 2Q5UA 1KILB 1OXZA 2EINC 3ZMTA 1DD3A 4YY3B 2KLVA 2HLOA 5E79E 4LR3A 3B8MA 4U3FE 4GZRB 1BE3D 3ZMUA 2C0WA 2LFSA 1HNWO 1NU1K 3L72E 3RYFA 2Q3EA 3HKBB 1W0KG 3CCRP 2DYSC 2ZM6B 5JCOC 1MZEA 1HUCA 4KHXA 1HJBA 2Y0PA 4DUYO 3L74G 3M06A 1GMGA 5B66Z 3JATA 5CCGD 3OMNB 4X1KA 1SQVD 2ODMA 5JJJB 1YTZI 3TJTA 1MKMA 1G6UA 3IC9A 2XV5A 4OPAA 5AVRB 3JSNA 2E42A 2ETNA 3JD3A 1AJQA 1FZEA 1LP1A 2JJ2G 4DR1O 2ZD9A 2N9BA 1OZ0A 1XBLA 1XL4A 1T5EA 2I1KA 1NTKH 3TF5A 3RK3C 3WB2A 2FYUG 2LFRA 3D3QA 1TUEB 1VQ6V 1Z56A 3Q1MA 4O4HB 3ZRVA 4UCTA 2YS8A 3CCUV 1LTGC 4N23A 2IM9A 3CCVP 2BOCC 1OHHG 1SA0A 3AG1B 4WVZA 1URQB 3ETEA 3EFFK 1JJOA 4DV5O 2IBZG 3E86A 2UUBB 4W80A 1VQNP 1H89A 4R4MA 3CRAA 4Z1MH 4OX9O 3ZEDA 1CI6A 2KG7B 4PDMA 5IJ9B 3QVNA 4IYIA 2I8DA 3E8HA 1XMQO 3FX0A 2LO1A 4MVRA 3C1LA 1M9NA 1YQ3C 3K58A 3SYPA 1NTME 2QKSA 4FLZA 3V2PA 4NXNO 2CGNA 2P6JA 2BCCJ 2XAQA 1NTZK 2N1TD 1OW8A 2ZR2A 2JKVA 5IYDO 2ZE7A 5ITZA 1OJHA 2WSSG 3OGCC 1S5LH 3JD4A 3A3YB 4MT8A 1A02F 5AVQB 4HNAA 4MTOA 3ABVC 5H2FZ 2UUAO 2K1AA 2ZJSE 3G9RA 2O01H 1L0LJ 1L2PA 3RYHB 1SQPK 1NS1A 5LHGA 4GLXA 2YDEA 2GV9A 1KQGB 4RO0A 3CCSP 5LMNB 3BRTB 2Z5HA 2QTOA 2KYVA 1PV0A 3T1HB 2QJPB 1NTKG 2EINB 3RL0D 4AI8A 3AEIA 4I4TA 2A79B 1E79H 1BGYG 5CCGA 1K34A 1KFNA 3CX5F 2Q7CA 3WUTA 2LGQA 1NU1H 3CX5H 4NPFX 3HKDB 2ZNJA 5APTA 1CSBA 2ATKC 1NGMB 1T2KD 3B4SA 2B87A 2E5LB 4O4IB 1PIXA 3HE5B 1LTIC 4HYTB 4DV0O 2KNCA 4WFEA 1IBKB 5AVVB 5IJ0A 4PI2A 2WMMA 1HF9A 5CBGA 3G4SP 2HPCB 2AHYA 1T8ZA 2J59M 4Z1MG 2XTAA 3CS5A 1U96A 3CCJP 4PA4A 1MUUA 4JPRA 2QE7H 2JDIH 3HPLC 1DK1A 3A8TA 5LYJB 2YC0A 3BA9A 4MVUA 2Q7HA 3THOA 1HBWA 3JAKA 1SQXK 5FPRA 2JEXA 3IC7A 5B3SC 2KB7P 3CC4V 1BCCJ 1KP3A 2PI5A 3AE6C 4QE9A 1AFOA 4BIZA 1HGZA 3NTNA 3H25A 1J1EC 4XDKA 2XAHA 3P8CE 2WWWA 2R5BA 1KB9F 2DJVA 4J9ZB 3FXEA 4I7ZC 4J7JA 1KB9H 1XUQA 4JI8O 3G6EP 4W4KA 3VQVA 1M57B 4Y99C 3OAAG 1Y74A 3SPHA 2Z5IA 1KQLA 2YUAA 2L6LA 1Y76B 2IJIA 1OCRC 3BAAA 3K3WA 2YKPA 1WT6A 5CJ4A 3OTFA 2P7JA 2BEZF 1N32O 1BCCE 4DR7O 3U0ZA 4YIOA 3T1CA 5CBHA 1EXJA 5BXZA 2VQEO 3D6ZA 4X1YB 1FZAA 1N73A 3H1JJ 3P3NA 1VF7A 1KD1W 1D7MA 3BCCJ 3AG3C 1H2SB 5H9CA 1BDCA 1FPOA 3CMAV 5KUMA 2ADQB 3N2KA 2ZVOB 4MVZA 2P58A 1SZTA 4CBCA 1QEXA 1RSOB 4FLXA 2AZ2A 1LT1A 3HD7C 3L73G 5EIBC 2W8ZA 1LWUB 3OUSA 2ZDIA 4I0XB 2WITA 5LP6C 2PYLA 2AEJA 4R6ZA 2QJYB 1M1KW 1TVKA 5CCHC 3LSUA 2JDIG 5FLXN 1Y47A 3I56V 1KYOF 2QIWA 1JMKC 4JTCB 2K9JB 3JSVC 1KYOH 3QTCA 1VQMV 3H1JE 3CXCU 3ABUA 3BCCE 1VF5D 3HTKA 1S4XA 5L3FA 4EDFA 2LW7A 3P8MC 2ARHA 1U57A 4O4JB 1F7YA 1S1CX 4TUYB 4BRYB 2VWKA 3D3IA 3CJHB 1M1JC 4J7KA 5DM6V 3CWBD 5AW4B 1F4NA 4WFFA 4WBAA 2WLHA 2WSCJ 4B3SB 4LFBO 2LXBA 3L74J 4FM0A 4IL6Z 1AILA 4FM2A 4UXNA 5C8YB 3MZWB 5DJTB 1Y66A 1BSNA 3IJ4A 1NAFA 3VQXA 3Q4HB 2OWOA 1H8AA 1Q7YQ 4B08A 2F4VO 1IFMA 1JY2P 2A06H 1P84I 1Q82Q 3OW2U 4D6TD 2CH7B 5CA0A 2UWJE 3K08A 1GZLA 5AVSB 1Q6UA 4PDVA 2PGDA 5B5EE 5LMUO 3O9OA 2L35A 1FAVA 4NYKA 3AG2C 3BABA 2QWPB 4CH6A 2FYUJ 1SF9A 1SQXH 2NN4A 1R5LA 1EXIA 3N27A 3IGAC 2IDBA 3RL0g 1PGOA 2WLIA 1EDIA 3KZIE 2Q68A 4I7ZB 1KORA 1VQ8V 4U7JA 1NH2B 3P7KA 1COWG 1YJWP 4Y99B 4JI5O 1M56B 3JAWA 3H6PA 2PUSA 2WSEJ 4DV3O 2PY5A 1N36O 4DR2B 3R2PA 3M8AA 1OCRB 3BFRA 3JD0A 4AYCA 1WB7A 1SVFA 4GX0A 2IU0A 2PGGA 5EC1C 4UVCA 4KHPB 2FYUE 3KKYA 4JF7A 2QKAA 1B6QA 4X65B 1RF1A 3JD2A 1L0NH 5AW0B 2FL4A 4PD4E 3G71V 2UUCB 5L3DA 2A45I 2N05A 4WF9V 2P4VA 1BS3A 4L87A 4UFZA 5AW7B 3AEFC 2X6CA 4JV5O 4GT1A 4MTGA 3AG3B 1G4YB 3SJQC 1OMIA 2IBZE 3JYCA 1OX3A 1IFNA 3J81N 3SFDC 2WLNA 1CEZA 3MUDA 1AR5A 1JUNA 3GB7C 1OZHA 2W6AA 2R9AA 2FYNC 3ASNB 3D36A 2GUVA 3HD7B 4TV9B 3ZX6A 4CPGA 3V2RA 2WPDG 4DW1A 1FJKA 4H0LD 4NTXA 4XA4A 1X59A 5LP6B 1GW4A 3MAQA 2GA1A 4PJ0H 3ETDA 4RO2A 1MSWD 2Y9YA 4J80A 1PGJA 1PPJD 3CYOA 1S77D 1NTZD 2UXBO 3CC7V 5KJ7C 1I5XA 1KILD 1NTKJ 1HNXB 3SPCA 2EIKB 1SQXG 5GONB 2IJKA 2ZR3A 3GWKC 1BGYJ 1M90Q 3RGBA 1VQ9V 1M1JB 3OT7A 1AROP 5FNVA 3ZHVA 3SFEC 2HEPA 1BSHA 4L75A 1XMOB 5EYPB 4PV1C 5APQA 1AJPA 2MK3A 3RN4A 3I5DA 2YEVA 1BT8A 1EZVH 5KMGB 2XU6A 1PZQA 1GN2A 1S9KE 1LT9B 4FFKA 1SQBD 2Z3YA 4JZGA 4MW8A 3PLNA 1WA8B 1EM1A 1NTKE 3CRCA 2KP8A 3R4YA 3E35A 3UCSC 1EC5A 1JMBA 2KKWA 2EULA 1BGYE 3V4WA 2GSMB 2YSUB 1L0NG 2B9BA 2OCCC 3E8BA 5GTHZ 1HP8A 2RDCA 4DV7O 2WT7A 1LTBC 2Z4EA 2JWAA 2Q7EA 1P7BA 5CBNA 5CB4B 3E22B 5DECA 1Y67A 4U3JB 2RNBA 1LTAC 2ZYDA 4DV4O 1FJGO 3F89A 2ZIOA 3ABTA 3ZN0A 4K35A 4LF5O 1URQD 4O4LA 3FKSG 1A02J 2QSIA 5LGNA 2CTQA 1GRJA 2RMKB 4QJFB 5LA6A 4E2LA 4K0KB 4U3FD 5K1PA 3STLC 2XHBA 3L75H 1IBMO 3L72D 4FK5C 1N33B 1Q81W 1BQZA 2HYNA 1JFFA 3K9SA 4YJ3B 2PRRA 3C3SA 3T1YB 1ZW0A 1FOSE 1VQOP 2E5YA 2VRSA 1JX9A 3SPIA 4JTDB 5LL6Y 3CCQP 2Q4PA 2K88A 1SS3A 5H2FH 1S5LE 4IFMA 1FZCA 3GF7A 4DUZO 4NKGB 1K33A 2JS3A 1GM9A 3TXSA 1ZRTE 1G1IA 1PGPA 3JASB 2Q5ZA 1YHQV 3L70G 3JC22 1EZVG 2HHHB 1RE4C 5J2TA 4L74A 2HFEC 4FPPA 2BTQA 2FYNB 2DW3A 4K3AA 4LWSA 3CL3D 3L73J 1BE3H 1G1JA 2Y4UA 4PD4I 4XBFA 1S5LX 3G3ZA 1V9PA 1KILA 1PP9H 2I1JA 2M3BA 4C7RA 3AECC 4LF7B 3M0DC 2HKOA 4JYCA 4QIWF 2IBZI 1TA8A 2KZIA 4R50A 4GKJO 3LDCA 3HKBA 5AVYB 3PN1A 1IXBA 3BY6A 2EIJC 3B5NB 1SQVH 5CA3A 3HKCB 3TCUA 3F7VC 3CX5E 2KSJA 4CZZA 5LGTA 4UB6H 2Q0OC 1PV3A 4Z2WA 3WG7B 1OVVA 3C8VA 1GH6A 1KU9A 2ZKOA 5L3GA 4K8XA 2FKWB 1QU7A 2VQFO 3L73E 2WTYA 1K5SA 3AK3A 3B09A 1US6A 4PV1B 5AW1B 1JY3P 5AW2B 4MN4C 3S9OA 1XNRB 1S0VA 3NMDA 3TSIA 1V55B 1TGOA 4ZBMA 5BR8O 4CS3A 1ZMEC 4X9QA 3G6EV 2ZE6A 2E76C 2KS1B 1IXMA 4FZ1A 4FLTA 2Q3IA 3M9HA 2KXPB 4OGQD 1LGHB 2E74D 2OTLP 1FZFA 1RE3C 2N9YB 1NVOA 1Q3EA 4O4HA 2OARA 5E1AC 3VOUA 4ZNCA 3RK2C 1YEWA 3QG5A 4P2ZA 4GCZA 3JALA 1M7LA 3D70A 2QJ1A 5GTIZ 1RF0A 1URQA 2IFNA 4DV6B 2OCCB 3CP1A 3Q5RA 1JOCA 1AVOA 4BWAA 4YY3O 3JCUZ 4LFAB 2JK5C 3PJSK 4G2KA 4DRXB 3ZHTA 2H94A 3CLQA 1O9GA 4G28B 2YO2A 3SJBC 3UM7A 2BCCD 3FWNA 1AQ5A 1M57D 2MJZA 3K5NA 4KL1A 3EHBB 2AHZA 1J1DC 1AVMA 5FPOA 1AJYA 1PP9G 1ROPA 3ITKA 4H13C 4Q20A 4UCUA 5H5NA 3LIDA 3HB3B 3Q2YA 2YIDA 1PGQA 1YIJV 2POHA 3A2FA 1ZV8A 2WZ7A 3WB1A 1ZR4A 4PELA 3CMEP 3K03A 1L0LD 1SQVG 2YXRB 3MD0A 5J2UB 1JY2N 2FXOA 4UUJC 5IY5C 1FDOA 1N4CA 1VF6A 3C3TA 4UCSA 3CCLP 3OD4A 3TYYA 1CW5A 4LF9O 3F5TA 4WY4C 1QVGO 1SFCB 4ZI7B 1YDXA 3J80N 3RYHA 2ZXEB 1OW6A 2M8RA 1ENVA 1ZLZA 1XNQO 1A32A 4DV2B 3EFGA 3P32A 1W2BO 2X6AA 4DR6O 4PA9A 1QVFU 4HAMA 3W7WA 2UUBO 1KYOE 3SDLA 2AXCA 4IT5A 1HNZB 4GODA 1QHTA 4XE5B 4I50B 4OWFA 2IJJA 2A7WA 5JCOA 3HKDA 2EIJB 1LTJA 1SP4A 4IL6H 3FB8C 2OTKE 4DYLA 1GN4A 3N2GB 4MVSA 3SWYA 3ABMC 1F23A 4O4IA 4DZOA 1AQTA 3HE5A 1YI2P 4C7NB 4J7ZA 4DR5B 4LNUB 4PJ0Z 5AG2A 2RN9A 1VQ5P 4JI0O 1HR0B 3R66A 5LOVB 2R32A 4TQFA 1BCCD 1QNMA 3OEEG 3K57A 1PM9A 2EIMB 2QTSA 2ZNIA 1KECA 2ZT9D 5IWAB 1FDMA 2RKLA 2UU9B 1GL2C 3S3WA 3VP9A 5LYJA 3CX5I 4EB6A 5APWA 1MABG 4QNHB 4JI6B 4ZHQB 4GX2A 1YJWV 1E1RG 2E76B 1YTFB 3PTZA 5C93A 1JO5A 3CD6V 2WLLB 1J5EO 1NVPB 2XUMA 1SQXE 2JIZG 3RK2B 4H44C 1JA8A 5IT9N 3ZBHA 1L0NJ 3D71A 4WBNB 1VQ4V 2FB5A 3TGUH 3CXHF 4Q6GA 2RQ6A 5EZYB 4AHCA 3GHGB 2C2AA 1SQQH 3CXHH 4X8AA 3II6A 2EZPA 3AK1A 2EJRA 4DR4B 1N7SC 5KLIC 3I55P 3VOPA 1QBZA 1Y76A 4LF4B 1NTMJ 1FE6A 1ZP0C 1H2NA 4BAYA 3B77A 3ZHSA 1JJ2U 3RBZA 2VWJA 1T3JA 2R9RB 5KAFZ 4JYBA 2J58A 2FMLA 1VQLV 1U97A 3H1JD 5KLVH 3BCCD 3B40A 1NAYA 4O9BA 1IC2A 1M56D 4EYYQ 1DGSA 1J1DB 2E5LO 2GDSA 3MIWA 1QLNA 2BE3A 4FLYA 4X66B 1OV9A 3V2NA 3OM3B 4X1YA 1QLED 1YJNP 1IURA 5A2QN 1L0NE 1KQFB 2YIUC 2YXLA 3VQYA 2CTWA 4D7TA 4UCVA 4CH3A 3KCXA 2W6BA 3SSUA 1VQPV 5H6QA 2FFDB 2QJKB 3NR7A 1QL1A 3X2QC 4U7OA 3FWLA 5KAIZ 4JI3B 2LP7A 1RSOA 3GWOA 4EEQA 2JJLA 3L9DA 4IHJB 1N34B 2P06A 1LWUA 4I0XA 3UT5A 3WUVA 1K8AQ 4DT0A 5KHJA 3L70J 2A9HA 4UB8Z 4BW9A 2Y0EA 3B71A 1VMGA 4YHHO 1R6KA 2J5UA 1RM1C 1N0NA 1YTZT 4WFHA 1GW3A 2LQTA 2K9JA 3J7AU 3KDPB 4JF3A 5BU5A 5APVA 2PP6A 2WPSA 3RK3E 3OEHG 3CWBH 3SYAA 1HNWB 3L74D 1FS0E 5AVTB 4TQDA 2OYHC 3U59A 1ZOYC 4O4JA 1I94B 3AK2A 4B3MO 1SQBK 2Y0CA 4BRYA 5B66E 3CJHA 4DUYB 1BMFG 4ZKIA 1YXBA 3ZIAG 2O01N 2CAZC 1KC8W 3TGUG 1JCHA 4PA3A 4UVBA 2ITDC 1K73W 1SQQG 1HVVA 4ZOLB 3S3XA 1GM8A 4BIUA 3ABMB 5C8YA 4D6TH 3L70E 5KA6A 1MNGA 1P84E 1KYOI 1EZVE 3E83A 1DTOA 1QGKB 3Q4HA 3KG2A 3LUTB 2DYRC 3ABKC 4IIJB 2IZ1A 4FM1A 1IK9A 1JTHB 2DYSB 1I5YA 2FYUD 2WLMA 3LW5H 4X1IB 4EOTA 2KI7B 2CH7A 1BQ0A 5KLVG 3L71D 1SLQA 3W7UA 2V7QH 4DR1B 4AQYO 1MG1A 4PD4D 4UB6Z 1USDA 3S4RA 4X89A 1GMJA 5GTHH 3T97B 5K5GB 4BW5A 1H2GA 1OWAA 2P4KA 4MVOA 4O2AB 4JI4O 2GTAA 4DV1O 4H44B 1IBLO 4DV5B 2AEFA 4QGPA 2Q6AA 3CRRA 2CPBA 3AE5C 1VL2A 2D2CC 2KUBA 4IGGA 2R5DA 3E8FA 3MDSA 2M6YA 3CE2A 2Q73A 3RK3B 2Q9IA 1I0HA 3PHLA 3CCMP 5CCGC 1N7SB 1R6NA 5LXTB 3IR9A 5AW6B 4NXMO 4OX9B 3TNUB 3CEIA 3ICXA 1SZXA 1XMQB 5LHIA 4MTXA 4NXNB 5L3EA 2H8PD 2YMKA 4FMTA 2M0BA 2EBOA 2YXYA 1GTOA 1PP9J 2QA4P 4A5UB 3CWBG 2PTMA 4QPKA 2KSEA 4R4LA 1Q2NA 5CHXA 3HR0A 1GK4A 1JY3N 4X62B 5H2FE 2YIUB 2DN9A 1LTSC 2E75D 1S9KD 1SQVJ 1Z5WA 4JYAB 1LP1B 2FY8A 5KHIA 4HJGH 2WA3A 1N0JA 2JGDB 3X2QB 3LSSA 1VQ7V 2UXDO 1E79G 5EK0A 3HD7A 1VP7A 4TV9A 3AG4C 1Q43A 3ABLC 2JEUA 3BASA 3ZMSA 3H1HH 3BEHA 1NTKD 2X7RB 1NTZH 1NU1G 4IOIH 4HZ3A 1PP9E 3K5LA 3O6QB 3WMM0 1BGYD 1CP9A 2V7QG 5BY1A 1LTTC 4WWIA 4TSFG 4PI0A 5B1AC 3JAMN 2O3JA 4WFGA 1VARA 2W6JH 2HLDG 5JVDB 2C9LY 2JRIA 3KQGA 3W7XA 1SQVE 4BWNA 2OYHB 1S72P 5GONA 2N1TC 1VQKP 1GDTA 2QE7G 2P90A 1GAXA 1SQPH 1M1JA 1BSMA 3VTPC 5EBMC 3M99B 3CRQA 2QWRB 1B06A 3ZRXA 3B5ND 2IYOA 5EYPA 4TT3H 2GTSA 1QVGU 1BHBA 4DV0B 1N73C 3OR7C 3PH0A 3QO5A 1YF2A 4LP8A 1LT9A 4LH6A 4X65O 2FTKA 2XASA 5L8RJ 4IFDK 2DYRB 3H1IH 2OIGA 5ITZB 1D2DA 4ASVA 3MGNA 1W2BU 3BATA 2RMZA 4DXWA 2R9IA 3JARB 3MHHC 2C0XA 2PAJA 2XAJA 4PDLA 5CMUA 3C9IA 3K79A 3FAVB 1XI1A 1SERA 2EZOA 2DOSA 2ZDIC 2F95B 3K5MA 5GTIH 1Y4MA 1IVSA 1N2DC 3FX7A 3RL0C 4JAAA 3FYIB 5DEDA 1EZVI 1YJ9V 2NZ2A 1ZRTD 1NBMG 3KCYA 2CTRA 3GG2A 3JCUH 1GD2E 4KFMA 4X64B 2Q7GA 2YI9A 3G6BA 5CB4A 3K0GA 4LF8O 3WU2H 2BASA 4JI8B 1K9MQ 1T2KC 2AW9A 4TOIA 2EILC 4U3FH 1VDFA 1JY2O 3FB5C 2D2CB 5B3SB 1Q86Q 3DTUB 2BSKB 3CMEV 4OXSA 1WMKA 1J1EB 5M1BA 2FXMA 1NJIQ 2B9ZA 1HNXO 1L0LK 3K06A 3H1HG 1EDLA 4JZ2A 3AEAC 4LLHA 1IO4A 4K8ZA 1NTZG 3AE2C 1N32B 3CCEP 4JGSA 4DR7B 1JOYA 2WSFH 3CCLV 1RFYA 4GKKB 5TJHA 1GM7A 1XMOO 1EQ7A 1DX7A 2Y69C 3CX5D 2KNCB 5KUKA 2WVRA 5IJ0B 1UPGA 2NR5A 2HODB 2NPSD 2QM4A 4ASWA 4LC1A 4CC6A 3H01A 3L73D 1SQPG 2L91A 3LNNA 1L4AC 1W5CE 1RHZB 4TT3G 3JASA 4NTYA 4JI7B 2YIBD 1YBKA 3BVHA 3APOA 4N78E 1M93A 4B7KA 4O2BB 4DK0A 1HGVA 1KTMA 4R7CA 4FLUA 1F4MA 1JQ0A 2FXPA 5BVZA 1NR7A 3WB0A 4B3RB 4DJGA 3H1IG 3AG4B 4GOEA 4X20A 1SFCD 5CN0A 1RPOA 3P30A 3HUSC 4EFBA 2RCVA 1VQ5V 1Y74B 3CCRV 4W7YA 1VQ6P 4RJTA 1FBMA 4QMAA 3CCUP 1JPXA 3R65A 3B5NA 5IDJA 3OE7G 4B3TO 3HKCA 2A06G 1IZNB 4N3YB 3CC2P 4G27B 1FYJA 4IL6E 2N1TB 2N74A 2UXCO 1UIXA 4JPZB 3AG7A 1QQCA 3CB2A 4BR6A 3TGUJ 4WFBV 1TU3F 1SQQJ 1GK6A 1L1FA 3D6YA 2F4VB 2DW4A 2WQYC 2LXCB 1XHZA 2GBOA 4YJ2B 1GTWA 5B1OA 1DEBA 3Q3DA 4IL6X 3MUDC 1I08A 1FZBA 2CDYA 5KLVJ 3PP5A 4L73A 1XILA 3D36C 5LMUB 1NO4A 3RBXA 2K3RA 3L36A 1B04A 2GHYA 3CCVV 2ZVNB 2HHHO 1X8YA 1DIPA 1VF5C 2ZXWC 2W27A 2ZXXA 2DQ0A 3FFQA 2QSAA 3K5BA 2HJDA 2WPVB 5KHKA 1YTFD 2QG4A 1P49A 1TVKB 3TGUE 2F43G 2BCCH 1VQNV 1Q6HA 1SQQE 2CK3H 3CXHE 4DRXA 3RK2D 5KAFH 3HKEA 1OCOC 1XOUA 4LCUC 4ABMA 1YJNV 3RYCB 3SR2C 1ZSPA 4I9WA 2P1JA 3H1LH 3AG2B 4DV3B 1N36B 3SJAC 1KYOD 3ZHUA 5BMVB 5KLVE 3E8GA 3IN6A 1XDCA 1K3EA 2KSDA 1URFA 1RH5B 2NPSA 3IFXA 3H32B 1L0LH 3NFQA 4RKUJ 1WLEA 1FXKC 3JD1A 5J2UA 1NYHA 2O01J 5KAIH 1JCCA 2YIBA 4NR1A 2WPQA 3M9BA 2A3QA 4JV5B 3H1KH 5IE9A 1GK9A 5CA0B 4RQEA 1N86A 1EFRG 1R73A 4MSWC 3SYCA 1L4AB 3UO2A 1FS0G 4UB8H 1SFCA 4ZI7A 1Q7YW 1BL8A 1W59A 5HFLA 2GUSA 1Q82W 1H8EG 4UVAA 1N8RQ 3CCSV 2O1KA 1SESA 3V5BA 4LF6O 3VMYA 4JBZA 1DLBA 5LBQA 3GF3A 1M8OB 1XEQA 4KUMA 5IYBO 4B7EA 1NU1J 3GMAA 1NQTA 2LJ2A 1UJWB 4CS4A 3K5OA 2QGNA 2UXBB 3OTOO 3CWBE 2HP8A 2Y0IA 3USSA 3CC4P 3HUSB 4KT0J 1GU4A 5AW3B 3SPGA 3GVMA 1IFDA 3SJCC 2Z5UA 4A7PA 1EN6A 2CE4A 2FYUK 2B1IA 3AEDC 3QH9A 4J10A 2W0FC 1R8EA 3N2GA 1NKDA 1BCCH 4TV8B 1HJ0A 3IFMA 3FXDA 1LR1A 4C7NA 2CK3G 5GW7A 4LNUA 1GN3A 3FGAD 5BU8B 2H7HA 4D6TE 2B89A 1WP8A 2H88C 5LOVA 3G4SV 3CRMA 3B8EB 4Y28J 5AVUB 3ZCCA 2YKOA 3H1LG 3K9AA 4H33A 3TXQA 3CCJV 1NU1E 1FZCC 1BZKA 3U1CA 3W7SA 3AE1C 5TISH 1WPBA 1W2EA 4H0LC 1VEWA 1L0ND 3A0RA 5H6RA 4BXLA 1WNSA 4FJCC 4ZHQA 3A2AA 1JB0J 1HDJA 2Y48A 5GTHE 2GM4A 1BHAA 3W67A 3OUFA 1NTMD 3FB6C 2QRXA 2XDJA 1ZWIC 1MSDA 3U1AA 1FKAO 2FYZA 1ZLLA 1OCCC 1GN6A 2GUZB 4NVPA 2ITCC 2VRZA 5F2VO 4DV7B 1KILC 3AE4C 3L75G 4WBNA 3H1KG 3DXRB 1SKVA 2QDOA 5EZYA 2K9PA 4JI1O 3GHGA 4DV4B 1FJGB 2XKMA 3ZJZA 1X4TA 3BCCH 3RVZA 4LF5B 4JI2O 4H44D 4LGDE 5KX5B 4YXWH 1PNLA 5JH7B 3E1IA 1K4CC 3BRCA 1PNKA 1KB9E 3BPZA 2QM8A 1MZ9A 3RK3D 3ZDMA 2ILMA 1IBMB 1N7SD 4NPEA 3H1HJ 5FNVB 2CGOA 3AE3C 1YVWA 4JYYA 3WU2Z 1CZQA 2IYPA 4M3LA 3CXHI 1HR0O 3K0DA 2UXNA 5E79Z 2W6IG 2ZM6O 1JEKA 2KG7A 4LFCB 2O1JA 1I7FA 1FXKB 3CSXA 5IJ9A 4KJMA 5AW8B 5IYZB 1F51A 1AI4A 1M90W 1BE3G 1SQFA 3ZRSA 1NTKK 1PL5A 4EIJA 1QCEA 3RYIB 2ITAA 3HE4B 3L37A 4TWKA 5D5PA 4DK1A 3RWRD 1FU1A 1EZVD 1P84D 1VPCA 3L70D 4DUZB 2IPPA 2FFDA 3G67A 5B5EH 1SQPJ 4IHJA 2Q9LA 5JJEB 4XDJA 1TAEA 1AV1A 3M7MX 4MVMA 2HG5C 2IW5A 3AG1C 1RF0C 1URQC 3H1HE 1ZL8B 1NTZE 1N7LA 3L74H 2WSCH 2OYIC 2PF4E 3O65A 5JQGB 4D7SA 1H0TB 1MMMA 1HH0A 3KZIH 1U7MA 1M5IA 3H1IJ 2ZIMA 2DMXA 1THZA 3FYEB 4DR4O 1JMMA 4GKJB 4H37A 1Z2GA 4UCRA 1PKXA 5AVWB 5APUA 3SWKA 1Y6XA 3G80A 1SQPE 4WB4A 1YCIA 4JAVA 4UV8A 3P8CD 1JFFB 1Y8AA 1H2KA 1VQ8P 4ZOLA 4X66O 4IFFA 2VQFB 5AVZB 3L71H 1J95A 3SYOA 1SETA 4OVNF 3DC5A 1JTHA 4E4EA 4X1IA 2OYOA 3H1IE 3ZS8C 2D3OW 3AEEC 3M0AA 1SC5B 1VF6C 4F6RB 1SQXJ 5BR8B 1FXHA 4I9QA 1M4UA 2R70A 4GKGA 2HVKC 2OT5A 2P22C 2XAGA 4W4LA 4JI3O 2X0LA 3T97A 5GTIE 2HPCA 2E5TA 3AE8C 2A06E 4O2AA 3JCUE 4LWSB 3M91A 4FFBB 3ZMVA 2QJPC 3VP8A 3WU2E 3OGIB 3B2EE 4XDLA 2QM7A 1K4DC 1SRYA 2KQXA 5APXA 1N7SA 1ZAUA 5LXTA 2XT9A 1EZJA 1PP9D 3U11A 1U7JA 1I94O 3TNUA 2UXXA 2WSSH 1LTJC 5LMNO 3ZHRA 4ASUG 1IZ3A 2D2CD 1MFZA 5CA1B 4GDOA 4PA6A 1MOFA 1NZ6A 3JSLA 3T1HO 2BOBC 1JM0A 4QPJA 2KOGA 4I55B 2AGAA 3CC7P 4OGQC 1YITP 2E74C 2ZINA 1IDSA 1NH2D 1OW7A 3RW0A 1WP7A 1B3QA 1KD1Q 3WUUA 1G2CB 3A0BH 3OMIB 2K9YA 3OA7A 2NLJC 3ZRWB 3TETA 1KB9I 1VQ9P 2Y0DA 4DR3B 1JR9A 3BA8A 1ZN5A 5EBLC 3M9QA 2JGDA 4H13B 1AR1B 1IBKO 1LUWA 4LF9B 3CPWO 3D8CA 3TDKA 2OYQA 1Y9BA 3L71G 1BGYH 2HJFC 5KTBA 2Q1KA 2OTJP 3DGEA 3O8ZA 2WAMA 3JALB 3CC2V 3ETGA 3N4XA 5APYA 1LNQA 3QWOC 3B8NA 1XNQB 3UQ8A 1R3LC 5DJUB 1M57C 4DR6B 3O6QA 1M1KQ 5JJNB 2OYIB 2W90A 2QWQB 5IY5B 4B86A 3QO7A 2Q8VA 3UKMA 2XNXA 4XFJA 4WY4B 5JVDA 1GKFA 4NPDA 4EFEA 2CPSA 2OYHA 1UIIA 3W7TA 3VMAA 3A0HH 4PJ0E 4LBEC 3HD7D 1YSCA 2OIEA 4RAIA 5EIBD 1K7DA 1T6AA 3AE7C 1DF4A 3V4QA 1W0JG 2LGWA 3H9VA 4AQRD 4JI0B 1FOSF 4TUYA 2M5AB 2BEQD 1QX8A 5CCHD 4X62O 3HRNA 2G8YA 2KIKA 3U10A 1X22A 3H1LJ 3JARA 1TUBB 5IYCO 3IF4A 4F4LA 4JYAO 4R8CA 1KN7A 1JVMA 5K1XA 3FAVA 1LWUC 4P30A 1J5EB 5KKZC 1AA0A 1HTLC 1CXZB 2YICA 4YIPA 2OQQA 1AJNA 1FFXB 5LHHA 2QJYC 4YXDC 1ZTEA 1S3JA 2Q67A 5CBFA 1NR1A 2MW2B 2QVAA 4N78D 2BCCE 4N6JA 2DWDC 1GL2B 5KHHA 3L75J 5TISZ 1OIPA 1YYCA 3H1KJ 5KAFE 4ZKUA 2JGUA 2IBZD 1YHQP 4GUNA 1JCDA 2BSKA 4GX1A 3H1LE 1IX9A 1S76D 3QNEA 3I5CA 1DH3A 4MVQA 1S5JA 3OFNG 2ZFCA 1LTJB 1AB3A 2KLUA 3VQWA 2ZT9C 3VMXA 1L0LE 2E43A 4FLVA 3QO8A 1VQOV 3GW6A 3L73H 3RYFB 2YI8A 4J42A 2JS5A 5KLIB 2IZ0A 3CCQV 2HODA 4I6MC 4OGQB 3UO3A 1KUQA 3Q5SA 1HWYA 2E74B 5KAIE 1ZXGA 4DOJA 3L75E 1NKZB 3H1KE 2F23A 4CS2A 3JATB 1BE3J 3ETQA 4B3SO 4X1KB 4EB6B 4OPHA 4PHZA 1P7GA 4UB8E 4KXRA 2KK7A 4O2BA 1EDKA 1E5WA 3SYQA 3CI9A 1OVRA 1L4AD 4GYCB 4X64O 4YHHB 5B1BC 3AEBC 2C9NY 1QR9A 2B5UA 2UUAB 1M56C 2R3CA 4D6TG 5L3CA 4MS2A 3Q5PA 1XQ8A 3T2MA 5B5EZ 4DW0A 3OJAB 3TGUD 1SS1A 1PPJH 1QLEC 4B3MB 1AI5A 1BE3E 2NRGA 2RN0A 5EFWB 1SQQD 1WJZA 2AXTH 3CXHD 1SA0B 3NXSA 5LP6A 1E1QG 1FFTB 1H2MA 2P2UA 2QKCA 2FBWC 2N1TA 5CCHA 2Q69A 4DCKA 4GKKO 1RM1B 3BVOA 1L0NK 2VS0A 4I5SA 4HBNA 1X79B 4U7NA 3E2EA 1NI8A 3KZIZ 2QEXP 3C90A 5KLVD 1G1XB 4JTAB 4N21A 4DR2O 1NTMK 1CI6B 5EBWC 3EVKA 4WFAV 2WLJA 1BDDA 4YJ2A 4UB6E 1NKNA 3VN0A 4J11A 5TISE 1IJDB 1SQBH 2JWDA 2IX7C 1K97A 4AQYB 1IK7A 4KHPO 5KJ7D 3S1KA 2OTLV 4GX5A 3ASNC 4P9PA 5KMGA 4MW3A 1AP6A 4JI7O 1YQ4C 1KP2A 2IU3A 1YIJP 2WLKA 2KB1A 3UT5B 2UUCO 5HFMA 3ABKB 3MHVA 3SGIA 5KKZB 3EQ2A
chains in the Genus database with same CATH topology
1DD4A 3D6ZA 1FDIA 4PV1D 1OW8A 1AJYA 1WMKA 2P10A 5M1BA 4H13C 4H44D 3AEAC 3AE2C 3Q2YA 3IN6A 2YMKA 4H0LB 3AEFC 3ABVC 1K05A 4R4LA 1OMIA 2D2CD 2YIUC 4GDOA 2WSFJ 4RKUJ 1KQFB 3AE3C 3GF7A 1Q90D 3SFDC 3G9RA 2E76D 1VF5B 2ZT9C 1FDOA 1ZRTE 2FYNC 2E75D 1KQGB 4OGQC 3IAOA 2O01J 1NYHA 2E74C 2ZT9B 1OW7A 1DD3A 1PL5A 4H0LD 3AE9C 4OGQB 2QIWA 1OW6A 2K9YA 3Q5SA 2E74B 1S5LX 1VF5D 3AECC 1KTMA 3B71A 4H13B 2FXPA 1U57A 2J5UA 3AEGC 1S1CX 1Y9BA 1NGMB 3RK3E 3GF3A 3GLMA 1RQVA 1ZOYC 1PIXA 3GMAA 2WSCJ 3O6QA 1MKMA 1PV3A 2G3AA 3AEBC 3SFEC 4KT0J 4H13D 1HF9A 4PV1C 3C8VA 4XFJA 1RQUA 2MKVA 3AEDC 3Q5PA 4PV1B 4TT3H 1R8EA 1HJ0A 1UIXA 3S9OA 3EWKA 3Q1MA 3FGAD 2ZT9D 1TU3F 2FBWC 3AE6C 2H88C 1KMIZ 5L8RJ 1ZMEC 3AE7C 3D6YA 3H25A 3R4YA 2E76C 2WQYC 4OGQD 4Y28J 2E74D 1KILE 3LW5J 2E75C 3Q3DA 2BEQD 4I7ZC 3AE1C 4IL6X 1EXIA 2E76B 1GMJA 2IDBA 2V7QJ 3AEEC 3RL0g 3T97B 4H0LC 3D70A 2H89C 2E75B 2G8YA 4R4MA 4I7ZB 1KORA 4H44C 4U7JA 1JB0J 3Q5RA 4Z1MH 1IK7A 1VF5C 3D71A 2NZ2A 1DIPA 2QJKC 4H44B 2WSEJ 3AE8C 2JP3A 1VL2A 3AE5C 1YQ4C 2D2CC 2QSIA 2WPVB 5KLIC 5KKZC 2BEZF 4YTPC 1ZP0C 1YQ3C 3AE4C 2OQQA 2QJYC 4YXDC 1K04A 2QJPC 2JO1A 2D2CB 1EXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZT9 B;  3LW5 J;  4IL6 X;  2E76 B;  4KT0 J;  3C8V A;  4OGQ B;  2QIW A;  2K9Y A;  2E74 B;  2E75 B;  4I7Z B;  1S5L X;  1JB0 J;  4PV1 B;  4H0L B;  4H13 B;  2QJK C;  4H44 B;  2WSC J;  2YIU C;  2WSF J;  4RKU J;  2WSE J;  5KLI C;  5KKZ C;  2WPV B;  1Q90 D;  2QSI A;  1VF5 B;  5L8R J;  1ZRT E;  2QJY C;  4Y28 J;  2FYN C;  2QJP C;  2D2C B;  2O01 J; 
#chains in the Genus database with same CATH topology
 4JI4 B;  4B3R O;  1DD4 A;  1WA8 A;  1FDI A;  1USE A;  2O57 A;  4PV1 D;  3JCZ A;  2HR3 A;  5LGU A;  4DV1 B;  1IBL B;  1KQS O;  4HNA B;  2Z0A A;  2Y9Z A;  2SPZ A;  1FXV A;  1ZR2 A;  1K8A W;  2W0X A;  1YZB A;  5CMZ A;  3RYC A;  2B88 A;  1OVU A;  2EIK C;  2JVD A;  4NXM B;  5BMV A;  2EJ7 A;  2P7T C;  2BTO A;  3E22 A;  4U3J A;  4JAU A;  3H32 A;  1Q81 Q;  2DWE C;  3STZ C;  5E79 H;  1PL4 A;  2YXQ B;  1L8D A;  1LT9 C;  2ZT9 B;  1AR4 A;  2R72 A;  3L72 H;  4I4T B;  2K37 A;  2WPR A;  1KFM A;  1PPJ G;  4PA7 A;  3LNM B;  2Q6Q A;  3OMA B;  4BIO A;  2YMY A;  2IH3 C;  3N7N A;  2B87 B;  4YJ3 A;  3AEG C;  3P3P A;  1IFJ A;  2VQE B;  1L4A A;  4JAS A;  1NU1 D;  1D5A A;  1R3I C;  2CUG A;  2ZCE A;  2W6J G;  1QL2 A;  2RH0 A;  2UXD B;  2M3E A;  5FL7 G;  2PFX A;  2F1M A;  3L71 J;  3K04 A;  3T4Z A;  3L74 E;  3T4D A;  4ZKP A;  2AZ0 A;  2YIA A;  3A0B Z;  1SQB G;  2F93 B;  5B1B B;  3JAK B;  4X88 A;  3HUS A;  3KPE A;  2H8P C;  3CD6 P;  3DC6 A;  1WN7 A;  5AW9 B;  3KXD A;  2H43 A;  3ABL B;  2LKM A;  1QLE B;  1K92 A;  4TV8 A;  1ZX3 A;  2P5O A;  1YI2 V;  1VQ4 P;  4UV9 A;  1QVF O;  3CPW U;  1R1B A;  3MTU E;  4FZ0 A;  2E75 C;  2HFE D;  3SPJ A;  5B1A B;  1KB9 D;  5DN6 G;  1S2E A;  3L71 E;  3LDE A;  1KKC A;  4NTW A;  5KJ7 A;  1GO3 F;  3VBB A;  4TLF A;  4K0K O;  2JEE A;  3W68 A;  1NWQ A;  1VQL P;  1N33 O;  1PFI A;  1AI7 A;  2KZJ A;  1NTM H;  4LFB B;  1FZG A;  3A0H Z;  1RF1 C;  4U3F G;  2IH1 C;  2X6B A;  3T1Y O;  4EI2 A;  2YKQ A;  3L72 G;  1N73 B;  1OCZ C;  1XTG B;  1K04 A;  3RFR A;  2JO1 A;  2GUZ A;  1T3U A;  1D5N A;  2LR2 A;  3LDD A;  2P10 A;  4GOF A;  2ZE8 A;  3N2K B;  3UIA A;  4FLW A;  1VQP P;  4LF8 B;  3DXR A;  2KS1 A;  2NNU A;  2N04 A;  1S5L Z;  2IJH A;  3RT3 C;  3I55 V;  1LJ2 A;  2R44 A;  3VMZ A;  1SQV K;  3H1H D;  1H8H G;  2E3C A;  3B5N C;  4HH2 A;  1YIT V;  1AP5 A;  2ZE5 A;  5KX5 A;  5JH7 A;  3APQ A;  1J2J B;  2ZYG A;  3A7O A;  4HB1 A;  1R3J C;  3CHX A;  1Z5V A;  1WRG A;  3RL0 B;  5B66 H;  3BHP A;  4C7U A;  1XL6 A;  3WG7 C;  2E76 D;  1NVP D;  4LF7 O;  4EKW A;  3IAO A;  2H3O A;  3PRJ A;  4I2L C;  4P9O A;  3ML0 A;  3ZMZ A;  2PZS A;  3HTK B;  1P84 F;  4RUF A;  4JI5 B;  3K59 A;  3L70 H;  2EIL B;  1P84 H;  3E7K A;  1SQP D;  2ADP A;  1FC2 C;  2OTJ V;  1FXK A;  2PI4 A;  5IYZ A;  1EDJ A;  1V55 C;  3A0B E;  3RYI A;  3HE4 A;  1FJP A;  3LSQ A;  4ICG A;  5AVX B;  1XTC C;  1PL0 A;  2XND H;  3H1I D;  3GLM A;  3FB7 C;  1RQV A;  2XZR A;  2Y69 B;  5J9P C;  4OH8 B;  3EXA A;  5BZB A;  5KHG A;  2JR8 A;  4DO2 A;  3CWB J;  1ORQ C;  1ZL8 A;  1XNR O;  3V2Q A;  1MA1 A;  4IYH A;  1MV8 A;  4H13 D;  1V54 C;  5JQG A;  1H0T A;  1RQU A;  2MKV A;  4JQ0 D;  1NTM G;  4AIL C;  2A06 D;  2L5G B;  3L35 A;  2CTP A;  1MFT A;  2P67 A;  2HG5 D;  3L4F A;  4L76 A;  2PYJ A;  3EWK A;  2XAF A;  3OAK A;  5APS A;  4D6T J;  1RE4 A;  1Q6I A;  5D5Q A;  1PD3 A;  4RES B;  1PNM A;  3MHS C;  1DF5 A;  4B3T B;  1QR8 A;  1CPY A;  4RWU A;  4DV6 O;  2NPS C;  3A0H E;  2WLI B;  2ZAE B;  4WY4 D;  1VIB A;  1K9M W;  3LW5 J;  4MTF A;  4LFA O;  2V4D A;  1SQX D;  2F66 C;  2UXC B;  3M0D A;  3BRV B;  1GU5 A;  4ZIB A;  2V7Q J;  3RGU A;  1Q86 W;  3QF7 A;  2A45 H;  3JAW B;  2H89 C;  2E75 B;  4J41 A;  3KYQ A;  4I50 A;  4CH4 A;  1NJI W;  2R3S A;  4LFC O;  1EN4 A;  2Q0A A;  1OFC X;  4HKZ H;  2OCH A;  4F6R A;  3MP7 B;  2AXT Z;  2BCC G;  1XRE A;  2LW1 A;  1K5Q A;  1WPX A;  2ZYA A;  4YPC A;  2V1D A;  3F5W C;  1SFC C;  5EC2 C;  4UCO A;  4LH7 A;  1RF1 B;  1OCZ B;  5L3B A;  1KV4 A;  1Q8I A;  4FFB A;  3ZN1 A;  1P4R A;  3ASO C;  4X20 B;  3WFV A;  2W83 C;  4W7Z A;  1L0L G;  3CCM V;  2XND G;  1EBO A;  2WLL A;  1FAF A;  1VQ7 P;  1K05 A;  1RE3 A;  3VYI A;  4I1L A;  1WAZ A;  2K1E A;  1GL2 D;  1XHX A;  1VF5 B;  2ZXW B;  3CMA P;  1ZUQ A;  4DV2 O;  1RY3 A;  2FKX A;  5CA1 A;  2JJ1 G;  4F6E A;  1X0T A;  1HWT C;  1WB8 A;  4KP4 A;  4I55 A;  1JY3 O;  3H1J H;  2QA4 V;  3AE9 C;  1G8M A;  1HNZ O;  4C46 A;  1SQG A;  1UFI A;  1OCO B;  2EIM C;  3E89 A;  3KHU A;  4GIF A;  1G2C A;  2Y4T A;  1KQS U;  3A5T A;  2A0L A;  2WA4 A;  3ZRW A;  3LIE A;  5KA5 A;  3I56 P;  2V4H A;  2IFM A;  3ZHQ A;  1NTZ J;  4Z1V A;  1NOH A;  1VQM P;  4DR5 O;  1DEE G;  1X9V A;  1O9H A;  2YEV B;  4ZMD A;  2DE0 X;  1MZF A;  1KBH A;  2A45 G;  2G3A A;  2RJZ A;  3TK1 A;  1IFP A;  1KZU B;  2YNY A;  3E1R A;  1SQQ K;  5JWP A;  4LF6 B;  5IWA O;  4L8J A;  1EN5 A;  4CC5 A;  2UU9 O;  1NT2 B;  3GHG C;  5AW5 B;  1BCC G;  2OYI A;  1RPR A;  1V54 B;  4CH5 A;  2DQ3 A;  2EX3 A;  4JI6 O;  1RP3 B;  1R3K C;  2ZQM A;  2QEX V;  1FD9 A;  4QE7 A;  3HKE B;  3OTO B;  1SQB J;  4WY4 A;  5KLV K;  4FVM A;  4HYO A;  1S72 V;  1NH4 A;  1KMI Z;  1PPJ E;  1VQK V;  3F7Y C;  1IFI A;  2AXT E;  1H38 A;  2G38 A;  2WT7 B;  1YJ9 P;  4J9Y B;  1KIL E;  3IAY A;  2M7W A;  5CBO A;  1AVY A;  2NPS B;  3H1L D;  1KC8 Q;  1JNM A;  4PDR A;  3FD9 A;  1R6T A;  4LF4 O;  1K73 Q;  4O4L B;  5A9G A;  2M5A A;  4RQF A;  3DSQ A;  2QWN B;  1Q5O A;  5LA6 B;  1H88 A;  2FFD C;  2QJK C;  4AUW A;  1TUB A;  2JP3 A;  1SQB E;  4YTP C;  2FYU H;  2B1G A;  3H1J G;  4WCE V;  4DR3 O;  3BCC G;  4FIP C;  2YO3 A;  1KKD A;  4PD4 F;  3L75 D;  4IIJ A;  1NHL A;  3RVY A;  3H1K D;  4PD4 H;  4YXW G;  4U3F J;  2AEM A;  1FFX A;  3L72 J;  1HW7 A;  3OR6 C;  4NB5 A;  5B1N A;  3F5H A;  1FZC B;  2IBZ H;  1LUV A;  2HVJ C;  1GL2 A;  4JI1 B;  1R5S A;  4H0L B;  2QR4 A;  5C39 A;  2WSE H;  3ASO B;  5CJ0 A;  1S5H C;  1N34 O;  1H2L A;  2WSF J;  3SWF A;  2YXH A;  4RUE A;  2OGU A;  1Q90 D;  2XOK G;  5J2T B;  1N8R W;  4JI2 B;  2QWO B;  3G71 P;  2BTQ B;  3V6I A;  3CCE V;  1AI6 A;  3OW2 O;  1OCC B;  2Q5U A;  1KIL B;  1OXZ A;  2EIN C;  3ZMT A;  1DD3 A;  4YY3 B;  2KLV A;  2HLO A;  5E79 E;  4LR3 A;  3B8M A;  4U3F E;  4GZR B;  1BE3 D;  3ZMU A;  2C0W A;  2LFS A;  1HNW O;  1NU1 K;  3L72 E;  3RYF A;  2Q3E A;  3HKB B;  1W0K G;  3CCR P;  2DYS C;  2ZM6 B;  5JCO C;  1MZE A;  1HUC A;  4KHX A;  1HJB A;  2Y0P A;  4DUY O;  3L74 G;  3M06 A;  1GMG A;  5B66 Z;  3JAT A;  5CCG D;  3OMN B;  4X1K A;  1SQV D;  2ODM A;  5JJJ B;  1YTZ I;  3TJT A;  1MKM A;  1G6U A;  3IC9 A;  2XV5 A;  4OPA A;  5AVR B;  3JSN A;  2E42 A;  2ETN A;  3JD3 A;  1AJQ A;  1FZE A;  1LP1 A;  2JJ2 G;  4DR1 O;  2ZD9 A;  2N9B A;  1OZ0 A;  1XBL A;  1XL4 A;  1T5E A;  2I1K A;  1NTK H;  3TF5 A;  3RK3 C;  3WB2 A;  2FYU G;  2LFR A;  3D3Q A;  1TUE B;  1VQ6 V;  1Z56 A;  3Q1M A;  4O4H B;  3ZRV A;  4UCT A;  2YS8 A;  3CCU V;  1LTG C;  4N23 A;  2IM9 A;  3CCV P;  2BOC C;  1OHH G;  1SA0 A;  3AG1 B;  4WVZ A;  1URQ B;  3ETE A;  3EFF K;  1JJO A;  4DV5 O;  2IBZ G;  3E86 A;  2UUB B;  4W80 A;  1VQN P;  1H89 A;  4R4M A;  3CRA A;  4Z1M H;  4OX9 O;  3ZED A;  1CI6 A;  2KG7 B;  4PDM A;  5IJ9 B;  3QVN A;  4IYI A;  2I8D A;  3E8H A;  1XMQ O;  3FX0 A;  2LO1 A;  4MVR A;  3C1L A;  1M9N A;  1YQ3 C;  3K58 A;  3SYP A;  1NTM E;  2QKS A;  4FLZ A;  3V2P A;  4NXN O;  2CGN A;  2P6J A;  2BCC J;  2XAQ A;  1NTZ K;  2N1T D;  1OW8 A;  2ZR2 A;  2JKV A;  5IYD O;  2ZE7 A;  5ITZ A;  1OJH A;  2WSS G;  3OGC C;  1S5L H;  3JD4 A;  3A3Y B;  4MT8 A;  1A02 F;  5AVQ B;  4HNA A;  4MTO A;  3ABV C;  5H2F Z;  2UUA O;  2K1A A;  2ZJS E;  3G9R A;  2O01 H;  1L0L J;  1L2P A;  3RYH B;  1SQP K;  1NS1 A;  5LHG A;  4GLX A;  2YDE A;  2GV9 A;  1KQG B;  4RO0 A;  3CCS P;  5LMN B;  3BRT B;  2Z5H A;  2QTO A;  2KYV A;  1PV0 A;  3T1H B;  2QJP B;  1NTK G;  2EIN B;  3RL0 D;  4AI8 A;  3AEI A;  4I4T A;  2A79 B;  1E79 H;  1BGY G;  5CCG A;  1K34 A;  1KFN A;  3CX5 F;  2Q7C A;  3WUT A;  2LGQ A;  1NU1 H;  3CX5 H;  4NPF X;  3HKD B;  2ZNJ A;  5APT A;  1CSB A;  2ATK C;  1NGM B;  1T2K D;  3B4S A;  2B87 A;  2E5L B;  4O4I B;  1PIX A;  3HE5 B;  1LTI C;  4HYT B;  4DV0 O;  2KNC A;  4WFE A;  1IBK B;  5AVV B;  5IJ0 A;  4PI2 A;  2WMM A;  1HF9 A;  5CBG A;  3G4S P;  2HPC B;  2AHY A;  1T8Z A;  2J59 M;  4Z1M G;  2XTA A;  3CS5 A;  1U96 A;  3CCJ P;  4PA4 A;  1MUU A;  4JPR A;  2QE7 H;  2JDI H;  3HPL C;  1DK1 A;  3A8T A;  5LYJ B;  2YC0 A;  3BA9 A;  4MVU A;  2Q7H A;  3THO A;  1HBW A;  3JAK A;  1SQX K;  5FPR A;  2JEX A;  3IC7 A;  5B3S C;  2KB7 P;  3CC4 V;  1BCC J;  1KP3 A;  2PI5 A;  3AE6 C;  4QE9 A;  1AFO A;  4BIZ A;  1HGZ A;  3NTN A;  3H25 A;  1J1E C;  4XDK A;  2XAH A;  3P8C E;  2WWW A;  2R5B A;  1KB9 F;  2DJV A;  4J9Z B;  3FXE A;  4I7Z C;  4J7J A;  1KB9 H;  1XUQ A;  4JI8 O;  3G6E P;  4W4K A;  3VQV A;  1M57 B;  4Y99 C;  3OAA G;  1Y74 A;  3SPH A;  2Z5I A;  1KQL A;  2YUA A;  2L6L A;  1Y76 B;  2IJI A;  1OCR C;  3BAA A;  3K3W A;  2YKP A;  1WT6 A;  5CJ4 A;  3OTF A;  2P7J A;  2BEZ F;  1N32 O;  1BCC E;  4DR7 O;  3U0Z A;  4YIO A;  3T1C A;  5CBH A;  1EXJ A;  5BXZ A;  2VQE O;  3D6Z A;  4X1Y B;  1FZA A;  1N73 A;  3H1J J;  3P3N A;  1VF7 A;  1KD1 W;  1D7M A;  3BCC J;  3AG3 C;  1H2S B;  5H9C A;  1BDC A;  1FPO A;  3CMA V;  5KUM A;  2ADQ B;  3N2K A;  2ZVO B;  4MVZ A;  2P58 A;  1SZT A;  4CBC A;  1QEX A;  1RSO B;  4FLX A;  2AZ2 A;  1LT1 A;  3HD7 C;  3L73 G;  5EIB C;  2W8Z A;  1LWU B;  3OUS A;  2ZDI A;  4I0X B;  2WIT A;  5LP6 C;  2PYL A;  2AEJ A;  4R6Z A;  2QJY B;  1M1K W;  1TVK A;  5CCH C;  3LSU A;  2JDI G;  5FLX N;  1Y47 A;  3I56 V;  1KYO F;  2QIW A;  1JMK C;  4JTC B;  2K9J B;  3JSV C;  1KYO H;  3QTC A;  1VQM V;  3H1J E;  3CXC U;  3ABU A;  3BCC E;  1VF5 D;  3HTK A;  1S4X A;  5L3F A;  4EDF A;  2LW7 A;  3P8M C;  2ARH A;  1U57 A;  4O4J B;  1F7Y A;  1S1C X;  4TUY B;  4BRY B;  2VWK A;  3D3I A;  3CJH B;  1M1J C;  4J7K A;  5DM6 V;  3CWB D;  5AW4 B;  1F4N A;  4WFF A;  4WBA A;  2WLH A;  2WSC J;  4B3S B;  4LFB O;  2LXB A;  3L74 J;  4FM0 A;  4IL6 Z;  1AIL A;  4FM2 A;  4UXN A;  5C8Y B;  3MZW B;  5DJT B;  1Y66 A;  1BSN A;  3IJ4 A;  1NAF A;  3VQX A;  3Q4H B;  2OWO A;  1H8A A;  1Q7Y Q;  4B08 A;  2F4V O;  1IFM A;  1JY2 P;  2A06 H;  1P84 I;  1Q82 Q;  3OW2 U;  4D6T D;  2CH7 B;  5CA0 A;  2UWJ E;  3K08 A;  1GZL A;  5AVS B;  1Q6U A;  4PDV A;  2PGD A;  5B5E E;  5LMU O;  3O9O A;  2L35 A;  1FAV A;  4NYK A;  3AG2 C;  3BAB A;  2QWP B;  4CH6 A;  2FYU J;  1SF9 A;  1SQX H;  2NN4 A;  1R5L A;  1EXI A;  3N27 A;  3IGA C;  2IDB A;  3RL0 g;  1PGO A;  2WLI A;  1EDI A;  3KZI E;  2Q68 A;  4I7Z B;  1KOR A;  1VQ8 V;  4U7J A;  1NH2 B;  3P7K A;  1COW G;  1YJW P;  4Y99 B;  4JI5 O;  1M56 B;  3JAW A;  3H6P A;  2PUS A;  2WSE J;  4DV3 O;  2PY5 A;  1N36 O;  4DR2 B;  3R2P A;  3M8A A;  1OCR B;  3BFR A;  3JD0 A;  4AYC A;  1WB7 A;  1SVF A;  4GX0 A;  2IU0 A;  2PGG A;  5EC1 C;  4UVC A;  4KHP B;  2FYU E;  3KKY A;  4JF7 A;  2QKA A;  1B6Q A;  4X65 B;  1RF1 A;  3JD2 A;  1L0N H;  5AW0 B;  2FL4 A;  4PD4 E;  3G71 V;  2UUC B;  5L3D A;  2A45 I;  2N05 A;  4WF9 V;  2P4V A;  1BS3 A;  4L87 A;  4UFZ A;  5AW7 B;  3AEF C;  2X6C A;  4JV5 O;  4GT1 A;  4MTG A;  3AG3 B;  1G4Y B;  3SJQ C;  1OMI A;  2IBZ E;  3JYC A;  1OX3 A;  1IFN A;  3J81 N;  3SFD C;  2WLN A;  1CEZ A;  3MUD A;  1AR5 A;  1JUN A;  3GB7 C;  1OZH A;  2W6A A;  2R9A A;  2FYN C;  3ASN B;  3D36 A;  2GUV A;  3HD7 B;  4TV9 B;  3ZX6 A;  4CPG A;  3V2R A;  2WPD G;  4DW1 A;  1FJK A;  4H0L D;  4NTX A;  4XA4 A;  1X59 A;  5LP6 B;  1GW4 A;  3MAQ A;  2GA1 A;  4PJ0 H;  3ETD A;  4RO2 A;  1MSW D;  2Y9Y A;  4J80 A;  1PGJ A;  1PPJ D;  3CYO A;  1S77 D;  1NTZ D;  2UXB O;  3CC7 V;  5KJ7 C;  1I5X A;  1KIL D;  1NTK J;  1HNX B;  3SPC A;  2EIK B;  1SQX G;  5GON B;  2IJK A;  2ZR3 A;  3GWK C;  1BGY J;  1M90 Q;  3RGB A;  1VQ9 V;  1M1J B;  3OT7 A;  1ARO P;  5FNV A;  3ZHV A;  3SFE C;  2HEP A;  1BSH A;  4L75 A;  1XMO B;  5EYP B;  4PV1 C;  5APQ A;  1AJP A;  2MK3 A;  3RN4 A;  3I5D A;  2YEV A;  1BT8 A;  1EZV H;  5KMG B;  2XU6 A;  1PZQ A;  1GN2 A;  1S9K E;  1LT9 B;  4FFK A;  1SQB D;  2Z3Y A;  4JZG A;  4MW8 A;  3PLN A;  1WA8 B;  1EM1 A;  1NTK E;  3CRC A;  2KP8 A;  3R4Y A;  3E35 A;  3UCS C;  1EC5 A;  1JMB A;  2KKW A;  2EUL A;  1BGY E;  3V4W A;  2GSM B;  2YSU B;  1L0N G;  2B9B A;  2OCC C;  3E8B A;  5GTH Z;  1HP8 A;  2RDC A;  4DV7 O;  2WT7 A;  1LTB C;  2Z4E A;  2JWA A;  2Q7E A;  1P7B A;  5CBN A;  5CB4 B;  3E22 B;  5DEC A;  1Y67 A;  4U3J B;  2RNB A;  1LTA C;  2ZYD A;  4DV4 O;  1FJG O;  3F89 A;  2ZIO A;  3ABT A;  3ZN0 A;  4K35 A;  4LF5 O;  1URQ D;  4O4L A;  3FKS G;  1A02 J;  2QSI A;  5LGN A;  2CTQ A;  1GRJ A;  2RMK B;  4QJF B;  5LA6 A;  4E2L A;  4K0K B;  4U3F D;  5K1P A;  3STL C;  2XHB A;  3L75 H;  1IBM O;  3L72 D;  4FK5 C;  1N33 B;  1Q81 W;  1BQZ A;  2HYN A;  1JFF A;  3K9S A;  4YJ3 B;  2PRR A;  3C3S A;  3T1Y B;  1ZW0 A;  1FOS E;  1VQO P;  2E5Y A;  2VRS A;  1JX9 A;  3SPI A;  4JTD B;  5LL6 Y;  3CCQ P;  2Q4P A;  2K88 A;  1SS3 A;  5H2F H;  1S5L E;  4IFM A;  1FZC A;  3GF7 A;  4DUZ O;  4NKG B;  1K33 A;  2JS3 A;  1GM9 A;  3TXS A;  1ZRT E;  1G1I A;  1PGP A;  3JAS B;  2Q5Z A;  1YHQ V;  3L70 G;  3JC2 2;  1EZV G;  2HHH B;  1RE4 C;  5J2T A;  4L74 A;  2HFE C;  4FPP A;  2BTQ A;  2FYN B;  2DW3 A;  4K3A A;  4LWS A;  3CL3 D;  3L73 J;  1BE3 H;  1G1J A;  2Y4U A;  4PD4 I;  4XBF A;  1S5L X;  3G3Z A;  1V9P A;  1KIL A;  1PP9 H;  2I1J A;  2M3B A;  4C7R A;  3AEC C;  4LF7 B;  3M0D C;  2HKO A;  4JYC A;  4QIW F;  2IBZ I;  1TA8 A;  2KZI A;  4R50 A;  4GKJ O;  3LDC A;  3HKB A;  5AVY B;  3PN1 A;  1IXB A;  3BY6 A;  2EIJ C;  3B5N B;  1SQV H;  5CA3 A;  3HKC B;  3TCU A;  3F7V C;  3CX5 E;  2KSJ A;  4CZZ A;  5LGT A;  4UB6 H;  2Q0O C;  1PV3 A;  4Z2W A;  3WG7 B;  1OVV A;  3C8V A;  1GH6 A;  1KU9 A;  2ZKO A;  5L3G A;  4K8X A;  2FKW B;  1QU7 A;  2VQF O;  3L73 E;  2WTY A;  1K5S A;  3AK3 A;  3B09 A;  1US6 A;  4PV1 B;  5AW1 B;  1JY3 P;  5AW2 B;  4MN4 C;  3S9O A;  1XNR B;  1S0V A;  3NMD A;  3TSI A;  1V55 B;  1TGO A;  4ZBM A;  5BR8 O;  4CS3 A;  1ZME C;  4X9Q A;  3G6E V;  2ZE6 A;  2E76 C;  2KS1 B;  1IXM A;  4FZ1 A;  4FLT A;  2Q3I A;  3M9H A;  2KXP B;  4OGQ D;  1LGH B;  2E74 D;  2OTL P;  1FZF A;  1RE3 C;  2N9Y B;  1NVO A;  1Q3E A;  4O4H A;  2OAR A;  5E1A C;  3VOU A;  4ZNC A;  3RK2 C;  1YEW A;  3QG5 A;  4P2Z A;  4GCZ A;  3JAL A;  1M7L A;  3D70 A;  2QJ1 A;  5GTI Z;  1RF0 A;  1URQ A;  2IFN A;  4DV6 B;  2OCC B;  3CP1 A;  3Q5R A;  1JOC A;  1AVO A;  4BWA A;  4YY3 O;  3JCU Z;  4LFA B;  2JK5 C;  3PJS K;  4G2K A;  4DRX B;  3ZHT A;  2H94 A;  3CLQ A;  1O9G A;  4G28 B;  2YO2 A;  3SJB C;  3UM7 A;  2BCC D;  3FWN A;  1AQ5 A;  1M57 D;  2MJZ A;  3K5N A;  4KL1 A;  3EHB B;  2AHZ A;  1J1D C;  1AVM A;  5FPO A;  1AJY A;  1PP9 G;  1ROP A;  3ITK A;  4H13 C;  4Q20 A;  4UCU A;  5H5N A;  3LID A;  3HB3 B;  3Q2Y A;  2YID A;  1PGQ A;  1YIJ V;  2POH A;  3A2F A;  1ZV8 A;  2WZ7 A;  3WB1 A;  1ZR4 A;  4PEL A;  3CME P;  3K03 A;  1L0L D;  1SQV G;  2YXR B;  3MD0 A;  5J2U B;  1JY2 N;  2FXO A;  4UUJ C;  5IY5 C;  1FDO A;  1N4C A;  1VF6 A;  3C3T A;  4UCS A;  3CCL P;  3OD4 A;  3TYY A;  1CW5 A;  4LF9 O;  3F5T A;  4WY4 C;  1QVG O;  1SFC B;  4ZI7 B;  1YDX A;  3J80 N;  3RYH A;  2ZXE B;  1OW6 A;  2M8R A;  1ENV A;  1ZLZ A;  1XNQ O;  1A32 A;  4DV2 B;  3EFG A;  3P32 A;  1W2B O;  2X6A A;  4DR6 O;  4PA9 A;  1QVF U;  4HAM A;  3W7W A;  2UUB O;  1KYO E;  3SDL A;  2AXC A;  4IT5 A;  1HNZ B;  4GOD A;  1QHT A;  4XE5 B;  4I50 B;  4OWF A;  2IJJ A;  2A7W A;  5JCO A;  3HKD A;  2EIJ B;  1LTJ A;  1SP4 A;  4IL6 H;  3FB8 C;  2OTK E;  4DYL A;  1GN4 A;  3N2G B;  4MVS A;  3SWY A;  3ABM C;  1F23 A;  4O4I A;  4DZO A;  1AQT A;  3HE5 A;  1YI2 P;  4C7N B;  4J7Z A;  4DR5 B;  4LNU B;  4PJ0 Z;  5AG2 A;  2RN9 A;  1VQ5 P;  4JI0 O;  1HR0 B;  3R66 A;  5LOV B;  2R32 A;  4TQF A;  1BCC D;  1QNM A;  3OEE G;  3K57 A;  1PM9 A;  2EIM B;  2QTS A;  2ZNI A;  1KEC A;  2ZT9 D;  5IWA B;  1FDM A;  2RKL A;  2UU9 B;  1GL2 C;  3S3W A;  3VP9 A;  5LYJ A;  3CX5 I;  4EB6 A;  5APW A;  1MAB G;  4QNH B;  4JI6 B;  4ZHQ B;  4GX2 A;  1YJW V;  1E1R G;  2E76 B;  1YTF B;  3PTZ A;  5C93 A;  1JO5 A;  3CD6 V;  2WLL B;  1J5E O;  1NVP B;  2XUM A;  1SQX E;  2JIZ G;  3RK2 B;  4H44 C;  1JA8 A;  5IT9 N;  3ZBH A;  1L0N J;  3D71 A;  4WBN B;  1VQ4 V;  2FB5 A;  3TGU H;  3CXH F;  4Q6G A;  2RQ6 A;  5EZY B;  4AHC A;  3GHG B;  2C2A A;  1SQQ H;  3CXH H;  4X8A A;  3II6 A;  2EZP A;  3AK1 A;  2EJR A;  4DR4 B;  1N7S C;  5KLI C;  3I55 P;  3VOP A;  1QBZ A;  1Y76 A;  4LF4 B;  1NTM J;  1FE6 A;  1ZP0 C;  1H2N A;  4BAY A;  3B77 A;  3ZHS A;  1JJ2 U;  3RBZ A;  2VWJ A;  1T3J A;  2R9R B;  5KAF Z;  4JYB A;  2J58 A;  2FML A;  1VQL V;  1U97 A;  3H1J D;  5KLV H;  3BCC D;  3B40 A;  1NAY A;  4O9B A;  1IC2 A;  1M56 D;  4EYY Q;  1DGS A;  1J1D B;  2E5L O;  2GDS A;  3MIW A;  1QLN A;  2BE3 A;  4FLY A;  4X66 B;  1OV9 A;  3V2N A;  3OM3 B;  4X1Y A;  1QLE D;  1YJN P;  1IUR A;  5A2Q N;  1L0N E;  1KQF B;  2YIU C;  2YXL A;  3VQY A;  2CTW A;  4D7T A;  4UCV A;  4CH3 A;  3KCX A;  2W6B A;  3SSU A;  1VQP V;  5H6Q A;  2FFD B;  2QJK B;  3NR7 A;  1QL1 A;  3X2Q C;  4U7O A;  3FWL A;  5KAI Z;  4JI3 B;  2LP7 A;  1RSO A;  3GWO A;  4EEQ A;  2JJL A;  3L9D A;  4IHJ B;  1N34 B;  2P06 A;  1LWU A;  4I0X A;  3UT5 A;  3WUV A;  1K8A Q;  4DT0 A;  5KHJ A;  3L70 J;  2A9H A;  4UB8 Z;  4BW9 A;  2Y0E A;  3B71 A;  1VMG A;  4YHH O;  1R6K A;  2J5U A;  1RM1 C;  1N0N A;  1YTZ T;  4WFH A;  1GW3 A;  2LQT A;  2K9J A;  3J7A U;  3KDP B;  4JF3 A;  5BU5 A;  5APV A;  2PP6 A;  2WPS A;  3RK3 E;  3OEH G;  3CWB H;  3SYA A;  1HNW B;  3L74 D;  1FS0 E;  5AVT B;  4TQD A;  2OYH C;  3U59 A;  1ZOY C;  4O4J A;  1I94 B;  3AK2 A;  4B3M O;  1SQB K;  2Y0C A;  4BRY A;  5B66 E;  3CJH A;  4DUY B;  1BMF G;  4ZKI A;  1YXB A;  3ZIA G;  2O01 N;  2CAZ C;  1KC8 W;  3TGU G;  1JCH A;  4PA3 A;  4UVB A;  2ITD C;  1K73 W;  1SQQ G;  1HVV A;  4ZOL B;  3S3X A;  1GM8 A;  4BIU A;  3ABM B;  5C8Y A;  4D6T H;  3L70 E;  5KA6 A;  1MNG A;  1P84 E;  1KYO I;  1EZV E;  3E83 A;  1DTO A;  1QGK B;  3Q4H A;  3KG2 A;  3LUT B;  2DYR C;  3ABK C;  4IIJ B;  2IZ1 A;  4FM1 A;  1IK9 A;  1JTH B;  2DYS B;  1I5Y A;  2FYU D;  2WLM A;  3LW5 H;  4X1I B;  4EOT A;  2KI7 B;  2CH7 A;  1BQ0 A;  5KLV G;  3L71 D;  1SLQ A;  3W7U A;  2V7Q H;  4DR1 B;  4AQY O;  1MG1 A;  4PD4 D;  4UB6 Z;  1USD A;  3S4R A;  4X89 A;  1GMJ A;  5GTH H;  3T97 B;  5K5G B;  4BW5 A;  1H2G A;  1OWA A;  2P4K A;  4MVO A;  4O2A B;  4JI4 O;  2GTA A;  4DV1 O;  4H44 B;  1IBL O;  4DV5 B;  2AEF A;  4QGP A;  2Q6A A;  3CRR A;  2CPB A;  3AE5 C;  1VL2 A;  2D2C C;  2KUB A;  4IGG A;  2R5D A;  3E8F A;  3MDS A;  2M6Y A;  3CE2 A;  2Q73 A;  3RK3 B;  2Q9I A;  1I0H A;  3PHL A;  3CCM P;  5CCG C;  1N7S B;  1R6N A;  5LXT B;  3IR9 A;  5AW6 B;  4NXM O;  4OX9 B;  3TNU B;  3CEI A;  3ICX A;  1SZX A;  1XMQ B;  5LHI A;  4MTX A;  4NXN B;  5L3E A;  2H8P D;  2YMK A;  4FMT A;  2M0B A;  2EBO A;  2YXY A;  1GTO A;  1PP9 J;  2QA4 P;  4A5U B;  3CWB G;  2PTM A;  4QPK A;  2KSE A;  4R4L A;  1Q2N A;  5CHX A;  3HR0 A;  1GK4 A;  1JY3 N;  4X62 B;  5H2F E;  2YIU B;  2DN9 A;  1LTS C;  2E75 D;  1S9K D;  1SQV J;  1Z5W A;  4JYA B;  1LP1 B;  2FY8 A;  5KHI A;  4HJG H;  2WA3 A;  1N0J A;  2JGD B;  3X2Q B;  3LSS A;  1VQ7 V;  2UXD O;  1E79 G;  5EK0 A;  3HD7 A;  1VP7 A;  4TV9 A;  3AG4 C;  1Q43 A;  3ABL C;  2JEU A;  3BAS A;  3ZMS A;  3H1H H;  3BEH A;  1NTK D;  2X7R B;  1NTZ H;  1NU1 G;  4IOI H;  4HZ3 A;  1PP9 E;  3K5L A;  3O6Q B;  3WMM 0;  1BGY D;  1CP9 A;  2V7Q G;  5BY1 A;  1LTT C;  4WWI A;  4TSF G;  4PI0 A;  5B1A C;  3JAM N;  2O3J A;  4WFG A;  1VAR A;  2W6J H;  2HLD G;  5JVD B;  2C9L Y;  2JRI A;  3KQG A;  3W7X A;  1SQV E;  4BWN A;  2OYH B;  1S72 P;  5GON A;  2N1T C;  1VQK P;  1GDT A;  2QE7 G;  2P90 A;  1GAX A;  1SQP H;  1M1J A;  1BSM A;  3VTP C;  5EBM C;  3M99 B;  3CRQ A;  2QWR B;  1B06 A;  3ZRX A;  3B5N D;  2IYO A;  5EYP A;  4TT3 H;  2GTS A;  1QVG U;  1BHB A;  4DV0 B;  1N73 C;  3OR7 C;  3PH0 A;  3QO5 A;  1YF2 A;  4LP8 A;  1LT9 A;  4LH6 A;  4X65 O;  2FTK A;  2XAS A;  5L8R J;  4IFD K;  2DYR B;  3H1I H;  2OIG A;  5ITZ B;  1D2D A;  4ASV A;  3MGN A;  1W2B U;  3BAT A;  2RMZ A;  4DXW A;  2R9I A;  3JAR B;  3MHH C;  2C0X A;  2PAJ A;  2XAJ A;  4PDL A;  5CMU A;  3C9I A;  3K79 A;  3FAV B;  1XI1 A;  1SER A;  2EZO A;  2DOS A;  2ZDI C;  2F95 B;  3K5M A;  5GTI H;  1Y4M A;  1IVS A;  1N2D C;  3FX7 A;  3RL0 C;  4JAA A;  3FYI B;  5DED A;  1EZV I;  1YJ9 V;  2NZ2 A;  1ZRT D;  1NBM G;  3KCY A;  2CTR A;  3GG2 A;  3JCU H;  1GD2 E;  4KFM A;  4X64 B;  2Q7G A;  2YI9 A;  3G6B A;  5CB4 A;  3K0G A;  4LF8 O;  3WU2 H;  2BAS A;  4JI8 B;  1K9M Q;  1T2K C;  2AW9 A;  4TOI A;  2EIL C;  4U3F H;  1VDF A;  1JY2 O;  3FB5 C;  2D2C B;  5B3S B;  1Q86 Q;  3DTU B;  2BSK B;  3CME V;  4OXS A;  1WMK A;  1J1E B;  5M1B A;  2FXM A;  1NJI Q;  2B9Z A;  1HNX O;  1L0L K;  3K06 A;  3H1H G;  1EDL A;  4JZ2 A;  3AEA C;  4LLH A;  1IO4 A;  4K8Z A;  1NTZ G;  3AE2 C;  1N32 B;  3CCE P;  4JGS A;  4DR7 B;  1JOY A;  2WSF H;  3CCL V;  1RFY A;  4GKK B;  5TJH A;  1GM7 A;  1XMO O;  1EQ7 A;  1DX7 A;  2Y69 C;  3CX5 D;  2KNC B;  5KUK A;  2WVR A;  5IJ0 B;  1UPG A;  2NR5 A;  2HOD B;  2NPS D;  2QM4 A;  4ASW A;  4LC1 A;  4CC6 A;  3H01 A;  3L73 D;  1SQP G;  2L91 A;  3LNN A;  1L4A C;  1W5C E;  1RHZ B;  4TT3 G;  3JAS A;  4NTY A;  4JI7 B;  2YIB D;  1YBK A;  3BVH A;  3APO A;  4N78 E;  1M93 A;  4B7K A;  4O2B B;  4DK0 A;  1HGV A;  1KTM A;  4R7C A;  4FLU A;  1F4M A;  1JQ0 A;  2FXP A;  5BVZ A;  1NR7 A;  3WB0 A;  4B3R B;  4DJG A;  3H1I G;  3AG4 B;  4GOE A;  4X20 A;  1SFC D;  5CN0 A;  1RPO A;  3P30 A;  3HUS C;  4EFB A;  2RCV A;  1VQ5 V;  1Y74 B;  3CCR V;  4W7Y A;  1VQ6 P;  4RJT A;  1FBM A;  4QMA A;  3CCU P;  1JPX A;  3R65 A;  3B5N A;  5IDJ A;  3OE7 G;  4B3T O;  3HKC A;  2A06 G;  1IZN B;  4N3Y B;  3CC2 P;  4G27 B;  1FYJ A;  4IL6 E;  2N1T B;  2N74 A;  2UXC O;  1UIX A;  4JPZ B;  3AG7 A;  1QQC A;  3CB2 A;  4BR6 A;  3TGU J;  4WFB V;  1TU3 F;  1SQQ J;  1GK6 A;  1L1F A;  3D6Y A;  2F4V B;  2DW4 A;  2WQY C;  2LXC B;  1XHZ A;  2GBO A;  4YJ2 B;  1GTW A;  5B1O A;  1DEB A;  3Q3D A;  4IL6 X;  3MUD C;  1I08 A;  1FZB A;  2CDY A;  5KLV J;  3PP5 A;  4L73 A;  1XIL A;  3D36 C;  5LMU B;  1NO4 A;  3RBX A;  2K3R A;  3L36 A;  1B04 A;  2GHY A;  3CCV V;  2ZVN B;  2HHH O;  1X8Y A;  1DIP A;  1VF5 C;  2ZXW C;  2W27 A;  2ZXX A;  2DQ0 A;  3FFQ A;  2QSA A;  3K5B A;  2HJD A;  2WPV B;  5KHK A;  1YTF D;  2QG4 A;  1P49 A;  1TVK B;  3TGU E;  2F43 G;  2BCC H;  1VQN V;  1Q6H A;  1SQQ E;  2CK3 H;  3CXH E;  4DRX A;  3RK2 D;  5KAF H;  3HKE A;  1OCO C;  1XOU A;  4LCU C;  4ABM A;  1YJN V;  3RYC B;  3SR2 C;  1ZSP A;  4I9W A;  2P1J A;  3H1L H;  3AG2 B;  4DV3 B;  1N36 B;  3SJA C;  1KYO D;  3ZHU A;  5BMV B;  5KLV E;  3E8G A;  3IN6 A;  1XDC A;  1K3E A;  2KSD A;  1URF A;  1RH5 B;  2NPS A;  3IFX A;  3H32 B;  1L0L H;  3NFQ A;  4RKU J;  1WLE A;  1FXK C;  3JD1 A;  5J2U A;  1NYH A;  2O01 J;  5KAI H;  1JCC A;  2YIB A;  4NR1 A;  2WPQ A;  3M9B A;  2A3Q A;  4JV5 B;  3H1K H;  5IE9 A;  1GK9 A;  5CA0 B;  4RQE A;  1N86 A;  1EFR G;  1R73 A;  4MSW C;  3SYC A;  1L4A B;  3UO2 A;  1FS0 G;  4UB8 H;  1SFC A;  4ZI7 A;  1Q7Y W;  1BL8 A;  1W59 A;  5HFL A;  2GUS A;  1Q82 W;  1H8E G;  4UVA A;  1N8R Q;  3CCS V;  2O1K A;  1SES A;  3V5B A;  4LF6 O;  3VMY A;  4JBZ A;  1DLB A;  5LBQ A;  3GF3 A;  1M8O B;  1XEQ A;  4KUM A;  5IYB O;  4B7E A;  1NU1 J;  3GMA A;  1NQT A;  2LJ2 A;  1UJW B;  4CS4 A;  3K5O A;  2QGN A;  2UXB B;  3OTO O;  3CWB E;  2HP8 A;  2Y0I A;  3USS A;  3CC4 P;  3HUS B;  4KT0 J;  1GU4 A;  5AW3 B;  3SPG A;  3GVM A;  1IFD A;  3SJC C;  2Z5U A;  4A7P A;  1EN6 A;  2CE4 A;  2FYU K;  2B1I A;  3AED C;  3QH9 A;  4J10 A;  2W0F C;  1R8E A;  3N2G A;  1NKD A;  1BCC H;  4TV8 B;  1HJ0 A;  3IFM A;  3FXD A;  1LR1 A;  4C7N A;  2CK3 G;  5GW7 A;  4LNU A;  1GN3 A;  3FGA D;  5BU8 B;  2H7H A;  4D6T E;  2B89 A;  1WP8 A;  2H88 C;  5LOV A;  3G4S V;  3CRM A;  3B8E B;  4Y28 J;  5AVU B;  3ZCC A;  2YKO A;  3H1L G;  3K9A A;  4H33 A;  3TXQ A;  3CCJ V;  1NU1 E;  1FZC C;  1BZK A;  3U1C A;  3W7S A;  3AE1 C;  5TIS H;  1WPB A;  1W2E A;  4H0L C;  1VEW A;  1L0N D;  3A0R A;  5H6R A;  4BXL A;  1WNS A;  4FJC C;  4ZHQ A;  3A2A A;  1JB0 J;  1HDJ A;  2Y48 A;  5GTH E;  2GM4 A;  1BHA A;  3W67 A;  3OUF A;  1NTM D;  3FB6 C;  2QRX A;  2XDJ A;  1ZWI C;  1MSD A;  3U1A A;  1FKA O;  2FYZ A;  1ZLL A;  1OCC C;  1GN6 A;  2GUZ B;  4NVP A;  2ITC C;  2VRZ A;  5F2V O;  4DV7 B;  1KIL C;  3AE4 C;  3L75 G;  4WBN A;  3H1K G;  3DXR B;  1SKV A;  2QDO A;  5EZY A;  2K9P A;  4JI1 O;  3GHG A;  4DV4 B;  1FJG B;  2XKM A;  3ZJZ A;  1X4T A;  3BCC H;  3RVZ A;  4LF5 B;  4JI2 O;  4H44 D;  4LGD E;  5KX5 B;  4YXW H;  1PNL A;  5JH7 B;  3E1I A;  1K4C C;  3BRC A;  1PNK A;  1KB9 E;  3BPZ A;  2QM8 A;  1MZ9 A;  3RK3 D;  3ZDM A;  2ILM A;  1IBM B;  1N7S D;  4NPE A;  3H1H J;  5FNV B;  2CGO A;  3AE3 C;  1YVW A;  4JYY A;  3WU2 Z;  1CZQ A;  2IYP A;  4M3L A;  3CXH I;  1HR0 O;  3K0D A;  2UXN A;  5E79 Z;  2W6I G;  2ZM6 O;  1JEK A;  2KG7 A;  4LFC B;  2O1J A;  1I7F A;  1FXK B;  3CSX A;  5IJ9 A;  4KJM A;  5AW8 B;  5IYZ B;  1F51 A;  1AI4 A;  1M90 W;  1BE3 G;  1SQF A;  3ZRS A;  1NTK K;  1PL5 A;  4EIJ A;  1QCE A;  3RYI B;  2ITA A;  3HE4 B;  3L37 A;  4TWK A;  5D5P A;  4DK1 A;  3RWR D;  1FU1 A;  1EZV D;  1P84 D;  1VPC A;  3L70 D;  4DUZ B;  2IPP A;  2FFD A;  3G67 A;  5B5E H;  1SQP J;  4IHJ A;  2Q9L A;  5JJE B;  4XDJ A;  1TAE A;  1AV1 A;  3M7M X;  4MVM A;  2HG5 C;  2IW5 A;  3AG1 C;  1RF0 C;  1URQ C;  3H1H E;  1ZL8 B;  1NTZ E;  1N7L A;  3L74 H;  2WSC H;  2OYI C;  2PF4 E;  3O65 A;  5JQG B;  4D7S A;  1H0T B;  1MMM A;  1HH0 A;  3KZI H;  1U7M A;  1M5I A;  3H1I J;  2ZIM A;  2DMX A;  1THZ A;  3FYE B;  4DR4 O;  1JMM A;  4GKJ B;  4H37 A;  1Z2G A;  4UCR A;  1PKX A;  5AVW B;  5APU A;  3SWK A;  1Y6X A;  3G80 A;  1SQP E;  4WB4 A;  1YCI A;  4JAV A;  4UV8 A;  3P8C D;  1JFF B;  1Y8A A;  1H2K A;  1VQ8 P;  4ZOL A;  4X66 O;  4IFF A;  2VQF B;  5AVZ B;  3L71 H;  1J95 A;  3SYO A;  1SET A;  4OVN F;  3DC5 A;  1JTH A;  4E4E A;  4X1I A;  2OYO A;  3H1I E;  3ZS8 C;  2D3O W;  3AEE C;  3M0A A;  1SC5 B;  1VF6 C;  4F6R B;  1SQX J;  5BR8 B;  1FXH A;  4I9Q A;  1M4U A;  2R70 A;  4GKG A;  2HVK C;  2OT5 A;  2P22 C;  2XAG A;  4W4L A;  4JI3 O;  2X0L A;  3T97 A;  5GTI E;  2HPC A;  2E5T A;  3AE8 C;  2A06 E;  4O2A A;  3JCU E;  4LWS B;  3M91 A;  4FFB B;  3ZMV A;  2QJP C;  3VP8 A;  3WU2 E;  3OGI B;  3B2E E;  4XDL A;  2QM7 A;  1K4D C;  1SRY A;  2KQX A;  5APX A;  1N7S A;  1ZAU A;  5LXT A;  2XT9 A;  1EZJ A;  1PP9 D;  3U11 A;  1U7J A;  1I94 O;  3TNU A;  2UXX A;  2WSS H;  1LTJ C;  5LMN O;  3ZHR A;  4ASU G;  1IZ3 A;  2D2C D;  1MFZ A;  5CA1 B;  4GDO A;  4PA6 A;  1MOF A;  1NZ6 A;  3JSL A;  3T1H O;  2BOB C;  1JM0 A;  4QPJ A;  2KOG A;  4I55 B;  2AGA A;  3CC7 P;  4OGQ C;  1YIT P;  2E74 C;  2ZIN A;  1IDS A;  1NH2 D;  1OW7 A;  3RW0 A;  1WP7 A;  1B3Q A;  1KD1 Q;  3WUU A;  1G2C B;  3A0B H;  3OMI B;  2K9Y A;  3OA7 A;  2NLJ C;  3ZRW B;  3TET A;  1KB9 I;  1VQ9 P;  2Y0D A;  4DR3 B;  1JR9 A;  3BA8 A;  1ZN5 A;  5EBL C;  3M9Q A;  2JGD A;  4H13 B;  1AR1 B;  1IBK O;  1LUW A;  4LF9 B;  3CPW O;  3D8C A;  3TDK A;  2OYQ A;  1Y9B A;  3L71 G;  1BGY H;  2HJF C;  5KTB A;  2Q1K A;  2OTJ P;  3DGE A;  3O8Z A;  2WAM A;  3JAL B;  3CC2 V;  3ETG A;  3N4X A;  5APY A;  1LNQ A;  3QWO C;  3B8N A;  1XNQ B;  3UQ8 A;  1R3L C;  5DJU B;  1M57 C;  4DR6 B;  3O6Q A;  1M1K Q;  5JJN B;  2OYI B;  2W90 A;  2QWQ B;  5IY5 B;  4B86 A;  3QO7 A;  2Q8V A;  3UKM A;  2XNX A;  4XFJ A;  4WY4 B;  5JVD A;  1GKF A;  4NPD A;  4EFE A;  2CPS A;  2OYH A;  1UII A;  3W7T A;  3VMA A;  3A0H H;  4PJ0 E;  4LBE C;  3HD7 D;  1YSC A;  2OIE A;  4RAI A;  5EIB D;  1K7D A;  1T6A A;  3AE7 C;  1DF4 A;  3V4Q A;  1W0J G;  2LGW A;  3H9V A;  4AQR D;  4JI0 B;  1FOS F;  4TUY A;  2M5A B;  2BEQ D;  1QX8 A;  5CCH D;  4X62 O;  3HRN A;  2G8Y A;  2KIK A;  3U10 A;  1X22 A;  3H1L J;  3JAR A;  1TUB B;  5IYC O;  3IF4 A;  4F4L A;  4JYA O;  4R8C A;  1KN7 A;  1JVM A;  5K1X A;  3FAV A;  1LWU C;  4P30 A;  1J5E B;  5KKZ C;  1AA0 A;  1HTL C;  1CXZ B;  2YIC A;  4YIP A;  2OQQ A;  1AJN A;  1FFX B;  5LHH A;  2QJY C;  4YXD C;  1ZTE A;  1S3J A;  2Q67 A;  5CBF A;  1NR1 A;  2MW2 B;  2QVA A;  4N78 D;  2BCC E;  4N6J A;  2DWD C;  1GL2 B;  5KHH A;  3L75 J;  5TIS Z;  1OIP A;  1YYC A;  3H1K J;  5KAF E;  4ZKU A;  2JGU A;  2IBZ D;  1YHQ P;  4GUN A;  1JCD A;  2BSK A;  4GX1 A;  3H1L E;  1IX9 A;  1S76 D;  3QNE A;  3I5C A;  1DH3 A;  4MVQ A;  1S5J A;  3OFN G;  2ZFC A;  1LTJ B;  1AB3 A;  2KLU A;  3VQW A;  2ZT9 C;  3VMX A;  1L0L E;  2E43 A;  4FLV A;  3QO8 A;  1VQO V;  3GW6 A;  3L73 H;  3RYF B;  2YI8 A;  4J42 A;  2JS5 A;  5KLI B;  2IZ0 A;  3CCQ V;  2HOD A;  4I6M C;  4OGQ B;  3UO3 A;  1KUQ A;  3Q5S A;  1HWY A;  2E74 B;  5KAI E;  1ZXG A;  4DOJ A;  3L75 E;  1NKZ B;  3H1K E;  2F23 A;  4CS2 A;  3JAT B;  1BE3 J;  3ETQ A;  4B3S O;  4X1K B;  4EB6 B;  4OPH A;  4PHZ A;  1P7G A;  4UB8 E;  4KXR A;  2KK7 A;  4O2B A;  1EDK A;  1E5W A;  3SYQ A;  3CI9 A;  1OVR A;  1L4A D;  4GYC B;  4X64 O;  4YHH B;  5B1B C;  3AEB C;  2C9N Y;  1QR9 A;  2B5U A;  2UUA B;  1M56 C;  2R3C A;  4D6T G;  5L3C A;  4MS2 A;  3Q5P A;  1XQ8 A;  3T2M A;  5B5E Z;  4DW0 A;  3OJA B;  3TGU D;  1SS1 A;  1PPJ H;  1QLE C;  4B3M B;  1AI5 A;  1BE3 E;  2NRG A;  2RN0 A;  5EFW B;  1SQQ D;  1WJZ A;  2AXT H;  3CXH D;  1SA0 B;  3NXS A;  5LP6 A;  1E1Q G;  1FFT B;  1H2M A;  2P2U A;  2QKC A;  2FBW C;  2N1T A;  5CCH A;  2Q69 A;  4DCK A;  4GKK O;  1RM1 B;  3BVO A;  1L0N K;  2VS0 A;  4I5S A;  4HBN A;  1X79 B;  4U7N A;  3E2E A;  1NI8 A;  3KZI Z;  2QEX P;  3C90 A;  5KLV D;  1G1X B;  4JTA B;  4N21 A;  4DR2 O;  1NTM K;  1CI6 B;  5EBW C;  3EVK A;  4WFA V;  2WLJ A;  1BDD A;  4YJ2 A;  4UB6 E;  1NKN A;  3VN0 A;  4J11 A;  5TIS E;  1IJD B;  1SQB H;  2JWD A;  2IX7 C;  1K97 A;  4AQY B;  1IK7 A;  4KHP O;  5KJ7 D;  3S1K A;  2OTL V;  4GX5 A;  3ASN C;  4P9P A;  5KMG A;  4MW3 A;  1AP6 A;  4JI7 O;  1YQ4 C;  1KP2 A;  2IU3 A;  1YIJ P;  2WLK A;  2KB1 A;  3UT5 B;  2UUC O;  5HFM A;  3ABK B;  3MHV A;  3SGI A;  5KKZ B;  3EQ2 A; 
#chains in the Genus database with same CATH homology
 1DD4 A;  3D6Z A;  1FDI A;  4PV1 D;  1OW8 A;  1AJY A;  1WMK A;  2P10 A;  5M1B A;  4H13 C;  4H44 D;  3AEA C;  3AE2 C;  3Q2Y A;  3IN6 A;  2YMK A;  4H0L B;  3AEF C;  3ABV C;  1K05 A;  4R4L A;  1OMI A;  2D2C D;  2YIU C;  4GDO A;  2WSF J;  4RKU J;  1KQF B;  3AE3 C;  3GF7 A;  1Q90 D;  3SFD C;  3G9R A;  2E76 D;  1VF5 B;  2ZT9 C;  1FDO A;  1ZRT E;  2FYN C;  2E75 D;  1KQG B;  4OGQ C;  3IAO A;  2O01 J;  1NYH A;  2E74 C;  2ZT9 B;  1OW7 A;  1DD3 A;  1PL5 A;  4H0L D;  3AE9 C;  4OGQ B;  2QIW A;  1OW6 A;  2K9Y A;  3Q5S A;  2E74 B;  1S5L X;  1VF5 D;  3AEC C;  1KTM A;  3B71 A;  4H13 B;  2FXP A;  1U57 A;  2J5U A;  3AEG C;  1S1C X;  1Y9B A;  1NGM B;  3RK3 E;  3GF3 A;  3GLM A;  1RQV A;  1ZOY C;  1PIX A;  3GMA A;  2WSC J;  3O6Q A;  1MKM A;  1PV3 A;  2G3A A;  3AEB C;  3SFE C;  4KT0 J;  4H13 D;  1HF9 A;  4PV1 C;  3C8V A;  4XFJ A;  1RQU A;  2MKV A;  3AED C;  3Q5P A;  4PV1 B;  4TT3 H;  1R8E A;  1HJ0 A;  1UIX A;  3S9O A;  3EWK A;  3Q1M A;  3FGA D;  2ZT9 D;  1TU3 F;  2FBW C;  3AE6 C;  2H88 C;  1KMI Z;  5L8R J;  1ZME C;  3AE7 C;  3D6Y A;  3H25 A;  3R4Y A;  2E76 C;  2WQY C;  4OGQ D;  4Y28 J;  2E74 D;  1KIL E;  3LW5 J;  2E75 C;  3Q3D A;  2BEQ D;  4I7Z C;  3AE1 C;  4IL6 X;  1EXI A;  2E76 B;  1GMJ A;  2IDB A;  2V7Q J;  3AEE C;  3RL0 g;  3T97 B;  4H0L C;  3D70 A;  2H89 C;  2E75 B;  2G8Y A;  4R4M A;  4I7Z B;  1KOR A;  4H44 C;  4U7J A;  1JB0 J;  3Q5R A;  4Z1M H;  1IK7 A;  1VF5 C;  3D71 A;  2NZ2 A;  1DIP A;  2QJK C;  4H44 B;  2WSE J;  3AE8 C;  2JP3 A;  1VL2 A;  3AE5 C;  1YQ4 C;  2D2C C;  2QSI A;  2WPV B;  5KLI C;  5KKZ C;  2BEZ F;  4YTP C;  1ZP0 C;  1YQ3 C;  3AE4 C;  2OQQ A;  2QJY C;  4YXD C;  1K04 A;  2QJP C;  2JO1 A;  2D2C B;  1EXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...