4H13B

Crystal structure of the cytochrome b6f complex from mastigocladus laminosus with tds
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 42
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4h13B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h13B01
2QJYC 2WSCJ 4RKUJ 2FYNC 4PV1B 1ZRTE 2WSEJ 1Q90D 4KT0J 5L8RJ 2YIUC 2K9YA 4Y28J 4H13B 5KLIC 2E76B 1S5LX 2QSIA 2ZT9B 2WPVB 4H44B 1JB0J 4H0LB 5KKZC 2O01J 2E74B 2WSFJ 2QIWA 2E75B 4I7ZB 4OGQB 1VF5B 2QJPC 2QJKC 3C8VA 2D2CB 3LW5J 4IL6X
chains in the Genus database with same CATH superfamily
3T1HO 1IK9A 3RK2C 4P9OA 1FXKC 3HR0A 5KLIB 3KCYA 2HG5D 1L0NG 2LJ2A 4DV6B 3SPHA 1P84F 3M99B 1OCRC 3MHHC 1N33O 1N33B 1RH5B 3E1IA 3R4YA 1SVFA 3ABMB 1QR8A 4NKGB 4WY4D 1FPOA 3W68A 3E8FA 1SQPH 3CCMV 1IX9A 3APQA 2GBOA 1K73Q 3HUSA 2HFEC 3WB1A 5BR8O 5IDJA 1S5LZ 1FOSE 1BGYH 1SQVH 2WLHA 1PPJG 2OCCC 1X59A 2QJ1A 1BE3D 3L70D 4GKJO 3CCUP 1DIPA 3EFGA 1PNMA 3SYQA 4NR1A 1H2KA 4RO2A 3C8VA 1HTLC 1J1EB 1ZN5A 2HJDA 3JC22 1JMMA 2OTJP 3RWRD 4FVMA 4UCVA 1HR0B 1SFCC 2WMMA 5AW2B 2ETNA 3E8HA 5C93A 1UJWB 1VQ8P 1KKCA 5C39A 3CWBD 1G2CB 5LGTA 3L72H 1VQ5P 4DR1B 3RVYA 2DW3A 4YJ3A 3C3SA 1KQLA 1P4RA 1LT9A 4L8JA 4X66O 3MIWA 4JI0B 2JRIA 1SQPD 3CMEP 4JV5B 4D6TG 4ZNCA 4TT3H 2F4VO 2KS1B 2OQQA 2C2AA 2MK3A 1K9MW 4EOTA 2ZVNB 5KJ7D 2D2CB 3LW5J 3L75E 4GKGA 2IJIA 1X9VA 1T5EA 4XBFA 3WB0A 5IJ9A 1H38A 1H2NA 3DGEA 2PP6A 2V4HA 3HE4A 2D3OW 2KLVA 2ZAEB 1LWUA 5APVA 1ZOYC 4K3AA 3HKEB 4NPEA 3CXHI 2OYIC 1M1JC 1DLBA 4DR2B 2ZE6A 1MABG 1AR5A 1NTMG 1EBOA 2L5GB 5IYZB 3ASOB 1NOHA 4TUYB 2R9IA 1LUVA 1BSHA 2VQEO 1HNZO 1KTMA 4LFBB 5KUMA 5IWAB 1KQSO 1WB7A 4RESB 1ZXGA 4HJGH 1V54C 2F66C 4ICGA 1IJDB 3W7WA 1S77D 4X20A 2R3SA 3JAWA 5CA3A 2FKWB 2P6JA 2YKPA 4EKWA 1SQQD 3L74H 5LA6A 2DYSB 1PGQA 1MA1A 1BCCD 4O2AB 1HWYA 3JARA 4LF8O 1SF9A 1U96A 2H3OA 2QGNA 4JAVA 5EZYB 4ZIBA 2QKAA 3CWBE 1OMIA 4WB4A 4WBAA 3ZMSA 2PZSA 3ZHRA 2WA4A 4BAYA 4H0LD 3N7NA 3P7KA 3VMYA 5BMVB 1VF5B 3I55V 3T1YO 3B71A 2IZ0A 2P5OA 3CB2A 2E74D 2N1TB 1L4AB 1VQ7P 2QJYC 3GVMA 4LBEC 2M7WA 4LCUC 3RYIB 1HNWO 3CL3D 5E79Z 3C90A 1VQ8V 1VQLP 1GN2A 2FFDB 2A3QA 2MW2B 3I55P 5KX5B 2Z0AA 1QQCA 3MHSC 1I0HA 1KILB 3B5NA 5IT9N 3CI9A 3QVNA 1UIIA 3PTZA 3AEBC 3TJTA 1EZVG 2E76D 4U3FJ 4UV8A 1N73B 3RN4A 3QWOC 1FFXB 1XMQB 4BWNA 4X1YA 4H44B 5LL6Y 1QEXA 2FBWC 2KSJA 4UB8H 3EFFK 3IN6A 1EDLA 3AG7A 5LXTB 3T4ZA 3JAKA 3CCRP 4K0KB 1NS1A 1NTZE 4WFEA 1AI4A 4DV6O 3PJSK 1RPRA 3O65A 5GTHZ 3THOA 2ARHA 2E5TA 2IDBA 4HH2A 4PA9A 1Y76B 3PN1A 2O01H 4FLUA 1J5EO 3F5WC 4KP4A 1FU1A 1Q5OA 2HP8A 4H37A 3SWFA 4NXMB 1IFIA 4MN4C 1SQQE 5KAIE 4FJCC 5FPRA 1RE4C 5EC1C 1T6AA 1L0NJ 3L75J 4JTAB 1D2DA 1JUNA 3TYYA 5DJUB 4G27B 1NTKG 1I5XA 2DQ3A 1SQQJ 5KMGA 3A2FA 1AJQA 2CDYA 4PI2A 4LFCO 3HE4B 3TXQA 1LWUB 1PNKA 4EI2A 1JEKA 4A5UB 1G1JA 2AEMA 1OVRA 1PZQA 3BABA 4BIUA 1P84D 4QPKA 2ZXXA 2UXNA 1FOSF 3AE6C 1NH4A 3OGCC 5LP6B 5CMZA 2IFMA 4J41A 4DR7B 2FXMA 3H1KJ 4B86A 2RN0A 5KAIH 4X9QA 3OAAG 3OFNG 1P84I 3W67A 3M7MX 4I0XB 3USSA 3RYCA 5CA1A 4DUZB 4JI2O 3F7VC 3MP7B 4I5SA 4RUEA 3D70A 4ZKPA 1VQ6P 5BZBA 4IYIA 4HYTB 1NTKK 5AW4B 3H1LH 4BW5A 2E74C 1KZUB 4RO0A 5HFMA 1JCHA 2CGNA 3SFEC 2V7QH 4LC1A 1SKVA 4H0LC 4GODA 1VF6C 2OARA 4DV3O 5BMVA 1BMFG 2Y0IA 1FZAA 5LHIA 1NU1E 2ZM6B 2Q7CA 3AG1B 3WU2E 3ZMZA 2H94A 4EB6B 2JEEA 1MNGA 5JJJB 1VPCA 2KSEA 1US6A 1VQMV 1D5NA 2A45G 2GM4A 5L3GA 4O4IB 2VWJA 1E79G 5LA6B 1FS0E 1NJIQ 1EFRG 2ZIMA 1T3UA 2KNCA 4JTDB 2CTQA 3L72E 2P7JA 1FXKB 2ZXEB 3CCLP 5LXTA 1FYJA 1P84E 1AP5A 3DC6A 2CH7A 1SQPJ 1VQPV 3GHGB 4BIZA 5LHGA 1K5SA 1IURA 4G28B 4TQFA 1SQFA 2FYZA 4OXSA 1OV9A 4ZKIA 3F89A 2OCCB 1GM8A 2B89A 2ZDIC 1KILA 1DGSA 3L71E 1NBMG 2QWOB 1LTTC 4ZI7A 3C9IA 4HBNA 1KP2A 4Y28J 2RMKB 3L72J 3G71P 4P2ZA 2ZVOB 3FXDA 1K4DC 4NB5A 5LOVA 2WAMA 3E2EA 2PGGA 1ZTEA 3CWBG 4J10A 2PYJA 3K5NA 4PD4E 1RP3B 1NVPB 1FZCA 1QBZA 1RQVA 3ZMVA 1ZSPA 1QVFU 1NTMJ 4D6TD 2GHYA 2K9JB 3K5LA 5CN0A 3K58A 1MFZA 3G4SV 5B5EH 4L74A 2D2CC 1FD9A 5E79E 1I5YA 3SPGA 2B87B 2ZXWB 3GWOA 3RVZA 1H89A 3BCCD 3H9VA 2BOBC 5LBQA 1H2GA 4OX9O 3SYPA 3CWBH 2DQ0A 3W7XA 3K04A 1I94B 3L72D 3RK3C 2EIMC 4ABMA 4WY4C 3O9OA 2CTPA 1RSOA 3CYOA 4JI6O 5K1XA 2WPQA 1KFMA 1NTMD 1OWAA 1VQ9V 2PFXA 5AVQB 1G2CA 2JO1A 4IL6Z 1Q81W 3HKCB 3V4WA 2Q3IA 3ASNB 3HE5B 4D7TA 3SJBC 3CJHA 2J58A 3CMAV 3H25A 3BAAA 1UFIA 2DYRC 1X4TA 5IYZA 3OR7C 3AK3A 5JWPA 1GN3A 2DYSC 3AEEC 3CMAP 3JASA 4KHPO 1AVOA 4C7NA 1M56B 4MVUA 4N3YB 1P7GA 2O57A 2Q4PA 4FMTA 2HHHO 3M0AA 4TV8A 1IBMO 2MJZA 3ZRXA 1RE4A 5EC2C 1L0LJ 1FXKA 2WSCJ 5M1BA 2ITCC 4O2AA 1ZRTE 4FIPC 1Q8IA 2BOCC 1NTMH 2X6BA 3STLC 3UCSC 3BVHA 1FZFA 2JDIG 3ETGA 3I56V 1SQQH 3L75G 3JSLA 2WWWA 1IBKO 2OYOA 3ZRSA 1Z56A 2UUCO 1L0NK 3O8ZA 1PFIA 3LDEA 2D2CD 4JI6B 3V6IA 4PDMA 2XV5A 2W90A 3JATA 4IL6X 3OW2U 1GD2E 5AW7B 1HH0A 2EZPA 3M9BA 1NTZD 2ILMA 2JEXA 5J2UA 2M5AA 1QCEA 4ZOLA 1Z2GA 2XAQA 3JD3A 4JAAA 4ZHQB 1Y47A 2YXLA 1WMKA 2QSIA 5BY1A 1KV4A 1KQFB 3N2GA 2KYVA 2DE0X 3AECC 1RF1A 1TUEB 1S5LE 3K0GA 4WFAV 4U7OA 2JK5C 2W83C 2K9PA 3BRVB 4PJ0E 3VQVA 1KYOD 4RKUJ 2GUSA 2YMKA 3U11A 4LF4O 2Q69A 5H9CA 3H1IE 3L35A 2YS8A 3HD7B 1VQPP 3HRNA 3ABKC 3KG2A 5CA0B 4QNHB 1XL4A 2PI4A 1NO4A 4D6TH 2JDIH 2KZJA 2HVJC 3RGUA 4QJFB 4GLXA 1GDTA 5F2VO 3GB7C 2P7TC 4HAMA 3UT5A 1F4MA 1DF4A 3AE7C 1OVUA 3NTNA 3EHBB 1QR9A 3K57A 1W0JG 4U7JA 3ZRVA 3G6EV 1S5LH 1T3JA 3WFVA 1S76D 3VQYA 1SETA 1M9NA 2XTAA 2K9JA 3BA9A 5IYBO 4IT5A 3P30A 1JY3N 2HLOA 1YTFD 2C0WA 2VQEB 5AVSB 4EFEA 3JCUE 1X8YA 1YSCA 1L4AC 1JOCA 2XNXA 4OWFA 3CCQP 4I0XA 1NR7A 2WLIA 4GYCB 1P84H 3VOUA 2G8YA 1HVVA 3AEAC 4ZMDA 1BCCH 1L0NE 3A0HZ 1PKXA 1SS1A 4DR4O 4WWIA 1IK7A 2ZD9A 4OGQB 3HKDA 2QA4P 5AVVB 3M06A 2YIUB 1ZLLA 1IFJA 3KDPB 4X8AA 4H13C 1SQPG 3FX0A 1GKFA 4DR6B 2CTRA 1RF0A 1JY3O 3BATA 2QKSA 3JCUH 3CHXA 4FLVA 3T97B 5CA1B 3V2QA 1T2KD 2H8PC 4J9YB 5K1PA 2OYQA 3CC4V 4CH6A 3H1KE 2LXBA 1IFPA 2UXCO 2K3RA 5KHHA 4YPCA 2PI5A 2EINB 1N32O 2WSEH 4JI4O 1H8HG 1HNXO 1XDCA 3JALB 4UCTA 1TVKB 4UB8Z 1PV0A 2VRSA 1URQD 1YTZI 4GZRB 4H44D 5GW7A 1SC5B 5LP6A 1KC8W 1N32B 1CI6A 3CC4P 1D7MA 5AVXB 4F4LA 2UXCB 3CC2P 2GUVA 2CPSA 4JI1B 3A0HE 3L71D 3Q4HA 2UWJE 4EB6A 1SQXE 3PRJA 1FKAO 1N7SA 5APQA 1HJBA 5LP6C 2NNUA 2Q5ZA 1OCOB 4PHZA 1PP9H 3FAVB 4IGGA 3OTOB 3K5BA 3T2MA 2ZE7A 1G1IA 1WRGA 2A06H 3MUDC 1YDXA 1BGYG 1SQVG 2A9HA 2LXCB 4DV2B 4U7NA 4DO2A 1VF5D 4NXMO 1LP1B 1JTHA 1X22A 1FC2C 4PDLA 1VF6A 1M5IA 5B1BC 5IJ0A 4JI2B 1M93A 4FZ0A 3FFQA 1BS3A 2O01N 1OZHA 2H7HA 3JCZA 1NH2B 2PY5A 2PYLA 3H1KD 3KYQA 4LGDE 5KAIZ 3S1KA 2QM8A 4BWAA 1GO3F 1NTZJ 3H1JG 3JD4A 5DM6V 1A02J 5KLVD 3B5NB 5BR8B 4LF6B 4GOFA 2RH0A 3HD7A 4KJMA 1AI7A 1XNRB 1NTME 3LIEA 2IJKA 5B66H 2M3EA 2GSMB 5DECA 5CCGA 1WP8A 2XAHA 2IYOA 4R4LA 2AHYA 3E35A 4RUFA 4RAIA 2Y0EA 2AW9A 2ITAA 3II6A 1RM1C 1OCCB 1YYCA 1MUUA 3ETDA 1JM0A 2E5LO 1HGVA 5FLXN 1VQ9P 3D3IA 3K9AA 2IJJA 4J7KA 1NU1G 1M56C 3R65A 5B3SC 4ZI7B 3CC2V 1VF7A 3CXHD 5TJHA 3CLQA 2HR3A 2WSCH 1AFOA 1XILA 4I4TA 3ZS8C 4UVBA 3P8CE 3U59A 4K0KO 2RDCA 2N1TD 1ZR2A 2PUSA 1ZRTD 2ZKOA 3VBBA 2O1KA 1RSOB 3ZCCA 2N04A 2B88A 4DW0A 3KQGA 4B3SB 4IIJA 3RK2B 5IWAO 2AHZA 5JQGA 4QE9A 3TK1A 4DV3B 3ABMC 2AEJA 2Y69B 3Q4HB 5KJ7C 2H8PD 3QO5A 3OUFA 2OYHA 2Z4EA 3WB2A 2QM4A 2NLJC 3VMZA 2WZ7A 2Q5UA 1BQZA 2BCCG 2XAFA 1JY2N 3X2QC 5JJNB 5GTIH 5KAFH 1FZEA 1GMJA 3FAVA 1DX7A 1QLNA 4DUYB 5KTBA 2EIKC 2YIAA 2V7QG 3GF3A 1JNMA 3P3NA 1JCCA 3SJQC 1NAYA 3LSUA 2QJPC 3HE5A 4X66B 3UO2A 1USDA 2FYUG 2CE4A 1Z5WA 1R5LA 5APXA 2NR5A 5B1AB 1NTMK 1RFYA 4MSWC 2KG7A 2WA3A 5LYJA 3VN0A 2A06D 2B5UA 5EIBC 1PM9A 5J2TB 4LFCB 1LJ2A 5KAFE 2GDSA 1K97A 1M1JA 4K8XA 2QWRB 1N34O 3RBZA 3L71G 1CSBA 1MMMA 2K1AA 4WY4A 3WMM0 3LSQA 3ITKA 1P49A 1AR4A 1Q6IA 3CC7P 4XA4A 1JOYA 1MSDA 1XUQA 5AW9B 2HG5C 2UUAO 2UUAB 4ZOLB 1VARA 1RQUA 3CPWU 4FM2A 2YXRB 4X1IA 4DV4O 5KLVK 4U3JB 4XFJA 1YVWA 2R44A 3V2NA 1IDSA 1NH2D 3SPIA 2YEVB 4GX0A 4LR3A 1AVYA 3Q1MA 3Q2YA 1J5EB 1W2BO 3TGUD 3M8AA 3AE9C 1N34B 3CXHF 3R2PA 1BGYD 2ADPA 1SQVD 3UT5B 4U3FH 1SS3A 5BU8B 2HVKC 2FMLA 5AVWB 2WPVB 3VP8A 1JB0J 1IBMB 2JGDB 2XT9A 2N9YB 1JX9A 3CCVV 2WSFH 3B8EB 1SZTA 3TSIA 1FFTB 3E1RA 3CSXA 1UIXA 3STZC 4UCSA 5JH7A 2XDJA 4AQYO 3AK2A 4UFZA 4LF7O 1VQ4P 2WPSA 3OMNB 3IAOA 3TNUA 4OGQC 2L6LA 1W5CE 1JFFA 2JEUA 2Q8VA 2A45H 3ICXA 5CJ0A 4YY3B 1FAVA 4EDFA 2BEQD 3TGUH 3D36C 1L0LE 1YQ4C 2Q3EA 5APYA 4NTXA 3D3QA 1URQB 2W0XA 2Y0CA 2B1IA 2BE3A 2VQFB 5H6RA 3G9RA 4GX2A 2FL4A 2HODB 1ROPA 1XMOO 3A0BZ 3FKSG 2EINC 4I4TB 3H1JE 5KKZB 1CP9A 4DV7O 2KS1A 2B87A 3N2KB 4OPAA 5CA0A 4BIOA 2Q9LA 1GL2B 1KILE 1KB9D 1KU9A 4AYCA 2CUGA 1NKZB 3FGAD 2BCCH 1VIBA 4MW8A 5TISZ 3IF4A 5CBOA 1SQBK 3TGUE 3G4SP 4LF9B 5A9GA 5EIBD 1YQ3C 3HD7C 2F43G 1K4CC 4BR6A 3ABKB 3JALA 3MDSA 4B3TB 1VQOP 5D5QA 2JKVA 1CZQA 2WLLB 1KECA 1YITV 3BRCA 1GN6A 2WT7B 3VP9A 2KG7B 3L74D 3DC5A 3CJHB 4O2BB 3RL0C 3OUSA 1FZGA 1QLEB 1GZLA 2KZIA 4NTYA 5CBGA 1GL2D 1K9MQ 1OCOC 4I55A 2OTLV 1FXVA 2VRZA 2BCCE 1N0NA 4IHJB 1KYOH 3CEIA 4N78E 4ZKUA 1ENVA 4C7NB 5LMNO 3FXEA 3CCSV 2Y0DA 5CCGD 5AW1B 4AQRD 3AG3C 4ASUG 3ZRWA 1K3EA 1YTFB 2F93B 4LP8A 1E79H 2KP8A 4Y99C 1KB9F 4N21A 2VQFO 2I8DA 2ZR3A 3CCSP 1Q81Q 4N6JA 4DV4B 3QH9A 3A0RA 1DEBA 3OR6C 3G80A 2OTLP 1GK9A 4LFAB 3S4RA 5TISE 2Y9ZA 1R3LC 4WVZA 1BGYJ 1KBHA 1SQVJ 2W6AA 5DJTB 2Q68A 3K9SA 2CPBA 5KLVE 3H1JD 2YKOA 3Q3DA 3ZHVA 2IU0A 4H13B 1GRJA 4UVAA 4JI3O 4Z1MG 1EQ7A 1KILD 1AJPA 4PA4A 4JYBA 2B9BA 3AE3C 3GMAA 4I7ZC 2ZT9B 2YIBA 4O4HB 1B06A 4I9WA 4JYCA 2N1TC 1H2LA 2P10A 4U3FD 2M0BA 2O01J 2HJFC 1EM1A 5JVDA 4K8ZA 2RJZA 3WG7B 1JFFB 1BHAA 3AEGC 1JTHB 1FZCC 1K33A 1M56D 3O6QB 1YJ9P 3L73D 1G6UA 1VDFA 4PA6A 3CRQA 3ETQA 1UPGA 3ML0A 1SRYA 1NU1D 1OFCX 4D6TJ 1Q86W 1TUBB 2HLDG 2LGWA 3N2GB 5LMUB 4DV0O 1YBKA 3TGUG 3P8CD 5GTIE 2KUBA 4WFBV 1OHHG 2LFSA 1GK4A 4YHHO 3C1LA 2W6IG 1O9GA 2POHA 3N2KA 1SQQG 4NTWA 5CCHA 1Y6XA 1GL2A 1EXJA 5AVRB 1FJPA 4DUZO 1BCCG 3OJAB 4LH6A 1GMGA 1Y9BA 3BRTB 1QVFO 1LUWA 1WB8A 1JJOA 1ZV8A 2V1DA 5KLVJ 3L36A 1F23A 4FK5C 1OZ0A 3L72G 3SPJA 5APWA 3SFDC 5CBNA 1H8AA 3H1JJ 2WT7A 3CX5F 4O4LB 4DT0A 3CWBJ 3L71J 3TXSA 2R3CA 3L74J 4DCKA 3ZHQA 1PGOA 2P90A 5IYCO 4DJGA 4RQFA 2BCCJ 5AW5B 2IFNA 2PGDA 3AEFC 5AW0B 1Z5VA 4IHJA 2LFRA 3H1KG 1HF9A 2GA1A 5KHKA 1M1KW 4OH8B 3VYIA 1R6NA 3L73E 4EYYQ 3D8CA 3GF7A 3G6EP 4B3MB 1RHZB 3ZX6A 2IBZH 4IFMA 1Q2NA 3DSQA 1XEQA 1HGZA 3QF7A 2E42A 1BSMA 1GU4A 2IX7C 3ZIAG 3VOPA 1L2PA 2QDOA 1SQXK 2OCHA 2E74B 4DXWA 4QIWF 4KHXA 4AHCA 2LW7A 1H0TB 2WLMA 3UIAA 2QJKC 3LW5H 2P22C 2JVDA 1GW3A 4L76A 3JCUZ 3CE2A 3JAMN 1Q90D 2JP3A 3ABTA 3E86A 2EIMB 3AG1C 2DJVA 1TAEA 1NTKD 2M8RA 5H2FZ 1SQXJ 4IIJB 2OT5A 3V2PA 4Q6GA 5LGNA 2AXTH 1BGYE 1SQVE 1COWG 2JS5A 1QVGU 1DD4A 5H2FH 1M57B 3E89A 2UUCB 5GTHH 3A8TA 3CC7V 4H13D 1SQQK 3ZN0A 1CI6B 5AW8B 1NU1J 2DYRB 5LGUA 4PDRA 2ZM6O 3V5BA 3Q5SA 2OYHB 1EXIA 3HUSC 5J2TA 2LO1A 1NWQA 2NRGA 2YMYA 4GDOA 1HWTC 3B09A 3L73J 3D6ZA 2Y9YA 2YI9A 1YJNP 3JD2A 3JD0A 1S72V 2UU9O 3TGUJ 2C9LY 2YXYA 4LWSB 2EULA 2JGDA 2YICA 3ZHSA 2ZYGA 5L3DA 1NU1H 4DR5O 2XASA 4TV9A 2AXTE 5JVDB 5BXZA 2YI8A 1SLQA 1XL6A 4KHPB 3CRCA 3WU2H 1BHBA 2ZNIA 3LIDA 3HPLC 4DV5O 3I56P 1J2JB 4TT3G 1LTBC 2I1JA 3TNUB 3K03A 3RYHA 1ZP0C 3CCVP 2EIKB 1HNWB 1R6TA 3TDKA 2R9RB 5LYJB 1KKDA 5ITZA 1IBLO 3C3TA 2QG4A 3MHVA 4GIFA 1YXBA 3VMAA 4DR5B 1L4AA 2HPCB 4YXWG 3ZHTA 2NN4A 1VQ6V 3GW6A 3IC9A 3V4QA 2WSSH 5CCGC 5L3EA 4QGPA 3JYCA 1MFTA 1LTJC 4A7PA 4BRYB 1RF1C 5GTIZ 4FFBB 4I50A 2DN9A 3T1HB 4JV5O 3UM7A 1HBWA 1BT8A 1YF2A 2F1MA 1NTZK 2XZRA 3H1LG 1JR9A 2AGAA 2FYNC 2JWDA 2ZXWC 3H1HD 3JAKB 1BSNA 1W59A 3L74E 1LR1A 1VQKP 4K35A 2QTSA 3RK3B 4UV9A 1AI6A 2E75D 1VQMP 3LNNA 4KL1A 4PI0A 4LH7A 1OJHA 3CD6V 1QX8A 3U1AA 4WFHA 1AJYA 1YCIA 3MD0A 4C7RA 3B77A 1JO5A 1R3KC 2DMXA 2FYUD 4DV5B 2NZ2A 5D5PA 4R50A 4PD4H 1W0KG 5JH7B 3WU2Z 3H1ID 2QEXP 2EX3A 1VQOV 2LW1A 3B2EE 2Q6QA 2RN9A 3FYEB 5HFLA 4CH5A 4MVSA 3SSUA 3OE7G 2KSDA 5KMGB 4JYAO 5CCHD 1LTAC 1SQBG 1VP7A 3B5ND 3KPEA 1PP9G 4XDLA 2DW4A 3NFQA 1N36O 2WLLA 2WSSG 4IOIH 1XHXA 4BXLA 1K34A 2YIDA 4Z2WA 4UB8E 4O9BA 4W7YA 2P58A 1NKDA 1AROP 3IGAC 1AJNA 3BA8A 3G71V 1NZ6A 5LMUO 2W6BA 3K5MA 3DXRB 3BCCG 3SGIA 2QWPB 3T1CA 4CC5A 1S5JA 3IR9A 2WPDG 3WG7C 3EWKA 4W7ZA 3SWKA 1EN5A 3A0BE 5KAFZ 3TF5A 1SFCD 2JR8A 3RL0D 2ADQB 3W7UA 4MVZA 4WFFA 1DH3A 2Q0OC 1KQGB 4J7ZA 4X1KB 3ABLB 1EDKA 3UKMA 2KLUA 1KMIZ 4BW9A 1U57A 2P2UA 2R9AA 1M1KQ 4DR2O 1ZW0A 1TU3F 3HKEA 2UXDB 1YJWV 1Y74B 3A0BH 2QE7G 2LGQA 1G1XB 3APOA 2E76B 2IBZE 2L35A 3RK2D 2K1EA 2J5UA 1PIXA 1BDDA 2CK3G 4NXNB 4F6RA 5KLVG 3AG3B 3SYAA 2YEVA 3LNMB 1FE6A 1TUBA 1EN4A 1CPYA 3L70E 1Y67A 5CB4A 5L8RJ 2ZIOA 4UCRA 2ZINA 2Y4UA 3F5TA 4FM1A 1EZVH 4JI3B 4O4HA 5APTA 1VMGA 5AW6B 1K05A 5AW3B 2WLIB 1FJGB 2FYUK 3RW0A 4LFAO 1NTZG 5GTHE 4JI4B 4I7ZB 2R5BA 2ZT9C 2QM7A 2E5YA 4LF5O 5FL7G 1MZFA 4PV1B 4FLWA 1HDJA 3A5TA 4R8CA 1B3QA 1FJGO 4X64B 5LHHA 2P4VA 1K04A 3L37A 1FZCB 3N27A 4I9QA 2PTMA 4M3LA 1U7MA 3JD1A 2YIBD 2FY8A 1L8DA 3IFXA 1ZMEC 1THZA 3W7SA 3ZMUA 1J1DB 3L9DA 2JWAA 5H5NA 2HHHB 4DV1O 3B5NC 3CCEP 4RQEA 1AA0A 3G67A 1IFMA 4ASWA 1YIJP 3CCLV 3AE2C 1N7SD 4PA3A 3U1CA 3H1LE 2IZ1A 4ASVA 3L71H 1ZLZA 2Q9IA 4DUYO 3ZMTA 4R6ZA 1R3JC 4LF7B 1JA8A 3L74G 2WPRA 3A3YB 2ZFCA 3HKCA 2UXBB 4UB6H 4X1KA 2DWEC 2P06A 1QU7A 5KUKA 4JF7A 2Y4TA 2MKVA 1OCRB 4O4JB 1JJ2U 4I2LC 1H0TA 1ZUQA 1BCCE 1PV3A 4PDVA 1S4XA 1PP9D 4UB6Z 4X65B 3NXSA 1GH6A 1X0TA 3L73G 1ZWIC 3CX5D 1R6KA 1HP8A 3H01A 5FNVB 1N7SB 3TETA 1IC2A 1BDCA 4CC6A 2KK7A 4I55B 1SZXA 1PD3A 3QNEA 3PLNA 1NVPD 1WLEA 3EVKA 3CS5A 4TV8B 5E79H 2IYPA 1K5QA 1YITP 4UB6E 4CH3A 1G8MA 3T4DA 3SR2C 3J81N 3E8BA 3H1KH 4B7EA 2KI7B 1GM9A 3AE4C 3VMXA 1LTSC 1GU5A 4LFBO 1R73A 5AVTB 2WLJA 1MV8A 2YDEA 1M7LA 5KHJA 1KQSU 4KFMA 2P4KA 1BL8A 4TLFA 2FXPA 1SQXG 3OAKA 2HPCA 1QVGO 1W2BU 5FPOA 3X2QB 4DV2O 4JI7B 4FFKA 4JI8O 4F6EA 2QJKB 3G3ZA 3D71A 1DD3A 2FYNB 3A0HH 1S5LX 3CRRA 2F95B 4N23A 3CCEV 4B7KA 2RCVA 4F6RB 2F4VB 2SPZA 2JS3A 4FFBA 2QJPB 1IVSA 4YJ2B 4JYAB 1EZVD 2KB7P 4ZHQA 3MAQA 1YZBA 4JF3A 1QLED 4NPDA 4QMAA 5B1AC 4LF5B 3AG4C 1LTGC 3PH0A 2Q7EA 4C46A 1BE3J 3ASOC 4JI7O 2KOGA 1YJWP 4P9PA 3UQ8A 2FYUE 4DOJA 3G6BA 2A06E 3M0DA 1N7LA 1FS0G 2N74A 3PHLA 2UXDO 2B9ZA 1PGPA 5B5EE 4L73A 1YI2P 4P30A 5L3FA 3U0ZA 1EC5A 2ZYAA 2QSAA 5KLIC 1JVMA 4OVNF 2EJRA 1L1FA 4BRYA 3KCXA 5CMUA 1Q82W 1SQBD 1IXBA 5B3SB 3SWYA 1WA8B 2Q1KA 3DTUB 1XHZA 1NTZH 3GWKC 1MZ9A 1XTGB 1GK6A 1BE3E 5ITZB 2FYUH 4FZ1A 3BFRA 2KQXA 1XMOB 2HYNA 1SFCA 3AG2B 1FAFA 1VF5C 2BSKB 5EBWC 2OTKE 5A2QN 1OW8A 5AVYB 3HKBB 1OX3A 1A02F 3CCUV 2FKXA 3ZBHA 5L3BA 1PP9J 4RWUA 1JPXA 4R7CA 3E7KA 1IBKB 1PL4A 4UVCA 4WBNA 2KB1A 4I50B 1WPXA 1SQPK 1OCZB 2FXOA 3AE8C 2ZJSE 5BVZA 4YTPC 2P67A 4PD4F 4PJ0Z 2YO3A 3H32A 2FFDA 1FDMA 1SQBH 5KX5A 5B5EZ 1BE3H 4GOEA 1E1RG 2V4DA 2XKMA 2H89C 2WLKA 4GCZA 1HNXB 1URFA 4X88A 3ZDMA 3L70H 1NGMB 5C8YB 4KT0J 3A7OA 2DOSA 2GTAA 1FJKA 3SDLA 4LLHA 1URQC 4FPPA 3M9HA 4CPGA 4HYOA 1ZR4A 3FX7A 3CP1A 1AI5A 2BEZF 1MKMA 3KZIE 2PF4E 5KKZC 2EIJC 2JIZG 2OYIB 1M1JB 2AXTZ 1GTWA 1Y76A 3LDDA 3BPZA 3CCJV 3AE1C 3KXDA 1N8RQ 4GUNA 4E2LA 1D5AA 1Y74A 1R5SA 2EILB 3MZWB 1M57D 4PA7A 1XNQB 1JY2P 3NMDA 2JJ1G 4LNUA 1VL2A 1V54B 3IAYA 4CS3A 1VQ7V 4H33A 2Q7HA 4X1IB 1LWUC 3JASB 3ABVC 1AILA 1MZEA 1KP3A 1N36B 2R32A 1N2DC 1Y8AA 4IFFA 3V2RA 1L0NH 4I6MC 2IM9A 4JAUA 1AP6A 1XNRO 1S0VA 1QLEC 2ZE5A 1PGJA 1K8AW 2W6JG 2QIWA 2E75B 4Z1VA 4AUWA 4HNAA 2R5DA 1RE3A 1CEZA 4B3SO 4PJ0H 1B04A 4NYKA 4G2KA 5B1NA 3BVOA 4N78D 2WLNA 1DK1A 1F4NA 4PD4D 3BASA 1HR0O 5CJ4A 3BY6A 3H1IH 2XNDG 3CD6P 2Y48A 3RT3C 4L75A 5KA6A 1USEA 2GUZA 2HFED 2ZQMA 3L4FA 1NKNA 4YXDC 2ZDIA 1KILC 2ZYDA 1KB9I 2UUBB 1HW7A 1VQLV 2Z5UA 1KYOI 4JZGA 3BCCE 2WVRA 2LQTA 2IJHA 5H6QA 4UUJC 5CB4B 3OMIB 1IZ3A 1WAZA 5L3CA 3LSSA 5J2UB 2M5AB 1S72P 1QHTA 2A06G 2O3JA 2ZCEA 5CBHA 3ABLC 4JYYA 1Y66A 3IC7A 3N4XA 2HODA 2XNDH 2WTYA 3JSNA 1NVOA 3H1LD 1MOFA 2HEPA 4W4KA 4IFDK 1XBLA 3KKYA 1IZNB 3H32B 1XQ8A 5EBLC 3J7AU 1RY3A 1N4CA 1WJZA 1Y4MA 2YC0A 1ZAUA 1RF0C 1Q86Q 2ATKC 4J11A 5DN6G 2UUBO 1OXZA 2WSFJ 3P8MC 3CCJP 2IH1C 3OM3B 1GL2C 1PP9E 4TOIA 2KNCB 1FXHA 2A7WA 1IFNA 2Z3YA 2RNBA 5DEDA 5GONB 2BSKA 3CX5E 1S9KD 3ETEA 2HKOA 1SESA 4HZ3A 3AE5C 4O2BA 3H1IG 3M9QA 1NJIW 1K7DA 2A0LA 4DR3B 2OYIA 1NHLA 1RE3C 4WF9V 3MGNA 2NPSB 4R4MA 3VTPC 2C9NY 2FTKA 5FNVA 3L70J 1AQ5A 3RL0B 1U97A 4LF8B 2IBZG 4MVOA 5JCOA 4Z1MH 3TCUA 2K88A 3WUVA 3H1JH 2X6CA 1EDJA 3CX5H 3RBXA 1PPJH 4JI5B 4JI8B 1GM7A 3FWNA 1N86A 4NPFX 4DR3O 2EJ7A 3GLMA 4Y99B 4PV1C 4PD4I 3CRMA 3SJAC 1IBLB 3K06A 1SQXH 1XI1A 1IFDA 2XHBA 1Q7YW 3HKDB 4OPHA 4H0LB 2ZT9D 4Q20A 2B1GA 4EFBA 1N8RW 2XOKG 3K79A 5EFWB 2OIGA 2QWNB 4YXWH 5AVZB 2QRXA 3BHPA 4TWKA 3VQXA 2Q7GA 1PPJE 1WP7A 4TQDA 4AILC 1NTKH 3AG4B 5EYPB 1P7BA 3OEHG 1JY2O 1L0LD 2W27A 3O6QA 1Q7YQ 4MTGA 1ZL8A 5IY5C 1KYOE 4XDKA 2H88C 4JGSA 4PELA 3CCMP 5JJEB 2CAZC 3ASNC 1YJNV 1S5HC 4GKKB 3FB6C 4MTXA 4X62B 1LT1A 3PP5A 3AK1A 1JCDA 4JTCB 2E5LB 3RK3D 1H88A 2W6JH 4MW3A 1QL2A 1SQBE 1KB9E 4YY3O 1BE3G 1NAFA 3ZEDA 4X62O 4D7SA 3OW2O 4JPZB 2XUMA 2X0LA 1X79B 2Q67A 5J9PC 3CPWO 4X20B 1K73W 4DK0A 3F7YC 4YIOA 5KLVH 1Q43A 2K9YA 4YJ2A 1Q6HA 2E43A 5B66E 4U3JA 1GN4A 3KZIZ 1FBMA 1V9PA 5AG2A 4FM0A 3H6PA 4C7UA 2AZ2A 2P1JA 1XMQO 3AG2C 1QNMA 2G38A 1SERA 1AVMA 4DV1B 2RQ6A 5KJ7A 3I5DA 2ZR2A 4YIPA 3KZIH 1KFNA 4B08A 1MG1A 5EZYA 3RGBA 2OYHC 2BTQA 1NU1K 2A79B 1YHQP 1E1QG 4JASA 2Y0PA 3H1HG 1KB9H 1WPBA 1LP1A 2BCCD 4CS4A 5IJ0B 1T8ZA 1H2MA 1ZX3A 2N1TA 1KD1Q 2QKCA 4J9ZB 1KYOF 4HB1A 2O1JA 4KXRA 1WA8A 2R72A 3K3WA 4MVQA 4WBNB 2QA4V 4JQ0D 4CZZA 3K0DA 4D6TE 2PAJA 2RMZA 3MUDA 1AB3A 1J95A 3L70G 5APUA 1LT9C 3U10A 2H43A 1XOUA 1J1EC 1WT6A 3Q5PA 3H1HH 1SFCB 5GONA 1IO4A 4JI0O 4DYLA 2YKQA 2LP7A 1LTIC 4LF6O 2GTSA 2NPSD 2W8ZA 3RK3E 2YSUB 3WUTA 2PRRA 2UXXA 3QG5A 3D6YA 4JI1O 1LTJB 4RJTA 4WCEV 1SA0A 1S2EA 5CCHC 3AEIA 4JBZA 2XAGA 4U3FE 2DWDC 1RF1B 2AZ0A 3WUUA 4FLYA 2RKLA 1SQVK 4YJ3B 5KHIA 3BCCH 1SQXD 4B3MO 5EYPA 1S3JA 2QE7H 1PL5A 2M6YA 3OD4A 2KKWA 1JMBA 1DTOA 1K8AQ 1V55B 2ITDC 3HKBA 2E75C 2FB5A 1M90W 2IPPA 1AV1A 1EN6A 2M3BA 3OGIB 5LMNB 1M57C 1L0LH 2C0XA 1TGOA 1SP4A 2OTJV 3LUTB 2IH3C 1CW5A 3HUSB 4LWSA 1VQNP 2AXCA 1JQ0A 3I5CA 3RYCB 2CGOA 3J80N 1JMKC 3ZRWB 1F7YA 2YUAA 2JJLA 1OCZC 2YXHA 3FD9A 1H8EG 2N9BA 1NI8A 4NXNO 3OA7A 4GKJB 1OIPA 1VQ5V 3RYFA 4MVRA 2CK3H 3CXHH 2OGUA 1M90Q 3S9OA 4YHHB 2IU3A 2X7RB 3B40A 1VQNV 4HNAB 3BEHA 3Q5RA 4DV0B 2QJYB 3FYIB 3ZHUA 1NQTA 5H2FE 1SQGA 4EEQA 1XTCC 2FFDC 4XDJA 1M8OB 1MSWD 1BCCJ 3T97A 2GUZB 2EIJB 4LNUB 2WITA 1N73C 4X64O 4O4IA 4UXNA 3SJCC 2GV9A 3AEDC 4H44C 2EILC 5IJ9B 1HJ0A 2W0FC 4MVMA 1S9KE 3VQWA 4KUMA 4QE7A 3RFRA 2Q73A 2YO2A 1GTOA 4WFGA 1GW4A 1TVKA 1HNZB 1FDOA 1I7FA 1YEWA 1NTKJ 3H1IJ 3JARB 1U7JA 4UCUA 4W4LA 3ZN1A 2IBZI 3L75D 4DW1A 2EBOA 3GHGA 2NPSC 4X89A 3QO8A 4DR7O 2FYUJ 4B3RB 1SA0B 2E76C 1T2KC 4J7JA 2IBZD 1NTKE 4NVPA 4L87A 4E4EA 3JAWB 3SYOA 4FLXA 1NT2B 1E5WA 5CHXA 3F5HA 1LGHB 1H2SB 3RYIA 3LDCA 3FWLA 3FB5C 1GAXA 5CBFA 2L91A 3ABUA 4EIJA 3P32A 4I1LA 4O4LA 1L0ND 1BZKA 3FB7C 3CCQV 1DEEG 1SQBJ 1OVVA 4LF4B 5APSA 3L75H 1XNQO 4W80A 2E3CA 1WNSA 2ZNJA 4B3RO 2EZOA 1LNQA 2YIUC 5IE9A 4U3FG 2QVAA 1QL1A 3DXRA 5KA5A 1AQTA 4TSFG 4GX5A 1PPJD 1URQA 3OTFA 1N0JA 5EK0A 2Q0AA 3HB3B 1YHQV 2QTOA 4IYHA 3E22A 3KHUA 1N73A 4J80A 1L4AD 1XREA 1AR1B 2VWKA 2ZE8A 3HTKA 3B4SA 4DK1A 3CCRV 1KC8Q 3EQ2A 1FDIA 2LKMA 1R1BA 3D36A 5C8YA 3RYFB 3SPCA 1OCCC 4DV7B 3P3PA 1ZL8B 4CH4A 2Z5HA 3M0DC 5TISH 1QGKB 2VS0A 3NR7A 3OEEG 2WSEJ 4IL6H 1PNLA 2IW5A 2N05A 2QWQB 1F51A 4DRXB 1EZVI 3M91A 3CXCU 3S3XA 4GX1A 4MTOA 4FLZA 2NPSA 4DR1O 3SYCA 3H1LJ 3CRAA 3FB8C 4DR4B 2X6AA 1VQ4V 5B66Z 2ODMA 2V7QJ 4UCOA 1Q6UA 2UXBO 1EZJA 1L0LK 1JY3P 5JCOC 3H1HE 3B8NA 4GKKO 1CXZB 1YI2V 1OW6A 1I94O 3S3WA 4AQYB 4GT1A 5AVUB 4OX9B 3MTUE 1K92A 1IXMA 5KHGA 4IL6E 4CS2A 3QTCA 1R8EA 3L73H 2Y69C 3GHGC 3IJ4A 2WQYC 1ORQC 1YTZT 1G4YB 1YIJV 2UU9B 2XAJA 3W7TA 1NYHA 2XU6A 3HD7D 2AEFA 1R3IC 1VEWA 1M4UA 4PV1D 1N7SC 4CBCA 5JQGB 2G3AA 1YJ9V 5B1BB 4DR6O 5B1OA 3OT7A 4MT8A 5E1AC 4TUYA 1BQ0A 2YNYA 4HKZH 5BU5A 4AI8A 4TV9B 4B3TO 1LT9B 3H1HJ 3T1YB 2LR2A 1VQKV 1I08A 4J42A 2QR4A 4QPJA 3RL0g 1EDIA 3JATB 3UO3A 2OWOA 4XE5B 1TA8A 2BASA 1WN7A 3RYHB 2K37A 1O9HA 3JSVC 3B8MA 2KIKA 1RPOA 1A32A 1OW7A 4FLTA 2BTQB 3CMEV 2BTOA 1DF5A 1Q3EA 5K5GB 5IY5B 3OMAB 3BCCJ 2QEXV 2Z5IA 3GG2A 5LOVB 2JGUA 5EBMC 1S1CX 4OGQD 3R66A 4JZ2A 1Q82Q 4X65O 4DZOA 2Q6AA 1B6QA 1RM1B 1FZBA 1LTJA 3K5OA 3QO7A 2R70A 1PL0A 4JPRA 3CX5I 2J59M 1J1DC 1NR1A 2F23A 2JJ2G 3EXAA 3E22B 2I1KA 3CXHE 4WY4B 1V55C 1EZVE 1SQPE 1KN7A 5IYDO 4MS2A 2CTWA 1KD1W 3E8GA 4ZBMA 3HTKB 1KUQA 1W2EA 4LF9O 3K59A 2KXPB 1FFXA 3K08A 2CH7B 4JI5O 3A2AA 4X1YB 4O4JA 2YXQB 3IFMA 2OIEA 4MTFA 2A45I 3OTOO 1L0LG 1KORA 4DRXA 3E83A 3ZJZA 1HUCA
chains in the Genus database with same CATH topology
2QJYC 2WSCJ 1EXIA 5M1BA 4H13C 1ZRTE 3IAOA 2WSEJ 4OGQC 3EWKA 4GDOA 1VF5C 3R4YA 1OW8A 2K9YA 3T97B 3AEBC 2E76D 3D6ZA 3S9OA 2BEQD 2MKVA 1YQ4C 1PV3A 2FBWC 4H44B 1KQGB 2V7QJ 3AE8C 3IN6A 3Q5RA 2D2CD 4YTPC 2WSFJ 1EXJA 3G9RA 1DIPA 3C8VA 1OW6A 1KMIZ 1ZP0C 4IL6X 1U57A 1Y9BA 2H89C 2IDBA 1TU3F 4H44D 1NGMB 1KILE 4KT0J 3AE5C 1R8EA 3AEDC 3FGAD 4H44C 1HJ0A 4Y28J 2WQYC 2E76B 1NYHA 3SFDC 3AE4C 1WMKA 1GMJA 2QSIA 1YQ3C 2J5UA 4PV1D 4R4MA 1KQFB 1PIXA 2BEZF 2G3AA 1MKMA 1FDOA 5KKZC 3GF3A 3AECC 4TT3H 4Z1MH 3Q5PA 2OQQA 3AE1C 3AEFC 2QJPC 2D2CB 3LW5J 1HF9A 2FXPA 4RKUJ 1RQVA 2FYNC 3RL0g 2E76C 2YMKA 3RK3E 1VF5D 5L8RJ 1VL2A 3D6YA 3AE6C 2D2CC 3GF7A 3GLMA 3D71A 1DD3A 1ZOYC 2E75D 3ABVC 4PV1C 1S5LX 1OW7A 1AJYA 1K05A 1UIXA 2ZT9D 4H0LB 3AE7C 1KTMA 2E74B 4U7JA 2NZ2A 2QIWA 3D70A 1S1CX 4OGQD 2E75B 4I7ZB 2ZT9C 1PL5A 2QJKC 1RQUA 2JO1A 2E74C 4PV1B 4XFJA 3Q2YA 3Q1MA 3SFEC 2E75C 1Q90D 2JP3A 1K04A 3AE9C 2YIUC 3O6QA 3H25A 3Q3DA 4H0LC 2H88C 4H13B 5KLIC 2G8YA 4YXDC 3AE3C 3AEEC 3AEAC 3GMAA 4R4LA 4I7ZC 1ZMEC 1OMIA 2ZT9B 2WPVB 1JB0J 2P10A 4H0LD 1DD4A 2O01J 1IK7A 4H13D 4OGQB 1VF5B 3AEGC 3B71A 3AE2C 1FDIA 1KORA 2E74D 3Q5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJY C;  2WSC J;  4RKU J;  2FYN C;  4PV1 B;  1ZRT E;  2WSE J;  1Q90 D;  4KT0 J;  5L8R J;  2YIU C;  2K9Y A;  4Y28 J;  4H13 B;  5KLI C;  2E76 B;  1S5L X;  2QSI A;  2ZT9 B;  2WPV B;  4H44 B;  1JB0 J;  4H0L B;  5KKZ C;  2O01 J;  2E74 B;  2WSF J;  2QIW A;  2E75 B;  4I7Z B;  4OGQ B;  1VF5 B;  2QJP C;  2QJK C;  3C8V A;  2D2C B;  3LW5 J;  4IL6 X; 
#chains in the Genus database with same CATH topology
 3T1H O;  1IK9 A;  3RK2 C;  4P9O A;  1FXK C;  3HR0 A;  5KLI B;  3KCY A;  2HG5 D;  1L0N G;  2LJ2 A;  4DV6 B;  3SPH A;  1P84 F;  3M99 B;  1OCR C;  3MHH C;  1N33 O;  1N33 B;  1RH5 B;  3E1I A;  3R4Y A;  1SVF A;  3ABM B;  1QR8 A;  4NKG B;  4WY4 D;  1FPO A;  3W68 A;  3E8F A;  1SQP H;  3CCM V;  1IX9 A;  3APQ A;  2GBO A;  1K73 Q;  3HUS A;  2HFE C;  3WB1 A;  5BR8 O;  5IDJ A;  1S5L Z;  1FOS E;  1BGY H;  1SQV H;  2WLH A;  1PPJ G;  2OCC C;  1X59 A;  2QJ1 A;  1BE3 D;  3L70 D;  4GKJ O;  3CCU P;  1DIP A;  3EFG A;  1PNM A;  3SYQ A;  4NR1 A;  1H2K A;  4RO2 A;  3C8V A;  1HTL C;  1J1E B;  1ZN5 A;  2HJD A;  3JC2 2;  1JMM A;  2OTJ P;  3RWR D;  4FVM A;  4UCV A;  1HR0 B;  1SFC C;  2WMM A;  5AW2 B;  2ETN A;  3E8H A;  5C93 A;  1UJW B;  1VQ8 P;  1KKC A;  5C39 A;  3CWB D;  1G2C B;  5LGT A;  3L72 H;  1VQ5 P;  4DR1 B;  3RVY A;  2DW3 A;  4YJ3 A;  3C3S A;  1KQL A;  1P4R A;  1LT9 A;  4L8J A;  4X66 O;  3MIW A;  4JI0 B;  2JRI A;  1SQP D;  3CME P;  4JV5 B;  4D6T G;  4ZNC A;  4TT3 H;  2F4V O;  2KS1 B;  2OQQ A;  2C2A A;  2MK3 A;  1K9M W;  4EOT A;  2ZVN B;  5KJ7 D;  2D2C B;  3LW5 J;  3L75 E;  4GKG A;  2IJI A;  1X9V A;  1T5E A;  4XBF A;  3WB0 A;  5IJ9 A;  1H38 A;  1H2N A;  3DGE A;  2PP6 A;  2V4H A;  3HE4 A;  2D3O W;  2KLV A;  2ZAE B;  1LWU A;  5APV A;  1ZOY C;  4K3A A;  3HKE B;  4NPE A;  3CXH I;  2OYI C;  1M1J C;  1DLB A;  4DR2 B;  2ZE6 A;  1MAB G;  1AR5 A;  1NTM G;  1EBO A;  2L5G B;  5IYZ B;  3ASO B;  1NOH A;  4TUY B;  2R9I A;  1LUV A;  1BSH A;  2VQE O;  1HNZ O;  1KTM A;  4LFB B;  5KUM A;  5IWA B;  1KQS O;  1WB7 A;  4RES B;  1ZXG A;  4HJG H;  1V54 C;  2F66 C;  4ICG A;  1IJD B;  3W7W A;  1S77 D;  4X20 A;  2R3S A;  3JAW A;  5CA3 A;  2FKW B;  2P6J A;  2YKP A;  4EKW A;  1SQQ D;  3L74 H;  5LA6 A;  2DYS B;  1PGQ A;  1MA1 A;  1BCC D;  4O2A B;  1HWY A;  3JAR A;  4LF8 O;  1SF9 A;  1U96 A;  2H3O A;  2QGN A;  4JAV A;  5EZY B;  4ZIB A;  2QKA A;  3CWB E;  1OMI A;  4WB4 A;  4WBA A;  3ZMS A;  2PZS A;  3ZHR A;  2WA4 A;  4BAY A;  4H0L D;  3N7N A;  3P7K A;  3VMY A;  5BMV B;  1VF5 B;  3I55 V;  3T1Y O;  3B71 A;  2IZ0 A;  2P5O A;  3CB2 A;  2E74 D;  2N1T B;  1L4A B;  1VQ7 P;  2QJY C;  3GVM A;  4LBE C;  2M7W A;  4LCU C;  3RYI B;  1HNW O;  3CL3 D;  5E79 Z;  3C90 A;  1VQ8 V;  1VQL P;  1GN2 A;  2FFD B;  2A3Q A;  2MW2 B;  3I55 P;  5KX5 B;  2Z0A A;  1QQC A;  3MHS C;  1I0H A;  1KIL B;  3B5N A;  5IT9 N;  3CI9 A;  3QVN A;  1UII A;  3PTZ A;  3AEB C;  3TJT A;  1EZV G;  2E76 D;  4U3F J;  4UV8 A;  1N73 B;  3RN4 A;  3QWO C;  1FFX B;  1XMQ B;  4BWN A;  4X1Y A;  4H44 B;  5LL6 Y;  1QEX A;  2FBW C;  2KSJ A;  4UB8 H;  3EFF K;  3IN6 A;  1EDL A;  3AG7 A;  5LXT B;  3T4Z A;  3JAK A;  3CCR P;  4K0K B;  1NS1 A;  1NTZ E;  4WFE A;  1AI4 A;  4DV6 O;  3PJS K;  1RPR A;  3O65 A;  5GTH Z;  3THO A;  2ARH A;  2E5T A;  2IDB A;  4HH2 A;  4PA9 A;  1Y76 B;  3PN1 A;  2O01 H;  4FLU A;  1J5E O;  3F5W C;  4KP4 A;  1FU1 A;  1Q5O A;  2HP8 A;  4H37 A;  3SWF A;  4NXM B;  1IFI A;  4MN4 C;  1SQQ E;  5KAI E;  4FJC C;  5FPR A;  1RE4 C;  5EC1 C;  1T6A A;  1L0N J;  3L75 J;  4JTA B;  1D2D A;  1JUN A;  3TYY A;  5DJU B;  4G27 B;  1NTK G;  1I5X A;  2DQ3 A;  1SQQ J;  5KMG A;  3A2F A;  1AJQ A;  2CDY A;  4PI2 A;  4LFC O;  3HE4 B;  3TXQ A;  1LWU B;  1PNK A;  4EI2 A;  1JEK A;  4A5U B;  1G1J A;  2AEM A;  1OVR A;  1PZQ A;  3BAB A;  4BIU A;  1P84 D;  4QPK A;  2ZXX A;  2UXN A;  1FOS F;  3AE6 C;  1NH4 A;  3OGC C;  5LP6 B;  5CMZ A;  2IFM A;  4J41 A;  4DR7 B;  2FXM A;  3H1K J;  4B86 A;  2RN0 A;  5KAI H;  4X9Q A;  3OAA G;  3OFN G;  1P84 I;  3W67 A;  3M7M X;  4I0X B;  3USS A;  3RYC A;  5CA1 A;  4DUZ B;  4JI2 O;  3F7V C;  3MP7 B;  4I5S A;  4RUE A;  3D70 A;  4ZKP A;  1VQ6 P;  5BZB A;  4IYI A;  4HYT B;  1NTK K;  5AW4 B;  3H1L H;  4BW5 A;  2E74 C;  1KZU B;  4RO0 A;  5HFM A;  1JCH A;  2CGN A;  3SFE C;  2V7Q H;  4LC1 A;  1SKV A;  4H0L C;  4GOD A;  1VF6 C;  2OAR A;  4DV3 O;  5BMV A;  1BMF G;  2Y0I A;  1FZA A;  5LHI A;  1NU1 E;  2ZM6 B;  2Q7C A;  3AG1 B;  3WU2 E;  3ZMZ A;  2H94 A;  4EB6 B;  2JEE A;  1MNG A;  5JJJ B;  1VPC A;  2KSE A;  1US6 A;  1VQM V;  1D5N A;  2A45 G;  2GM4 A;  5L3G A;  4O4I B;  2VWJ A;  1E79 G;  5LA6 B;  1FS0 E;  1NJI Q;  1EFR G;  2ZIM A;  1T3U A;  2KNC A;  4JTD B;  2CTQ A;  3L72 E;  2P7J A;  1FXK B;  2ZXE B;  3CCL P;  5LXT A;  1FYJ A;  1P84 E;  1AP5 A;  3DC6 A;  2CH7 A;  1SQP J;  1VQP V;  3GHG B;  4BIZ A;  5LHG A;  1K5S A;  1IUR A;  4G28 B;  4TQF A;  1SQF A;  2FYZ A;  4OXS A;  1OV9 A;  4ZKI A;  3F89 A;  2OCC B;  1GM8 A;  2B89 A;  2ZDI C;  1KIL A;  1DGS A;  3L71 E;  1NBM G;  2QWO B;  1LTT C;  4ZI7 A;  3C9I A;  4HBN A;  1KP2 A;  4Y28 J;  2RMK B;  3L72 J;  3G71 P;  4P2Z A;  2ZVO B;  3FXD A;  1K4D C;  4NB5 A;  5LOV A;  2WAM A;  3E2E A;  2PGG A;  1ZTE A;  3CWB G;  4J10 A;  2PYJ A;  3K5N A;  4PD4 E;  1RP3 B;  1NVP B;  1FZC A;  1QBZ A;  1RQV A;  3ZMV A;  1ZSP A;  1QVF U;  1NTM J;  4D6T D;  2GHY A;  2K9J B;  3K5L A;  5CN0 A;  3K58 A;  1MFZ A;  3G4S V;  5B5E H;  4L74 A;  2D2C C;  1FD9 A;  5E79 E;  1I5Y A;  3SPG A;  2B87 B;  2ZXW B;  3GWO A;  3RVZ A;  1H89 A;  3BCC D;  3H9V A;  2BOB C;  5LBQ A;  1H2G A;  4OX9 O;  3SYP A;  3CWB H;  2DQ0 A;  3W7X A;  3K04 A;  1I94 B;  3L72 D;  3RK3 C;  2EIM C;  4ABM A;  4WY4 C;  3O9O A;  2CTP A;  1RSO A;  3CYO A;  4JI6 O;  5K1X A;  2WPQ A;  1KFM A;  1NTM D;  1OWA A;  1VQ9 V;  2PFX A;  5AVQ B;  1G2C A;  2JO1 A;  4IL6 Z;  1Q81 W;  3HKC B;  3V4W A;  2Q3I A;  3ASN B;  3HE5 B;  4D7T A;  3SJB C;  3CJH A;  2J58 A;  3CMA V;  3H25 A;  3BAA A;  1UFI A;  2DYR C;  1X4T A;  5IYZ A;  3OR7 C;  3AK3 A;  5JWP A;  1GN3 A;  2DYS C;  3AEE C;  3CMA P;  3JAS A;  4KHP O;  1AVO A;  4C7N A;  1M56 B;  4MVU A;  4N3Y B;  1P7G A;  2O57 A;  2Q4P A;  4FMT A;  2HHH O;  3M0A A;  4TV8 A;  1IBM O;  2MJZ A;  3ZRX A;  1RE4 A;  5EC2 C;  1L0L J;  1FXK A;  2WSC J;  5M1B A;  2ITC C;  4O2A A;  1ZRT E;  4FIP C;  1Q8I A;  2BOC C;  1NTM H;  2X6B A;  3STL C;  3UCS C;  3BVH A;  1FZF A;  2JDI G;  3ETG A;  3I56 V;  1SQQ H;  3L75 G;  3JSL A;  2WWW A;  1IBK O;  2OYO A;  3ZRS A;  1Z56 A;  2UUC O;  1L0N K;  3O8Z A;  1PFI A;  3LDE A;  2D2C D;  4JI6 B;  3V6I A;  4PDM A;  2XV5 A;  2W90 A;  3JAT A;  4IL6 X;  3OW2 U;  1GD2 E;  5AW7 B;  1HH0 A;  2EZP A;  3M9B A;  1NTZ D;  2ILM A;  2JEX A;  5J2U A;  2M5A A;  1QCE A;  4ZOL A;  1Z2G A;  2XAQ A;  3JD3 A;  4JAA A;  4ZHQ B;  1Y47 A;  2YXL A;  1WMK A;  2QSI A;  5BY1 A;  1KV4 A;  1KQF B;  3N2G A;  2KYV A;  2DE0 X;  3AEC C;  1RF1 A;  1TUE B;  1S5L E;  3K0G A;  4WFA V;  4U7O A;  2JK5 C;  2W83 C;  2K9P A;  3BRV B;  4PJ0 E;  3VQV A;  1KYO D;  4RKU J;  2GUS A;  2YMK A;  3U11 A;  4LF4 O;  2Q69 A;  5H9C A;  3H1I E;  3L35 A;  2YS8 A;  3HD7 B;  1VQP P;  3HRN A;  3ABK C;  3KG2 A;  5CA0 B;  4QNH B;  1XL4 A;  2PI4 A;  1NO4 A;  4D6T H;  2JDI H;  2KZJ A;  2HVJ C;  3RGU A;  4QJF B;  4GLX A;  1GDT A;  5F2V O;  3GB7 C;  2P7T C;  4HAM A;  3UT5 A;  1F4M A;  1DF4 A;  3AE7 C;  1OVU A;  3NTN A;  3EHB B;  1QR9 A;  3K57 A;  1W0J G;  4U7J A;  3ZRV A;  3G6E V;  1S5L H;  1T3J A;  3WFV A;  1S76 D;  3VQY A;  1SET A;  1M9N A;  2XTA A;  2K9J A;  3BA9 A;  5IYB O;  4IT5 A;  3P30 A;  1JY3 N;  2HLO A;  1YTF D;  2C0W A;  2VQE B;  5AVS B;  4EFE A;  3JCU E;  1X8Y A;  1YSC A;  1L4A C;  1JOC A;  2XNX A;  4OWF A;  3CCQ P;  4I0X A;  1NR7 A;  2WLI A;  4GYC B;  1P84 H;  3VOU A;  2G8Y A;  1HVV A;  3AEA C;  4ZMD A;  1BCC H;  1L0N E;  3A0H Z;  1PKX A;  1SS1 A;  4DR4 O;  4WWI A;  1IK7 A;  2ZD9 A;  4OGQ B;  3HKD A;  2QA4 P;  5AVV B;  3M06 A;  2YIU B;  1ZLL A;  1IFJ A;  3KDP B;  4X8A A;  4H13 C;  1SQP G;  3FX0 A;  1GKF A;  4DR6 B;  2CTR A;  1RF0 A;  1JY3 O;  3BAT A;  2QKS A;  3JCU H;  3CHX A;  4FLV A;  3T97 B;  5CA1 B;  3V2Q A;  1T2K D;  2H8P C;  4J9Y B;  5K1P A;  2OYQ A;  3CC4 V;  4CH6 A;  3H1K E;  2LXB A;  1IFP A;  2UXC O;  2K3R A;  5KHH A;  4YPC A;  2PI5 A;  2EIN B;  1N32 O;  2WSE H;  4JI4 O;  1H8H G;  1HNX O;  1XDC A;  3JAL B;  4UCT A;  1TVK B;  4UB8 Z;  1PV0 A;  2VRS A;  1URQ D;  1YTZ I;  4GZR B;  4H44 D;  5GW7 A;  1SC5 B;  5LP6 A;  1KC8 W;  1N32 B;  1CI6 A;  3CC4 P;  1D7M A;  5AVX B;  4F4L A;  2UXC B;  3CC2 P;  2GUV A;  2CPS A;  4JI1 B;  3A0H E;  3L71 D;  3Q4H A;  2UWJ E;  4EB6 A;  1SQX E;  3PRJ A;  1FKA O;  1N7S A;  5APQ A;  1HJB A;  5LP6 C;  2NNU A;  2Q5Z A;  1OCO B;  4PHZ A;  1PP9 H;  3FAV B;  4IGG A;  3OTO B;  3K5B A;  3T2M A;  2ZE7 A;  1G1I A;  1WRG A;  2A06 H;  3MUD C;  1YDX A;  1BGY G;  1SQV G;  2A9H A;  2LXC B;  4DV2 B;  4U7N A;  4DO2 A;  1VF5 D;  4NXM O;  1LP1 B;  1JTH A;  1X22 A;  1FC2 C;  4PDL A;  1VF6 A;  1M5I A;  5B1B C;  5IJ0 A;  4JI2 B;  1M93 A;  4FZ0 A;  3FFQ A;  1BS3 A;  2O01 N;  1OZH A;  2H7H A;  3JCZ A;  1NH2 B;  2PY5 A;  2PYL A;  3H1K D;  3KYQ A;  4LGD E;  5KAI Z;  3S1K A;  2QM8 A;  4BWA A;  1GO3 F;  1NTZ J;  3H1J G;  3JD4 A;  5DM6 V;  1A02 J;  5KLV D;  3B5N B;  5BR8 B;  4LF6 B;  4GOF A;  2RH0 A;  3HD7 A;  4KJM A;  1AI7 A;  1XNR B;  1NTM E;  3LIE A;  2IJK A;  5B66 H;  2M3E A;  2GSM B;  5DEC A;  5CCG A;  1WP8 A;  2XAH A;  2IYO A;  4R4L A;  2AHY A;  3E35 A;  4RUF A;  4RAI A;  2Y0E A;  2AW9 A;  2ITA A;  3II6 A;  1RM1 C;  1OCC B;  1YYC A;  1MUU A;  3ETD A;  1JM0 A;  2E5L O;  1HGV A;  5FLX N;  1VQ9 P;  3D3I A;  3K9A A;  2IJJ A;  4J7K A;  1NU1 G;  1M56 C;  3R65 A;  5B3S C;  4ZI7 B;  3CC2 V;  1VF7 A;  3CXH D;  5TJH A;  3CLQ A;  2HR3 A;  2WSC H;  1AFO A;  1XIL A;  4I4T A;  3ZS8 C;  4UVB A;  3P8C E;  3U59 A;  4K0K O;  2RDC A;  2N1T D;  1ZR2 A;  2PUS A;  1ZRT D;  2ZKO A;  3VBB A;  2O1K A;  1RSO B;  3ZCC A;  2N04 A;  2B88 A;  4DW0 A;  3KQG A;  4B3S B;  4IIJ A;  3RK2 B;  5IWA O;  2AHZ A;  5JQG A;  4QE9 A;  3TK1 A;  4DV3 B;  3ABM C;  2AEJ A;  2Y69 B;  3Q4H B;  5KJ7 C;  2H8P D;  3QO5 A;  3OUF A;  2OYH A;  2Z4E A;  3WB2 A;  2QM4 A;  2NLJ C;  3VMZ A;  2WZ7 A;  2Q5U A;  1BQZ A;  2BCC G;  2XAF A;  1JY2 N;  3X2Q C;  5JJN B;  5GTI H;  5KAF H;  1FZE A;  1GMJ A;  3FAV A;  1DX7 A;  1QLN A;  4DUY B;  5KTB A;  2EIK C;  2YIA A;  2V7Q G;  3GF3 A;  1JNM A;  3P3N A;  1JCC A;  3SJQ C;  1NAY A;  3LSU A;  2QJP C;  3HE5 A;  4X66 B;  3UO2 A;  1USD A;  2FYU G;  2CE4 A;  1Z5W A;  1R5L A;  5APX A;  2NR5 A;  5B1A B;  1NTM K;  1RFY A;  4MSW C;  2KG7 A;  2WA3 A;  5LYJ A;  3VN0 A;  2A06 D;  2B5U A;  5EIB C;  1PM9 A;  5J2T B;  4LFC B;  1LJ2 A;  5KAF E;  2GDS A;  1K97 A;  1M1J A;  4K8X A;  2QWR B;  1N34 O;  3RBZ A;  3L71 G;  1CSB A;  1MMM A;  2K1A A;  4WY4 A;  3WMM 0;  3LSQ A;  3ITK A;  1P49 A;  1AR4 A;  1Q6I A;  3CC7 P;  4XA4 A;  1JOY A;  1MSD A;  1XUQ A;  5AW9 B;  2HG5 C;  2UUA O;  2UUA B;  4ZOL B;  1VAR A;  1RQU A;  3CPW U;  4FM2 A;  2YXR B;  4X1I A;  4DV4 O;  5KLV K;  4U3J B;  4XFJ A;  1YVW A;  2R44 A;  3V2N A;  1IDS A;  1NH2 D;  3SPI A;  2YEV B;  4GX0 A;  4LR3 A;  1AVY A;  3Q1M A;  3Q2Y A;  1J5E B;  1W2B O;  3TGU D;  3M8A A;  3AE9 C;  1N34 B;  3CXH F;  3R2P A;  1BGY D;  2ADP A;  1SQV D;  3UT5 B;  4U3F H;  1SS3 A;  5BU8 B;  2HVK C;  2FML A;  5AVW B;  2WPV B;  3VP8 A;  1JB0 J;  1IBM B;  2JGD B;  2XT9 A;  2N9Y B;  1JX9 A;  3CCV V;  2WSF H;  3B8E B;  1SZT A;  3TSI A;  1FFT B;  3E1R A;  3CSX A;  1UIX A;  3STZ C;  4UCS A;  5JH7 A;  2XDJ A;  4AQY O;  3AK2 A;  4UFZ A;  4LF7 O;  1VQ4 P;  2WPS A;  3OMN B;  3IAO A;  3TNU A;  4OGQ C;  2L6L A;  1W5C E;  1JFF A;  2JEU A;  2Q8V A;  2A45 H;  3ICX A;  5CJ0 A;  4YY3 B;  1FAV A;  4EDF A;  2BEQ D;  3TGU H;  3D36 C;  1L0L E;  1YQ4 C;  2Q3E A;  5APY A;  4NTX A;  3D3Q A;  1URQ B;  2W0X A;  2Y0C A;  2B1I A;  2BE3 A;  2VQF B;  5H6R A;  3G9R A;  4GX2 A;  2FL4 A;  2HOD B;  1ROP A;  1XMO O;  3A0B Z;  3FKS G;  2EIN C;  4I4T B;  3H1J E;  5KKZ B;  1CP9 A;  4DV7 O;  2KS1 A;  2B87 A;  3N2K B;  4OPA A;  5CA0 A;  4BIO A;  2Q9L A;  1GL2 B;  1KIL E;  1KB9 D;  1KU9 A;  4AYC A;  2CUG A;  1NKZ B;  3FGA D;  2BCC H;  1VIB A;  4MW8 A;  5TIS Z;  3IF4 A;  5CBO A;  1SQB K;  3TGU E;  3G4S P;  4LF9 B;  5A9G A;  5EIB D;  1YQ3 C;  3HD7 C;  2F43 G;  1K4C C;  4BR6 A;  3ABK B;  3JAL A;  3MDS A;  4B3T B;  1VQO P;  5D5Q A;  2JKV A;  1CZQ A;  2WLL B;  1KEC A;  1YIT V;  3BRC A;  1GN6 A;  2WT7 B;  3VP9 A;  2KG7 B;  3L74 D;  3DC5 A;  3CJH B;  4O2B B;  3RL0 C;  3OUS A;  1FZG A;  1QLE B;  1GZL A;  2KZI A;  4NTY A;  5CBG A;  1GL2 D;  1K9M Q;  1OCO C;  4I55 A;  2OTL V;  1FXV A;  2VRZ A;  2BCC E;  1N0N A;  4IHJ B;  1KYO H;  3CEI A;  4N78 E;  4ZKU A;  1ENV A;  4C7N B;  5LMN O;  3FXE A;  3CCS V;  2Y0D A;  5CCG D;  5AW1 B;  4AQR D;  3AG3 C;  4ASU G;  3ZRW A;  1K3E A;  1YTF B;  2F93 B;  4LP8 A;  1E79 H;  2KP8 A;  4Y99 C;  1KB9 F;  4N21 A;  2VQF O;  2I8D A;  2ZR3 A;  3CCS P;  1Q81 Q;  4N6J A;  4DV4 B;  3QH9 A;  3A0R A;  1DEB A;  3OR6 C;  3G80 A;  2OTL P;  1GK9 A;  4LFA B;  3S4R A;  5TIS E;  2Y9Z A;  1R3L C;  4WVZ A;  1BGY J;  1KBH A;  1SQV J;  2W6A A;  5DJT B;  2Q68 A;  3K9S A;  2CPB A;  5KLV E;  3H1J D;  2YKO A;  3Q3D A;  3ZHV A;  2IU0 A;  4H13 B;  1GRJ A;  4UVA A;  4JI3 O;  4Z1M G;  1EQ7 A;  1KIL D;  1AJP A;  4PA4 A;  4JYB A;  2B9B A;  3AE3 C;  3GMA A;  4I7Z C;  2ZT9 B;  2YIB A;  4O4H B;  1B06 A;  4I9W A;  4JYC A;  2N1T C;  1H2L A;  2P10 A;  4U3F D;  2M0B A;  2O01 J;  2HJF C;  1EM1 A;  5JVD A;  4K8Z A;  2RJZ A;  3WG7 B;  1JFF B;  1BHA A;  3AEG C;  1JTH B;  1FZC C;  1K33 A;  1M56 D;  3O6Q B;  1YJ9 P;  3L73 D;  1G6U A;  1VDF A;  4PA6 A;  3CRQ A;  3ETQ A;  1UPG A;  3ML0 A;  1SRY A;  1NU1 D;  1OFC X;  4D6T J;  1Q86 W;  1TUB B;  2HLD G;  2LGW A;  3N2G B;  5LMU B;  4DV0 O;  1YBK A;  3TGU G;  3P8C D;  5GTI E;  2KUB A;  4WFB V;  1OHH G;  2LFS A;  1GK4 A;  4YHH O;  3C1L A;  2W6I G;  1O9G A;  2POH A;  3N2K A;  1SQQ G;  4NTW A;  5CCH A;  1Y6X A;  1GL2 A;  1EXJ A;  5AVR B;  1FJP A;  4DUZ O;  1BCC G;  3OJA B;  4LH6 A;  1GMG A;  1Y9B A;  3BRT B;  1QVF O;  1LUW A;  1WB8 A;  1JJO A;  1ZV8 A;  2V1D A;  5KLV J;  3L36 A;  1F23 A;  4FK5 C;  1OZ0 A;  3L72 G;  3SPJ A;  5APW A;  3SFD C;  5CBN A;  1H8A A;  3H1J J;  2WT7 A;  3CX5 F;  4O4L B;  4DT0 A;  3CWB J;  3L71 J;  3TXS A;  2R3C A;  3L74 J;  4DCK A;  3ZHQ A;  1PGO A;  2P90 A;  5IYC O;  4DJG A;  4RQF A;  2BCC J;  5AW5 B;  2IFN A;  2PGD A;  3AEF C;  5AW0 B;  1Z5V A;  4IHJ A;  2LFR A;  3H1K G;  1HF9 A;  2GA1 A;  5KHK A;  1M1K W;  4OH8 B;  3VYI A;  1R6N A;  3L73 E;  4EYY Q;  3D8C A;  3GF7 A;  3G6E P;  4B3M B;  1RHZ B;  3ZX6 A;  2IBZ H;  4IFM A;  1Q2N A;  3DSQ A;  1XEQ A;  1HGZ A;  3QF7 A;  2E42 A;  1BSM A;  1GU4 A;  2IX7 C;  3ZIA G;  3VOP A;  1L2P A;  2QDO A;  1SQX K;  2OCH A;  2E74 B;  4DXW A;  4QIW F;  4KHX A;  4AHC A;  2LW7 A;  1H0T B;  2WLM A;  3UIA A;  2QJK C;  3LW5 H;  2P22 C;  2JVD A;  1GW3 A;  4L76 A;  3JCU Z;  3CE2 A;  3JAM N;  1Q90 D;  2JP3 A;  3ABT A;  3E86 A;  2EIM B;  3AG1 C;  2DJV A;  1TAE A;  1NTK D;  2M8R A;  5H2F Z;  1SQX J;  4IIJ B;  2OT5 A;  3V2P A;  4Q6G A;  5LGN A;  2AXT H;  1BGY E;  1SQV E;  1COW G;  2JS5 A;  1QVG U;  1DD4 A;  5H2F H;  1M57 B;  3E89 A;  2UUC B;  5GTH H;  3A8T A;  3CC7 V;  4H13 D;  1SQQ K;  3ZN0 A;  1CI6 B;  5AW8 B;  1NU1 J;  2DYR B;  5LGU A;  4PDR A;  2ZM6 O;  3V5B A;  3Q5S A;  2OYH B;  1EXI A;  3HUS C;  5J2T A;  2LO1 A;  1NWQ A;  2NRG A;  2YMY A;  4GDO A;  1HWT C;  3B09 A;  3L73 J;  3D6Z A;  2Y9Y A;  2YI9 A;  1YJN P;  3JD2 A;  3JD0 A;  1S72 V;  2UU9 O;  3TGU J;  2C9L Y;  2YXY A;  4LWS B;  2EUL A;  2JGD A;  2YIC A;  3ZHS A;  2ZYG A;  5L3D A;  1NU1 H;  4DR5 O;  2XAS A;  4TV9 A;  2AXT E;  5JVD B;  5BXZ A;  2YI8 A;  1SLQ A;  1XL6 A;  4KHP B;  3CRC A;  3WU2 H;  1BHB A;  2ZNI A;  3LID A;  3HPL C;  4DV5 O;  3I56 P;  1J2J B;  4TT3 G;  1LTB C;  2I1J A;  3TNU B;  3K03 A;  3RYH A;  1ZP0 C;  3CCV P;  2EIK B;  1HNW B;  1R6T A;  3TDK A;  2R9R B;  5LYJ B;  1KKD A;  5ITZ A;  1IBL O;  3C3T A;  2QG4 A;  3MHV A;  4GIF A;  1YXB A;  3VMA A;  4DR5 B;  1L4A A;  2HPC B;  4YXW G;  3ZHT A;  2NN4 A;  1VQ6 V;  3GW6 A;  3IC9 A;  3V4Q A;  2WSS H;  5CCG C;  5L3E A;  4QGP A;  3JYC A;  1MFT A;  1LTJ C;  4A7P A;  4BRY B;  1RF1 C;  5GTI Z;  4FFB B;  4I50 A;  2DN9 A;  3T1H B;  4JV5 O;  3UM7 A;  1HBW A;  1BT8 A;  1YF2 A;  2F1M A;  1NTZ K;  2XZR A;  3H1L G;  1JR9 A;  2AGA A;  2FYN C;  2JWD A;  2ZXW C;  3H1H D;  3JAK B;  1BSN A;  1W59 A;  3L74 E;  1LR1 A;  1VQK P;  4K35 A;  2QTS A;  3RK3 B;  4UV9 A;  1AI6 A;  2E75 D;  1VQM P;  3LNN A;  4KL1 A;  4PI0 A;  4LH7 A;  1OJH A;  3CD6 V;  1QX8 A;  3U1A A;  4WFH A;  1AJY A;  1YCI A;  3MD0 A;  4C7R A;  3B77 A;  1JO5 A;  1R3K C;  2DMX A;  2FYU D;  4DV5 B;  2NZ2 A;  5D5P A;  4R50 A;  4PD4 H;  1W0K G;  5JH7 B;  3WU2 Z;  3H1I D;  2QEX P;  2EX3 A;  1VQO V;  2LW1 A;  3B2E E;  2Q6Q A;  2RN9 A;  3FYE B;  5HFL A;  4CH5 A;  4MVS A;  3SSU A;  3OE7 G;  2KSD A;  5KMG B;  4JYA O;  5CCH D;  1LTA C;  1SQB G;  1VP7 A;  3B5N D;  3KPE A;  1PP9 G;  4XDL A;  2DW4 A;  3NFQ A;  1N36 O;  2WLL A;  2WSS G;  4IOI H;  1XHX A;  4BXL A;  1K34 A;  2YID A;  4Z2W A;  4UB8 E;  4O9B A;  4W7Y A;  2P58 A;  1NKD A;  1ARO P;  3IGA C;  1AJN A;  3BA8 A;  3G71 V;  1NZ6 A;  5LMU O;  2W6B A;  3K5M A;  3DXR B;  3BCC G;  3SGI A;  2QWP B;  3T1C A;  4CC5 A;  1S5J A;  3IR9 A;  2WPD G;  3WG7 C;  3EWK A;  4W7Z A;  3SWK A;  1EN5 A;  3A0B E;  5KAF Z;  3TF5 A;  1SFC D;  2JR8 A;  3RL0 D;  2ADQ B;  3W7U A;  4MVZ A;  4WFF A;  1DH3 A;  2Q0O C;  1KQG B;  4J7Z A;  4X1K B;  3ABL B;  1EDK A;  3UKM A;  2KLU A;  1KMI Z;  4BW9 A;  1U57 A;  2P2U A;  2R9A A;  1M1K Q;  4DR2 O;  1ZW0 A;  1TU3 F;  3HKE A;  2UXD B;  1YJW V;  1Y74 B;  3A0B H;  2QE7 G;  2LGQ A;  1G1X B;  3APO A;  2E76 B;  2IBZ E;  2L35 A;  3RK2 D;  2K1E A;  2J5U A;  1PIX A;  1BDD A;  2CK3 G;  4NXN B;  4F6R A;  5KLV G;  3AG3 B;  3SYA A;  2YEV A;  3LNM B;  1FE6 A;  1TUB A;  1EN4 A;  1CPY A;  3L70 E;  1Y67 A;  5CB4 A;  5L8R J;  2ZIO A;  4UCR A;  2ZIN A;  2Y4U A;  3F5T A;  4FM1 A;  1EZV H;  4JI3 B;  4O4H A;  5APT A;  1VMG A;  5AW6 B;  1K05 A;  5AW3 B;  2WLI B;  1FJG B;  2FYU K;  3RW0 A;  4LFA O;  1NTZ G;  5GTH E;  4JI4 B;  4I7Z B;  2R5B A;  2ZT9 C;  2QM7 A;  2E5Y A;  4LF5 O;  5FL7 G;  1MZF A;  4PV1 B;  4FLW A;  1HDJ A;  3A5T A;  4R8C A;  1B3Q A;  1FJG O;  4X64 B;  5LHH A;  2P4V A;  1K04 A;  3L37 A;  1FZC B;  3N27 A;  4I9Q A;  2PTM A;  4M3L A;  1U7M A;  3JD1 A;  2YIB D;  2FY8 A;  1L8D A;  3IFX A;  1ZME C;  1THZ A;  3W7S A;  3ZMU A;  1J1D B;  3L9D A;  2JWA A;  5H5N A;  2HHH B;  4DV1 O;  3B5N C;  3CCE P;  4RQE A;  1AA0 A;  3G67 A;  1IFM A;  4ASW A;  1YIJ P;  3CCL V;  3AE2 C;  1N7S D;  4PA3 A;  3U1C A;  3H1L E;  2IZ1 A;  4ASV A;  3L71 H;  1ZLZ A;  2Q9I A;  4DUY O;  3ZMT A;  4R6Z A;  1R3J C;  4LF7 B;  1JA8 A;  3L74 G;  2WPR A;  3A3Y B;  2ZFC A;  3HKC A;  2UXB B;  4UB6 H;  4X1K A;  2DWE C;  2P06 A;  1QU7 A;  5KUK A;  4JF7 A;  2Y4T A;  2MKV A;  1OCR B;  4O4J B;  1JJ2 U;  4I2L C;  1H0T A;  1ZUQ A;  1BCC E;  1PV3 A;  4PDV A;  1S4X A;  1PP9 D;  4UB6 Z;  4X65 B;  3NXS A;  1GH6 A;  1X0T A;  3L73 G;  1ZWI C;  3CX5 D;  1R6K A;  1HP8 A;  3H01 A;  5FNV B;  1N7S B;  3TET A;  1IC2 A;  1BDC A;  4CC6 A;  2KK7 A;  4I55 B;  1SZX A;  1PD3 A;  3QNE A;  3PLN A;  1NVP D;  1WLE A;  3EVK A;  3CS5 A;  4TV8 B;  5E79 H;  2IYP A;  1K5Q A;  1YIT P;  4UB6 E;  4CH3 A;  1G8M A;  3T4D A;  3SR2 C;  3J81 N;  3E8B A;  3H1K H;  4B7E A;  2KI7 B;  1GM9 A;  3AE4 C;  3VMX A;  1LTS C;  1GU5 A;  4LFB O;  1R73 A;  5AVT B;  2WLJ A;  1MV8 A;  2YDE A;  1M7L A;  5KHJ A;  1KQS U;  4KFM A;  2P4K A;  1BL8 A;  4TLF A;  2FXP A;  1SQX G;  3OAK A;  2HPC A;  1QVG O;  1W2B U;  5FPO A;  3X2Q B;  4DV2 O;  4JI7 B;  4FFK A;  4JI8 O;  4F6E A;  2QJK B;  3G3Z A;  3D71 A;  1DD3 A;  2FYN B;  3A0H H;  1S5L X;  3CRR A;  2F95 B;  4N23 A;  3CCE V;  4B7K A;  2RCV A;  4F6R B;  2F4V B;  2SPZ A;  2JS3 A;  4FFB A;  2QJP B;  1IVS A;  4YJ2 B;  4JYA B;  1EZV D;  2KB7 P;  4ZHQ A;  3MAQ A;  1YZB A;  4JF3 A;  1QLE D;  4NPD A;  4QMA A;  5B1A C;  4LF5 B;  3AG4 C;  1LTG C;  3PH0 A;  2Q7E A;  4C46 A;  1BE3 J;  3ASO C;  4JI7 O;  2KOG A;  1YJW P;  4P9P A;  3UQ8 A;  2FYU E;  4DOJ A;  3G6B A;  2A06 E;  3M0D A;  1N7L A;  1FS0 G;  2N74 A;  3PHL A;  2UXD O;  2B9Z A;  1PGP A;  5B5E E;  4L73 A;  1YI2 P;  4P30 A;  5L3F A;  3U0Z A;  1EC5 A;  2ZYA A;  2QSA A;  5KLI C;  1JVM A;  4OVN F;  2EJR A;  1L1F A;  4BRY A;  3KCX A;  5CMU A;  1Q82 W;  1SQB D;  1IXB A;  5B3S B;  3SWY A;  1WA8 B;  2Q1K A;  3DTU B;  1XHZ A;  1NTZ H;  3GWK C;  1MZ9 A;  1XTG B;  1GK6 A;  1BE3 E;  5ITZ B;  2FYU H;  4FZ1 A;  3BFR A;  2KQX A;  1XMO B;  2HYN A;  1SFC A;  3AG2 B;  1FAF A;  1VF5 C;  2BSK B;  5EBW C;  2OTK E;  5A2Q N;  1OW8 A;  5AVY B;  3HKB B;  1OX3 A;  1A02 F;  3CCU V;  2FKX A;  3ZBH A;  5L3B A;  1PP9 J;  4RWU A;  1JPX A;  4R7C A;  3E7K A;  1IBK B;  1PL4 A;  4UVC A;  4WBN A;  2KB1 A;  4I50 B;  1WPX A;  1SQP K;  1OCZ B;  2FXO A;  3AE8 C;  2ZJS E;  5BVZ A;  4YTP C;  2P67 A;  4PD4 F;  4PJ0 Z;  2YO3 A;  3H32 A;  2FFD A;  1FDM A;  1SQB H;  5KX5 A;  5B5E Z;  1BE3 H;  4GOE A;  1E1R G;  2V4D A;  2XKM A;  2H89 C;  2WLK A;  4GCZ A;  1HNX B;  1URF A;  4X88 A;  3ZDM A;  3L70 H;  1NGM B;  5C8Y B;  4KT0 J;  3A7O A;  2DOS A;  2GTA A;  1FJK A;  3SDL A;  4LLH A;  1URQ C;  4FPP A;  3M9H A;  4CPG A;  4HYO A;  1ZR4 A;  3FX7 A;  3CP1 A;  1AI5 A;  2BEZ F;  1MKM A;  3KZI E;  2PF4 E;  5KKZ C;  2EIJ C;  2JIZ G;  2OYI B;  1M1J B;  2AXT Z;  1GTW A;  1Y76 A;  3LDD A;  3BPZ A;  3CCJ V;  3AE1 C;  3KXD A;  1N8R Q;  4GUN A;  4E2L A;  1D5A A;  1Y74 A;  1R5S A;  2EIL B;  3MZW B;  1M57 D;  4PA7 A;  1XNQ B;  1JY2 P;  3NMD A;  2JJ1 G;  4LNU A;  1VL2 A;  1V54 B;  3IAY A;  4CS3 A;  1VQ7 V;  4H33 A;  2Q7H A;  4X1I B;  1LWU C;  3JAS B;  3ABV C;  1AIL A;  1MZE A;  1KP3 A;  1N36 B;  2R32 A;  1N2D C;  1Y8A A;  4IFF A;  3V2R A;  1L0N H;  4I6M C;  2IM9 A;  4JAU A;  1AP6 A;  1XNR O;  1S0V A;  1QLE C;  2ZE5 A;  1PGJ A;  1K8A W;  2W6J G;  2QIW A;  2E75 B;  4Z1V A;  4AUW A;  4HNA A;  2R5D A;  1RE3 A;  1CEZ A;  4B3S O;  4PJ0 H;  1B04 A;  4NYK A;  4G2K A;  5B1N A;  3BVO A;  4N78 D;  2WLN A;  1DK1 A;  1F4N A;  4PD4 D;  3BAS A;  1HR0 O;  5CJ4 A;  3BY6 A;  3H1I H;  2XND G;  3CD6 P;  2Y48 A;  3RT3 C;  4L75 A;  5KA6 A;  1USE A;  2GUZ A;  2HFE D;  2ZQM A;  3L4F A;  1NKN A;  4YXD C;  2ZDI A;  1KIL C;  2ZYD A;  1KB9 I;  2UUB B;  1HW7 A;  1VQL V;  2Z5U A;  1KYO I;  4JZG A;  3BCC E;  2WVR A;  2LQT A;  2IJH A;  5H6Q A;  4UUJ C;  5CB4 B;  3OMI B;  1IZ3 A;  1WAZ A;  5L3C A;  3LSS A;  5J2U B;  2M5A B;  1S72 P;  1QHT A;  2A06 G;  2O3J A;  2ZCE A;  5CBH A;  3ABL C;  4JYY A;  1Y66 A;  3IC7 A;  3N4X A;  2HOD A;  2XND H;  2WTY A;  3JSN A;  1NVO A;  3H1L D;  1MOF A;  2HEP A;  4W4K A;  4IFD K;  1XBL A;  3KKY A;  1IZN B;  3H32 B;  1XQ8 A;  5EBL C;  3J7A U;  1RY3 A;  1N4C A;  1WJZ A;  1Y4M A;  2YC0 A;  1ZAU A;  1RF0 C;  1Q86 Q;  2ATK C;  4J11 A;  5DN6 G;  2UUB O;  1OXZ A;  2WSF J;  3P8M C;  3CCJ P;  2IH1 C;  3OM3 B;  1GL2 C;  1PP9 E;  4TOI A;  2KNC B;  1FXH A;  2A7W A;  1IFN A;  2Z3Y A;  2RNB A;  5DED A;  5GON B;  2BSK A;  3CX5 E;  1S9K D;  3ETE A;  2HKO A;  1SES A;  4HZ3 A;  3AE5 C;  4O2B A;  3H1I G;  3M9Q A;  1NJI W;  1K7D A;  2A0L A;  4DR3 B;  2OYI A;  1NHL A;  1RE3 C;  4WF9 V;  3MGN A;  2NPS B;  4R4M A;  3VTP C;  2C9N Y;  2FTK A;  5FNV A;  3L70 J;  1AQ5 A;  3RL0 B;  1U97 A;  4LF8 B;  2IBZ G;  4MVO A;  5JCO A;  4Z1M H;  3TCU A;  2K88 A;  3WUV A;  3H1J H;  2X6C A;  1EDJ A;  3CX5 H;  3RBX A;  1PPJ H;  4JI5 B;  4JI8 B;  1GM7 A;  3FWN A;  1N86 A;  4NPF X;  4DR3 O;  2EJ7 A;  3GLM A;  4Y99 B;  4PV1 C;  4PD4 I;  3CRM A;  3SJA C;  1IBL B;  3K06 A;  1SQX H;  1XI1 A;  1IFD A;  2XHB A;  1Q7Y W;  3HKD B;  4OPH A;  4H0L B;  2ZT9 D;  4Q20 A;  2B1G A;  4EFB A;  1N8R W;  2XOK G;  3K79 A;  5EFW B;  2OIG A;  2QWN B;  4YXW H;  5AVZ B;  2QRX A;  3BHP A;  4TWK A;  3VQX A;  2Q7G A;  1PPJ E;  1WP7 A;  4TQD A;  4AIL C;  1NTK H;  3AG4 B;  5EYP B;  1P7B A;  3OEH G;  1JY2 O;  1L0L D;  2W27 A;  3O6Q A;  1Q7Y Q;  4MTG A;  1ZL8 A;  5IY5 C;  1KYO E;  4XDK A;  2H88 C;  4JGS A;  4PEL A;  3CCM P;  5JJE B;  2CAZ C;  3ASN C;  1YJN V;  1S5H C;  4GKK B;  3FB6 C;  4MTX A;  4X62 B;  1LT1 A;  3PP5 A;  3AK1 A;  1JCD A;  4JTC B;  2E5L B;  3RK3 D;  1H88 A;  2W6J H;  4MW3 A;  1QL2 A;  1SQB E;  1KB9 E;  4YY3 O;  1BE3 G;  1NAF A;  3ZED A;  4X62 O;  4D7S A;  3OW2 O;  4JPZ B;  2XUM A;  2X0L A;  1X79 B;  2Q67 A;  5J9P C;  3CPW O;  4X20 B;  1K73 W;  4DK0 A;  3F7Y C;  4YIO A;  5KLV H;  1Q43 A;  2K9Y A;  4YJ2 A;  1Q6H A;  2E43 A;  5B66 E;  4U3J A;  1GN4 A;  3KZI Z;  1FBM A;  1V9P A;  5AG2 A;  4FM0 A;  3H6P A;  4C7U A;  2AZ2 A;  2P1J A;  1XMQ O;  3AG2 C;  1QNM A;  2G38 A;  1SER A;  1AVM A;  4DV1 B;  2RQ6 A;  5KJ7 A;  3I5D A;  2ZR2 A;  4YIP A;  3KZI H;  1KFN A;  4B08 A;  1MG1 A;  5EZY A;  3RGB A;  2OYH C;  2BTQ A;  1NU1 K;  2A79 B;  1YHQ P;  1E1Q G;  4JAS A;  2Y0P A;  3H1H G;  1KB9 H;  1WPB A;  1LP1 A;  2BCC D;  4CS4 A;  5IJ0 B;  1T8Z A;  1H2M A;  1ZX3 A;  2N1T A;  1KD1 Q;  2QKC A;  4J9Z B;  1KYO F;  4HB1 A;  2O1J A;  4KXR A;  1WA8 A;  2R72 A;  3K3W A;  4MVQ A;  4WBN B;  2QA4 V;  4JQ0 D;  4CZZ A;  3K0D A;  4D6T E;  2PAJ A;  2RMZ A;  3MUD A;  1AB3 A;  1J95 A;  3L70 G;  5APU A;  1LT9 C;  3U10 A;  2H43 A;  1XOU A;  1J1E C;  1WT6 A;  3Q5P A;  3H1H H;  1SFC B;  5GON A;  1IO4 A;  4JI0 O;  4DYL A;  2YKQ A;  2LP7 A;  1LTI C;  4LF6 O;  2GTS A;  2NPS D;  2W8Z A;  3RK3 E;  2YSU B;  3WUT A;  2PRR A;  2UXX A;  3QG5 A;  3D6Y A;  4JI1 O;  1LTJ B;  4RJT A;  4WCE V;  1SA0 A;  1S2E A;  5CCH C;  3AEI A;  4JBZ A;  2XAG A;  4U3F E;  2DWD C;  1RF1 B;  2AZ0 A;  3WUU A;  4FLY A;  2RKL A;  1SQV K;  4YJ3 B;  5KHI A;  3BCC H;  1SQX D;  4B3M O;  5EYP A;  1S3J A;  2QE7 H;  1PL5 A;  2M6Y A;  3OD4 A;  2KKW A;  1JMB A;  1DTO A;  1K8A Q;  1V55 B;  2ITD C;  3HKB A;  2E75 C;  2FB5 A;  1M90 W;  2IPP A;  1AV1 A;  1EN6 A;  2M3B A;  3OGI B;  5LMN B;  1M57 C;  1L0L H;  2C0X A;  1TGO A;  1SP4 A;  2OTJ V;  3LUT B;  2IH3 C;  1CW5 A;  3HUS B;  4LWS A;  1VQN P;  2AXC A;  1JQ0 A;  3I5C A;  3RYC B;  2CGO A;  3J80 N;  1JMK C;  3ZRW B;  1F7Y A;  2YUA A;  2JJL A;  1OCZ C;  2YXH A;  3FD9 A;  1H8E G;  2N9B A;  1NI8 A;  4NXN O;  3OA7 A;  4GKJ B;  1OIP A;  1VQ5 V;  3RYF A;  4MVR A;  2CK3 H;  3CXH H;  2OGU A;  1M90 Q;  3S9O A;  4YHH B;  2IU3 A;  2X7R B;  3B40 A;  1VQN V;  4HNA B;  3BEH A;  3Q5R A;  4DV0 B;  2QJY B;  3FYI B;  3ZHU A;  1NQT A;  5H2F E;  1SQG A;  4EEQ A;  1XTC C;  2FFD C;  4XDJ A;  1M8O B;  1MSW D;  1BCC J;  3T97 A;  2GUZ B;  2EIJ B;  4LNU B;  2WIT A;  1N73 C;  4X64 O;  4O4I A;  4UXN A;  3SJC C;  2GV9 A;  3AED C;  4H44 C;  2EIL C;  5IJ9 B;  1HJ0 A;  2W0F C;  4MVM A;  1S9K E;  3VQW A;  4KUM A;  4QE7 A;  3RFR A;  2Q73 A;  2YO2 A;  1GTO A;  4WFG A;  1GW4 A;  1TVK A;  1HNZ B;  1FDO A;  1I7F A;  1YEW A;  1NTK J;  3H1I J;  3JAR B;  1U7J A;  4UCU A;  4W4L A;  3ZN1 A;  2IBZ I;  3L75 D;  4DW1 A;  2EBO A;  3GHG A;  2NPS C;  4X89 A;  3QO8 A;  4DR7 O;  2FYU J;  4B3R B;  1SA0 B;  2E76 C;  1T2K C;  4J7J A;  2IBZ D;  1NTK E;  4NVP A;  4L87 A;  4E4E A;  3JAW B;  3SYO A;  4FLX A;  1NT2 B;  1E5W A;  5CHX A;  3F5H A;  1LGH B;  1H2S B;  3RYI A;  3LDC A;  3FWL A;  3FB5 C;  1GAX A;  5CBF A;  2L91 A;  3ABU A;  4EIJ A;  3P32 A;  4I1L A;  4O4L A;  1L0N D;  1BZK A;  3FB7 C;  3CCQ V;  1DEE G;  1SQB J;  1OVV A;  4LF4 B;  5APS A;  3L75 H;  1XNQ O;  4W80 A;  2E3C A;  1WNS A;  2ZNJ A;  4B3R O;  2EZO A;  1LNQ A;  2YIU C;  5IE9 A;  4U3F G;  2QVA A;  1QL1 A;  3DXR A;  5KA5 A;  1AQT A;  4TSF G;  4GX5 A;  1PPJ D;  1URQ A;  3OTF A;  1N0J A;  5EK0 A;  2Q0A A;  3HB3 B;  1YHQ V;  2QTO A;  4IYH A;  3E22 A;  3KHU A;  1N73 A;  4J80 A;  1L4A D;  1XRE A;  1AR1 B;  2VWK A;  2ZE8 A;  3HTK A;  3B4S A;  4DK1 A;  3CCR V;  1KC8 Q;  3EQ2 A;  1FDI A;  2LKM A;  1R1B A;  3D36 A;  5C8Y A;  3RYF B;  3SPC A;  1OCC C;  4DV7 B;  3P3P A;  1ZL8 B;  4CH4 A;  2Z5H A;  3M0D C;  5TIS H;  1QGK B;  2VS0 A;  3NR7 A;  3OEE G;  2WSE J;  4IL6 H;  1PNL A;  2IW5 A;  2N05 A;  2QWQ B;  1F51 A;  4DRX B;  1EZV I;  3M91 A;  3CXC U;  3S3X A;  4GX1 A;  4MTO A;  4FLZ A;  2NPS A;  4DR1 O;  3SYC A;  3H1L J;  3CRA A;  3FB8 C;  4DR4 B;  2X6A A;  1VQ4 V;  5B66 Z;  2ODM A;  2V7Q J;  4UCO A;  1Q6U A;  2UXB O;  1EZJ A;  1L0L K;  1JY3 P;  5JCO C;  3H1H E;  3B8N A;  4GKK O;  1CXZ B;  1YI2 V;  1OW6 A;  1I94 O;  3S3W A;  4AQY B;  4GT1 A;  5AVU B;  4OX9 B;  3MTU E;  1K92 A;  1IXM A;  5KHG A;  4IL6 E;  4CS2 A;  3QTC A;  1R8E A;  3L73 H;  2Y69 C;  3GHG C;  3IJ4 A;  2WQY C;  1ORQ C;  1YTZ T;  1G4Y B;  1YIJ V;  2UU9 B;  2XAJ A;  3W7T A;  1NYH A;  2XU6 A;  3HD7 D;  2AEF A;  1R3I C;  1VEW A;  1M4U A;  4PV1 D;  1N7S C;  4CBC A;  5JQG B;  2G3A A;  1YJ9 V;  5B1B B;  4DR6 O;  5B1O A;  3OT7 A;  4MT8 A;  5E1A C;  4TUY A;  1BQ0 A;  2YNY A;  4HKZ H;  5BU5 A;  4AI8 A;  4TV9 B;  4B3T O;  1LT9 B;  3H1H J;  3T1Y B;  2LR2 A;  1VQK V;  1I08 A;  4J42 A;  2QR4 A;  4QPJ A;  3RL0 g;  1EDI A;  3JAT B;  3UO3 A;  2OWO A;  4XE5 B;  1TA8 A;  2BAS A;  1WN7 A;  3RYH B;  2K37 A;  1O9H A;  3JSV C;  3B8M A;  2KIK A;  1RPO A;  1A32 A;  1OW7 A;  4FLT A;  2BTQ B;  3CME V;  2BTO A;  1DF5 A;  1Q3E A;  5K5G B;  5IY5 B;  3OMA B;  3BCC J;  2QEX V;  2Z5I A;  3GG2 A;  5LOV B;  2JGU A;  5EBM C;  1S1C X;  4OGQ D;  3R66 A;  4JZ2 A;  1Q82 Q;  4X65 O;  4DZO A;  2Q6A A;  1B6Q A;  1RM1 B;  1FZB A;  1LTJ A;  3K5O A;  3QO7 A;  2R70 A;  1PL0 A;  4JPR A;  3CX5 I;  2J59 M;  1J1D C;  1NR1 A;  2F23 A;  2JJ2 G;  3EXA A;  3E22 B;  2I1K A;  3CXH E;  4WY4 B;  1V55 C;  1EZV E;  1SQP E;  1KN7 A;  5IYD O;  4MS2 A;  2CTW A;  1KD1 W;  3E8G A;  4ZBM A;  3HTK B;  1KUQ A;  1W2E A;  4LF9 O;  3K59 A;  2KXP B;  1FFX A;  3K08 A;  2CH7 B;  4JI5 O;  3A2A A;  4X1Y B;  4O4J A;  2YXQ B;  3IFM A;  2OIE A;  4MTF A;  2A45 I;  3OTO O;  1L0L G;  1KOR A;  4DRX A;  3E83 A;  3ZJZ A;  1HUC A; 
#chains in the Genus database with same CATH homology
 2QJY C;  2WSC J;  1EXI A;  5M1B A;  4H13 C;  1ZRT E;  3IAO A;  2WSE J;  4OGQ C;  3EWK A;  4GDO A;  1VF5 C;  3R4Y A;  1OW8 A;  2K9Y A;  3T97 B;  3AEB C;  2E76 D;  3D6Z A;  3S9O A;  2BEQ D;  2MKV A;  1YQ4 C;  1PV3 A;  2FBW C;  4H44 B;  1KQG B;  2V7Q J;  3AE8 C;  3IN6 A;  3Q5R A;  2D2C D;  4YTP C;  2WSF J;  1EXJ A;  3G9R A;  1DIP A;  3C8V A;  1OW6 A;  1KMI Z;  1ZP0 C;  4IL6 X;  1U57 A;  1Y9B A;  2H89 C;  2IDB A;  1TU3 F;  4H44 D;  1NGM B;  1KIL E;  4KT0 J;  3AE5 C;  1R8E A;  3AED C;  3FGA D;  4H44 C;  1HJ0 A;  4Y28 J;  2WQY C;  2E76 B;  1NYH A;  3SFD C;  3AE4 C;  1WMK A;  1GMJ A;  2QSI A;  1YQ3 C;  2J5U A;  4PV1 D;  4R4M A;  1KQF B;  1PIX A;  2BEZ F;  2G3A A;  1MKM A;  1FDO A;  5KKZ C;  3GF3 A;  3AEC C;  4TT3 H;  4Z1M H;  3Q5P A;  2OQQ A;  3AE1 C;  3AEF C;  2QJP C;  2D2C B;  3LW5 J;  1HF9 A;  2FXP A;  4RKU J;  1RQV A;  2FYN C;  3RL0 g;  2E76 C;  2YMK A;  3RK3 E;  1VF5 D;  5L8R J;  1VL2 A;  3D6Y A;  3AE6 C;  2D2C C;  3GF7 A;  3GLM A;  3D71 A;  1DD3 A;  1ZOY C;  2E75 D;  3ABV C;  4PV1 C;  1S5L X;  1OW7 A;  1AJY A;  1K05 A;  1UIX A;  2ZT9 D;  4H0L B;  3AE7 C;  1KTM A;  2E74 B;  4U7J A;  2NZ2 A;  2QIW A;  3D70 A;  1S1C X;  4OGQ D;  2E75 B;  4I7Z B;  2ZT9 C;  1PL5 A;  2QJK C;  1RQU A;  2JO1 A;  2E74 C;  4PV1 B;  4XFJ A;  3Q2Y A;  3Q1M A;  3SFE C;  2E75 C;  1Q90 D;  2JP3 A;  1K04 A;  3AE9 C;  2YIU C;  3O6Q A;  3H25 A;  3Q3D A;  4H0L C;  2H88 C;  4H13 B;  5KLI C;  2G8Y A;  4YXD C;  3AE3 C;  3AEE C;  3AEA C;  3GMA A;  4R4L A;  4I7Z C;  1ZME C;  1OMI A;  2ZT9 B;  2WPV B;  1JB0 J;  2P10 A;  4H0L D;  1DD4 A;  2O01 J;  1IK7 A;  4H13 D;  4OGQ B;  1VF5 B;  3AEG C;  3B71 A;  3AE2 C;  1FDI A;  1KOR A;  2E74 D;  3Q5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...