4H13B

Crystal structure of the cytochrome b6f complex from mastigocladus laminosus with tds
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 42
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4h13B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h13B01
2YIUC 4PV1B 1VF5B 4H44B 4RKUJ 2WPVB 2FYNC 4KT0J 2E76B 4Y28J 3LW5J 2ZT9B 4H0LB 4I7ZB 3C8VA 2K9YA 1S5LX 2QIWA 4IL6X 2WSCJ 2D2CB 5KKZC 2O01J 2WSFJ 1ZRTE 1JB0J 2E75B 4H13B 1Q90D 2E74B 2QSIA 2QJPC 5L8RJ 2QJYC 2WSEJ 2QJKC 4OGQB 5KLIC
chains in the Genus database with same CATH superfamily
2BCCH 2WVRA 2Y0CA 3LDEA 2L35A 1FZAA 1KQGB 2JEXA 1VQNP 3JAKA 1M1KQ 2NR5A 2QJPB 3ICXA 4YXWH 2Z3YA 3JASA 3L73J 1QLNA 5CCGA 4YXWG 4OWFA 2Y0PA 4K0KB 1J1DC 1HGVA 1QGKB 3H1LJ 3SWYA 3E7KA 1SQQH 5EBLC 5IJ9B 4QE7A 1D7MA 4ZKIA 5LA6B 1SQQG 4U7JA 2KLUA 5B1NA 1M9NA 1YTZT 2X6AA 5ITZA 2BSKA 2IBZH 3BPZA 1OCCC 1EZVI 2A06H 2IBZG 3NR7A 3OUFA 2FYNC 1N7SA 2A06G 3AEEC 4Y99C 1M57D 4YJ2B 3OMAB 2JK5C 3AEGC 3AG3C 3N7NA 3DTUB 1WB7A 3ITKA 2HFED 1JNMA 2IJKA 4X1YB 4LGDE 5KLIB 3II6A 2WLNA 3CCJV 1HBWA 2HHHO 1JEKA 4WY4C 5BMVA 1SQVK 4IT5A 4PI0A 1Q86W 2XNDH 3MZWB 1PM9A 2UXNA 1U57A 3VMZA 2QJKC 3MGNA 2XNDG 4ZIBA 2BCCJ 5JWPA 2Y4UA 3H1KE 2JP3A 3ZN0A 2JR8A 2VRZA 1S9KD 2HLDG 2QWQB 1Q43A 3MHSC 1GK6A 1FFXB 3CJHA 3KG2A 1SQQE 4JAAA 2W6JH 3ASOB 4GOEA 2BTQA 5LHHA 1L0LK 1SQQJ 1VQ5P 5KUMA 5TISH 1IX9A 5B1AC 3C3TA 1RH5B 3E8FA 2IBZE 1NWQA 2YSUB 1RSOA 2A06E 1SQVH 4R8CA 1H2SB 1Q90D 2EIJC 3HUSC 2IJIA 1SQVG 3WB1A 4JV5B 1FYJA 1URQC 4DR1B 1WT6A 2MKVA 3B2EE 2OYHA 1NKZB 2E5YA 1T6AA 2LJ2A 1ZRTD 5IYZB 4N23A 4O4JA 2OYIA 2GUSA 3OFNG 3L9DA 2WLKA 1S5LX 4YXDC 3MUDC 1IZ3A 3CRQA 1LTGC 1P84H 3TYYA 5BU8B 2GA1A 2M3EA 1FZFA 2QM8A 1R3JC 4DT0A 4HYOA 1L0LH 4NYKA 1IXBA 1RFYA 4UCUA 1L0LG 1NTZD 3KKYA 4MVOA 4C7UA 3OJAB 4B3TO 4KJMA 4O2AB 2AHYA 3G4SV 2EIMC 1YSCA 1IBLO 1JTHA 4MVZA 5KHHA 1WA8A 2ODMA 2XAQA 2QTSA 5LMNO 3UCSC 2YICA 2O01N 4JQ0D 1ZTEA 4D7TA 2JDIG 2ZM6B 5APWA 2CUGA 4I50A 1AJNA 1P84F 3FAVA 3GF7A 4R4MA 3WU2E 4XDLA 5TISE 2Q69A 3W7WA 4IIJA 4DV2O 1K9MQ 4AUWA 2BTOA 1NT2B 4TUYB 3ASNC 1SQVJ 1VQ4P 2N04A 1K4CC 2QM7A 3O65A 4K8ZA 1RF1A 2HG5C 5C8YA 1X8YA 3M06A 1OMIA 3A0HE 1SFCC 3CCSV 4HJGH 5KLIC 3IGAC 1M8OB 4JYAB 2G3AA 4DV3O 2CGNA 4JZGA 4HNAB 1SQPD 3SJBC 3UM7A 5B3SC 2M6YA 3AG4B 1XNRB 3E8GA 3FD9A 4ABMA 1YTFB 3CEIA 5GTIH 1K7DA 1L0LE 3HD7D 3VN0A 1BSMA 1ZSPA 2XOKG 2OCCB 2YIBA 4P9OA 3RYCB 1DF5A 3G3ZA 5LHIA 1L0LJ 5GTIZ 1ZWIC 5IYBO 5DJUB 2H3OA 4DR7B 3KZIZ 1LUVA 3E2EA 1XDCA 2HP8A 1YIJV 1JOCA 2IZ1A 1I94B 2M3BA 2DYSB 3ETGA 1LTJC 1GH6A 3S4RA 1L1FA 2ARHA 1VQ5V 3VBBA 1GMGA 1NTME 1GL2A 2A45I 3M99B 3PP5A 1MZ9A 1AI5A 4PELA 4GKJB 4LH6A 1QBZA 5IJ0B 2YIDA 1QHTA 1FZGA 1PFIA 3Q5SA 2Z0AA 4LNUA 1TAEA 2EBOA 5JH7A 1XILA 4DR5O 3GHGB 4NTXA 3L74H 1H2NA 1M57B 2A0LA 3MHVA 3AE5C 5CCHA 3MHHC 1ZUQA 3IFXA 5K1PA 1XHXA 3RW0A 3CD6V 1SLQA 4LF6O 1Z56A 4FVMA 2AGAA 3CCMV 2B9ZA 1GKFA 4FZ1A 1HUCA 1IFIA 1HF9A 2QIWA 5H5NA 3HE5B 1H2KA 3CMAV 4H13C 2D2CB 4FM1A 1LWUC 4MVSA 5GW7A 3K04A 2E76D 3HB3B 3LSSA 4PA3A 3RYHA 4J42A 3CCUV 4YTPC 4PJ0H 2N1TB 1U7MA 2X7RB 4TQFA 2Q1KA 1AR5A 3D36C 1V54B 2KZIA 2N9BA 5IJ9A 2P90A 3ZHVA 5LA6A 2R9RB 1LTAC 1W2EA 5KUKA 3FGAD 4ASUG 5LL6Y 4H44B 1NR1A 1IFPA 1KILC 1KYOD 2P4VA 2W6AA 4XBFA 2X6BA 1FC2C 2K9JB 1M7LA 3H1JH 2ZYAA 5CCGD 4YJ2A 1S0VA 1J1EB 1XMQO 3H1JG 1D2DA 3CX5D 4FFKA 4X1YA 3AE2C 2E42A 3WG7B 1CEZA 1FD9A 4W7YA 1Y6XA 2YI8A 1K8AW 4OGQC 5KKZB 1P49A 3RK2C 2OCCC 4DV7O 4Z2WA 4B7KA 5CB4B 1WP7A 1HNWB 1HDJA 4ASWA 1L4AB 2Q6AA 1KB9I 4R50A 1NU1K 5IWAO 4DV4B 1Y8AA 1VQOP 3BY6A 1FXHA 1IZNB 4GCZA 4NB5A 1N7SD 1N0JA 2QDOA 1AB3A 2PYLA 4PJ0E 2Q73A 3K0DA 4X8AA 1FFXA 1GD2E 1FU1A 3H9VA 2YI9A 4BIUA 1Q2NA 3FXDA 5FPOA 4JI2B 1LTSC 5DEDA 1F4NA 2Q7CA 1S5LE 1X22A 4EYYQ 4U3JB 1VQLV 4FJCC 1MMMA 3H1JE 1R5LA 4H0LB 1W59A 1PNLA 4LP8A 3CCRV 5AW9B 3V2NA 1FZEA 4O4IB 1M57C 1NU1G 3CCLP 5IYZA 3H1JJ 2Y0IA 2HEPA 4EKWA 2HFEC 2B9BA 1F23A 3H1IH 2UUAB 3GLMA 5KLVH 2Y48A 3S3WA 1IBMO 2WLHA 2VQFO 2M5AB 3H1IG 3V2PA 1KV4A 3SFDC 1JUNA 5GTHH 1HW7A 1Y9BA 1BDCA 2DWEC 4DYLA 2B88A 3SSUA 5BR8B 3OA7A 4OGQB 4FLYA 1YZBA 2Y69C 4O2AA 1N32O 2CAZC 5GTHZ 1VQKP 2P5OA 1QVGO 4LF4O 1XMOB 1EDKA 2EINC 3CC2P 3L72E 4LF7B 1MZEA 1R3IC 3VQXA 4X1IB 3TF5A 2XTAA 4NXMB 1K5QA 4U7OA 1NBMG 1URFA 4R4LA 4I0XB 3FX0A 2H94A 2Q9LA 4JAUA 2B1GA 4JI5O 3JALB 3ZMUA 1N86A 3D3QA 3ABTA 3L70H 5DECA 4TUYA 4CS2A 1ZLZA 1NTKK 4P9PA 1KP3A 1RE3A 3L70G 1H8EG 3KHUA 3ZMVA 4LF8B 1QVFO 1NU1E 3MP7B 5E79H 1KC8Q 1N8RW 2PY5A 3B5NB 1OX3A 4X1KB 1BE3H 2LGQA 2XAFA 5E79Z 3AK2A 3OW2U 4KL1A 4K0KO 3E86A 2WTYA 4CC6A 1K92A 2LGWA 1JX9A 1L0NE 1BE3G 3H1IE 3KCYA 2W90A 4LR3A 5KKZC 2HPCB 2KZJA 1ZL8B 3H1IJ 5EIBD 5KLVJ 2OTJP 3N2KB 1IC2A 1V9PA 2IU3A 5CA1B 3RYCA 4RESB 3OEHG 4DR3B 4JYCA 2AZ2A 2QKAA 1GN4A 3QTCA 5IY5C 4HH2A 1EZVE 3SPJA 1NTKG 1JY3P 4PV1B 1VF5B 1KUQA 4Y28J 1RHZB 2WA3A 3CXHI 1LTTC 3LIDA 1H38A 1FJGO 1CZQA 4O2BB 4CBCA 2Z5HA 2ZXEB 1JVMA 1SRYA 1MV8A 1KQSU 5DN6G 3H1KD 2QTOA 1VQ9P 2QM4A 2IJJA 2FFDB 2R9AA 2Q3EA 2YIBD 2C9NY 1LT9B 2NN4A 2JS5A 4UCOA 1SQQD 3L70J 5IJ0A 3P8CE 1Q81W 4ZKPA 1P7BA 4GODA 3B8EB 4YIPA 1FS0G 1JR9A 4TV9B 2OYQA 3GHGA 1BE3E 2IBZD 4BXLA 1DTOA 1H2MA 4I55B 2XZRA 4L76A 3RYFB 3OMNB 4CS4A 1P84I 2UXCB 4DUZB 1BE3J 2VWKA 4JI1O 3FB6C 1GL2D 3U0ZA 1B6QA 4UV8A 4NTWA 4X66O 1M93A 3HD7C 3JD4A 3HE5A 2HJDA 4JPRA 3ABMB 1PD3A 1NTKE 1SKVA 1KMIZ 1Y47A 1VQKV 1ZW0A 4DR1O 4R7CA 1SZTA 3ZRVA 4DK1A 3V4WA 3I55P 2N1TA 2RNBA 4DV5B 1OV9A 4UCTA 5CCHD 3CC7P 1AI6A 2ZR3A 3LW5J 5FPRA 5KMGB 3ZHTA 2XUMA 2N9YB 4WB4A 3HTKB 3AE4C 4QJFB 3V6IA 3KXDA 1BS3A 3CHXA 1SP4A 3CWBE 3K9AA 2Q5ZA 3GF3A 2K9JA 1QU7A 3K03A 3C1LA 2QSIA 1JJ2U 3L71E 3CE2A 5CA3A 1J5EO 1ORQC 3LSQA 4PDLA 3MAQA 1M90W 4IYHA 1OCOC 1MZFA 4FM0A 3TSIA 4JI3B 2Z5IA 1FOSF 3QO7A 4UCVA 4B08A 1Q82W 5CB4A 4RAIA 4X88A 1L4AA 2K88A 2E75C 2Y9YA 4XA4A 4TQDA 2A45H 5LGNA 1HNZB 2A45G 1K5SA 3VTPC 4TWKA 2RJZA 1N33O 1L0LD 4HZ3A 2E76C 5CN0A 1K73W 2H8PD 1MFTA 1QL1A 2JGUA 2JO1A 5KAIH 2YMYA 4I7ZC 1JMKC 2PUSA 4JYAO 2VWJA 1JJOA 2R5BA 2UU9O 4DO2A 1NAYA 2YXLA 5KAIZ 1XNRO 5CBNA 1FOSE 4DK0A 4IHJB 1FZCC 1BGYH 1BHBA 5KAFZ 2ZYDA 3NTNA 4GT1A 4U3JA 1BGYG 2DYRB 2QEXP 3STZC 1NR7A 1SZXA 4DR7O 1CPYA 2CGOA 3VQYA 1NTMD 3V2RA 1L2PA 1PIXA 4O4IA 1S2EA 2XU6A 1I94O 3O6QB 3OEEG 2O01H 5CCGC 1LR1A 3QO8A 3WUTA 5BXZA 3FXEA 2M5AA 1YHQP 2P06A 4GX1A 1YDXA 4KXRA 2M8RA 2N05A 5KHKA 4RKUJ 4JYBA 2L5GB 1A02J 5EBWC 1U7JA 1Q6IA 4LFBB 1KD1W 1G2CB 2IYOA 2FYUK 5H6QA 1PKXA 3I55V 1N7SC 3APOA 1OW6A 2B1IA 1X59A 3CB2A 3E1IA 3CC7V 4FLWA 1OCRB 4X1IA 2G38A 1IFDA 3P3NA 4I0XA 4FLUA 4B3MB 4UB8E 1K04A 3Q5PA 2ETNA 3JALA 4O4HB 1EN4A 2F95B 3CCJP 1BGYJ 1GMJA 1AR1B 3SJQC 1SQGA 2A79B 4GKKB 1V55C 4MT8A 1WB8A 5CMUA 4DZOA 4LC1A 1FAFA 2Q0OC 3B5NA 2FYUH 3ABKB 5CJ4A 4X1KA 3BRTB 2YXQB 2FYUG 2O01J 2HPCA 1XNQB 1IK9A 1GM8A 1ZL8A 5J2UB 4KFMA 5C39A 4CH5A 5AG2A 3H1LG 4E2LA 3JC22 4M3LA 1K05A 2ZE5A 3N2KA 5CA1A 2R3CA 4BIZA 3CC4V 1G8MA 1XUQA 3PJSK 1DLBA 1PPJH 4LCUC 4ZHQB 1PPJG 2OYHC 2QE7H 1PGPA 4O2BA 2QWRB 2OYIC 2BE3A 3PLNA 3OMIB 3GG2A 1NQTA 4O4LB 1YTFD 2ILMA 1XQ8A 4WFFA 1SQXK 2GSMB 2FFDA 4EFBA 1HNWO 2V4HA 3JSLA 2IW5A 2EIKC 1LT9A 3JD1A 1PL5A 4DV4O 1L8DA 1LT1A 2ADPA 4DUYB 1M1JB 3K9SA 3P3PA 1KB9E 4TV9A 3TETA 3L73E 5L3EA 1HTLC 1YJ9P 3HKBA 3C8VA 2BCCG 1TU3F 3IJ4A 4I55A 2FYUJ 3G4SP 3RYFA 3C90A 3RYHB 2YEVB 3H1LE 3AG1B 5H9CA 3AE9C 1YHQV 3CCEP 3B4SA 3FYEB 1FE6A 1QLEB 2KB1A 3P32A 4J11A 5EIBC 4JTAB 1SQXH 2EILB 3SJCC 2Q8VA 3ETQA 5LMUB 1PPJE 3BCCH 1SQXG 1EZJA 4DCKA 3BRCA 3BCCG 5AW3B 1J2JB 1RF1C 1RQUA 3D71A 1OCRC 4MW3A 4QMAA 3M7MX 5IT9N 2BEQD 3TGUH 3IR9A 2PGDA 5LP6B 1GRJA 1VDFA 3WB2A 2UUAO 1O9GA 4UB6E 5KMGA 1HNXB 3CCSP 3CMEV 1RY3A 4LF9B 3KCXA 3AE7C 2IU0A 4JI6O 3HTKA 2NPSB 3PRJA 3L72D 5EC1C 5BR8O 2D2CD 2K9PA 2BCCE 4BAYA 4KP4A 4ZI7B 1QL2A 2AEJA 3ABLC 4I2LC 2Q4PA 3E22B 1XMOO 3GVMA 2N1TD 3AG2B 3DC6A 1HJ0A 4LF7O 2KS1B 4NXMO 1RF0A 1YIJP 1NU1D 3ETDA 5D5PA 3CXHH 1N36B 2RN9A 1YI2V 4H44D 4KHPO 2W6JG 4J41A 1GL2C 1YQ3C 5JVDA 2J5UA 3B09A 3BCCE 3ZMSA 3ML0A 3H1ID 1L0ND 3APQA 3VOPA 1SQXJ 1NJIQ 2B5UA 2PP6A 5B1BC 3JD3A 4B3RB 3BCCJ 1AR4A 1GW3A 2HLOA 2OTKE 4NPEA 5DM6V 2V7QH 3LNMB 2OIEA 4WWIA 2ATKC 2WWWA 4J9ZB 4LF5O 4D6TH 2ZT9B 2OTLV 2N74A 1BCCD 3K08A 1SQFA 3F5TA 3TNUB 3CXHF 4D6TG 2PGGA 5LHGA 5CCHC 2RMKB 4IHJA 3G6EV 3SGIA 1EZVD 2ZAEB 1KFNA 4N78E 1L4AD 1RPRA 5LBQA 3CD6P 1T3UA 3OTOO 3GWOA 4CS3A 3CYOA 3CCMP 2GBOA 2CPSA 1YJ9V 4B86A 1UFIA 3O6QA 2QJPC 1Q7YQ 3CMAP 1NS1A 2UWJE 4XE5B 5JCOA 2JGDB 2ZIOA 3GWKC 5J2TB 4TOIA 3CCEV 2FXMA 4N3YB 3P8CD 4QE9A 1PP9H 4RQEA 4IL6H 3RBXA 3CCUP 1UPGA 1PL4A 1FJKA 3LNNA 3N4XA 1PP9G 1IFJA 1BE3D 2ZYGA 3RK3B 4IL6Z 3K57A 2FY8A 1EM1A 2OCHA 5KA6A 1G2CA 1SQVE 3AEDC 1N73B 4H0LD 5F2VO 1D5AA 4UVCA 1NVPB 4UUJC 2YS8A 4J80A 2HR3A 1RP3B 1CI6B 2EX3A 1KBHA 3JCUH 3K5BA 4D6TE 2QGNA 1VF7A 2UXCO 1PNKA 2H8PC 2JJ1G 3WFVA 4DUZO 1NTKD 2XKMA 2Y9ZA 3JCUZ 3OT7A 4D6TJ 1P84E 1RQVA 4O4HA 1QQCA 1US6A 4GOFA 1AP6A 3BAAA 4J9YB 3JATB 4OGQD 4UCSA 2K1AA 3U1AA 1D5NA 3KZIH 2W27A 4DW0A 4C46A 1JY2P 3CWBD 1PP9E 1SQBK 3AE6C 4DR6B 3ASOC 4RWUA 2GUZB 2DW3A 5J2UA 1I08A 3T1CA 2VRSA 2WQYC 4FK5C 1PP9J 4K35A 3RFRA 5AW5B 4TV8B 3L71D 1NOHA 3FYIB 4BWNA 1S72P 1DEBA 2Y0EA 4NKGB 1IBKO 5AW8B 1X9VA 3B5ND 4ZHQA 5KA5A 3CCVV 5EZYB 2ITCC 1VQLP 1U96A 3X2QB 5DJTB 1HR0B 4YY3B 3BFRA 5AW1B 3CCRP 2ZR2A 4YHHB 1FAVA 4O4LA 4JI3O 3ZHUA 4DR4B 1SQBH 4AQRD 4DW1A 2H89C 3L74G 1Q86Q 1XOUA 3H6PA 5BVZA 1SQBG 5GTIE 3ZBHA 2EZOA 1EQ7A 3VYIA 1DX7A 5IDJA 2X0LA 1HNZO 1EBOA 3J81N 1M1JA 4PV1D 1VF5D 1WN7A 2JEUA 3B8MA 3BA9A 4J7JA 3OUSA 4DRXB 4J10A 2YEVA 4GKGA 5L3GA 1XEQA 3VMYA 3MD0A 2HODB 4JAVA 1I5XA 3F7VC 3H1HH 4HAMA 4LBEC 3EFGA 4X65B 4OPAA 3K58A 3H1HG 2CTWA 1E1RG 3U11A 3EWKA 1W0KG 4QPJA 3RVZA 2R5DA 2CTQA 3L75H 2JJLA 3ZRSA 2WT7B 3JD0A 1VQ7P 4TT3H 2ZD9A 1RE3C 3L75G 4I5SA 4EDFA 2DQ3A 4TT3G 2W6IG 3NXSA 4B3SO 3RK3E 2I8DA 1WMKA 1M56B 2YIUB 2KG7B 1FZBA 1USEA 5LP6A 3L74E 3P8MC 3G71V 1SQBE 4N6JA 5B66Z 2QA4V 1SC5B 4J7KA 3GB7C 3AG4C 1NGMB 3L74J 1OWAA 1SVFA 1SQBJ 3C9IA 4MVQA 2ZXWB 3ZIAG 4MW8A 2NPSA 2XAHA 4LFBO 4JI4O 2XT9A 2QWPB 2RCVA 4FZ0A 5D5QA 4ZI7A 2E74D 3SPCA 1MUUA 3E22A 1BDDA 1COWG 1GZLA 1S5LZ 2W8ZA 1JPXA 2KS1A 1N4CA 2DYSC 3DXRB 4PDVA 3F7YC 1GN3A 4B3MO 2WLMA 3BA8A 5KLVK 5AW2B 3G6BA 3M0DA 3ZMZA 3H1HJ 1TUEB 2QSAA 2BEZF 2ZVOB 1OZHA 5AVQB 4I9WA 1S72V 3OAKA 3EXAA 1ZP0C 2AZ0A 3L75J 4LFAB 2K3RA 4IYIA 4WFEA 2ZJSE 2PF4E 3OE7G 1YYCA 3GHGC 5LGUA 2UXBB 4IFFA 1KZUB 2CTPA 1XNQO 2BOCC 4JI7O 1XL6A 3TNUA 2CH7B 1VQ8V 1IK7A 2FBWC 3OM3B 3SPGA 3GMAA 3AK3A 1BSNA 1YTZI 4PD4I 3I5DA 5KLVG 1USDA 2Q9IA 2AXTZ 1Q3EA 2D2CC 4JGSA 1OCZB 3FKSG 1JM0A 2YKQA 1AP5A 3U1CA 2R3SA 1H88A 5CMZA 3SPHA 1XBLA 2JGDA 3SYAA 2N1TC 5J2TA 1HVVA 1Y74B 4L8JA 2CE4A 4MTGA 4LFCO 1V54C 3OW2O 2LXBA 4ZNCA 3HKDB 3D6YA 5CBHA 1KB9D 1NTZK 4WFBV 3L73D 2QKCA 1WAZA 4X64B 5IE9A 4H44C 4RO0A 1VQ7V 1X79B 2GTAA 4IFDK 3H1LD 1FPOA 1N73A 4DUYO 5FNVB 1CI6A 3M8AA 3T4ZA 2IH1C 3ABVC 1R6TA 1J1EC 1HWTC 2UUBB 4OPHA 3I5CA 1JA8A 2KNCB 2P58A 1PPJD 3JAMN 3WG7C 2EULA 1LP1B 2LW1A 1YXBA 2VQEB 5KLVE 1CXZB 1KQSO 4K8XA 2V1DA 3OR7C 4K3AA 1NTZH 5HFLA 3JATA 5GTHE 2DQ0A 2JS3A 2PI4A 5LMUO 1L4AC 1NTZG 2ZCEA 2ZVNB 3E35A 1SESA 1JMBA 2W6BA 5AW7B 2JIZG 5AVUB 4QGPA 4NVPA 1PGJA 3B8NA 4LWSB 1ZXGA 1T5EA 2CK3H 5H2FZ 2BCCD 1Q5OA 2GUZA 1HNXO 4QPKA 3SWKA 4LF9O 2QR4A 5EYPB 1R1BA 4TV8A 4ZOLB 3D6ZA 2O57A 2PYJA 1AJPA 1I5YA 4UVAA 3L70E 3F89A 2DE0X 3TXQA 2GDSA 2OT5A 3D3IA 3NFQA 1WPXA 2W0XA 1IO4A 1R3KC 5EK0A 1FXKB 5EZYA 4H0LC 5E79E 1EXJA 5J9PC 3GW6A 1IXMA 1LUWA 1F4MA 1H2LA 2LXCB 2WAMA 3H32B 5KJ7A 3HKBB 3BCCD 1JFFB 1OW7A 2GUVA 1W2BO 1Y76A 1K8AQ 1MOFA 2Z4EA 4RJTA 2A06D 3A0BZ 3VMAA 1N36O 2ZQMA 5LMNB 2HJFC 2NNUA 5FLXN 2PAJA 3UQ8A 1AV1A 1NTZJ 4DV2B 2ZXXA 1OCZC 1VIBA 5KHGA 4PA4A 1KKDA 2FYZA 4GX5A 4FLZA 3SYOA 3A7OA 1HWYA 4IOIH 5B5EZ 4WF9V 1JQ0A 4JV5O 3MIWA 4AYCA 2E74B 2I1JA 4N78D 4DRXA 3G9RA 3M9QA 1W2BU 2YXRB 2HODA 4DR2B 3T97B 1QCEA 1AQ5A 4MTXA 2OARA 2KB7P 2KLVA 5EC2C 2F43G 3K5LA 1YJWV 1NH4A 4DV3B 4Q6GA 1H2GA 2HVKC 2QJYB 3R4YA 1X4TA 1E79H 4X20A 1ZV8A 2NRGA 4BW9A 3A2AA 2WT7A 2WSCH 4I9QA 4YJ3B 1E79G 5L3FA 2LO1A 1N34B 1Q6UA 2ZIMA 1FS0E 3E83A 4FM2A 1PV3A 1B06A 1RE4A 3B5NC 2KG7A 1EFRG 1W0JG 2WA4A 4R6ZA 1GM7A 3ZDMA 4FPPA 1SQVD 2HVJC 2ZM6O 2AEMA 3HKCB 1ZMEC 1QLED 3K79A 4KT0J 3MTUE 3PTZA 1OVVA 4D6TD 4HB1A 5JVDB 2XASA 3ABUA 1OVRA 1VARA 1F7YA 2GHYA 1P84D 4L74A 1K3EA 3CC4P 4PV1C 3B77A 4GX0A 4OX9B 1VF5C 1AI7A 3DXRA 4DJGA 4W4LA 2YXYA 1WLEA 2P6JA 2JWDA 3TK1A 2DJVA 1M1KW 5KAFH 3DGEA 4XDJA 3FB7C 1KYOH 2NPSD 2FFDC 1ZAUA 3ZEDA 3CRMA 5AVXB 1LT9C 2E5LB 1BHAA 1QR9A 1PP9D 3AEBC 3CL3D 3E1RA 1N8RQ 2WSCJ 3WB0A 4BW5A 5APSA 4JF7A 1T2KD 4UFZA 1S5HC 1R5SA 1BL8A 2JVDA 1PL0A 4NPFX 4DV0B 4DR6O 2XAGA 3MDSA 2YO2A 2CH7A 2AHZA 5AVZB 3RT3C 2DWDC 1KYOF 1WRGA 2WPSA 5APTA 1I7FA 2DN9A 2LP7A 3ABMC 3A3YB 5TJHA 4GKJO 1PZQA 3KPEA 2EJRA 2C2AA 2WPRA 1S3JA 2E74C 3F5HA 3CX5F 2Q7GA 1KFMA 4EIJA 4U7NA 1AQTA 5JQGB 2KYVA 1HR0O 3H01A 4YY3O 5KAIE 4U3FH 1Y74A 2ZT9D 2KSEA 2OYOA 4PA6A 4YPCA 4U3FG 4JZ2A 3HKDA 1XMQB 4ASVA 2C0XA 4F4LA 5L3CA 5AVYB 4JYYA 1H8AA 4D7SA 5H6RA 1BGYE 1J1DB 1TUBB 4WFGA 3RVYA 1FKAO 3ZJZA 1Q81Q 5CBGA 3CMEP 4FLXA 3Q5RA 3LDCA 4JI8B 1BT8A 1GM9A 2IYPA 5FNVA 4W4KA 4GIFA 2Q6QA 1SS3A 5IWAB 1FDIA 2IPPA 3W7TA 1NZ6A 3ZHQA 3CCQV 2RKLA 3CPWU 2KNCA 3UIAA 2FYNB 2FTKA 2YIAA 3M9BA 4Y99B 1LP1A 1RF0C 3OD4A 1YJNP 1MSWD 3IAOA 3JYCA 4X65O 3RK3D 3AG3B 1JB0J 3G80A 1G1JA 2YC0A 4I1LA 3L74D 5JJEB 1YI2P 3CP1A 5AW6B 1NVPD 1SQBD 4WY4B 1KQFB 4JPZB 4U3FE 3IC7A 4OVNF 4L75A 1LNQA 5K5GB 3VP8A 4LWSA 4NPDA 2QJKB 2QRXA 2OQQA 4U3FJ 1I0HA 2QE7G 5EYPA 4Z1MH 4ZOLA 2OTLP 3N2GB 4Z1MG 1G6UA 4JI0B 1T3JA 2QWOB 1FJPA 3WUUA 2DYRC 5C93A 2FXOA 3G6EP 2P10A 1WJZA 2PTMA 5M1BA 3ZS8C 1HGZA 1N2DC 4PD4H 1FBMA 5B1AB 1FXKA 4X62B 1M90Q 2ZDIA 1MNGA 1K9MW 2FYUE 3HUSB 2EIJB 2BOBC 2IH3C 3H32A 3JAWA 3K06A 5JCOC 1JFFA 2FL4A 2W0FC 1URQB 2H88C 5APYA 1Q82Q 3R65A 3SPIA 4QNHB 1ZR4A 3PN1A 1VF6A 3ETEA 2A3QA 1OW8A 5CJ0A 2QG4A 3ZMTA 4JI2O 2M7WA 3H1JD 3HKEB 4AI8A 5APQA 1VQPV 2L91A 1OIPA 1YQ4C 2XNXA 4UXNA 4LFAO 4PD4F 3KYQA 2F1MA 2WPDG 1K73Q 4X9QA 2FMLA 4CZZA 2WLIB 1LTIC 2UXBO 5KJ7D 4OH8B 3QWOC 3HR0A 3T97A 2EIMB 1JO5A 3H1KH 2F4VB 2ZE6A 3A2FA 3E89A 3TGUG 3H1KG 1AJYA 2QVAA 4AHCA 4JTCB 5APVA 2Q0AA 1AROP 1OVUA 4NXNB 3SJAC 1X0TA 4YJ3A 4PD4E 1K97A 2A7WA 1JCCA 2Q7EA 1M4UA 1JY2O 4CC5A 3T4DA 3E8HA 1G1XB 2WLLB 4P30A 1NHLA 3ASNB 4GX2A 3ABKC 4G28B 3IFMA 2ZE7A 1SF9A 1SETA 3EVKA 2L6LA 4HYTB 1YJNV 1NO4A 2H7HA 1S5JA 3HKCA 2QJ1A 4CH6A 1AVYA 5L3DA 2P1JA 1AILA 1S77D 1SFCB 1FJGB 4PDMA 4X64O 3W7UA 1KD1Q 2UUCB 1G1IA 5KTBA 3CRRA 2JJ2G 5B3SB 1SQXE 3CSXA 3K3WA 3BASA 4N21A 1TVKB 4BRYB 4LF8O 1XTGB 5KLVD 2KK7A 2WSFH 1M56D 3V4QA 4DXWA 1VL2A 2UUBO 3TGUE 2AEFA 3CCVP 2VS0A 4PA7A 1JMMA 2V7QG 1SA0B 1OJHA 2VQEO 3TGUJ 2OIGA 3H1KJ 3KQGA 4WVZA 3CLQA 3K5NA 1LTJB 3QF7A 4JI1B 3F5WC 3AK1A 3WU2H 3CI9A 3P7KA 4OXSA 2XV5A 3AG7A 4DV1B 4UVBA 4KHXA 4X66B 1LGHB 2KI7B 4MSWC 1EN6A 2ZNIA 3RL0D 3WU2Z 1M1JC 4DR3O 4GZRB 1VPCA 2ZFCA 1THZA 2J58A 3FWNA 5TISZ 3RWRD 1OHHG 3A0RA 3P30A 4YIOA 3CS5A 5KHJA 1H8HG 3ZHSA 3L70D 2IJHA 3OAAG 1NH2B 3AG1C 1A32A 3A0HH 4WCEV 3CXHE 1B04A 1QLEC 1MG1A 3RGBA 1NTMK 2LQTA 2LFRA 3VQWA 5HFMA 2EILC 3A0HZ 4BWAA 1KECA 5AVTB 4O9BA 3Q1MA 2CTRA 3WMM0 1VQNV 3VQVA 1XTCC 5JQGA 4EB6B 2P7TC 2WSFJ 4G2KA 4WBAA 4H13B 5B1OA 1BZKA 2KP8A 1KQLA 3EQ2A 4TLFA 2JWAA 5LP6C 1LWUB 2ZNJA 1W5CE 3S1KA 4J7ZA 1DD4A 2JDIH 2V7QJ 3AE1C 4RUFA 1J5EB 2JRIA 3BVHA 3L4FA 2ITAA 3G71P 2Q7HA 1TUBA 1ZOYC 4Z1VA 2QA4P 2NPSC 1EDIA 1NTMH 1GAXA 5K1XA 2YKOA 1NTMG 2MW2B 3THOA 2WSSH 5AW4B 1YVWA 2JKVA 5APUA 3RN4A 1LTBC 1KILB 3R2PA 1T2KC 2P4KA 2WSSG 3AG2C 3D70A 1K34A 3IC9A 4DR2O 4QIWF 1N33B 4IGGA 1MKMA 4DV5O 1XHZA 3L35A 4EI2A 2UXDB 1IDSA 4IL6E 3ZN1A 3RL0g 3M0DC 3IF4A 1R3LC 4JTDB 3W7SA 1OFCX 1YBKA 2WPVB 2UU9B 1GN6A 1EDLA 1KN7A 1VMGA 3K0GA 4H37A 1N34O 4HBNA 1FXVA 2MJZA 4WY4A 4ZMDA 2YMKA 3RK2B 3SYCA 5FL7G 2A9HA 4X89A 3G67A 4PDRA 3JCUE 4I6MC 4MVMA 3BVOA 3AEAC 2ZT9C 3T1HB 2HKOA 1R8EA 1KYOI 1QX8A 1Y76B 3BHPA 4WFHA 3N2GA 5LXTB 1P7GA 5CA0B 3PH0A 1VQ8P 3BRVB 2RQ6A 1GU5A 3UT5A 1K33A 2ZINA 2WPQA 1NTMJ 2UXXA 3ZRXA 3HPLC 3CX5I 3KZIE 5AW0B 3SR2C 1NKNA 4G27B 2O3JA 1H0TA 4OX9O 3Q4HB 3HUSA 2WITA 1GDTA 4JF3A 2R72A 1URQA 1BQZA 3AEFC 3SFEC 1DF4A 4I4TB 1N7LA 3UKMA 2KIKA 2SPZA 1G4YB 1KC8W 3N27A 5L8RJ 3USSA 1B3QA 1ROPA 3HKEA 3IN6A 4AQYB 3RK3C 1JY3N 3MUDA 2E5LO 1IURA 1GK4A 2E75D 2XHBA 3DC5A 4X20B 1N73C 1AI4A 3Q3DA 2WLIA 4E4EA 2IFMA 4MVUA 5LGTA 2Y69B 3W7XA 4DV0O 5B66H 4A7PA 1Z2GA 3E8BA 3M0AA 1E5WA 2EINB 2X6CA 3OTFA 3T2MA 1DIPA 3RGUA 3JSVC 4JBZA 2DMXA 4PJ0Z 4HKZH 5BU5A 1KU9A 5LYJB 4DV6B 4FIPC 2KKWA 4EEQA 1Q6HA 5LOVB 5AVWB 1UJWB 5IYDO 2GM4A 1JY3O 1S5LH 1VQ4V 2WLLA 2IX7C 2FKXA 3RL0B 3EFFK 2QKSA 4DOJA 1BGYD 2O1JA 4C7RA 4C7NB 3JARB 3T1YB 1CW5A 1SFCA 3JSNA 3H1HE 2Q68A 1KILE 1PGQA 2IDBA 1MA1A 3L36A 2Q3IA 5GONB 2B87B 1GU4A 1NVOA 3HE4B 1HJBA 1EXIA 3L75E 3ZRWB 4JI8O 4W7ZA 1TVKA 4ZBMA 1NAFA 4BRYA 1QR8A 2AW9A 4GKKO 3V5BA 1NI8A 4GYCB 1KTMA 2ZKOA 4F6RB 3TDKA 1M5IA 2W83C 3S9OA 2G8YA 1WP8A 5B66E 3X2QC 3L37A 4L73A 2HYNA 3W67A 1J95A 5KJ7C 3CRAA 4UV9A 4WBNB 5IY5B 2RN0A 1SA0A 4CH3A 1RM1B 3FX7A 1L0NK 2C0WA 5CBFA 1IJDB 3L72H 2OGUA 1LTJA 1SERA 4U3FD 1N0NA 1MFZA 2KSJA 3L72G 1OXZA 1DH3A 2AXTH 4BR6A 1GTOA 1IVSA 1AA0A 1FDOA 3J7AU 4FFBB 3JD2A 5BZBA 2V4DA 1CSBA 3OGIB 4NTYA 3I56P 1R6KA 3D8CA 1K4DC 1T8ZA 2WMMA 1NYHA 1NU1H 1RPOA 1VQMP 1S76D 4ICGA 1WPBA 1R6NA 2I1KA 5KX5B 1KORA 1L0NH 2FYUD 4JI0O 4UCRA 3C3SA 1YJWP 1L0NG 2E5TA 1EDJA 4MS2A 5L3BA 3KDPB 3O8ZA 2HHHB 4JI6B 3QG5A 1AVOA 5CHXA 2ZE8A 4X62O 3HD7B 2E3CA 2GV9A 4EB6A 1RE4C 2P67A 1FDMA 1M56C 2YIUC 1BCCH 3B40A 1LWUA 1BSHA 1AVMA 1YCIA 1BCCG 4W80A 1EZVH 3LSUA 1SS1A 2C9LY 1XI1A 3BEHA 1EZVG 1EC5A 4MVRA 4TSFG 2YO3A 3VP9A 3D36A 2ZXWC 2AXTE 2IZ0A 3L72J 3H25A 3FB8C 2RDCA 2IBZI 4KHPB 2LKMA 2P7JA 3RL0C 1VP7A 1KILA 1S9KE 1SQPK 5H2FH 1FFTB 1ZR2A 2POHA 1QVGU 3BATA 3LUTB 1PGOA 4PD4D 2KUBA 1NU1J 2F4VO 4LF5B 4HNAA 2BASA 4PA9A 2CK3G 1OCOB 1IFNA 4NXNO 3EHBB 1L0NJ 2LR2A 3PHLA 4MN4C 2FKWB 1GK9A 2KSDA 3CRCA 1VQOV 4LH7A 3OTOB 1QVFU 1ZRTE 1CP9A 2E75B 3STLC 3RYIB 1NTKH 1BCCE 5KHIA 1SQXD 1RM1C 4B3TB 1BCCJ 2AXCA 3A0BH 4EOTA 4FLVA 1SQPH 3JAWB 3W68A 1NKDA 2E76B 1IBLB 1SQPG 3LW5H 4PI2A 1DEEG 4I7ZB 5LXTA 4BIOA 5CA0A 2UUCO 3ZCCA 3B71A 3ZX6A 1NTZE 3TGUD 2LW7A 4GDOA 5JJNB 4WY4D 5B5EH 4L87A 3OR6C 1FZCB 2WZ7A 3I56V 3IAYA 1ZLLA 4B3RO 3CWBH 3Q4HA 4IFMA 5H2FE 1AFOA 1VQMV 1YF2A 3CWBG 3CCLV 3M91A 2YKPA 4I4TA 3JAKB 1JCDA 4H33A 1P4RA 2YNYA 3JASB 3L71H 3OGCC 1WNSA 3L71G 1EN5A 3O9OA 4FMTA 5EFWB 4DV1O 2E43A 1QEXA 1Z5WA 2P22C 4CH4A 1DD3A 3VMXA 1MSDA 3AEIA 3CXHD 5ITZB 2BSKB 3JCZA 5BY1A 5A2QN 3UO3A 3A0BE 1URQD 3CC2V 1NTKJ 3FFQA 1SQPE 2YDEA 3TXSA 4MTOA 2FXPA 1N7SB 2F93B 4JASA 3CCQP 1JCHA 1SQPJ 1OZ0A 3QO5A 1JOYA 1Y67A 1KKCA 5LYJA 5B5EE 3AECC 5E1AC 5LOVA 2B89A 5BMVB 2F66C 2PFXA 2ITDC 3VOUA 5AVRB 1S1CX 1VQ6P 1E1QG 1IBKB 1XREA 2CPBA 3QH9A 1V55B 3V2QA 3CWBJ 2KOGA 2NLJC 4C7NA 1GN2A 5APXA 2M0BA 3JARA 1TGOA 4RUEA 1MABG 4DR5B 2Y4TA 3L71J 5GONA 2B87A 3CJHB 3SDLA 2R70A 3HE4A 4PHZA 2OTJV 1Z5VA 2PRRA 3ZRWA 3FB5C 2BTQB 4RQFA 2K9YA 1S4XA 3TCUA 4LF6B 2GTSA 4ZKUA 1FXKC 4F6RA 2DOSA 5A9GA 2ZDIC 1RSOB 2EJ7A 3WUVA 2QWNB 3CX5H 4WBNA 3A5TA 4KUMA 2HG5D 3K59A 2K1EA 2WLJA 4WFAV 2UXDO 1GW4A 2IM9A 1SFCD 2OYHB 2R44A 1GTWA 1VF6C 2H43A 1UIXA 1XL4A 4MTFA 4O4JB 2ADQB 2OYIB 2WSEH 1A02F 1VQ9V 2P2UA 3AE8C 3SWFA 1DK1A 3DSQA 4UB8H 3UO2A 4CPGA 4FFBA 2K37A 5EBMC 1VQPP 4NR1A 1ENVA 1AJQA 2EIKB 4UB8Z 1YITP 4F6EA 5CBOA 2F23A 5JJJB 3LDDA 4B3SB 3K5MA 2YUAA 3T1HO 2CDYA 3CPWO 3AE3C 1H89A 4YHHO 1JTHB 1WA8B 5KX5A 5KAFE 4DR4O 3SYPA 1KYOE 1F51A 2QJYC 1U97A 4I50B 3QVNA 3A8TA 3FAVB 4GLXA 1O9HA 2Q67A 4EFEA 1ZX3A 5IYCO 2XDJA 4IIJB 2LFSA 1IFMA 3HD7A 4JI4B 4DV7B 2RMZA 1Y4MA 1PNMA 3CX5E 2YXHA 2NZ2A 1NH2D 1OCCB 4RO2A 3TJTA 3U10A 5AVVB 3U59A 4LLHA 1Q8IA 1RF1B 1NJIW 2RH0A 4GUNA 5C8YB 2JEEA 4AQYO 4Q20A 1HP8A 2IFNA 3SYQA 3QNEA 3R66A 2WSEJ 2EZPA 2D3OW 3M9HA 1KP2A 4XDKA 1Y66A 1VQ6V 5AVSB 4B7EA 4P2ZA 4H13D 4AILC 4IL6X 2DW4A 3ABLB 2PZSA 1KB9H 3ZHRA 3L73H 2OWOA 3FWLA 3J80N 3L73G 3K5OA 1UIIA 1DGSA 1LJ2A 3CXCU 3H1LH 3BABA 4JI7B 1Q7YW 1QNMA 4DV6O 1VEWA 2R9IA 1R73A 3LIEA 1GO3F 1TA8A 1GL2B 1IBMB 2Z5UA 2VQFB 2Q5UA 3H1HD 1KILD 4FLTA 3UT5B 1ZN5A 3RYIA 1BQ0A 2J59M 3Q2YA 2Y0DA 1H0TB 2KQXA 1KB9F 5B1BB 3L75D 1N32B 3HRNA 4XFJA 3S3XA 3T1YO 2XAJA 4LNUB 5JH7B 4LF4B 2O1KA 2MK3A 1PV0A 3RBZA 1SQQK 4LFCB 4A5UB 1YEWA 2PI5A 4UB6H 2R32A 3RK2D 1BMFG 1JY2N 3NMDA 2QEXV 1FZCA 4JI5B 1HH0A 2FB5A 4UB6Z 1YITV 2KXPB
chains in the Genus database with same CATH topology
3FGAD 4H44B 2WPVB 1KTMA 1KQGB 2E76B 3Q5RA 3S9OA 2G8YA 2ZT9B 3GF7A 4R4MA 4I7ZB 3B71A 3R4YA 2YMKA 1FDIA 2E75C 5KKZC 4GDOA 4PV1D 1VF5D 3D6YA 1PV3A 4H44C 3AE3C 3IAOA 2E76C 3AE2C 4U7JA 3AEAC 2JO1A 2ZT9C 1JB0J 4I7ZC 3O6QA 2QJPC 1FDOA 1R8EA 2QJYC 1OMIA 1VL2A 1PL5A 1ZMEC 5KLIC 3EWKA 4PV1B 1VF5B 2G3AA 3ABVC 2FYNC 4KT0J 4Y28J 3AEEC 1NYHA 4TT3H 3C8VA 1KQFB 1TU3F 3AEGC 2NZ2A 3RK3E 1DD3A 1WMKA 2OQQA 3AE9C 3AEDC 1KORA 1PIXA 4H0LD 1VF5C 3AEFC 4PV1C 3SFEC 4Z1MH 1NGMB 5L8RJ 2FXPA 3IN6A 2P10A 1U57A 2WSEJ 2QJKC 5M1BA 2YIUC 4RKUJ 2E75D 1RQUA 2E74D 2JP3A 3D71A 1RQVA 2BEQD 4H13D 4H0LB 3AECC 3AEBC 3Q3DA 4IL6X 2WSCJ 2H88C 4OGQD 3D6ZA 1OW6A 3H25A 3Q1MA 1S1CX 1OW8A 3Q5SA 1KMIZ 3GLMA 3AE7C 1DIPA 2WSFJ 1YQ4C 3SFDC 2D2CD 4H13B 1Q90D 2BEZF 4H0LC 1EXJA 1K04A 3Q5PA 1Y9BA 3AE5C 3AE6C 2MKVA 1ZP0C 1DD4A 2V7QJ 3AE1C 4OGQB 2WQYC 1OW7A 1GMJA 1HJ0A 3Q2YA 3LW5J 1ZOYC 2K9YA 1S5LX 2QIWA 4XFJA 4YXDC 1HF9A 2E74C 4H13C 2D2CB 3AE4C 1AJYA 4H44D 1YQ3C 2E76D 4R4LA 2O01J 4OGQC 2ZT9D 3GF3A 1IK7A 2J5UA 2FBWC 1KILE 3GMAA 4YTPC 2IDBA 3AE8C 3D70A 1ZRTE 2E75B 2QSIA 2E74B 1MKMA 3G9RA 1UIXA 1K05A 1EXIA 2D2CC 2H89C 3T97B 3RL0g
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YIU C;  4PV1 B;  1VF5 B;  4H44 B;  4RKU J;  2WPV B;  2FYN C;  4KT0 J;  2E76 B;  4Y28 J;  3LW5 J;  2ZT9 B;  4H0L B;  4I7Z B;  3C8V A;  2K9Y A;  1S5L X;  2QIW A;  4IL6 X;  2WSC J;  2D2C B;  5KKZ C;  2O01 J;  2WSF J;  1ZRT E;  1JB0 J;  2E75 B;  4H13 B;  1Q90 D;  2E74 B;  2QSI A;  2QJP C;  5L8R J;  2QJY C;  2WSE J;  2QJK C;  4OGQ B;  5KLI C; 
#chains in the Genus database with same CATH topology
 2BCC H;  2WVR A;  2Y0C A;  3LDE A;  2L35 A;  1FZA A;  1KQG B;  2JEX A;  1VQN P;  3JAK A;  1M1K Q;  2NR5 A;  2QJP B;  3ICX A;  4YXW H;  2Z3Y A;  3JAS A;  3L73 J;  1QLN A;  5CCG A;  4YXW G;  4OWF A;  2Y0P A;  4K0K B;  1J1D C;  1HGV A;  1QGK B;  3H1L J;  3SWY A;  3E7K A;  1SQQ H;  5EBL C;  5IJ9 B;  4QE7 A;  1D7M A;  4ZKI A;  5LA6 B;  1SQQ G;  4U7J A;  2KLU A;  5B1N A;  1M9N A;  1YTZ T;  2X6A A;  5ITZ A;  2BSK A;  2IBZ H;  3BPZ A;  1OCC C;  1EZV I;  2A06 H;  2IBZ G;  3NR7 A;  3OUF A;  2FYN C;  1N7S A;  2A06 G;  3AEE C;  4Y99 C;  1M57 D;  4YJ2 B;  3OMA B;  2JK5 C;  3AEG C;  3AG3 C;  3N7N A;  3DTU B;  1WB7 A;  3ITK A;  2HFE D;  1JNM A;  2IJK A;  4X1Y B;  4LGD E;  5KLI B;  3II6 A;  2WLN A;  3CCJ V;  1HBW A;  2HHH O;  1JEK A;  4WY4 C;  5BMV A;  1SQV K;  4IT5 A;  4PI0 A;  1Q86 W;  2XND H;  3MZW B;  1PM9 A;  2UXN A;  1U57 A;  3VMZ A;  2QJK C;  3MGN A;  2XND G;  4ZIB A;  2BCC J;  5JWP A;  2Y4U A;  3H1K E;  2JP3 A;  3ZN0 A;  2JR8 A;  2VRZ A;  1S9K D;  2HLD G;  2QWQ B;  1Q43 A;  3MHS C;  1GK6 A;  1FFX B;  3CJH A;  3KG2 A;  1SQQ E;  4JAA A;  2W6J H;  3ASO B;  4GOE A;  2BTQ A;  5LHH A;  1L0L K;  1SQQ J;  1VQ5 P;  5KUM A;  5TIS H;  1IX9 A;  5B1A C;  3C3T A;  1RH5 B;  3E8F A;  2IBZ E;  1NWQ A;  2YSU B;  1RSO A;  2A06 E;  1SQV H;  4R8C A;  1H2S B;  1Q90 D;  2EIJ C;  3HUS C;  2IJI A;  1SQV G;  3WB1 A;  4JV5 B;  1FYJ A;  1URQ C;  4DR1 B;  1WT6 A;  2MKV A;  3B2E E;  2OYH A;  1NKZ B;  2E5Y A;  1T6A A;  2LJ2 A;  1ZRT D;  5IYZ B;  4N23 A;  4O4J A;  2OYI A;  2GUS A;  3OFN G;  3L9D A;  2WLK A;  1S5L X;  4YXD C;  3MUD C;  1IZ3 A;  3CRQ A;  1LTG C;  1P84 H;  3TYY A;  5BU8 B;  2GA1 A;  2M3E A;  1FZF A;  2QM8 A;  1R3J C;  4DT0 A;  4HYO A;  1L0L H;  4NYK A;  1IXB A;  1RFY A;  4UCU A;  1L0L G;  1NTZ D;  3KKY A;  4MVO A;  4C7U A;  3OJA B;  4B3T O;  4KJM A;  4O2A B;  2AHY A;  3G4S V;  2EIM C;  1YSC A;  1IBL O;  1JTH A;  4MVZ A;  5KHH A;  1WA8 A;  2ODM A;  2XAQ A;  2QTS A;  5LMN O;  3UCS C;  2YIC A;  2O01 N;  4JQ0 D;  1ZTE A;  4D7T A;  2JDI G;  2ZM6 B;  5APW A;  2CUG A;  4I50 A;  1AJN A;  1P84 F;  3FAV A;  3GF7 A;  4R4M A;  3WU2 E;  4XDL A;  5TIS E;  2Q69 A;  3W7W A;  4IIJ A;  4DV2 O;  1K9M Q;  4AUW A;  2BTO A;  1NT2 B;  4TUY B;  3ASN C;  1SQV J;  1VQ4 P;  2N04 A;  1K4C C;  2QM7 A;  3O65 A;  4K8Z A;  1RF1 A;  2HG5 C;  5C8Y A;  1X8Y A;  3M06 A;  1OMI A;  3A0H E;  1SFC C;  3CCS V;  4HJG H;  5KLI C;  3IGA C;  1M8O B;  4JYA B;  2G3A A;  4DV3 O;  2CGN A;  4JZG A;  4HNA B;  1SQP D;  3SJB C;  3UM7 A;  5B3S C;  2M6Y A;  3AG4 B;  1XNR B;  3E8G A;  3FD9 A;  4ABM A;  1YTF B;  3CEI A;  5GTI H;  1K7D A;  1L0L E;  3HD7 D;  3VN0 A;  1BSM A;  1ZSP A;  2XOK G;  2OCC B;  2YIB A;  4P9O A;  3RYC B;  1DF5 A;  3G3Z A;  5LHI A;  1L0L J;  5GTI Z;  1ZWI C;  5IYB O;  5DJU B;  2H3O A;  4DR7 B;  3KZI Z;  1LUV A;  3E2E A;  1XDC A;  2HP8 A;  1YIJ V;  1JOC A;  2IZ1 A;  1I94 B;  2M3B A;  2DYS B;  3ETG A;  1LTJ C;  1GH6 A;  3S4R A;  1L1F A;  2ARH A;  1VQ5 V;  3VBB A;  1GMG A;  1NTM E;  1GL2 A;  2A45 I;  3M99 B;  3PP5 A;  1MZ9 A;  1AI5 A;  4PEL A;  4GKJ B;  4LH6 A;  1QBZ A;  5IJ0 B;  2YID A;  1QHT A;  1FZG A;  1PFI A;  3Q5S A;  2Z0A A;  4LNU A;  1TAE A;  2EBO A;  5JH7 A;  1XIL A;  4DR5 O;  3GHG B;  4NTX A;  3L74 H;  1H2N A;  1M57 B;  2A0L A;  3MHV A;  3AE5 C;  5CCH A;  3MHH C;  1ZUQ A;  3IFX A;  5K1P A;  1XHX A;  3RW0 A;  3CD6 V;  1SLQ A;  4LF6 O;  1Z56 A;  4FVM A;  2AGA A;  3CCM V;  2B9Z A;  1GKF A;  4FZ1 A;  1HUC A;  1IFI A;  1HF9 A;  2QIW A;  5H5N A;  3HE5 B;  1H2K A;  3CMA V;  4H13 C;  2D2C B;  4FM1 A;  1LWU C;  4MVS A;  5GW7 A;  3K04 A;  2E76 D;  3HB3 B;  3LSS A;  4PA3 A;  3RYH A;  4J42 A;  3CCU V;  4YTP C;  4PJ0 H;  2N1T B;  1U7M A;  2X7R B;  4TQF A;  2Q1K A;  1AR5 A;  3D36 C;  1V54 B;  2KZI A;  2N9B A;  5IJ9 A;  2P90 A;  3ZHV A;  5LA6 A;  2R9R B;  1LTA C;  1W2E A;  5KUK A;  3FGA D;  4ASU G;  5LL6 Y;  4H44 B;  1NR1 A;  1IFP A;  1KIL C;  1KYO D;  2P4V A;  2W6A A;  4XBF A;  2X6B A;  1FC2 C;  2K9J B;  1M7L A;  3H1J H;  2ZYA A;  5CCG D;  4YJ2 A;  1S0V A;  1J1E B;  1XMQ O;  3H1J G;  1D2D A;  3CX5 D;  4FFK A;  4X1Y A;  3AE2 C;  2E42 A;  3WG7 B;  1CEZ A;  1FD9 A;  4W7Y A;  1Y6X A;  2YI8 A;  1K8A W;  4OGQ C;  5KKZ B;  1P49 A;  3RK2 C;  2OCC C;  4DV7 O;  4Z2W A;  4B7K A;  5CB4 B;  1WP7 A;  1HNW B;  1HDJ A;  4ASW A;  1L4A B;  2Q6A A;  1KB9 I;  4R50 A;  1NU1 K;  5IWA O;  4DV4 B;  1Y8A A;  1VQO P;  3BY6 A;  1FXH A;  1IZN B;  4GCZ A;  4NB5 A;  1N7S D;  1N0J A;  2QDO A;  1AB3 A;  2PYL A;  4PJ0 E;  2Q73 A;  3K0D A;  4X8A A;  1FFX A;  1GD2 E;  1FU1 A;  3H9V A;  2YI9 A;  4BIU A;  1Q2N A;  3FXD A;  5FPO A;  4JI2 B;  1LTS C;  5DED A;  1F4N A;  2Q7C A;  1S5L E;  1X22 A;  4EYY Q;  4U3J B;  1VQL V;  4FJC C;  1MMM A;  3H1J E;  1R5L A;  4H0L B;  1W59 A;  1PNL A;  4LP8 A;  3CCR V;  5AW9 B;  3V2N A;  1FZE A;  4O4I B;  1M57 C;  1NU1 G;  3CCL P;  5IYZ A;  3H1J J;  2Y0I A;  2HEP A;  4EKW A;  2HFE C;  2B9B A;  1F23 A;  3H1I H;  2UUA B;  3GLM A;  5KLV H;  2Y48 A;  3S3W A;  1IBM O;  2WLH A;  2VQF O;  2M5A B;  3H1I G;  3V2P A;  1KV4 A;  3SFD C;  1JUN A;  5GTH H;  1HW7 A;  1Y9B A;  1BDC A;  2DWE C;  4DYL A;  2B88 A;  3SSU A;  5BR8 B;  3OA7 A;  4OGQ B;  4FLY A;  1YZB A;  2Y69 C;  4O2A A;  1N32 O;  2CAZ C;  5GTH Z;  1VQK P;  2P5O A;  1QVG O;  4LF4 O;  1XMO B;  1EDK A;  2EIN C;  3CC2 P;  3L72 E;  4LF7 B;  1MZE A;  1R3I C;  3VQX A;  4X1I B;  3TF5 A;  2XTA A;  4NXM B;  1K5Q A;  4U7O A;  1NBM G;  1URF A;  4R4L A;  4I0X B;  3FX0 A;  2H94 A;  2Q9L A;  4JAU A;  2B1G A;  4JI5 O;  3JAL B;  3ZMU A;  1N86 A;  3D3Q A;  3ABT A;  3L70 H;  5DEC A;  4TUY A;  4CS2 A;  1ZLZ A;  1NTK K;  4P9P A;  1KP3 A;  1RE3 A;  3L70 G;  1H8E G;  3KHU A;  3ZMV A;  4LF8 B;  1QVF O;  1NU1 E;  3MP7 B;  5E79 H;  1KC8 Q;  1N8R W;  2PY5 A;  3B5N B;  1OX3 A;  4X1K B;  1BE3 H;  2LGQ A;  2XAF A;  5E79 Z;  3AK2 A;  3OW2 U;  4KL1 A;  4K0K O;  3E86 A;  2WTY A;  4CC6 A;  1K92 A;  2LGW A;  1JX9 A;  1L0N E;  1BE3 G;  3H1I E;  3KCY A;  2W90 A;  4LR3 A;  5KKZ C;  2HPC B;  2KZJ A;  1ZL8 B;  3H1I J;  5EIB D;  5KLV J;  2OTJ P;  3N2K B;  1IC2 A;  1V9P A;  2IU3 A;  5CA1 B;  3RYC A;  4RES B;  3OEH G;  4DR3 B;  4JYC A;  2AZ2 A;  2QKA A;  1GN4 A;  3QTC A;  5IY5 C;  4HH2 A;  1EZV E;  3SPJ A;  1NTK G;  1JY3 P;  4PV1 B;  1VF5 B;  1KUQ A;  4Y28 J;  1RHZ B;  2WA3 A;  3CXH I;  1LTT C;  3LID A;  1H38 A;  1FJG O;  1CZQ A;  4O2B B;  4CBC A;  2Z5H A;  2ZXE B;  1JVM A;  1SRY A;  1MV8 A;  1KQS U;  5DN6 G;  3H1K D;  2QTO A;  1VQ9 P;  2QM4 A;  2IJJ A;  2FFD B;  2R9A A;  2Q3E A;  2YIB D;  2C9N Y;  1LT9 B;  2NN4 A;  2JS5 A;  4UCO A;  1SQQ D;  3L70 J;  5IJ0 A;  3P8C E;  1Q81 W;  4ZKP A;  1P7B A;  4GOD A;  3B8E B;  4YIP A;  1FS0 G;  1JR9 A;  4TV9 B;  2OYQ A;  3GHG A;  1BE3 E;  2IBZ D;  4BXL A;  1DTO A;  1H2M A;  4I55 B;  2XZR A;  4L76 A;  3RYF B;  3OMN B;  4CS4 A;  1P84 I;  2UXC B;  4DUZ B;  1BE3 J;  2VWK A;  4JI1 O;  3FB6 C;  1GL2 D;  3U0Z A;  1B6Q A;  4UV8 A;  4NTW A;  4X66 O;  1M93 A;  3HD7 C;  3JD4 A;  3HE5 A;  2HJD A;  4JPR A;  3ABM B;  1PD3 A;  1NTK E;  1SKV A;  1KMI Z;  1Y47 A;  1VQK V;  1ZW0 A;  4DR1 O;  4R7C A;  1SZT A;  3ZRV A;  4DK1 A;  3V4W A;  3I55 P;  2N1T A;  2RNB A;  4DV5 B;  1OV9 A;  4UCT A;  5CCH D;  3CC7 P;  1AI6 A;  2ZR3 A;  3LW5 J;  5FPR A;  5KMG B;  3ZHT A;  2XUM A;  2N9Y B;  4WB4 A;  3HTK B;  3AE4 C;  4QJF B;  3V6I A;  3KXD A;  1BS3 A;  3CHX A;  1SP4 A;  3CWB E;  3K9A A;  2Q5Z A;  3GF3 A;  2K9J A;  1QU7 A;  3K03 A;  3C1L A;  2QSI A;  1JJ2 U;  3L71 E;  3CE2 A;  5CA3 A;  1J5E O;  1ORQ C;  3LSQ A;  4PDL A;  3MAQ A;  1M90 W;  4IYH A;  1OCO C;  1MZF A;  4FM0 A;  3TSI A;  4JI3 B;  2Z5I A;  1FOS F;  3QO7 A;  4UCV A;  4B08 A;  1Q82 W;  5CB4 A;  4RAI A;  4X88 A;  1L4A A;  2K88 A;  2E75 C;  2Y9Y A;  4XA4 A;  4TQD A;  2A45 H;  5LGN A;  1HNZ B;  2A45 G;  1K5S A;  3VTP C;  4TWK A;  2RJZ A;  1N33 O;  1L0L D;  4HZ3 A;  2E76 C;  5CN0 A;  1K73 W;  2H8P D;  1MFT A;  1QL1 A;  2JGU A;  2JO1 A;  5KAI H;  2YMY A;  4I7Z C;  1JMK C;  2PUS A;  4JYA O;  2VWJ A;  1JJO A;  2R5B A;  2UU9 O;  4DO2 A;  1NAY A;  2YXL A;  5KAI Z;  1XNR O;  5CBN A;  1FOS E;  4DK0 A;  4IHJ B;  1FZC C;  1BGY H;  1BHB A;  5KAF Z;  2ZYD A;  3NTN A;  4GT1 A;  4U3J A;  1BGY G;  2DYR B;  2QEX P;  3STZ C;  1NR7 A;  1SZX A;  4DR7 O;  1CPY A;  2CGO A;  3VQY A;  1NTM D;  3V2R A;  1L2P A;  1PIX A;  4O4I A;  1S2E A;  2XU6 A;  1I94 O;  3O6Q B;  3OEE G;  2O01 H;  5CCG C;  1LR1 A;  3QO8 A;  3WUT A;  5BXZ A;  3FXE A;  2M5A A;  1YHQ P;  2P06 A;  4GX1 A;  1YDX A;  4KXR A;  2M8R A;  2N05 A;  5KHK A;  4RKU J;  4JYB A;  2L5G B;  1A02 J;  5EBW C;  1U7J A;  1Q6I A;  4LFB B;  1KD1 W;  1G2C B;  2IYO A;  2FYU K;  5H6Q A;  1PKX A;  3I55 V;  1N7S C;  3APO A;  1OW6 A;  2B1I A;  1X59 A;  3CB2 A;  3E1I A;  3CC7 V;  4FLW A;  1OCR B;  4X1I A;  2G38 A;  1IFD A;  3P3N A;  4I0X A;  4FLU A;  4B3M B;  4UB8 E;  1K04 A;  3Q5P A;  2ETN A;  3JAL A;  4O4H B;  1EN4 A;  2F95 B;  3CCJ P;  1BGY J;  1GMJ A;  1AR1 B;  3SJQ C;  1SQG A;  2A79 B;  4GKK B;  1V55 C;  4MT8 A;  1WB8 A;  5CMU A;  4DZO A;  4LC1 A;  1FAF A;  2Q0O C;  3B5N A;  2FYU H;  3ABK B;  5CJ4 A;  4X1K A;  3BRT B;  2YXQ B;  2FYU G;  2O01 J;  2HPC A;  1XNQ B;  1IK9 A;  1GM8 A;  1ZL8 A;  5J2U B;  4KFM A;  5C39 A;  4CH5 A;  5AG2 A;  3H1L G;  4E2L A;  3JC2 2;  4M3L A;  1K05 A;  2ZE5 A;  3N2K A;  5CA1 A;  2R3C A;  4BIZ A;  3CC4 V;  1G8M A;  1XUQ A;  3PJS K;  1DLB A;  1PPJ H;  4LCU C;  4ZHQ B;  1PPJ G;  2OYH C;  2QE7 H;  1PGP A;  4O2B A;  2QWR B;  2OYI C;  2BE3 A;  3PLN A;  3OMI B;  3GG2 A;  1NQT A;  4O4L B;  1YTF D;  2ILM A;  1XQ8 A;  4WFF A;  1SQX K;  2GSM B;  2FFD A;  4EFB A;  1HNW O;  2V4H A;  3JSL A;  2IW5 A;  2EIK C;  1LT9 A;  3JD1 A;  1PL5 A;  4DV4 O;  1L8D A;  1LT1 A;  2ADP A;  4DUY B;  1M1J B;  3K9S A;  3P3P A;  1KB9 E;  4TV9 A;  3TET A;  3L73 E;  5L3E A;  1HTL C;  1YJ9 P;  3HKB A;  3C8V A;  2BCC G;  1TU3 F;  3IJ4 A;  4I55 A;  2FYU J;  3G4S P;  3RYF A;  3C90 A;  3RYH B;  2YEV B;  3H1L E;  3AG1 B;  5H9C A;  3AE9 C;  1YHQ V;  3CCE P;  3B4S A;  3FYE B;  1FE6 A;  1QLE B;  2KB1 A;  3P32 A;  4J11 A;  5EIB C;  4JTA B;  1SQX H;  2EIL B;  3SJC C;  2Q8V A;  3ETQ A;  5LMU B;  1PPJ E;  3BCC H;  1SQX G;  1EZJ A;  4DCK A;  3BRC A;  3BCC G;  5AW3 B;  1J2J B;  1RF1 C;  1RQU A;  3D71 A;  1OCR C;  4MW3 A;  4QMA A;  3M7M X;  5IT9 N;  2BEQ D;  3TGU H;  3IR9 A;  2PGD A;  5LP6 B;  1GRJ A;  1VDF A;  3WB2 A;  2UUA O;  1O9G A;  4UB6 E;  5KMG A;  1HNX B;  3CCS P;  3CME V;  1RY3 A;  4LF9 B;  3KCX A;  3AE7 C;  2IU0 A;  4JI6 O;  3HTK A;  2NPS B;  3PRJ A;  3L72 D;  5EC1 C;  5BR8 O;  2D2C D;  2K9P A;  2BCC E;  4BAY A;  4KP4 A;  4ZI7 B;  1QL2 A;  2AEJ A;  3ABL C;  4I2L C;  2Q4P A;  3E22 B;  1XMO O;  3GVM A;  2N1T D;  3AG2 B;  3DC6 A;  1HJ0 A;  4LF7 O;  2KS1 B;  4NXM O;  1RF0 A;  1YIJ P;  1NU1 D;  3ETD A;  5D5P A;  3CXH H;  1N36 B;  2RN9 A;  1YI2 V;  4H44 D;  4KHP O;  2W6J G;  4J41 A;  1GL2 C;  1YQ3 C;  5JVD A;  2J5U A;  3B09 A;  3BCC E;  3ZMS A;  3ML0 A;  3H1I D;  1L0N D;  3APQ A;  3VOP A;  1SQX J;  1NJI Q;  2B5U A;  2PP6 A;  5B1B C;  3JD3 A;  4B3R B;  3BCC J;  1AR4 A;  1GW3 A;  2HLO A;  2OTK E;  4NPE A;  5DM6 V;  2V7Q H;  3LNM B;  2OIE A;  4WWI A;  2ATK C;  2WWW A;  4J9Z B;  4LF5 O;  4D6T H;  2ZT9 B;  2OTL V;  2N74 A;  1BCC D;  3K08 A;  1SQF A;  3F5T A;  3TNU B;  3CXH F;  4D6T G;  2PGG A;  5LHG A;  5CCH C;  2RMK B;  4IHJ A;  3G6E V;  3SGI A;  1EZV D;  2ZAE B;  1KFN A;  4N78 E;  1L4A D;  1RPR A;  5LBQ A;  3CD6 P;  1T3U A;  3OTO O;  3GWO A;  4CS3 A;  3CYO A;  3CCM P;  2GBO A;  2CPS A;  1YJ9 V;  4B86 A;  1UFI A;  3O6Q A;  2QJP C;  1Q7Y Q;  3CMA P;  1NS1 A;  2UWJ E;  4XE5 B;  5JCO A;  2JGD B;  2ZIO A;  3GWK C;  5J2T B;  4TOI A;  3CCE V;  2FXM A;  4N3Y B;  3P8C D;  4QE9 A;  1PP9 H;  4RQE A;  4IL6 H;  3RBX A;  3CCU P;  1UPG A;  1PL4 A;  1FJK A;  3LNN A;  3N4X A;  1PP9 G;  1IFJ A;  1BE3 D;  2ZYG A;  3RK3 B;  4IL6 Z;  3K57 A;  2FY8 A;  1EM1 A;  2OCH A;  5KA6 A;  1G2C A;  1SQV E;  3AED C;  1N73 B;  4H0L D;  5F2V O;  1D5A A;  4UVC A;  1NVP B;  4UUJ C;  2YS8 A;  4J80 A;  2HR3 A;  1RP3 B;  1CI6 B;  2EX3 A;  1KBH A;  3JCU H;  3K5B A;  4D6T E;  2QGN A;  1VF7 A;  2UXC O;  1PNK A;  2H8P C;  2JJ1 G;  3WFV A;  4DUZ O;  1NTK D;  2XKM A;  2Y9Z A;  3JCU Z;  3OT7 A;  4D6T J;  1P84 E;  1RQV A;  4O4H A;  1QQC A;  1US6 A;  4GOF A;  1AP6 A;  3BAA A;  4J9Y B;  3JAT B;  4OGQ D;  4UCS A;  2K1A A;  3U1A A;  1D5N A;  3KZI H;  2W27 A;  4DW0 A;  4C46 A;  1JY2 P;  3CWB D;  1PP9 E;  1SQB K;  3AE6 C;  4DR6 B;  3ASO C;  4RWU A;  2GUZ B;  2DW3 A;  5J2U A;  1I08 A;  3T1C A;  2VRS A;  2WQY C;  4FK5 C;  1PP9 J;  4K35 A;  3RFR A;  5AW5 B;  4TV8 B;  3L71 D;  1NOH A;  3FYI B;  4BWN A;  1S72 P;  1DEB A;  2Y0E A;  4NKG B;  1IBK O;  5AW8 B;  1X9V A;  3B5N D;  4ZHQ A;  5KA5 A;  3CCV V;  5EZY B;  2ITC C;  1VQL P;  1U96 A;  3X2Q B;  5DJT B;  1HR0 B;  4YY3 B;  3BFR A;  5AW1 B;  3CCR P;  2ZR2 A;  4YHH B;  1FAV A;  4O4L A;  4JI3 O;  3ZHU A;  4DR4 B;  1SQB H;  4AQR D;  4DW1 A;  2H89 C;  3L74 G;  1Q86 Q;  1XOU A;  3H6P A;  5BVZ A;  1SQB G;  5GTI E;  3ZBH A;  2EZO A;  1EQ7 A;  3VYI A;  1DX7 A;  5IDJ A;  2X0L A;  1HNZ O;  1EBO A;  3J81 N;  1M1J A;  4PV1 D;  1VF5 D;  1WN7 A;  2JEU A;  3B8M A;  3BA9 A;  4J7J A;  3OUS A;  4DRX B;  4J10 A;  2YEV A;  4GKG A;  5L3G A;  1XEQ A;  3VMY A;  3MD0 A;  2HOD B;  4JAV A;  1I5X A;  3F7V C;  3H1H H;  4HAM A;  4LBE C;  3EFG A;  4X65 B;  4OPA A;  3K58 A;  3H1H G;  2CTW A;  1E1R G;  3U11 A;  3EWK A;  1W0K G;  4QPJ A;  3RVZ A;  2R5D A;  2CTQ A;  3L75 H;  2JJL A;  3ZRS A;  2WT7 B;  3JD0 A;  1VQ7 P;  4TT3 H;  2ZD9 A;  1RE3 C;  3L75 G;  4I5S A;  4EDF A;  2DQ3 A;  4TT3 G;  2W6I G;  3NXS A;  4B3S O;  3RK3 E;  2I8D A;  1WMK A;  1M56 B;  2YIU B;  2KG7 B;  1FZB A;  1USE A;  5LP6 A;  3L74 E;  3P8M C;  3G71 V;  1SQB E;  4N6J A;  5B66 Z;  2QA4 V;  1SC5 B;  4J7K A;  3GB7 C;  3AG4 C;  1NGM B;  3L74 J;  1OWA A;  1SVF A;  1SQB J;  3C9I A;  4MVQ A;  2ZXW B;  3ZIA G;  4MW8 A;  2NPS A;  2XAH A;  4LFB O;  4JI4 O;  2XT9 A;  2QWP B;  2RCV A;  4FZ0 A;  5D5Q A;  4ZI7 A;  2E74 D;  3SPC A;  1MUU A;  3E22 A;  1BDD A;  1COW G;  1GZL A;  1S5L Z;  2W8Z A;  1JPX A;  2KS1 A;  1N4C A;  2DYS C;  3DXR B;  4PDV A;  3F7Y C;  1GN3 A;  4B3M O;  2WLM A;  3BA8 A;  5KLV K;  5AW2 B;  3G6B A;  3M0D A;  3ZMZ A;  3H1H J;  1TUE B;  2QSA A;  2BEZ F;  2ZVO B;  1OZH A;  5AVQ B;  4I9W A;  1S72 V;  3OAK A;  3EXA A;  1ZP0 C;  2AZ0 A;  3L75 J;  4LFA B;  2K3R A;  4IYI A;  4WFE A;  2ZJS E;  2PF4 E;  3OE7 G;  1YYC A;  3GHG C;  5LGU A;  2UXB B;  4IFF A;  1KZU B;  2CTP A;  1XNQ O;  2BOC C;  4JI7 O;  1XL6 A;  3TNU A;  2CH7 B;  1VQ8 V;  1IK7 A;  2FBW C;  3OM3 B;  3SPG A;  3GMA A;  3AK3 A;  1BSN A;  1YTZ I;  4PD4 I;  3I5D A;  5KLV G;  1USD A;  2Q9I A;  2AXT Z;  1Q3E A;  2D2C C;  4JGS A;  1OCZ B;  3FKS G;  1JM0 A;  2YKQ A;  1AP5 A;  3U1C A;  2R3S A;  1H88 A;  5CMZ A;  3SPH A;  1XBL A;  2JGD A;  3SYA A;  2N1T C;  5J2T A;  1HVV A;  1Y74 B;  4L8J A;  2CE4 A;  4MTG A;  4LFC O;  1V54 C;  3OW2 O;  2LXB A;  4ZNC A;  3HKD B;  3D6Y A;  5CBH A;  1KB9 D;  1NTZ K;  4WFB V;  3L73 D;  2QKC A;  1WAZ A;  4X64 B;  5IE9 A;  4H44 C;  4RO0 A;  1VQ7 V;  1X79 B;  2GTA A;  4IFD K;  3H1L D;  1FPO A;  1N73 A;  4DUY O;  5FNV B;  1CI6 A;  3M8A A;  3T4Z A;  2IH1 C;  3ABV C;  1R6T A;  1J1E C;  1HWT C;  2UUB B;  4OPH A;  3I5C A;  1JA8 A;  2KNC B;  2P58 A;  1PPJ D;  3JAM N;  3WG7 C;  2EUL A;  1LP1 B;  2LW1 A;  1YXB A;  2VQE B;  5KLV E;  1CXZ B;  1KQS O;  4K8X A;  2V1D A;  3OR7 C;  4K3A A;  1NTZ H;  5HFL A;  3JAT A;  5GTH E;  2DQ0 A;  2JS3 A;  2PI4 A;  5LMU O;  1L4A C;  1NTZ G;  2ZCE A;  2ZVN B;  3E35 A;  1SES A;  1JMB A;  2W6B A;  5AW7 B;  2JIZ G;  5AVU B;  4QGP A;  4NVP A;  1PGJ A;  3B8N A;  4LWS B;  1ZXG A;  1T5E A;  2CK3 H;  5H2F Z;  2BCC D;  1Q5O A;  2GUZ A;  1HNX O;  4QPK A;  3SWK A;  4LF9 O;  2QR4 A;  5EYP B;  1R1B A;  4TV8 A;  4ZOL B;  3D6Z A;  2O57 A;  2PYJ A;  1AJP A;  1I5Y A;  4UVA A;  3L70 E;  3F89 A;  2DE0 X;  3TXQ A;  2GDS A;  2OT5 A;  3D3I A;  3NFQ A;  1WPX A;  2W0X A;  1IO4 A;  1R3K C;  5EK0 A;  1FXK B;  5EZY A;  4H0L C;  5E79 E;  1EXJ A;  5J9P C;  3GW6 A;  1IXM A;  1LUW A;  1F4M A;  1H2L A;  2LXC B;  2WAM A;  3H32 B;  5KJ7 A;  3HKB B;  3BCC D;  1JFF B;  1OW7 A;  2GUV A;  1W2B O;  1Y76 A;  1K8A Q;  1MOF A;  2Z4E A;  4RJT A;  2A06 D;  3A0B Z;  3VMA A;  1N36 O;  2ZQM A;  5LMN B;  2HJF C;  2NNU A;  5FLX N;  2PAJ A;  3UQ8 A;  1AV1 A;  1NTZ J;  4DV2 B;  2ZXX A;  1OCZ C;  1VIB A;  5KHG A;  4PA4 A;  1KKD A;  2FYZ A;  4GX5 A;  4FLZ A;  3SYO A;  3A7O A;  1HWY A;  4IOI H;  5B5E Z;  4WF9 V;  1JQ0 A;  4JV5 O;  3MIW A;  4AYC A;  2E74 B;  2I1J A;  4N78 D;  4DRX A;  3G9R A;  3M9Q A;  1W2B U;  2YXR B;  2HOD A;  4DR2 B;  3T97 B;  1QCE A;  1AQ5 A;  4MTX A;  2OAR A;  2KB7 P;  2KLV A;  5EC2 C;  2F43 G;  3K5L A;  1YJW V;  1NH4 A;  4DV3 B;  4Q6G A;  1H2G A;  2HVK C;  2QJY B;  3R4Y A;  1X4T A;  1E79 H;  4X20 A;  1ZV8 A;  2NRG A;  4BW9 A;  3A2A A;  2WT7 A;  2WSC H;  4I9Q A;  4YJ3 B;  1E79 G;  5L3F A;  2LO1 A;  1N34 B;  1Q6U A;  2ZIM A;  1FS0 E;  3E83 A;  4FM2 A;  1PV3 A;  1B06 A;  1RE4 A;  3B5N C;  2KG7 A;  1EFR G;  1W0J G;  2WA4 A;  4R6Z A;  1GM7 A;  3ZDM A;  4FPP A;  1SQV D;  2HVJ C;  2ZM6 O;  2AEM A;  3HKC B;  1ZME C;  1QLE D;  3K79 A;  4KT0 J;  3MTU E;  3PTZ A;  1OVV A;  4D6T D;  4HB1 A;  5JVD B;  2XAS A;  3ABU A;  1OVR A;  1VAR A;  1F7Y A;  2GHY A;  1P84 D;  4L74 A;  1K3E A;  3CC4 P;  4PV1 C;  3B77 A;  4GX0 A;  4OX9 B;  1VF5 C;  1AI7 A;  3DXR A;  4DJG A;  4W4L A;  2YXY A;  1WLE A;  2P6J A;  2JWD A;  3TK1 A;  2DJV A;  1M1K W;  5KAF H;  3DGE A;  4XDJ A;  3FB7 C;  1KYO H;  2NPS D;  2FFD C;  1ZAU A;  3ZED A;  3CRM A;  5AVX B;  1LT9 C;  2E5L B;  1BHA A;  1QR9 A;  1PP9 D;  3AEB C;  3CL3 D;  3E1R A;  1N8R Q;  2WSC J;  3WB0 A;  4BW5 A;  5APS A;  4JF7 A;  1T2K D;  4UFZ A;  1S5H C;  1R5S A;  1BL8 A;  2JVD A;  1PL0 A;  4NPF X;  4DV0 B;  4DR6 O;  2XAG A;  3MDS A;  2YO2 A;  2CH7 A;  2AHZ A;  5AVZ B;  3RT3 C;  2DWD C;  1KYO F;  1WRG A;  2WPS A;  5APT A;  1I7F A;  2DN9 A;  2LP7 A;  3ABM C;  3A3Y B;  5TJH A;  4GKJ O;  1PZQ A;  3KPE A;  2EJR A;  2C2A A;  2WPR A;  1S3J A;  2E74 C;  3F5H A;  3CX5 F;  2Q7G A;  1KFM A;  4EIJ A;  4U7N A;  1AQT A;  5JQG B;  2KYV A;  1HR0 O;  3H01 A;  4YY3 O;  5KAI E;  4U3F H;  1Y74 A;  2ZT9 D;  2KSE A;  2OYO A;  4PA6 A;  4YPC A;  4U3F G;  4JZ2 A;  3HKD A;  1XMQ B;  4ASV A;  2C0X A;  4F4L A;  5L3C A;  5AVY B;  4JYY A;  1H8A A;  4D7S A;  5H6R A;  1BGY E;  1J1D B;  1TUB B;  4WFG A;  3RVY A;  1FKA O;  3ZJZ A;  1Q81 Q;  5CBG A;  3CME P;  4FLX A;  3Q5R A;  3LDC A;  4JI8 B;  1BT8 A;  1GM9 A;  2IYP A;  5FNV A;  4W4K A;  4GIF A;  2Q6Q A;  1SS3 A;  5IWA B;  1FDI A;  2IPP A;  3W7T A;  1NZ6 A;  3ZHQ A;  3CCQ V;  2RKL A;  3CPW U;  2KNC A;  3UIA A;  2FYN B;  2FTK A;  2YIA A;  3M9B A;  4Y99 B;  1LP1 A;  1RF0 C;  3OD4 A;  1YJN P;  1MSW D;  3IAO A;  3JYC A;  4X65 O;  3RK3 D;  3AG3 B;  1JB0 J;  3G80 A;  1G1J A;  2YC0 A;  4I1L A;  3L74 D;  5JJE B;  1YI2 P;  3CP1 A;  5AW6 B;  1NVP D;  1SQB D;  4WY4 B;  1KQF B;  4JPZ B;  4U3F E;  3IC7 A;  4OVN F;  4L75 A;  1LNQ A;  5K5G B;  3VP8 A;  4LWS A;  4NPD A;  2QJK B;  2QRX A;  2OQQ A;  4U3F J;  1I0H A;  2QE7 G;  5EYP A;  4Z1M H;  4ZOL A;  2OTL P;  3N2G B;  4Z1M G;  1G6U A;  4JI0 B;  1T3J A;  2QWO B;  1FJP A;  3WUU A;  2DYR C;  5C93 A;  2FXO A;  3G6E P;  2P10 A;  1WJZ A;  2PTM A;  5M1B A;  3ZS8 C;  1HGZ A;  1N2D C;  4PD4 H;  1FBM A;  5B1A B;  1FXK A;  4X62 B;  1M90 Q;  2ZDI A;  1MNG A;  1K9M W;  2FYU E;  3HUS B;  2EIJ B;  2BOB C;  2IH3 C;  3H32 A;  3JAW A;  3K06 A;  5JCO C;  1JFF A;  2FL4 A;  2W0F C;  1URQ B;  2H88 C;  5APY A;  1Q82 Q;  3R65 A;  3SPI A;  4QNH B;  1ZR4 A;  3PN1 A;  1VF6 A;  3ETE A;  2A3Q A;  1OW8 A;  5CJ0 A;  2QG4 A;  3ZMT A;  4JI2 O;  2M7W A;  3H1J D;  3HKE B;  4AI8 A;  5APQ A;  1VQP V;  2L91 A;  1OIP A;  1YQ4 C;  2XNX A;  4UXN A;  4LFA O;  4PD4 F;  3KYQ A;  2F1M A;  2WPD G;  1K73 Q;  4X9Q A;  2FML A;  4CZZ A;  2WLI B;  1LTI C;  2UXB O;  5KJ7 D;  4OH8 B;  3QWO C;  3HR0 A;  3T97 A;  2EIM B;  1JO5 A;  3H1K H;  2F4V B;  2ZE6 A;  3A2F A;  3E89 A;  3TGU G;  3H1K G;  1AJY A;  2QVA A;  4AHC A;  4JTC B;  5APV A;  2Q0A A;  1ARO P;  1OVU A;  4NXN B;  3SJA C;  1X0T A;  4YJ3 A;  4PD4 E;  1K97 A;  2A7W A;  1JCC A;  2Q7E A;  1M4U A;  1JY2 O;  4CC5 A;  3T4D A;  3E8H A;  1G1X B;  2WLL B;  4P30 A;  1NHL A;  3ASN B;  4GX2 A;  3ABK C;  4G28 B;  3IFM A;  2ZE7 A;  1SF9 A;  1SET A;  3EVK A;  2L6L A;  4HYT B;  1YJN V;  1NO4 A;  2H7H A;  1S5J A;  3HKC A;  2QJ1 A;  4CH6 A;  1AVY A;  5L3D A;  2P1J A;  1AIL A;  1S77 D;  1SFC B;  1FJG B;  4PDM A;  4X64 O;  3W7U A;  1KD1 Q;  2UUC B;  1G1I A;  5KTB A;  3CRR A;  2JJ2 G;  5B3S B;  1SQX E;  3CSX A;  3K3W A;  3BAS A;  4N21 A;  1TVK B;  4BRY B;  4LF8 O;  1XTG B;  5KLV D;  2KK7 A;  2WSF H;  1M56 D;  3V4Q A;  4DXW A;  1VL2 A;  2UUB O;  3TGU E;  2AEF A;  3CCV P;  2VS0 A;  4PA7 A;  1JMM A;  2V7Q G;  1SA0 B;  1OJH A;  2VQE O;  3TGU J;  2OIG A;  3H1K J;  3KQG A;  4WVZ A;  3CLQ A;  3K5N A;  1LTJ B;  3QF7 A;  4JI1 B;  3F5W C;  3AK1 A;  3WU2 H;  3CI9 A;  3P7K A;  4OXS A;  2XV5 A;  3AG7 A;  4DV1 B;  4UVB A;  4KHX A;  4X66 B;  1LGH B;  2KI7 B;  4MSW C;  1EN6 A;  2ZNI A;  3RL0 D;  3WU2 Z;  1M1J C;  4DR3 O;  4GZR B;  1VPC A;  2ZFC A;  1THZ A;  2J58 A;  3FWN A;  5TIS Z;  3RWR D;  1OHH G;  3A0R A;  3P30 A;  4YIO A;  3CS5 A;  5KHJ A;  1H8H G;  3ZHS A;  3L70 D;  2IJH A;  3OAA G;  1NH2 B;  3AG1 C;  1A32 A;  3A0H H;  4WCE V;  3CXH E;  1B04 A;  1QLE C;  1MG1 A;  3RGB A;  1NTM K;  2LQT A;  2LFR A;  3VQW A;  5HFM A;  2EIL C;  3A0H Z;  4BWA A;  1KEC A;  5AVT B;  4O9B A;  3Q1M A;  2CTR A;  3WMM 0;  1VQN V;  3VQV A;  1XTC C;  5JQG A;  4EB6 B;  2P7T C;  2WSF J;  4G2K A;  4WBA A;  4H13 B;  5B1O A;  1BZK A;  2KP8 A;  1KQL A;  3EQ2 A;  4TLF A;  2JWA A;  5LP6 C;  1LWU B;  2ZNJ A;  1W5C E;  3S1K A;  4J7Z A;  1DD4 A;  2JDI H;  2V7Q J;  3AE1 C;  4RUF A;  1J5E B;  2JRI A;  3BVH A;  3L4F A;  2ITA A;  3G71 P;  2Q7H A;  1TUB A;  1ZOY C;  4Z1V A;  2QA4 P;  2NPS C;  1EDI A;  1NTM H;  1GAX A;  5K1X A;  2YKO A;  1NTM G;  2MW2 B;  3THO A;  2WSS H;  5AW4 B;  1YVW A;  2JKV A;  5APU A;  3RN4 A;  1LTB C;  1KIL B;  3R2P A;  1T2K C;  2P4K A;  2WSS G;  3AG2 C;  3D70 A;  1K34 A;  3IC9 A;  4DR2 O;  4QIW F;  1N33 B;  4IGG A;  1MKM A;  4DV5 O;  1XHZ A;  3L35 A;  4EI2 A;  2UXD B;  1IDS A;  4IL6 E;  3ZN1 A;  3RL0 g;  3M0D C;  3IF4 A;  1R3L C;  4JTD B;  3W7S A;  1OFC X;  1YBK A;  2WPV B;  2UU9 B;  1GN6 A;  1EDL A;  1KN7 A;  1VMG A;  3K0G A;  4H37 A;  1N34 O;  4HBN A;  1FXV A;  2MJZ A;  4WY4 A;  4ZMD A;  2YMK A;  3RK2 B;  3SYC A;  5FL7 G;  2A9H A;  4X89 A;  3G67 A;  4PDR A;  3JCU E;  4I6M C;  4MVM A;  3BVO A;  3AEA C;  2ZT9 C;  3T1H B;  2HKO A;  1R8E A;  1KYO I;  1QX8 A;  1Y76 B;  3BHP A;  4WFH A;  3N2G A;  5LXT B;  1P7G A;  5CA0 B;  3PH0 A;  1VQ8 P;  3BRV B;  2RQ6 A;  1GU5 A;  3UT5 A;  1K33 A;  2ZIN A;  2WPQ A;  1NTM J;  2UXX A;  3ZRX A;  3HPL C;  3CX5 I;  3KZI E;  5AW0 B;  3SR2 C;  1NKN A;  4G27 B;  2O3J A;  1H0T A;  4OX9 O;  3Q4H B;  3HUS A;  2WIT A;  1GDT A;  4JF3 A;  2R72 A;  1URQ A;  1BQZ A;  3AEF C;  3SFE C;  1DF4 A;  4I4T B;  1N7L A;  3UKM A;  2KIK A;  2SPZ A;  1G4Y B;  1KC8 W;  3N27 A;  5L8R J;  3USS A;  1B3Q A;  1ROP A;  3HKE A;  3IN6 A;  4AQY B;  3RK3 C;  1JY3 N;  3MUD A;  2E5L O;  1IUR A;  1GK4 A;  2E75 D;  2XHB A;  3DC5 A;  4X20 B;  1N73 C;  1AI4 A;  3Q3D A;  2WLI A;  4E4E A;  2IFM A;  4MVU A;  5LGT A;  2Y69 B;  3W7X A;  4DV0 O;  5B66 H;  4A7P A;  1Z2G A;  3E8B A;  3M0A A;  1E5W A;  2EIN B;  2X6C A;  3OTF A;  3T2M A;  1DIP A;  3RGU A;  3JSV C;  4JBZ A;  2DMX A;  4PJ0 Z;  4HKZ H;  5BU5 A;  1KU9 A;  5LYJ B;  4DV6 B;  4FIP C;  2KKW A;  4EEQ A;  1Q6H A;  5LOV B;  5AVW B;  1UJW B;  5IYD O;  2GM4 A;  1JY3 O;  1S5L H;  1VQ4 V;  2WLL A;  2IX7 C;  2FKX A;  3RL0 B;  3EFF K;  2QKS A;  4DOJ A;  1BGY D;  2O1J A;  4C7R A;  4C7N B;  3JAR B;  3T1Y B;  1CW5 A;  1SFC A;  3JSN A;  3H1H E;  2Q68 A;  1KIL E;  1PGQ A;  2IDB A;  1MA1 A;  3L36 A;  2Q3I A;  5GON B;  2B87 B;  1GU4 A;  1NVO A;  3HE4 B;  1HJB A;  1EXI A;  3L75 E;  3ZRW B;  4JI8 O;  4W7Z A;  1TVK A;  4ZBM A;  1NAF A;  4BRY A;  1QR8 A;  2AW9 A;  4GKK O;  3V5B A;  1NI8 A;  4GYC B;  1KTM A;  2ZKO A;  4F6R B;  3TDK A;  1M5I A;  2W83 C;  3S9O A;  2G8Y A;  1WP8 A;  5B66 E;  3X2Q C;  3L37 A;  4L73 A;  2HYN A;  3W67 A;  1J95 A;  5KJ7 C;  3CRA A;  4UV9 A;  4WBN B;  5IY5 B;  2RN0 A;  1SA0 A;  4CH3 A;  1RM1 B;  3FX7 A;  1L0N K;  2C0W A;  5CBF A;  1IJD B;  3L72 H;  2OGU A;  1LTJ A;  1SER A;  4U3F D;  1N0N A;  1MFZ A;  2KSJ A;  3L72 G;  1OXZ A;  1DH3 A;  2AXT H;  4BR6 A;  1GTO A;  1IVS A;  1AA0 A;  1FDO A;  3J7A U;  4FFB B;  3JD2 A;  5BZB A;  2V4D A;  1CSB A;  3OGI B;  4NTY A;  3I56 P;  1R6K A;  3D8C A;  1K4D C;  1T8Z A;  2WMM A;  1NYH A;  1NU1 H;  1RPO A;  1VQM P;  1S76 D;  4ICG A;  1WPB A;  1R6N A;  2I1K A;  5KX5 B;  1KOR A;  1L0N H;  2FYU D;  4JI0 O;  4UCR A;  3C3S A;  1YJW P;  1L0N G;  2E5T A;  1EDJ A;  4MS2 A;  5L3B A;  3KDP B;  3O8Z A;  2HHH B;  4JI6 B;  3QG5 A;  1AVO A;  5CHX A;  2ZE8 A;  4X62 O;  3HD7 B;  2E3C A;  2GV9 A;  4EB6 A;  1RE4 C;  2P67 A;  1FDM A;  1M56 C;  2YIU C;  1BCC H;  3B40 A;  1LWU A;  1BSH A;  1AVM A;  1YCI A;  1BCC G;  4W80 A;  1EZV H;  3LSU A;  1SS1 A;  2C9L Y;  1XI1 A;  3BEH A;  1EZV G;  1EC5 A;  4MVR A;  4TSF G;  2YO3 A;  3VP9 A;  3D36 A;  2ZXW C;  2AXT E;  2IZ0 A;  3L72 J;  3H25 A;  3FB8 C;  2RDC A;  2IBZ I;  4KHP B;  2LKM A;  2P7J A;  3RL0 C;  1VP7 A;  1KIL A;  1S9K E;  1SQP K;  5H2F H;  1FFT B;  1ZR2 A;  2POH A;  1QVG U;  3BAT A;  3LUT B;  1PGO A;  4PD4 D;  2KUB A;  1NU1 J;  2F4V O;  4LF5 B;  4HNA A;  2BAS A;  4PA9 A;  2CK3 G;  1OCO B;  1IFN A;  4NXN O;  3EHB B;  1L0N J;  2LR2 A;  3PHL A;  4MN4 C;  2FKW B;  1GK9 A;  2KSD A;  3CRC A;  1VQO V;  4LH7 A;  3OTO B;  1QVF U;  1ZRT E;  1CP9 A;  2E75 B;  3STL C;  3RYI B;  1NTK H;  1BCC E;  5KHI A;  1SQX D;  1RM1 C;  4B3T B;  1BCC J;  2AXC A;  3A0B H;  4EOT A;  4FLV A;  1SQP H;  3JAW B;  3W68 A;  1NKD A;  2E76 B;  1IBL B;  1SQP G;  3LW5 H;  4PI2 A;  1DEE G;  4I7Z B;  5LXT A;  4BIO A;  5CA0 A;  2UUC O;  3ZCC A;  3B71 A;  3ZX6 A;  1NTZ E;  3TGU D;  2LW7 A;  4GDO A;  5JJN B;  4WY4 D;  5B5E H;  4L87 A;  3OR6 C;  1FZC B;  2WZ7 A;  3I56 V;  3IAY A;  1ZLL A;  4B3R O;  3CWB H;  3Q4H A;  4IFM A;  5H2F E;  1AFO A;  1VQM V;  1YF2 A;  3CWB G;  3CCL V;  3M91 A;  2YKP A;  4I4T A;  3JAK B;  1JCD A;  4H33 A;  1P4R A;  2YNY A;  3JAS B;  3L71 H;  3OGC C;  1WNS A;  3L71 G;  1EN5 A;  3O9O A;  4FMT A;  5EFW B;  4DV1 O;  2E43 A;  1QEX A;  1Z5W A;  2P22 C;  4CH4 A;  1DD3 A;  3VMX A;  1MSD A;  3AEI A;  3CXH D;  5ITZ B;  2BSK B;  3JCZ A;  5BY1 A;  5A2Q N;  3UO3 A;  3A0B E;  1URQ D;  3CC2 V;  1NTK J;  3FFQ A;  1SQP E;  2YDE A;  3TXS A;  4MTO A;  2FXP A;  1N7S B;  2F93 B;  4JAS A;  3CCQ P;  1JCH A;  1SQP J;  1OZ0 A;  3QO5 A;  1JOY A;  1Y67 A;  1KKC A;  5LYJ A;  5B5E E;  3AEC C;  5E1A C;  5LOV A;  2B89 A;  5BMV B;  2F66 C;  2PFX A;  2ITD C;  3VOU A;  5AVR B;  1S1C X;  1VQ6 P;  1E1Q G;  1IBK B;  1XRE A;  2CPB A;  3QH9 A;  1V55 B;  3V2Q A;  3CWB J;  2KOG A;  2NLJ C;  4C7N A;  1GN2 A;  5APX A;  2M0B A;  3JAR A;  1TGO A;  4RUE A;  1MAB G;  4DR5 B;  2Y4T A;  3L71 J;  5GON A;  2B87 A;  3CJH B;  3SDL A;  2R70 A;  3HE4 A;  4PHZ A;  2OTJ V;  1Z5V A;  2PRR A;  3ZRW A;  3FB5 C;  2BTQ B;  4RQF A;  2K9Y A;  1S4X A;  3TCU A;  4LF6 B;  2GTS A;  4ZKU A;  1FXK C;  4F6R A;  2DOS A;  5A9G A;  2ZDI C;  1RSO B;  2EJ7 A;  3WUV A;  2QWN B;  3CX5 H;  4WBN A;  3A5T A;  4KUM A;  2HG5 D;  3K59 A;  2K1E A;  2WLJ A;  4WFA V;  2UXD O;  1GW4 A;  2IM9 A;  1SFC D;  2OYH B;  2R44 A;  1GTW A;  1VF6 C;  2H43 A;  1UIX A;  1XL4 A;  4MTF A;  4O4J B;  2ADQ B;  2OYI B;  2WSE H;  1A02 F;  1VQ9 V;  2P2U A;  3AE8 C;  3SWF A;  1DK1 A;  3DSQ A;  4UB8 H;  3UO2 A;  4CPG A;  4FFB A;  2K37 A;  5EBM C;  1VQP P;  4NR1 A;  1ENV A;  1AJQ A;  2EIK B;  4UB8 Z;  1YIT P;  4F6E A;  5CBO A;  2F23 A;  5JJJ B;  3LDD A;  4B3S B;  3K5M A;  2YUA A;  3T1H O;  2CDY A;  3CPW O;  3AE3 C;  1H89 A;  4YHH O;  1JTH B;  1WA8 B;  5KX5 A;  5KAF E;  4DR4 O;  3SYP A;  1KYO E;  1F51 A;  2QJY C;  1U97 A;  4I50 B;  3QVN A;  3A8T A;  3FAV B;  4GLX A;  1O9H A;  2Q67 A;  4EFE A;  1ZX3 A;  5IYC O;  2XDJ A;  4IIJ B;  2LFS A;  1IFM A;  3HD7 A;  4JI4 B;  4DV7 B;  2RMZ A;  1Y4M A;  1PNM A;  3CX5 E;  2YXH A;  2NZ2 A;  1NH2 D;  1OCC B;  4RO2 A;  3TJT A;  3U10 A;  5AVV B;  3U59 A;  4LLH A;  1Q8I A;  1RF1 B;  1NJI W;  2RH0 A;  4GUN A;  5C8Y B;  2JEE A;  4AQY O;  4Q20 A;  1HP8 A;  2IFN A;  3SYQ A;  3QNE A;  3R66 A;  2WSE J;  2EZP A;  2D3O W;  3M9H A;  1KP2 A;  4XDK A;  1Y66 A;  1VQ6 V;  5AVS B;  4B7E A;  4P2Z A;  4H13 D;  4AIL C;  4IL6 X;  2DW4 A;  3ABL B;  2PZS A;  1KB9 H;  3ZHR A;  3L73 H;  2OWO A;  3FWL A;  3J80 N;  3L73 G;  3K5O A;  1UII A;  1DGS A;  1LJ2 A;  3CXC U;  3H1L H;  3BAB A;  4JI7 B;  1Q7Y W;  1QNM A;  4DV6 O;  1VEW A;  2R9I A;  1R73 A;  3LIE A;  1GO3 F;  1TA8 A;  1GL2 B;  1IBM B;  2Z5U A;  2VQF B;  2Q5U A;  3H1H D;  1KIL D;  4FLT A;  3UT5 B;  1ZN5 A;  3RYI A;  1BQ0 A;  2J59 M;  3Q2Y A;  2Y0D A;  1H0T B;  2KQX A;  1KB9 F;  5B1B B;  3L75 D;  1N32 B;  3HRN A;  4XFJ A;  3S3X A;  3T1Y O;  2XAJ A;  4LNU B;  5JH7 B;  4LF4 B;  2O1K A;  2MK3 A;  1PV0 A;  3RBZ A;  1SQQ K;  4LFC B;  4A5U B;  1YEW A;  2PI5 A;  4UB6 H;  2R32 A;  3RK2 D;  1BMF G;  1JY2 N;  3NMD A;  2QEX V;  1FZC A;  4JI5 B;  1HH0 A;  2FB5 A;  4UB6 Z;  1YIT V;  2KXP B; 
#chains in the Genus database with same CATH homology
 3FGA D;  4H44 B;  2WPV B;  1KTM A;  1KQG B;  2E76 B;  3Q5R A;  3S9O A;  2G8Y A;  2ZT9 B;  3GF7 A;  4R4M A;  4I7Z B;  3B71 A;  3R4Y A;  2YMK A;  1FDI A;  2E75 C;  5KKZ C;  4GDO A;  4PV1 D;  1VF5 D;  3D6Y A;  1PV3 A;  4H44 C;  3AE3 C;  3IAO A;  2E76 C;  3AE2 C;  4U7J A;  3AEA C;  2JO1 A;  2ZT9 C;  1JB0 J;  4I7Z C;  3O6Q A;  2QJP C;  1FDO A;  1R8E A;  2QJY C;  1OMI A;  1VL2 A;  1PL5 A;  1ZME C;  5KLI C;  3EWK A;  4PV1 B;  1VF5 B;  2G3A A;  3ABV C;  2FYN C;  4KT0 J;  4Y28 J;  3AEE C;  1NYH A;  4TT3 H;  3C8V A;  1KQF B;  1TU3 F;  3AEG C;  2NZ2 A;  3RK3 E;  1DD3 A;  1WMK A;  2OQQ A;  3AE9 C;  3AED C;  1KOR A;  1PIX A;  4H0L D;  1VF5 C;  3AEF C;  4PV1 C;  3SFE C;  4Z1M H;  1NGM B;  5L8R J;  2FXP A;  3IN6 A;  2P10 A;  1U57 A;  2WSE J;  2QJK C;  5M1B A;  2YIU C;  4RKU J;  2E75 D;  1RQU A;  2E74 D;  2JP3 A;  3D71 A;  1RQV A;  2BEQ D;  4H13 D;  4H0L B;  3AEC C;  3AEB C;  3Q3D A;  4IL6 X;  2WSC J;  2H88 C;  4OGQ D;  3D6Z A;  1OW6 A;  3H25 A;  3Q1M A;  1S1C X;  1OW8 A;  3Q5S A;  1KMI Z;  3GLM A;  3AE7 C;  1DIP A;  2WSF J;  1YQ4 C;  3SFD C;  2D2C D;  4H13 B;  1Q90 D;  2BEZ F;  4H0L C;  1EXJ A;  1K04 A;  3Q5P A;  1Y9B A;  3AE5 C;  3AE6 C;  2MKV A;  1ZP0 C;  1DD4 A;  2V7Q J;  3AE1 C;  4OGQ B;  2WQY C;  1OW7 A;  1GMJ A;  1HJ0 A;  3Q2Y A;  3LW5 J;  1ZOY C;  2K9Y A;  1S5L X;  2QIW A;  4XFJ A;  4YXD C;  1HF9 A;  2E74 C;  4H13 C;  2D2C B;  3AE4 C;  1AJY A;  4H44 D;  1YQ3 C;  2E76 D;  4R4L A;  2O01 J;  4OGQ C;  2ZT9 D;  3GF3 A;  1IK7 A;  2J5U A;  2FBW C;  1KIL E;  3GMA A;  4YTP C;  2IDB A;  3AE8 C;  3D70 A;  1ZRT E;  2E75 B;  2QSI A;  2E74 B;  1MKM A;  3G9R A;  1UIX A;  1K05 A;  1EXI A;  2D2C C;  2H89 C;  3T97 B;  3RL0 g; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...