4H13B

Crystal structure of the cytochrome b6f complex from mastigocladus laminosus with tds
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 42
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4h13B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h13B01
4RKUJ 2WSEJ 4H44B 2QJPC 2K9YA 2QJKC 1S5LX 2WSCJ 2QIWA 1VF5B 4KT0J 2E74B 5KKZC 1JB0J 4H0LB 4OGQB 2D2CB 2QSIA 2E76B 2WSFJ 4I7ZB 2WPVB 2ZT9B 2O01J 3C8VA 1Q90D 4IL6X 3LW5J 4Y28J 2QJYC 5KLIC 4H13B 2YIUC 5L8RJ 2E75B 1ZRTE 4PV1B 2FYNC
chains in the Genus database with same CATH superfamily
1FAVA 4JYCA 3SJCC 1R73A 3TCUA 3VQVA 2KQXA 1N0JA 3KCXA 1HNXO 4GKJO 3U0ZA 1J1DB 3MP7B 4JI3O 2QKCA 1G2CA 1SQBJ 1SC5B 4ABMA 1VQMP 1FJKA 1IURA 2E76B 2OGUA 5EZYA 3CCQV 1FYJA 1AV1A 1NU1E 2OYIC 4ICGA 2EZPA 2Z3YA 3A0HE 3JARA 2C0XA 5AVVB 4F4LA 1SQPJ 5CMUA 2AXCA 2Y0PA 2A06D 1VQ7V 3H1KJ 3HKEA 3RL0g 3V2RA 1QR9A 4Z1VA 4FLWA 4EI2A 4QNHB 4PA7A 4LF9O 3HKCB 4ZKUA 2PF4E 4P9OA 1NAFA 2JVDA 4DR3O 4U3JB 4RAIA 2P90A 5KX5B 4LFBB 1WMKA 3L71D 3L74E 1WB8A 1OFCX 3CC2V 1Z2GA 2KG7B 2X6CA 1YITV 1URQD 4E2LA 2A06H 2JS5A 2VWJA 1EZVH 3OJAB 2I1JA 1Q6UA 1MABG 3K0DA 4UVBA 1DLBA 1NTZG 2O57A 3A0BE 4GX5A 2CH7A 1Y67A 2R70A 4B7EA 1RF1C 3OFNG 3WUVA 1YTZT 3NXSA 1QL1A 2UUBB 4L73A 1HVVA 3L72H 1AI5A 1F51A 2ZE8A 3LDCA 3IAOA 1KORA 4RQEA 3OTFA 2RQ6A 4YJ3A 3VQYA 2JIZG 1GW4A 2K37A 5AVXB 2HFED 5K5GB 2Y0CA 1HWYA 1WPXA 3OTOB 3HE4A 4GYCB 5KMGA 3QG5A 3AECC 2HLDG 4TWKA 2QJYB 1WJZA 3H1LH 5EIBD 4LBEC 4QMAA 2FYUJ 5KHJA 1N4CA 3B8NA 1PPJD 5CBHA 1N2DC 4DR2O 1USEA 1HWTC 2HODA 5GTHH 3F5HA 3WU2H 2O1KA 1QX8A 1RE4C 4H44B 4JI6B 5KHGA 4DV2O 1L2PA 2JWAA 4DRXA 3UO2A 4JI0B 2BEZF 2WPVB 1MSDA 2B5UA 1T3UA 4HH2A 5C39A 3UO3A 5AW7B 5JCOC 3CI9A 1NTMH 2B1IA 4Z1MH 1K9MW 5J2TB 3IN6A 4C7NA 3K5MA 1SQVE 1N34O 3Q5RA 3A0HZ 3JD3A 1QCEA 2JDIH 3RL0D 1NR7A 4GUNA 3U1CA 1R6NA 3LNMB 2RNBA 2R9AA 5H2FZ 3OAAG 4QE9A 1X22A 4U7OA 3G4SV 4GLXA 1QLNA 5IWAB 2HYNA 4EIJA 2AHYA 2RCVA 4E4EA 3IAYA 4DR7O 3JASB 4WFAV 3B8MA 5FNVA 3ZN1A 1SQFA 2QE7H 5LP6C 2YUAA 4JPZB 1RFYA 2GA1A 3L70J 3H1HE 1BL8A 2OTJV 4PA4A 2RMZA 2L6LA 4IL6Z 2YIUC 5B5EE 4LNUB 1EDLA 3HKBA 1EDKA 2Z5UA 3G4SP 2ITCC 3JAKB 2PYLA 2FFDA 1KILE 1GN3A 3AEAC 2JGDA 4N21A 1P84F 3CXHF 2ZXWC 4D6TJ 3ABMB 1EDIA 3TGUE 2NPSC 1EXJA 1U96A 2OTJP 4TSFG 2H8PC 2QM4A 3JD4A 4DV7O 4FPPA 2QM8A 3UIAA 1SQVK 2ZNJA 3RW0A 5KLVD 1PP9D 2E76D 2B9ZA 1MA1A 1ZTEA 4MSWC 3U10A 3QWOC 3P8MC 4DUYB 1H8EG 1OCZB 5C8YB 3TJTA 2JKVA 1JOYA 3FB6C 3EFGA 3CHXA 2F4VB 2LKMA 2EIKC 4HBNA 2YC0A 4ZI7B 1VQ5V 3CEIA 1AI7A 1YQ4C 5TISE 1N8RQ 4IYHA 1KV4A 3G71V 2KSJA 2K3RA 4CC5A 1GO3F 4ZNCA 1K5QA 4JGSA 5LMNO 2G38A 5KHIA 2R72A 1QLEC 1GAXA 1S1CX 1NTKD 2QWPB 3RFRA 4PJ0E 1PP9H 4GX1A 1XNQB 2ZR2A 3IC7A 2XV5A 1RY3A 5AW4B 2JEXA 3K9SA 1ZW0A 1AJYA 4CC6A 3FXDA 2K1AA 4XA4A 4BAYA 3G71P 3P32A 5E1AC 1LWUB 1FU1A 2E75B 2Q5UA 3FWLA 3KDPB 3VMAA 4AI8A 1NU1H 2M0BA 1KD1Q 3A0HH 3MZWB 3H1JG 3FB7C 3ABKB 3CC4V 1URQC 3M0DC 2XOKG 1NKDA 2DYRC 2YO2A 4OXSA 5FPOA 1L0LJ 5H2FH 2KIKA 4MTFA 1FPOA 2ZT9B 2CTPA 3S4RA 1SESA 3AG2B 1S9KD 3Q1MA 1CEZA 2ZXEB 4NTYA 2KSDA 3L74H 1SQQE 2UXNA 3L75E 4N23A 4N78D 1QEXA 1GD2E 4GIFA 1RSOA 1EDJA 3ZMZA 4GOEA 4AUWA 2F1MA 4GODA 5KAIE 4XDLA 1W2EA 3ABVC 2WLJA 2HJFC 3AG4C 3X2QB 4WBNA 1EBOA 2GUZB 3M99B 2HFEC 1YHQV 4Y99C 5B5EZ 3H6PA 1PL4A 3L71J 2H3OA 3ZMVA 2ZINA 1YJWV 4H44D 3A0BH 5KJ7D 2EZOA 1TA8A 3KKYA 3D6ZA 2XHBA 4LF5O 5LXTB 3VN0A 3CCVP 1SQBE 3OT7A 2HLOA 1WRGA 4FLUA 4FZ0A 3EWKA 2HKOA 1L4AD 1PGOA 5LOVB 2YKOA 3RK2B 4NKGB 3SGIA 3OMAB 1H0TB 4DYLA 4AQRD 5GW7A 1SQPE 1FZCC 1KN7A 1CXZB 4ZIBA 1N33O 1JY3N 2LGWA 3H1KE 4NXNO 1XREA 2OYQA 1XMOO 4K35A 1BE3D 1L0NG 2WZ7A 3WMM0 2K9JB 1BSMA 4F6RB 1VP7A 1V55C 1IFJA 2QDOA 5EC1C 3CYOA 1T5EA 1E1RG 1M56B 1YI2V 1Q90D 2W6JG 1NH4A 3CX5E 2BSKB 2WLMA 1BDDA 1E1QG 3ZRXA 3KXDA 4YY3B 2CDYA 1KB9I 1I08A 3J81N 4TUYB 2OYOA 1W2BO 1AQ5A 4PD4I 1XOUA 3OR6C 4ZHQA 4JASA 2Y0DA 1TVKB 3CCJV 1YEWA 1BGYD 1TUBA 4UV8A 1RE3C 5CCGD 1YI2P 2K88A 2ZFCA 1JY3O 2IW5A 1FDOA 2WITA 3TSIA 3K58A 3CD6V 2OYIB 1U97A 1YF2A 2W27A 5KHKA 5AW6B 1NYHA 3KHUA 3AK3A 4EOTA 5IYBO 1SFCA 4YJ2B 2QA4P 1SQPK 4LFBO 1Z5WA 3BASA 2LW1A 2CUGA 3RYHA 3A2AA 3P3PA 1PL5A 1BGYH 2FYUE 3SWFA 1PGJA 4K8XA 2IX7C 2AEMA 3WB0A 4DV0B 1H2NA 5AW3B 1S3JA 4WFGA 1DK1A 4IFMA 4ZKPA 1EZVG 3H1HH 5CA0A 1DEEG 2C0WA 1VF5C 2ZVNB 4EFBA 5B5EH 1Q7YQ 2WSFJ 5APUA 3H25A 2IPPA 1QNMA 3W7SA 4ASVA 2N74A 2Q73A 3JAMN 4LH6A 3KG2A 5J2UA 1M1JC 2E76C 3STLC 2ZJSE 1JQ0A 2UUBO 4QPKA 3OUFA 5CA1B 4J7JA 3ZHQA 3KZIZ 3L72G 3E8HA 1RF1B 3CC7V 3TGUH 2M5AA 1N73A 3L73D 4PV1B 2GTSA 4O4IB 1DD4A 2UXDB 1N7SB 2J5UA 2X6BA 2E75D 5KTBA 2WT7B 4K3AA 4IFDK 1Q81Q 3E7KA 3H1LG 5AW0B 1L8DA 3JAWB 5L3BA 5B3SC 2VQEB 3HUSB 3BA8A 1MFZA 1ZV8A 4UB6Z 2W83C 1H8HG 2N04A 2IJIA 2YXHA 3CP1A 3AE7C 4JI6O 3BPZA 1N32O 3AEFC 2BTQB 2ZT9D 2SPZA 2HVJC 4J7KA 1AQTA 5KLVJ 3L70E 3CMEV 1Y74A 3SYQA 2IZ1A 4CH6A 1F4MA 1OV9A 5LGUA 1D5NA 3QVNA 1QHTA 3ZHVA 1SQGA 3PHLA 4O4HA 3R65A 1NTMG 1Q5OA 1AVMA 2BASA 1T2KC 4Z1MG 3D36A 3CCLV 2B88A 2MW2B 1P7BA 3L75D 1SA0B 2K9PA 3T97B 1NTKJ 3VBBA 2IZ0A 1SKVA 4D6TE 3HD7C 1JMBA 1FXVA 3CMEP 2X0LA 4MS2A 4G28B 4I50A 3RT3C 3ZRVA 2M7WA 5C93A 2QJYC 3AE5C 5GTIE 5KUKA 3OEHG 1GU4A 2WLIA 1VQ9P 2Z4EA 3EHBB 2ZVOB 3N4XA 4PI0A 2Z5HA 5IWAO 3CCRV 1Q43A 3RK2D 2QJKC 1SQQH 3C90A 1XL6A 4L76A 5EK0A 3L75H 3ZJZA 1NZ6A 5IT9N 1VQ4V 4FK5C 5KJ7C 3K57A 1RPRA 2QE7G 4X1YB 3CJHB 3W7TA 1PV0A 4H33A 1BQZA 2KB7P 1M9NA 4IOIH 3CCRP 3H1KD 1FS0G 3E8BA 4IIJA 1M56D 3ABUA 1IZ3A 3KZIH 2HPCA 1SQBH 3B5NA 3P30A 3U1AA 5IYZA 2Q1KA 3OW2O 3E8GA 3Q4HB 2B89A 4N6JA 3STZC 3HE5B 1KB9D 2NPSB 1SQPH 4DUYO 1S0VA 3H1KH 3QH9A 4OGQC 4PD4D 2F4VO 1AVOA 3CRAA 3T1CA 3DSQA 3OUSA 1X0TA 1U57A 2EIKB 1GTWA 4MVMA 5CCHA 1ZL8A 3FAVA 2W90A 2QR4A 1AVYA 4DR7B 1DIPA 1E79G 2V4HA 5CCGC 2F93B 2DE0X 2A06E 1ZXGA 3CX5H 4XDKA 4JV5B 4EDFA 4RJTA 2F66C 1OZHA 2ADPA 1QLEB 1HNWB 1S2EA 4ZOLA 1FZGA 1BE3J 1H8AA 1PV3A 4XDJA 4MVQA 1RF0C 1MSWD 1Y6XA 4PD4F 3AE4C 3L71E 1NJIQ 2O01J 2YICA 5AVZB 1NU1G 2UU9O 1VIBA 5APYA 2W0XA 2AEJA 3QO5A 2Y69B 4I4TB 3HRNA 5KA6A 2A0LA 2BOCC 4DUZB 2XASA 5AVRB 1OCZC 4DV5B 3T1YB 5B1AC 3MAQA 5LYJB 2QJPC 2IBZI 5BXZA 1YVWA 2DYRB 4PV1D 3HPLC 3L74G 4NTWA 3JATA 2F95B 1O9GA 4X9QA 1BMFG 2Z5IA 2FYUH 3JSVC 3SPHA 1N7SD 4X64O 2GV9A 4YPCA 1Q3EA 4KFMA 2Q6QA 2Q5ZA 1FOSF 3HKDA 4A5UB 3VP8A 3SSUA 1QU7A 1LWUC 1KKDA 2JEEA 2Q7HA 4HYOA 3AG4B 1Q6HA 1AILA 1BCCJ 2E75C 1PFIA 1PPJE 2YIBD 4U3FD 3O6QB 1JJ2U 1PM9A 1B6QA 4J9YB 2KS1A 2XZRA 1EN5A 3BAAA 2Y4UA 3GB7C 1S5JA 3ETGA 5H9CA 2DW3A 3AE1C 3L70D 5IYDO 3AG2C 5BMVB 3C9IA 4IFFA 1GKFA 4UFZA 2I1KA 2UWJE 3D8CA 2EIMB 2BEQD 4QJFB 4BXLA 1JTHB 5LL6Y 3L73J 3G9RA 2ZDIC 3R4YA 4JF7A 2IH1C 4KP4A 5BU8B 1VQ6P 5H5NA 1BSNA 3ASOC 1VQ8V 1HR0B 3O8ZA 1KFNA 1NHLA 3X2QC 2L5GB 1GTOA 4YY3O 1G2CB 2C9NY 2KK7A 3L70H 3RYCB 1IBMB 3FWNA 5EZYB 2KNCA 4RWUA 1BDCA 5IYCO 3HTKA 3RBZA 2QG4A 2FYNB 2FKXA 3LW5J 1NO4A 2YXYA 1P84I 2Y0IA 2GUSA 3HKEB 3CXHI 4MW8A 1SQVG 3AE9C 1NTMK 2WSEJ 4H37A 1QQCA 5KAFZ 1S72P 1VF6C 4DR1B 1AROP 2QIWA 1OCRC 3II6A 4RESB 1KQFB 2H7HA 5GTIH 2EBOA 2O1JA 1IK7A 1VL2A 2OIEA 5EC2C 4WY4A 2ZIMA 3N2KA 4MVUA 3KQGA 3B4SA 1XTCC 2NPSD 4DV0O 3AG7A 1LTJA 2A3QA 1JY2N 2YMKA 4J42A 1NVOA 2OCHA 3H1HG 1T3JA 2CH7B 2A7WA 1MG1A 1PP9E 5KLVE 1VF5B 4EB6B 2OYHA 1KYOF 1ORQC 1L0LD 4YJ3B 1XNRB 2A45I 3BY6A 5JJJB 2QSIA 2QKSA 3LSSA 5CMZA 1M1JB 4G27B 1PNMA 2OT5A 3TGUG 1QLED 2G3AA 4KHXA 5EFWB 3JALB 2NN4A 2QTSA 2UXDO 4X1KB 1ZP0C 3RVZA 1NTKE 2XNDH 1KU9A 1KECA 3AG1C 5H2FE 2AEFA 2VQEO 3GWOA 1L0LH 3I5DA 1JY2O 5DJUB 1OVUA 1HUCA 3CCQP 2FMLA 1KQSO 2E5TA 5B3SB 3CWBG 5JJEB 1EZJA 1FXKA 4DRXB 2GM4A 1D7MA 1VQ7P 4L87A 1S5HC 2H43A 2IBZD 4X1IA 4IL6E 3M06A 4CH5A 5AW2B 1LT9A 3B40A 4Y28J 1NAYA 2QJ1A 4LR3A 5AW8B 4DR4B 1S9KE 3L71H 3HR0A 5DJTB 1W0KG 1USDA 3DC6A 3CC2P 5LBQA 2AXTZ 4CH3A 1T8ZA 4N78E 4PV1C 4TV8B 1YITP 4X20B 4UVCA 4X88A 3O9OA 5AVYB 5APVA 3B77A 4RUFA 1R5SA 1FE6A 4QPJA 3ZBHA 1N7SC 1NU1K 2IBZH 4H0LB 3K08A 1SQXJ 1Q86Q 4R50A 1JO5A 2DQ3A 3HD7B 1DF4A 2YXQB 3RYFA 3BVOA 5LA6A 3UKMA 3E2EA 3TDKA 3HUSC 2OCCC 1HGVA 1K3EA 2V7QG 2NLJC 4I0XB 4FVMA 5FNVB 3SJAC 3T1HB 1JCCA 4LH7A 2FXPA 4IL6X 5CHXA 5DEDA 1SQQG 5BVZA 2V4DA 3L75G 2VS0A 1XTGB 3SWYA 3C3SA 2MK3A 3LSUA 1LT1A 2QJKB 3HKBB 4UCUA 3UQ8A 2XKMA 1N32B 2FFDB 4OVNF 1W2BU 2RN0A 2JGDB 2FB5A 3WFVA 2E43A 3ZMUA 2E5YA 1OW8A 4FLZA 1OJHA 3IR9A 2P5OA 1BE3E 4I6MC 1SQBG 1PPJH 1J1EB 1LTAC 2WWWA 1OMIA 2WLLB 4JYAB 1Y76A 2NR5A 1OX3A 5E79E 4I55A 4WVZA 1KTMA 4UV9A 4LWSB 4BIOA 3IC9A 3ABLB 5IJ0B 5L3FA 1UJWB 1SQPG 2VRZA 1N0NA 3BEHA 3H1KG 1XHXA 1UFIA 2KLUA 3DGEA 4BIZA 1TGOA 2OTKE 3GWKC 4BW9A 1P84D 4U3FJ 4OGQB 4CH4A 2CK3H 3E1RA 1IZNB 3CXHD 1N86A 1I5YA 1BGYE 2WPQA 1GMJA 3B8EB 1JMMA 4WCEV 4JV5O 1ZR2A 3PRJA 1HNWO 1I7FA 3UCSC 1FFTB 1PGPA 1IX9A 4DCKA 2N1TA 2H94A 2WSFH 1YIJV 4K0KB 3L37A 2JK5C 3OD4A 3CXHH 3F89A 4X65B 2AXTH 2ZE5A 3ZDMA 2UXXA 5CB4A 1BCCE 3ETEA 3JYCA 3PJSK 2DW4A 3AK2A 1L1FA 4DO2A 1K8AW 3CCMV 3A0RA 5CBNA 1ZUQA 3AEEC 1WA8A 1CSBA 3J7AU 1OCCB 4DUZO 5IJ9B 1VF5D 4J9ZB 5KHHA 4DV5O 3T1YO 4EYYQ 1JEKA 1QVFO 4J80A 1R6TA 3S3WA 2YKPA 2YO3A 3E22B 4ZMDA 3WG7C 5B1AB 2QJPB 5HFLA 1IBKB 2LO1A 3I55V 2FYUG 1OZ0A 1AJNA 1O9HA 2ARHA 2HVKC 1WP7A 2Y4TA 4WBNB 1JCDA 1L4AA 3L73E 2YIAA 2YMYA 2EX3A 2MJZA 3AEDC 3P8CD 5IY5C 3OA7A 2Q69A 3F7VC 3LIEA 2D2CC 3RVYA 5KLVH 2W6BA 3SFDC 3D71A 3H9VA 2X6AA 2A45H 2ZYDA 4I5SA 1VQ5P 3DXRB 4JYYA 2YDEA 2Z0AA 4HAMA 4TQFA 3G6EV 1JA8A 1LGHB 2ETNA 2R3CA 2Y69C 2IU0A 5DECA 4UCSA 3K3WA 5E79Z 3TF5A 4DV6O 2UU9B 1FZBA 1MUUA 5JQGA 2PZSA 4LF6B 1NTKH 2PGDA 4ZBMA 2V1DA 3SDLA 2Y48A 1LP1B 3JASA 4JI2B 1KC8Q 1KZUB 2W0FC 2KSEA 1T2KD 2B87A 3GLMA 1GN2A 5LGTA 1OXZA 4LF4B 2PTMA 4JAUA 1F4NA 3M8AA 4DR5B 4H0LD 1B3QA 3K06A 2P7TC 1HNZB 4J41A 2FXMA 3MD0A 3AEGC 2XAGA 3HD7D 2R5DA 1HR0O 2XAHA 3K5NA 4X64B 2JRIA 3ZHUA 2JJLA 3CC4P 1CP9A 1XMQB 1JNMA 1XQ8A 1IBMO 4IL6H 2E42A 3ASOB 4LC1A 4ZHQB 1Q82W 3H1ID 4FLXA 5TJHA 2YXRB 2KZIA 3RK3C 1KILA 2E74C 1E5WA 4W7ZA 1X9VA 2X7RB 3KZIE 3OW2U 4LFAB 5BU5A 1VEWA 4B7KA 5C8YA 4JI7B 4D6TG 4WY4C 1Y66A 3W7WA 2JP3A 4PA3A 4BWNA 4DR1O 1TAEA 3OMNB 4ZI7A 2WVRA 2CTWA 4CS2A 1YHQP 2ITDC 3J80N 3SPGA 3VP9A 3RYHB 3GHGC 2P58A 2LP7A 1JPXA 4LFCB 2ATKC 2EIMC 2AHZA 1YJWP 1OCRB 1PNLA 4O4JA 1HF9A 3CPWO 3E86A 4D7TA 3JSNA 3MTUE 4UB6E 1AA0A 3TNUA 3LNNA 3ABTA 5CA0B 1HGZA 3BCCD 1M90W 5FL7G 3CCUV 2ODMA 3FXEA 1NH2B 1SQQK 2WSSH 3B2EE 1KB9E 4OGQD 3RBXA 1JFFA 1ENVA 5EYPA 2YSUB 5LMUB 3BRCA 4CS4A 1Y4MA 1FC2C 4PD4E 3ZRWA 4MVRA 3TXSA 3ZHSA 4HNAA 1VQLV 4B3RB 1IJDB 1XL4A 1XNRO 2FYNC 2M5AB 4JBZA 4EKWA 1BE3H 2IJJA 2Q9IA 1K5SA 3CCUP 1FKAO 1AJPA 2O01H 5E79H 1JUNA 2P22C 1VQPV 2R44A 3H01A 1SQBK 2EILB 1VDFA 2WPRA 2OIGA 2Y9YA 2IFMA 5APWA 2DYSC 2ZIOA 1P49A 4O2AA 1HTLC 1RP3B 5JVDA 1HJBA 1SQXE 4PDVA 4JQ0D 1NKNA 3JC22 4JYBA 3AG1B 3CCJP 3S1KA 2BCCD 3BVHA 1QR8A 1VQPP 1ZAUA 1LT9C 1BCCD 2QWOB 2XU6A 3FD9A 3CD6P 1Y74B 4GX0A 2JO1A 1FDIA 4J11A 1XUQA 3EVKA 5J9PC 2DWDC 2A06G 2E5LB 4HKZH 5LXTA 3M9QA 1H2LA 4O4HB 1NVPB 2P1JA 3A3YB 4GT1A 2P6JA 4DR4O 1BS3A 1JOCA 1BSHA 3LSQA 5GONB 3C8VA 2P4VA 5LOVA 1SVFA 3L71G 1GL2A 1IFIA 1DX7A 2JR8A 1BCCH 2YI9A 3VOUA 2IFNA 3GF3A 2ZD9A 5APTA 1IO4A 2WLIB 1MMMA 2Q67A 4OPHA 1KBHA 1NOHA 2QWRB 2K9YA 3I56V 4NB5A 3RYIB 1M1KW 4O2BA 2G8YA 2KOGA 2EINC 2LXBA 1K92A 3A7OA 3VMZA 1ZX3A 3T1HO 4GOFA 4AHCA 4CPGA 1M57B 1GRJA 1LUWA 1H2GA 1FZFA 2O01N 1K4DC 2BSKA 4U3FE 2OCCB 3CC7P 1K9MQ 1US6A 3FB8C 5CBOA 3K04A 1JX9A 3L73H 2CAZC 4KUMA 2QM7A 3BABA 2FYUK 4DW1A 4A7PA 4IIJB 3IFMA 1P4RA 1TVKA 3N7NA 1URFA 2LW7A 3B5NB 2KZJA 3LIDA 4I1LA 5A2QN 5B66Z 2AZ0A 1PPJG 3CE2A 4OWFA 4JYAO 3JD1A 1PD3A 1AP6A 1NTZD 3ZHTA 3BRVB 3THOA 4YJ2A 3LW5H 2XT9A 1X79B 4H0LC 4KHPB 3H32B 3C1LA 4ASUG 2IU3A 4K8ZA 2WSEH 2UUAB 2JDIG 4JI4B 2M8RA 2DMXA 4JI5B 3CCSV 1ZL8B 2CK3G 3FAVB 1Y8AA 2FY8A 3CLQA 3CCLP 3T4DA 2QWNB 1NTZH 3OM3B 1QBZA 2WSCJ 5IE9A 1OCOC 2N9BA 4DK1A 1GU5A 3E83A 1YYCA 2ILMA 4ZOLB 4KJMA 1NWQA 2FFDC 4UB8Z 4B08A 1NI8A 5CA1A 2QVAA 3UT5B 1ZWIC 1RF1A 2QKAA 1FZAA 4K0KO 4FM0A 2UXBB 2HJDA 4X65O 1J1EC 2N05A 3ZRSA 1NH2D 1KYOI 3CSXA 3PLNA 1IXBA 1JR9A 3BATA 1VQNV 1VQ4P 4JF3A 1AR1B 2GHYA 3UM7A 2CTQA 2FXOA 2WT7A 2L35A 3ABLC 3N2GA 3T4ZA 2HEPA 3H1IJ 1PGQA 1IC2A 4LF8B 2Q4PA 2RN9A 1G1JA 1VPCA 1IBKO 4CBCA 2HP8A 2YXLA 3D70A 4I9WA 1L0LE 2Q7GA 1KQSU 3AE2C 3A8TA 5KUMA 4UB6H 3FX7A 3E89A 3QNEA 1LTGC 3WG7B 3ASNB 2KYVA 5CJ4A 4M3LA 3VTPC 1IBLB 1KB9H 5KLVG 1PP9G 2RMKB 3D6YA 4XE5B 3RN4A 3JCUE 5IY5B 2IJHA 3JD2A 4PD4H 1SQXD 5JCOA 1SA0A 1GN4A 3P7KA 2Q7CA 2D2CB 2GUVA 5B66H 1DH3A 2LGQA 1H2KA 4BRYA 2KS1B 3BCCJ 4YXWH 3FYIB 4TT3H 1OCCC 1ZLZA 3SYAA 1NVPD 3M91A 4LF6O 3DTUB 4NVPA 4WF9V 5KAFE 3SJQC 1OWAA 1NTKG 3BHPA 4WWIA 2IM9A 1VQOV 2IBZE 4GX2A 4LP8A 1MV8A 1Q2NA 2ZYGA 4JI2O 1GW3A 3GG2A 1SQXH 4AQYB 4X1YA 2AGAA 4LF4O 5JH7A 1AR4A 3CX5F 3CJHA 4DR5O 2M6YA 1HNZO 1EZVI 5LP6A 1L0LK 1FFXB 1LTBC 2XTAA 4W7YA 1SLQA 4Z2WA 2I8DA 4AILC 1XMQO 1JJOA 2KNCB 1M57D 3OMIB 2QWQB 1BHBA 1H2MA 3HTKB 2GTAA 1DTOA 4JI8B 3R2PA 3JD0A 3Q4HA 5AVUB 4B3SB 2BCCJ 1CI6A 1K04A 2WTYA 3Q2YA 3HE5A 4I2LC 4LFAO 1NBMG 2NPSA 2QTOA 1R5LA 2VWKA 3GF7A 3RK3B 2P2UA 4JI7O 2E74B 1JB0J 5ITZA 3NFQA 5JJNB 3K9AA 3B5ND 2PAJA 4I7ZB 1AJQA 5D5PA 1JCHA 3SJBC 2QGNA 3D3IA 1YJ9V 4FM2A 4WY4B 4DV6B 4LFCO 3H1JD 2C9LY 1S76D 2POHA 4PHZA 3GHGB 2WLHA 2ZR3A 1U7MA 2K1EA 4U3FH 1JM0A 2J58A 4P30A 1OW6A 3CRRA 1EQ7A 1TU3F 3ETQA 2EIJC 3SR2C 5KA5A 4IYIA 5CCHD 4TV9A 5LMUO 1MZEA 4L8JA 1XBLA 3TYYA 4B3RO 4MT8A 1M7LA 2BE3A 3JCUZ 2KB1A 4R4LA 1P84E 1BE3G 3JARB 2HHHB 1ROPA 3CXHE 3CCEV 2FTKA 2AXTE 1SFCC 4H13B 3CWBJ 1S4XA 1VQ8P 1URQA 1IFMA 3M0DA 4LF7B 1NT2B 1W59A 4DR6B 1ZLLA 4IHJA 1QVFU 3IJ4A 3K59A 2MKVA 1KD1W 5KKZC 1MNGA 4GKKB 1KYOD 2DYSB 2NNUA 4GZRB 1Q8IA 4DV3O 2Q3EA 5CBGA 1EFRG 3P3NA 3ZIAG 2RKLA 3V2NA 1TUEB 1NTZJ 3IFXA 1BGYG 3SYCA 5KLIB 5FPRA 1L0ND 1DGSA 2W6AA 3GW6A 2GDSA 4FLVA 1LT9B 2E5LO 2KLVA 2YEVA 1FD9A 2ZYAA 1KYOH 1Z5VA 1N73C 1HW7A 4YIOA 4CZZA 1BT8A 1P7GA 4DV4B 4FZ1A 1FJPA 1BCCG 1SP4A 1Y47A 3L4FA 3VYIA 2EILC 1FAFA 2PP6A 3S9OA 3W68A 1SZTA 4O4LA 3RYFB 3L36A 1VQMV 4PDRA 3T2MA 3HE4B 1FZCA 5KMGB 3ML0A 2D2CD 3WUTA 1AI6A 4BW5A 3P8CE 5APSA 5IDJA 5EBMC 4GDOA 3O65A 3USSA 1V9PA 2W6JH 3MHSC 5HFMA 1S5LX 1YQ3C 1WAZA 2KKWA 2HODB 2EINB 4FFBA 3ETDA 2OTLV 1SETA 3AG3C 2P4KA 1J5EB 4GCZA 2WLNA 3RYCA 3L73G 2W6IG 1R8EA 1SERA 3SPCA 1SF9A 4EFEA 3G6BA 3CS5A 3MHVA 1QL2A 4C7RA 1QVGO 3NMDA 3FYEB 3D36C 4UUJC 3JCUH 1WLEA 1EZVD 2OTLP 1Y76B 1HH0A 4I55B 5KLVK 4JI1B 4R8CA 1K05A 1RE3A 4C7NB 1ZSPA 1SRYA 1PIXA 4FFKA 3JCZA 4KHPO 4PA6A 4PI2A 4EEQA 3AE6C 3V5BA 5KAFH 2UUAO 3L72D 3OEEG 1V54B 4WFEA 2B1GA 2EULA 4JI4O 2IJKA 4JI5O 3H1IE 3M0AA 3V2PA 1M57C 3RK3D 1NTKK 3CPWU 2WPDG 4MVOA 1HDJA 2E74D 3MUDA 3ITKA 4DXWA 5AG2A 1A02F 2LJ2A 4MVZA 4X62O 3D3QA 3H1LD 1W5CE 4WY4D 1M4UA 4FIPC 2H88C 4EB6A 2N1TB 4B3TB 4LLHA 1OCOB 1S5LZ 3B5NC 2M3EA 1RH5B 1M1JA 5CB4B 2UXBO 1KMIZ 3SYOA 2PUSA 3ICXA 3JALA 3QF7A 3C3TA 1WA8B 4X1KA 1Q7YW 2RDCA 1ZRTD 4LGDE 3E35A 3PH0A 3W67A 2WA4A 2P06A 5AW9B 1FJGB 2R32A 3BCCE 3V4QA 3CRQA 3HKCA 3S3XA 4WFBV 1NTMD 1ZR4A 1MOFA 4U3JA 2BTOA 4LF8O 5KX5A 2GSMB 5F2VO 3IF4A 3AK1A 4JTDB 5CCHC 4X66B 1RM1B 1G6UA 1IK9A 4H13D 1YXBA 2KG7A 2R9IA 3MGNA 3CXCU 1L4AB 3SFEC 3ZCCA 4AYCA 1UPGA 2A79B 1MZ9A 3Q5SA 2Q0OC 1IBLO 2VQFB 1Q81W 2IH3C 1BHAA 1R3LC 3CB2A 2NZ2A 4X8AA 3LDEA 2XAJA 2OWOA 3H1JJ 3VQXA 1PL0A 3N27A 2FBWC 5AW5B 4TV8A 4X20A 2DWEC 1NKZB 4DV1O 2PY5A 1G8MA 2R9RB 4OX9B 1P84H 4OH8B 3R66A 3AE3C 2BCCE 4YXWG 5JQGB 2GBOA 3OAKA 4TT3G 2OARA 5APXA 2PRRA 2XUMA 3HD7A 2CGOA 1AR5A 2ZAEB 4I9QA 1SS1A 1AI4A 4I0XA 1SS3A 5L3CA 3SPIA 5BR8O 2B87B 1YSCA 1F23A 3WB1A 4AQYO 4DK0A 1SQXG 1IFPA 1YIJP 4Q20A 2Q8VA 3NTNA 2NRGA 5APQA 5B1BB 2JJ2G 3ASNC 5KJ7A 1RSOB 3MHHC 2Q68A 2Q3IA 4RO2A 3CCMP 3M9BA 3A0BZ 2JJ1G 1EN6A 4MW3A 1XHZA 1GK4A 1S5LH 1PNKA 2XDJA 3AE8C 4XBFA 1KILB 4JI8O 2N9YB 3AEIA 2BOBC 3ZEDA 2WLLA 4B3SO 2Y0EA 5J2TA 4LWSA 3I55P 4ASWA 2FL4A 1LJ2A 1H38A 1LUVA 1XEQA 5IJ0A 2QSAA 4X89A 1L0NJ 2ZKOA 1GZLA 3K03A 3B09A 2R3SA 2FYZA 4C7UA 1D2DA 2ZM6B 2XNXA 1NU1D 3CWBE 2L91A 1AFOA 4B3MB 4O4JB 3OGIB 1E79H 4WFFA 2FKWB 2HR3A 3TNUB 3VMYA 1CW5A 1H88A 1ZMEC 3A2FA 3G6EP 2YS8A 1K97A 4U3FG 2PYJA 2PI5A 1S77D 4UCRA 4FM1A 1NTZE 1JFFB 3CL3D 5CCGA 4LNUA 5EYPB 3L74D 2WSCH 2DN9A 1JVMA 5AVSB 3ZRWB 4D7SA 5A9GA 5JWPA 4HNAB 2EIJB 3JAKA 2CPBA 3G80A 4WFHA 3L70G 1RF0A 2D3OW 4MVSA 1JY3P 2KXPB 1BQ0A 4PDMA 3ZHRA 4CS3A 2HHHO 1TUBB 3E8FA 1K34A 5IJ9A 2N1TD 4YHHB 1GM7A 1PKXA 4O2AB 4I7ZC 4LF7O 5JVDB 4DR6O 1NJIW 3E22A 3CCVV 1SFCB 5H6RA 1N36B 4GKKO 1U7JA 1A02J 3H1IH 3NR7A 1LTJC 1K73W 3FB5C 3ZX6A 1BZKA 2VRSA 1K4CC 1IXMA 3RWRD 1D5AA 2IYOA 3EQ2A 1R1BA 5DM6V 1WT6A 5KKZB 4FMTA 2LFSA 1I94B 4IT5A 5LHIA 1OVVA 3W7XA 2RJZA 1G1XB 3L72J 5EIBC 2OYHC 5EBWC 1NTZK 3DXRA 2YI8A 3KCYA 2HG5D 3CRCA 2WQYC 3JSLA 5J2UB 1CPYA 1GL2B 1LWUA 4LCUC 3A5TA 1OW7A 4DV4O 2P10A 1HBWA 1NGMB 2LR2A 4HB1A 5B66E 1GM9A 5M1BA 2LQTA 3H1LJ 4HZ3A 4H13C 1N73B 1G1IA 3VMXA 3BCCH 4O2BB 1LP1A 4KT0J 5TISZ 2PI4A 1M5IA 2JGUA 4KXRA 4QE7A 2XNDG 2WAMA 3U11A 1SQVD 3RGUA 1RQVA 3BFRA 2UXCB 1VQLP 5K1PA 1FXKC 4W4LA 2A9HA 4PJ0Z 1Y9BA 4C46A 1L0LG 3CX5I 3RL0C 4R7CA 5KLIC 4DV3B 1J5EO 2ZDIA 5L8RJ 1YZBA 2QA4V 4NXMB 1NTMJ 2UUCB 4L75A 2PGGA 1FOSE 2GUZA 3AG3B 4J10A 4FLTA 1YTFB 3VOPA 4UB8E 4YTPC 1SQVH 1GDTA 4PELA 5FLXN 3H1HD 4JI1O 1AB3A 2XAQA 1R3KC 3CRMA 2EJRA 3I5CA 2BCCH 1H0TA 4MTOA 3F5WC 5L3DA 4MN4C 1KILD 3OE7G 3OGCC 4PA9A 3MUDC 1VF6A 4I50B 1OIPA 1CZQA 4DW0A 1FBMA 4RKUJ 2IBZG 3TGUD 3SPJA 1XILA 1LTTC 1WP8A 2K9JA 1UIXA 1K33A 4F6RA 5KAIZ 1J1DC 1GK6A 3LUTB 1SQXK 4JZ2A 1HNXB 2O3JA 4GKJB 5D5QA 4JI3B 2H89C 2CPSA 1A32A 4YIPA 4B3TO 1IFDA 4TUYA 4P9PA 4QIWF 5LHGA 3I56P 3L9DA 1GMGA 4P2ZA 3CWBD 3QTCA 1B04A 4ZKIA 4UCVA 1WB7A 3H1JE 2PFXA 3U59A 4DOJA 3M7MX 3OTOO 4N3YB 5L3GA 2HPCB 2WA3A 1GH6A 4BR6A 4U7NA 5IYZB 1GK9A 1M8OB 3N2GB 1GN6A 2OYIA 2ZE7A 4LF9B 3WB2A 1DF5A 1FJGO 4DR3B 5TISH 3HB3B 1X4TA 4Q6GA 2CE4A 1V54C 2RH0A 5AVQB 1Z56A 3CWBH 3F7YC 4MTGA 1OHHG 1LNQA 4X66O 2P7JA 1PP9J 4JI0O 1IDSA 4PJ0H 1I5XA 3TK1A 1Q6IA 1KP2A 4B86A 4BWAA 1SFCD 2YNYA 3V6IA 2VQFO 4JAAA 2C2AA 1VQ9V 1K8AQ 1B06A 4UVAA 1NU1J 3L35A 2N1TC 4X62B 2IYPA 1SQQD 5BZBA 2R5BA 3V4WA 2JEUA 5GONA 5L3EA 5EBLC 4DZOA 1NR1A 4BRYB 3CCSP 1KYOE 2AW9A 4OX9O 5CBFA 4FLYA 4R4MA 4NR1A 2J59M 4O4IA 1MKMA 1X59A 2V7QH 3RYIA 1UIIA 3L74J 4NPDA 3KYQA 1N7SA 3ZN0A 1GL2D 4BIUA 3FGAD 1L0NE 4NPFX 1YJNV 1VF7A 1SQBD 4H44C 2AZ2A 2QEXV 1HP8A 3K5LA 1YBKA 4F6EA 5JH7B 4DR2B 3JAWA 1G4YB 3ZMSA 1RM1C 3HUSA 1ZOYC 5KAIH 2HG5C 2ZE6A 3JATB 1L4AC 5LP6B 3EFFK 1PZQA 4DV2B 1RHZB 1SQPD 1R6KA 1Q86W 1VQNP 1VMGA 2BTQA 3MDSA 2YIUB 2Q9LA 2YIBA 2ITAA 1YJNP 2KI7B 1RE4A 3GVMA 2WLKA 3HKDB 2QEXP 1MZFA 2YKQA 2EJ7A 3DC5A 2Q0AA 1WPBA 3G3ZA 1QVGU 3SWKA 4YXDC 3G67A 3SYPA 2OQQA 1CI6B 3BRTB 2ZXWB 1M93A 1AP5A 3CX5D 2M3BA 1N34B 5CA3A 5AVTB 2A45G 5B1OA 1X8YA 5ITZB 3H32A 3T97A 1YTFD 4GKGA 4DV1B 3KPEA 3GMAA 4WBAA 4KL1A 4FJCC 2ZCEA 2ZM6O 5B1NA 1OVRA 3IGAC 4B3MO 1LR1A 3K5OA 1H89A 4WB4A 1NQTA 4TQDA 1L0NK 4JPRA 4U7JA 1Q82Q 3LDDA 2DJVA 1XNQO 2JWDA 5LHHA 4RO0A 5BR8B 5B1BC 1EZVE 1IFNA 4NTXA 2JS3A 1WN7A 3Q5PA 3APQA 1KB9F 1KP3A 2F23A 3OR7C 1FXHA 3ZMTA 2Q7EA 1RQUA 2Q6AA 4TV9B 4NYKA 3UT5A 3ABMC 4DT0A 4JAVA 4NPEA 2FYUD 1VQOP 4UB8H 1KILC 1SQVJ 3L72E 3VQWA 4JTCB 1I0HA 1EN4A 2E3CA 1K73Q 1H2SB 2YIDA 3FX0A 3RK3E 4XFJA 3FFQA 4TLFA 4DV7B 4YHHO 5CJ0A 1URQB 3E1IA 5GTIZ 2WMMA 4UXNA 3APOA 2XAFA 4W4KA 4IHJB 1XI1A 3H1LE 1ZN5A 1M90Q 1BGYJ 1HJ0A 1NS1A 3MIWA 2KUBA 4L74A 4UCTA 1COWG 1N36O 3WU2E 3V2QA 5GTHE 2LXCB 3H1IG 3H1HJ 3N2KB 5LMNB 3EXAA 1KFMA 1LTSC 2P67A 1SZXA 3CMAV 5BY1A 3ZS8C 1LTJB 2ZQMA 1I94O 1ZRTE 4W80A 4PDLA 4TOIA 4Y99B 4RUEA 1XDCA 3Q3DA 2YEVB 3TETA 1LTIC 1YDXA 3W7UA 4R6ZA 1NTME 1N8RW 3TGUJ 2ZNIA 1MFTA 1YJ9P 2LFRA 2WSSG 3RGBA 1F7YA 3ABKC 1R3JC 2WPSA 2OYHB 4OPAA 2KP8A 3K5BA 3H1JH 3CMAP 5LGNA 1VQ6V 1RPOA 2ZT9C 3BA9A 1GM8A 4I4TA 4O4LB 4UCOA 1FZCB 2CTRA 1YCIA 1JMKC 2QRXA 3BCCG 1EXIA 5CN0A 3FKSG 3TXQA 5LYJA 4JZGA 1JY2P 1YTZI 1THZA 4RQFA 1KUQA 3QO7A 2F43G 2ZXXA 2UXCO 4FFBB 2IDBA 4MTXA 4D6TD 1V55B 2Y9ZA 1J2JB 1FFXA 4J7ZA 1S72V 3QO8A 1R3IC 1DEBA 4HJGH 3CCEP 3M9HA 4NXMO 1FXKB 1FDMA 1FS0E 2UUCO 1W0JG 1KQLA 2ADQB 1J95A 1KC8W 1DD3A 1EC5A 3RL0B 4X1IB 1FZEA 4JTAB 4IGGA 1KKCA 3RK2C 3K79A 4LF5B 1T6AA 3PTZA 1GL2C 1S5LE 1KQGB 1M1KQ 2CGNA 4D6TH 2B9BA 1VARA 2W8ZA 4HYTB 4O9BA 3O6QA 2DQ0A 1VQKV 5DN6G 1N7LA 4G2KA 5H6QA 4DJGA 1IVSA 3B71A 3PN1A 4QGPA 2V7QJ 1N33B 2BCCG 3WUUA 1EM1A 4NXNB 1SQQJ 3K0GA 3L75J 1L0NH 3PP5A 1XMOB 2DOSA 1M56C 5BMVA 1K7DA 5K1XA 2H8PD 5LA6B 3GHGA 1WNSA 1QGKB 5GTHZ 3WU2Z 5AW1B 1VQKP 1JTHA 3AEBC 3F5TA 5AVWB
chains in the Genus database with same CATH topology
5M1BA 1DIPA 4H13C 1OW6A 2WSEJ 3ABVC 1DD4A 1PIXA 1TU3F 2JO1A 1FDIA 2J5UA 2QIWA 3AE6C 2E75D 1KQFB 1HJ0A 4KT0J 4H44D 1PV3A 2E76B 3D6ZA 1OW8A 1IK7A 3AE8C 1VL2A 3AE4C 1RQVA 2O01J 3C8VA 3GLMA 3D70A 2E74D 4R4LA 4H0LD 3AE7C 1OMIA 3AE2C 3AEFC 3EWKA 1Y9BA 3AEGC 1KTMA 4R4MA 3RL0g 2YMKA 2ZT9D 5KLIC 3GF3A 4H13B 2YIUC 5L8RJ 1ZRTE 1MKMA 2QJPC 3Q3DA 2H88C 2K9YA 3FGAD 1KILE 1WMKA 2G8YA 4H44C 4YTPC 3D6YA 2MKVA 3AEAC 1VF5B 4PV1D 5KKZC 4OGQB 1KMIZ 2D2CB 2QSIA 2E74C 1ZOYC 1EXJA 1ZMEC 3T97B 2G3AA 1GMJA 1Q90D 2ZT9C 4TT3H 1ZP0C 2E76D 2JP3A 3AE5C 2QJYC 1EXIA 1YQ4C 4RKUJ 4YXDC 2E75C 2QJKC 2OQQA 1HF9A 4H13D 2IDBA 1KORA 3IAOA 1UIXA 1FDOA 1S1CX 3SFEC 3AEEC 3Q5SA 1NYHA 3S9OA 4H0LC 1VF5D 3GMAA 3AECC 4I7ZC 3AE1C 1DD3A 2H89C 4OGQD 2D2CD 2NZ2A 1AJYA 4GDOA 4Y28J 2FBWC 2E75B 1PL5A 2BEQD 4U7JA 1YQ3C 1KQGB 1S5LX 2FYNC 4H44B 1K04A 3Q2YA 3G9RA 4PV1C 3O6QA 3R4YA 2WSCJ 3AE3C 3GF7A 3Q5PA 2E74B 1JB0J 1VF5C 3B71A 4H0LB 2BEZF 2V7QJ 3AEDC 2WSFJ 3H25A 1RQUA 1R8EA 4I7ZB 2WPVB 4OGQC 2D2CC 2ZT9B 3SFDC 3D71A 2E76C 3Q1MA 2WQYC 2FXPA 4IL6X 4Z1MH 1U57A 3LW5J 1OW7A 3IN6A 3RK3E 3Q5RA 3AEBC 4XFJA 2P10A 4PV1B 1K05A 1NGMB 3AE9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RKU J;  2WSE J;  4H44 B;  2QJP C;  2K9Y A;  2QJK C;  1S5L X;  2WSC J;  2QIW A;  1VF5 B;  4KT0 J;  2E74 B;  5KKZ C;  1JB0 J;  4H0L B;  4OGQ B;  2D2C B;  2QSI A;  2E76 B;  2WSF J;  4I7Z B;  2WPV B;  2ZT9 B;  2O01 J;  3C8V A;  1Q90 D;  4IL6 X;  3LW5 J;  4Y28 J;  2QJY C;  5KLI C;  4H13 B;  2YIU C;  5L8R J;  2E75 B;  1ZRT E;  4PV1 B;  2FYN C; 
#chains in the Genus database with same CATH topology
 1FAV A;  4JYC A;  3SJC C;  1R73 A;  3TCU A;  3VQV A;  2KQX A;  1N0J A;  3KCX A;  1HNX O;  4GKJ O;  3U0Z A;  1J1D B;  3MP7 B;  4JI3 O;  2QKC A;  1G2C A;  1SQB J;  1SC5 B;  4ABM A;  1VQM P;  1FJK A;  1IUR A;  2E76 B;  2OGU A;  5EZY A;  3CCQ V;  1FYJ A;  1AV1 A;  1NU1 E;  2OYI C;  4ICG A;  2EZP A;  2Z3Y A;  3A0H E;  3JAR A;  2C0X A;  5AVV B;  4F4L A;  1SQP J;  5CMU A;  2AXC A;  2Y0P A;  2A06 D;  1VQ7 V;  3H1K J;  3HKE A;  3RL0 g;  3V2R A;  1QR9 A;  4Z1V A;  4FLW A;  4EI2 A;  4QNH B;  4PA7 A;  4LF9 O;  3HKC B;  4ZKU A;  2PF4 E;  4P9O A;  1NAF A;  2JVD A;  4DR3 O;  4U3J B;  4RAI A;  2P90 A;  5KX5 B;  4LFB B;  1WMK A;  3L71 D;  3L74 E;  1WB8 A;  1OFC X;  3CC2 V;  1Z2G A;  2KG7 B;  2X6C A;  1YIT V;  1URQ D;  4E2L A;  2A06 H;  2JS5 A;  2VWJ A;  1EZV H;  3OJA B;  2I1J A;  1Q6U A;  1MAB G;  3K0D A;  4UVB A;  1DLB A;  1NTZ G;  2O57 A;  3A0B E;  4GX5 A;  2CH7 A;  1Y67 A;  2R70 A;  4B7E A;  1RF1 C;  3OFN G;  3WUV A;  1YTZ T;  3NXS A;  1QL1 A;  2UUB B;  4L73 A;  1HVV A;  3L72 H;  1AI5 A;  1F51 A;  2ZE8 A;  3LDC A;  3IAO A;  1KOR A;  4RQE A;  3OTF A;  2RQ6 A;  4YJ3 A;  3VQY A;  2JIZ G;  1GW4 A;  2K37 A;  5AVX B;  2HFE D;  5K5G B;  2Y0C A;  1HWY A;  1WPX A;  3OTO B;  3HE4 A;  4GYC B;  5KMG A;  3QG5 A;  3AEC C;  2HLD G;  4TWK A;  2QJY B;  1WJZ A;  3H1L H;  5EIB D;  4LBE C;  4QMA A;  2FYU J;  5KHJ A;  1N4C A;  3B8N A;  1PPJ D;  5CBH A;  1N2D C;  4DR2 O;  1USE A;  1HWT C;  2HOD A;  5GTH H;  3F5H A;  3WU2 H;  2O1K A;  1QX8 A;  1RE4 C;  4H44 B;  4JI6 B;  5KHG A;  4DV2 O;  1L2P A;  2JWA A;  4DRX A;  3UO2 A;  4JI0 B;  2BEZ F;  2WPV B;  1MSD A;  2B5U A;  1T3U A;  4HH2 A;  5C39 A;  3UO3 A;  5AW7 B;  5JCO C;  3CI9 A;  1NTM H;  2B1I A;  4Z1M H;  1K9M W;  5J2T B;  3IN6 A;  4C7N A;  3K5M A;  1SQV E;  1N34 O;  3Q5R A;  3A0H Z;  3JD3 A;  1QCE A;  2JDI H;  3RL0 D;  1NR7 A;  4GUN A;  3U1C A;  1R6N A;  3LNM B;  2RNB A;  2R9A A;  5H2F Z;  3OAA G;  4QE9 A;  1X22 A;  4U7O A;  3G4S V;  4GLX A;  1QLN A;  5IWA B;  2HYN A;  4EIJ A;  2AHY A;  2RCV A;  4E4E A;  3IAY A;  4DR7 O;  3JAS B;  4WFA V;  3B8M A;  5FNV A;  3ZN1 A;  1SQF A;  2QE7 H;  5LP6 C;  2YUA A;  4JPZ B;  1RFY A;  2GA1 A;  3L70 J;  3H1H E;  1BL8 A;  2OTJ V;  4PA4 A;  2RMZ A;  2L6L A;  4IL6 Z;  2YIU C;  5B5E E;  4LNU B;  1EDL A;  3HKB A;  1EDK A;  2Z5U A;  3G4S P;  2ITC C;  3JAK B;  2PYL A;  2FFD A;  1KIL E;  1GN3 A;  3AEA C;  2JGD A;  4N21 A;  1P84 F;  3CXH F;  2ZXW C;  4D6T J;  3ABM B;  1EDI A;  3TGU E;  2NPS C;  1EXJ A;  1U96 A;  2OTJ P;  4TSF G;  2H8P C;  2QM4 A;  3JD4 A;  4DV7 O;  4FPP A;  2QM8 A;  3UIA A;  1SQV K;  2ZNJ A;  3RW0 A;  5KLV D;  1PP9 D;  2E76 D;  2B9Z A;  1MA1 A;  1ZTE A;  4MSW C;  3U10 A;  3QWO C;  3P8M C;  4DUY B;  1H8E G;  1OCZ B;  5C8Y B;  3TJT A;  2JKV A;  1JOY A;  3FB6 C;  3EFG A;  3CHX A;  2F4V B;  2LKM A;  2EIK C;  4HBN A;  2YC0 A;  4ZI7 B;  1VQ5 V;  3CEI A;  1AI7 A;  1YQ4 C;  5TIS E;  1N8R Q;  4IYH A;  1KV4 A;  3G71 V;  2KSJ A;  2K3R A;  4CC5 A;  1GO3 F;  4ZNC A;  1K5Q A;  4JGS A;  5LMN O;  2G38 A;  5KHI A;  2R72 A;  1QLE C;  1GAX A;  1S1C X;  1NTK D;  2QWP B;  3RFR A;  4PJ0 E;  1PP9 H;  4GX1 A;  1XNQ B;  2ZR2 A;  3IC7 A;  2XV5 A;  1RY3 A;  5AW4 B;  2JEX A;  3K9S A;  1ZW0 A;  1AJY A;  4CC6 A;  3FXD A;  2K1A A;  4XA4 A;  4BAY A;  3G71 P;  3P32 A;  5E1A C;  1LWU B;  1FU1 A;  2E75 B;  2Q5U A;  3FWL A;  3KDP B;  3VMA A;  4AI8 A;  1NU1 H;  2M0B A;  1KD1 Q;  3A0H H;  3MZW B;  3H1J G;  3FB7 C;  3ABK B;  3CC4 V;  1URQ C;  3M0D C;  2XOK G;  1NKD A;  2DYR C;  2YO2 A;  4OXS A;  5FPO A;  1L0L J;  5H2F H;  2KIK A;  4MTF A;  1FPO A;  2ZT9 B;  2CTP A;  3S4R A;  1SES A;  3AG2 B;  1S9K D;  3Q1M A;  1CEZ A;  2ZXE B;  4NTY A;  2KSD A;  3L74 H;  1SQQ E;  2UXN A;  3L75 E;  4N23 A;  4N78 D;  1QEX A;  1GD2 E;  4GIF A;  1RSO A;  1EDJ A;  3ZMZ A;  4GOE A;  4AUW A;  2F1M A;  4GOD A;  5KAI E;  4XDL A;  1W2E A;  3ABV C;  2WLJ A;  2HJF C;  3AG4 C;  3X2Q B;  4WBN A;  1EBO A;  2GUZ B;  3M99 B;  2HFE C;  1YHQ V;  4Y99 C;  5B5E Z;  3H6P A;  1PL4 A;  3L71 J;  2H3O A;  3ZMV A;  2ZIN A;  1YJW V;  4H44 D;  3A0B H;  5KJ7 D;  2EZO A;  1TA8 A;  3KKY A;  3D6Z A;  2XHB A;  4LF5 O;  5LXT B;  3VN0 A;  3CCV P;  1SQB E;  3OT7 A;  2HLO A;  1WRG A;  4FLU A;  4FZ0 A;  3EWK A;  2HKO A;  1L4A D;  1PGO A;  5LOV B;  2YKO A;  3RK2 B;  4NKG B;  3SGI A;  3OMA B;  1H0T B;  4DYL A;  4AQR D;  5GW7 A;  1SQP E;  1FZC C;  1KN7 A;  1CXZ B;  4ZIB A;  1N33 O;  1JY3 N;  2LGW A;  3H1K E;  4NXN O;  1XRE A;  2OYQ A;  1XMO O;  4K35 A;  1BE3 D;  1L0N G;  2WZ7 A;  3WMM 0;  2K9J B;  1BSM A;  4F6R B;  1VP7 A;  1V55 C;  1IFJ A;  2QDO A;  5EC1 C;  3CYO A;  1T5E A;  1E1R G;  1M56 B;  1YI2 V;  1Q90 D;  2W6J G;  1NH4 A;  3CX5 E;  2BSK B;  2WLM A;  1BDD A;  1E1Q G;  3ZRX A;  3KXD A;  4YY3 B;  2CDY A;  1KB9 I;  1I08 A;  3J81 N;  4TUY B;  2OYO A;  1W2B O;  1AQ5 A;  4PD4 I;  1XOU A;  3OR6 C;  4ZHQ A;  4JAS A;  2Y0D A;  1TVK B;  3CCJ V;  1YEW A;  1BGY D;  1TUB A;  4UV8 A;  1RE3 C;  5CCG D;  1YI2 P;  2K88 A;  2ZFC A;  1JY3 O;  2IW5 A;  1FDO A;  2WIT A;  3TSI A;  3K58 A;  3CD6 V;  2OYI B;  1U97 A;  1YF2 A;  2W27 A;  5KHK A;  5AW6 B;  1NYH A;  3KHU A;  3AK3 A;  4EOT A;  5IYB O;  1SFC A;  4YJ2 B;  2QA4 P;  1SQP K;  4LFB O;  1Z5W A;  3BAS A;  2LW1 A;  2CUG A;  3RYH A;  3A2A A;  3P3P A;  1PL5 A;  1BGY H;  2FYU E;  3SWF A;  1PGJ A;  4K8X A;  2IX7 C;  2AEM A;  3WB0 A;  4DV0 B;  1H2N A;  5AW3 B;  1S3J A;  4WFG A;  1DK1 A;  4IFM A;  4ZKP A;  1EZV G;  3H1H H;  5CA0 A;  1DEE G;  2C0W A;  1VF5 C;  2ZVN B;  4EFB A;  5B5E H;  1Q7Y Q;  2WSF J;  5APU A;  3H25 A;  2IPP A;  1QNM A;  3W7S A;  4ASV A;  2N74 A;  2Q73 A;  3JAM N;  4LH6 A;  3KG2 A;  5J2U A;  1M1J C;  2E76 C;  3STL C;  2ZJS E;  1JQ0 A;  2UUB O;  4QPK A;  3OUF A;  5CA1 B;  4J7J A;  3ZHQ A;  3KZI Z;  3L72 G;  3E8H A;  1RF1 B;  3CC7 V;  3TGU H;  2M5A A;  1N73 A;  3L73 D;  4PV1 B;  2GTS A;  4O4I B;  1DD4 A;  2UXD B;  1N7S B;  2J5U A;  2X6B A;  2E75 D;  5KTB A;  2WT7 B;  4K3A A;  4IFD K;  1Q81 Q;  3E7K A;  3H1L G;  5AW0 B;  1L8D A;  3JAW B;  5L3B A;  5B3S C;  2VQE B;  3HUS B;  3BA8 A;  1MFZ A;  1ZV8 A;  4UB6 Z;  2W83 C;  1H8H G;  2N04 A;  2IJI A;  2YXH A;  3CP1 A;  3AE7 C;  4JI6 O;  3BPZ A;  1N32 O;  3AEF C;  2BTQ B;  2ZT9 D;  2SPZ A;  2HVJ C;  4J7K A;  1AQT A;  5KLV J;  3L70 E;  3CME V;  1Y74 A;  3SYQ A;  2IZ1 A;  4CH6 A;  1F4M A;  1OV9 A;  5LGU A;  1D5N A;  3QVN A;  1QHT A;  3ZHV A;  1SQG A;  3PHL A;  4O4H A;  3R65 A;  1NTM G;  1Q5O A;  1AVM A;  2BAS A;  1T2K C;  4Z1M G;  3D36 A;  3CCL V;  2B88 A;  2MW2 B;  1P7B A;  3L75 D;  1SA0 B;  2K9P A;  3T97 B;  1NTK J;  3VBB A;  2IZ0 A;  1SKV A;  4D6T E;  3HD7 C;  1JMB A;  1FXV A;  3CME P;  2X0L A;  4MS2 A;  4G28 B;  4I50 A;  3RT3 C;  3ZRV A;  2M7W A;  5C93 A;  2QJY C;  3AE5 C;  5GTI E;  5KUK A;  3OEH G;  1GU4 A;  2WLI A;  1VQ9 P;  2Z4E A;  3EHB B;  2ZVO B;  3N4X A;  4PI0 A;  2Z5H A;  5IWA O;  3CCR V;  1Q43 A;  3RK2 D;  2QJK C;  1SQQ H;  3C90 A;  1XL6 A;  4L76 A;  5EK0 A;  3L75 H;  3ZJZ A;  1NZ6 A;  5IT9 N;  1VQ4 V;  4FK5 C;  5KJ7 C;  3K57 A;  1RPR A;  2QE7 G;  4X1Y B;  3CJH B;  3W7T A;  1PV0 A;  4H33 A;  1BQZ A;  2KB7 P;  1M9N A;  4IOI H;  3CCR P;  3H1K D;  1FS0 G;  3E8B A;  4IIJ A;  1M56 D;  3ABU A;  1IZ3 A;  3KZI H;  2HPC A;  1SQB H;  3B5N A;  3P30 A;  3U1A A;  5IYZ A;  2Q1K A;  3OW2 O;  3E8G A;  3Q4H B;  2B89 A;  4N6J A;  3STZ C;  3HE5 B;  1KB9 D;  2NPS B;  1SQP H;  4DUY O;  1S0V A;  3H1K H;  3QH9 A;  4OGQ C;  4PD4 D;  2F4V O;  1AVO A;  3CRA A;  3T1C A;  3DSQ A;  3OUS A;  1X0T A;  1U57 A;  2EIK B;  1GTW A;  4MVM A;  5CCH A;  1ZL8 A;  3FAV A;  2W90 A;  2QR4 A;  1AVY A;  4DR7 B;  1DIP A;  1E79 G;  2V4H A;  5CCG C;  2F93 B;  2DE0 X;  2A06 E;  1ZXG A;  3CX5 H;  4XDK A;  4JV5 B;  4EDF A;  4RJT A;  2F66 C;  1OZH A;  2ADP A;  1QLE B;  1HNW B;  1S2E A;  4ZOL A;  1FZG A;  1BE3 J;  1H8A A;  1PV3 A;  4XDJ A;  4MVQ A;  1RF0 C;  1MSW D;  1Y6X A;  4PD4 F;  3AE4 C;  3L71 E;  1NJI Q;  2O01 J;  2YIC A;  5AVZ B;  1NU1 G;  2UU9 O;  1VIB A;  5APY A;  2W0X A;  2AEJ A;  3QO5 A;  2Y69 B;  4I4T B;  3HRN A;  5KA6 A;  2A0L A;  2BOC C;  4DUZ B;  2XAS A;  5AVR B;  1OCZ C;  4DV5 B;  3T1Y B;  5B1A C;  3MAQ A;  5LYJ B;  2QJP C;  2IBZ I;  5BXZ A;  1YVW A;  2DYR B;  4PV1 D;  3HPL C;  3L74 G;  4NTW A;  3JAT A;  2F95 B;  1O9G A;  4X9Q A;  1BMF G;  2Z5I A;  2FYU H;  3JSV C;  3SPH A;  1N7S D;  4X64 O;  2GV9 A;  4YPC A;  1Q3E A;  4KFM A;  2Q6Q A;  2Q5Z A;  1FOS F;  3HKD A;  4A5U B;  3VP8 A;  3SSU A;  1QU7 A;  1LWU C;  1KKD A;  2JEE A;  2Q7H A;  4HYO A;  3AG4 B;  1Q6H A;  1AIL A;  1BCC J;  2E75 C;  1PFI A;  1PPJ E;  2YIB D;  4U3F D;  3O6Q B;  1JJ2 U;  1PM9 A;  1B6Q A;  4J9Y B;  2KS1 A;  2XZR A;  1EN5 A;  3BAA A;  2Y4U A;  3GB7 C;  1S5J A;  3ETG A;  5H9C A;  2DW3 A;  3AE1 C;  3L70 D;  5IYD O;  3AG2 C;  5BMV B;  3C9I A;  4IFF A;  1GKF A;  4UFZ A;  2I1K A;  2UWJ E;  3D8C A;  2EIM B;  2BEQ D;  4QJF B;  4BXL A;  1JTH B;  5LL6 Y;  3L73 J;  3G9R A;  2ZDI C;  3R4Y A;  4JF7 A;  2IH1 C;  4KP4 A;  5BU8 B;  1VQ6 P;  5H5N A;  1BSN A;  3ASO C;  1VQ8 V;  1HR0 B;  3O8Z A;  1KFN A;  1NHL A;  3X2Q C;  2L5G B;  1GTO A;  4YY3 O;  1G2C B;  2C9N Y;  2KK7 A;  3L70 H;  3RYC B;  1IBM B;  3FWN A;  5EZY B;  2KNC A;  4RWU A;  1BDC A;  5IYC O;  3HTK A;  3RBZ A;  2QG4 A;  2FYN B;  2FKX A;  3LW5 J;  1NO4 A;  2YXY A;  1P84 I;  2Y0I A;  2GUS A;  3HKE B;  3CXH I;  4MW8 A;  1SQV G;  3AE9 C;  1NTM K;  2WSE J;  4H37 A;  1QQC A;  5KAF Z;  1S72 P;  1VF6 C;  4DR1 B;  1ARO P;  2QIW A;  1OCR C;  3II6 A;  4RES B;  1KQF B;  2H7H A;  5GTI H;  2EBO A;  2O1J A;  1IK7 A;  1VL2 A;  2OIE A;  5EC2 C;  4WY4 A;  2ZIM A;  3N2K A;  4MVU A;  3KQG A;  3B4S A;  1XTC C;  2NPS D;  4DV0 O;  3AG7 A;  1LTJ A;  2A3Q A;  1JY2 N;  2YMK A;  4J42 A;  1NVO A;  2OCH A;  3H1H G;  1T3J A;  2CH7 B;  2A7W A;  1MG1 A;  1PP9 E;  5KLV E;  1VF5 B;  4EB6 B;  2OYH A;  1KYO F;  1ORQ C;  1L0L D;  4YJ3 B;  1XNR B;  2A45 I;  3BY6 A;  5JJJ B;  2QSI A;  2QKS A;  3LSS A;  5CMZ A;  1M1J B;  4G27 B;  1PNM A;  2OT5 A;  3TGU G;  1QLE D;  2G3A A;  4KHX A;  5EFW B;  3JAL B;  2NN4 A;  2QTS A;  2UXD O;  4X1K B;  1ZP0 C;  3RVZ A;  1NTK E;  2XND H;  1KU9 A;  1KEC A;  3AG1 C;  5H2F E;  2AEF A;  2VQE O;  3GWO A;  1L0L H;  3I5D A;  1JY2 O;  5DJU B;  1OVU A;  1HUC A;  3CCQ P;  2FML A;  1KQS O;  2E5T A;  5B3S B;  3CWB G;  5JJE B;  1EZJ A;  1FXK A;  4DRX B;  2GM4 A;  1D7M A;  1VQ7 P;  4L87 A;  1S5H C;  2H43 A;  2IBZ D;  4X1I A;  4IL6 E;  3M06 A;  4CH5 A;  5AW2 B;  1LT9 A;  3B40 A;  4Y28 J;  1NAY A;  2QJ1 A;  4LR3 A;  5AW8 B;  4DR4 B;  1S9K E;  3L71 H;  3HR0 A;  5DJT B;  1W0K G;  1USD A;  3DC6 A;  3CC2 P;  5LBQ A;  2AXT Z;  4CH3 A;  1T8Z A;  4N78 E;  4PV1 C;  4TV8 B;  1YIT P;  4X20 B;  4UVC A;  4X88 A;  3O9O A;  5AVY B;  5APV A;  3B77 A;  4RUF A;  1R5S A;  1FE6 A;  4QPJ A;  3ZBH A;  1N7S C;  1NU1 K;  2IBZ H;  4H0L B;  3K08 A;  1SQX J;  1Q86 Q;  4R50 A;  1JO5 A;  2DQ3 A;  3HD7 B;  1DF4 A;  2YXQ B;  3RYF A;  3BVO A;  5LA6 A;  3UKM A;  3E2E A;  3TDK A;  3HUS C;  2OCC C;  1HGV A;  1K3E A;  2V7Q G;  2NLJ C;  4I0X B;  4FVM A;  5FNV B;  3SJA C;  3T1H B;  1JCC A;  4LH7 A;  2FXP A;  4IL6 X;  5CHX A;  5DED A;  1SQQ G;  5BVZ A;  2V4D A;  3L75 G;  2VS0 A;  1XTG B;  3SWY A;  3C3S A;  2MK3 A;  3LSU A;  1LT1 A;  2QJK B;  3HKB B;  4UCU A;  3UQ8 A;  2XKM A;  1N32 B;  2FFD B;  4OVN F;  1W2B U;  2RN0 A;  2JGD B;  2FB5 A;  3WFV A;  2E43 A;  3ZMU A;  2E5Y A;  1OW8 A;  4FLZ A;  1OJH A;  3IR9 A;  2P5O A;  1BE3 E;  4I6M C;  1SQB G;  1PPJ H;  1J1E B;  1LTA C;  2WWW A;  1OMI A;  2WLL B;  4JYA B;  1Y76 A;  2NR5 A;  1OX3 A;  5E79 E;  4I55 A;  4WVZ A;  1KTM A;  4UV9 A;  4LWS B;  4BIO A;  3IC9 A;  3ABL B;  5IJ0 B;  5L3F A;  1UJW B;  1SQP G;  2VRZ A;  1N0N A;  3BEH A;  3H1K G;  1XHX A;  1UFI A;  2KLU A;  3DGE A;  4BIZ A;  1TGO A;  2OTK E;  3GWK C;  4BW9 A;  1P84 D;  4U3F J;  4OGQ B;  4CH4 A;  2CK3 H;  3E1R A;  1IZN B;  3CXH D;  1N86 A;  1I5Y A;  1BGY E;  2WPQ A;  1GMJ A;  3B8E B;  1JMM A;  4WCE V;  4JV5 O;  1ZR2 A;  3PRJ A;  1HNW O;  1I7F A;  3UCS C;  1FFT B;  1PGP A;  1IX9 A;  4DCK A;  2N1T A;  2H94 A;  2WSF H;  1YIJ V;  4K0K B;  3L37 A;  2JK5 C;  3OD4 A;  3CXH H;  3F89 A;  4X65 B;  2AXT H;  2ZE5 A;  3ZDM A;  2UXX A;  5CB4 A;  1BCC E;  3ETE A;  3JYC A;  3PJS K;  2DW4 A;  3AK2 A;  1L1F A;  4DO2 A;  1K8A W;  3CCM V;  3A0R A;  5CBN A;  1ZUQ A;  3AEE C;  1WA8 A;  1CSB A;  3J7A U;  1OCC B;  4DUZ O;  5IJ9 B;  1VF5 D;  4J9Z B;  5KHH A;  4DV5 O;  3T1Y O;  4EYY Q;  1JEK A;  1QVF O;  4J80 A;  1R6T A;  3S3W A;  2YKP A;  2YO3 A;  3E22 B;  4ZMD A;  3WG7 C;  5B1A B;  2QJP B;  5HFL A;  1IBK B;  2LO1 A;  3I55 V;  2FYU G;  1OZ0 A;  1AJN A;  1O9H A;  2ARH A;  2HVK C;  1WP7 A;  2Y4T A;  4WBN B;  1JCD A;  1L4A A;  3L73 E;  2YIA A;  2YMY A;  2EX3 A;  2MJZ A;  3AED C;  3P8C D;  5IY5 C;  3OA7 A;  2Q69 A;  3F7V C;  3LIE A;  2D2C C;  3RVY A;  5KLV H;  2W6B A;  3SFD C;  3D71 A;  3H9V A;  2X6A A;  2A45 H;  2ZYD A;  4I5S A;  1VQ5 P;  3DXR B;  4JYY A;  2YDE A;  2Z0A A;  4HAM A;  4TQF A;  3G6E V;  1JA8 A;  1LGH B;  2ETN A;  2R3C A;  2Y69 C;  2IU0 A;  5DEC A;  4UCS A;  3K3W A;  5E79 Z;  3TF5 A;  4DV6 O;  2UU9 B;  1FZB A;  1MUU A;  5JQG A;  2PZS A;  4LF6 B;  1NTK H;  2PGD A;  4ZBM A;  2V1D A;  3SDL A;  2Y48 A;  1LP1 B;  3JAS A;  4JI2 B;  1KC8 Q;  1KZU B;  2W0F C;  2KSE A;  1T2K D;  2B87 A;  3GLM A;  1GN2 A;  5LGT A;  1OXZ A;  4LF4 B;  2PTM A;  4JAU A;  1F4N A;  3M8A A;  4DR5 B;  4H0L D;  1B3Q A;  3K06 A;  2P7T C;  1HNZ B;  4J41 A;  2FXM A;  3MD0 A;  3AEG C;  2XAG A;  3HD7 D;  2R5D A;  1HR0 O;  2XAH A;  3K5N A;  4X64 B;  2JRI A;  3ZHU A;  2JJL A;  3CC4 P;  1CP9 A;  1XMQ B;  1JNM A;  1XQ8 A;  1IBM O;  4IL6 H;  2E42 A;  3ASO B;  4LC1 A;  4ZHQ B;  1Q82 W;  3H1I D;  4FLX A;  5TJH A;  2YXR B;  2KZI A;  3RK3 C;  1KIL A;  2E74 C;  1E5W A;  4W7Z A;  1X9V A;  2X7R B;  3KZI E;  3OW2 U;  4LFA B;  5BU5 A;  1VEW A;  4B7K A;  5C8Y A;  4JI7 B;  4D6T G;  4WY4 C;  1Y66 A;  3W7W A;  2JP3 A;  4PA3 A;  4BWN A;  4DR1 O;  1TAE A;  3OMN B;  4ZI7 A;  2WVR A;  2CTW A;  4CS2 A;  1YHQ P;  2ITD C;  3J80 N;  3SPG A;  3VP9 A;  3RYH B;  3GHG C;  2P58 A;  2LP7 A;  1JPX A;  4LFC B;  2ATK C;  2EIM C;  2AHZ A;  1YJW P;  1OCR B;  1PNL A;  4O4J A;  1HF9 A;  3CPW O;  3E86 A;  4D7T A;  3JSN A;  3MTU E;  4UB6 E;  1AA0 A;  3TNU A;  3LNN A;  3ABT A;  5CA0 B;  1HGZ A;  3BCC D;  1M90 W;  5FL7 G;  3CCU V;  2ODM A;  3FXE A;  1NH2 B;  1SQQ K;  2WSS H;  3B2E E;  1KB9 E;  4OGQ D;  3RBX A;  1JFF A;  1ENV A;  5EYP A;  2YSU B;  5LMU B;  3BRC A;  4CS4 A;  1Y4M A;  1FC2 C;  4PD4 E;  3ZRW A;  4MVR A;  3TXS A;  3ZHS A;  4HNA A;  1VQL V;  4B3R B;  1IJD B;  1XL4 A;  1XNR O;  2FYN C;  2M5A B;  4JBZ A;  4EKW A;  1BE3 H;  2IJJ A;  2Q9I A;  1K5S A;  3CCU P;  1FKA O;  1AJP A;  2O01 H;  5E79 H;  1JUN A;  2P22 C;  1VQP V;  2R44 A;  3H01 A;  1SQB K;  2EIL B;  1VDF A;  2WPR A;  2OIG A;  2Y9Y A;  2IFM A;  5APW A;  2DYS C;  2ZIO A;  1P49 A;  4O2A A;  1HTL C;  1RP3 B;  5JVD A;  1HJB A;  1SQX E;  4PDV A;  4JQ0 D;  1NKN A;  3JC2 2;  4JYB A;  3AG1 B;  3CCJ P;  3S1K A;  2BCC D;  3BVH A;  1QR8 A;  1VQP P;  1ZAU A;  1LT9 C;  1BCC D;  2QWO B;  2XU6 A;  3FD9 A;  3CD6 P;  1Y74 B;  4GX0 A;  2JO1 A;  1FDI A;  4J11 A;  1XUQ A;  3EVK A;  5J9P C;  2DWD C;  2A06 G;  2E5L B;  4HKZ H;  5LXT A;  3M9Q A;  1H2L A;  4O4H B;  1NVP B;  2P1J A;  3A3Y B;  4GT1 A;  2P6J A;  4DR4 O;  1BS3 A;  1JOC A;  1BSH A;  3LSQ A;  5GON B;  3C8V A;  2P4V A;  5LOV A;  1SVF A;  3L71 G;  1GL2 A;  1IFI A;  1DX7 A;  2JR8 A;  1BCC H;  2YI9 A;  3VOU A;  2IFN A;  3GF3 A;  2ZD9 A;  5APT A;  1IO4 A;  2WLI B;  1MMM A;  2Q67 A;  4OPH A;  1KBH A;  1NOH A;  2QWR B;  2K9Y A;  3I56 V;  4NB5 A;  3RYI B;  1M1K W;  4O2B A;  2G8Y A;  2KOG A;  2EIN C;  2LXB A;  1K92 A;  3A7O A;  3VMZ A;  1ZX3 A;  3T1H O;  4GOF A;  4AHC A;  4CPG A;  1M57 B;  1GRJ A;  1LUW A;  1H2G A;  1FZF A;  2O01 N;  1K4D C;  2BSK A;  4U3F E;  2OCC B;  3CC7 P;  1K9M Q;  1US6 A;  3FB8 C;  5CBO A;  3K04 A;  1JX9 A;  3L73 H;  2CAZ C;  4KUM A;  2QM7 A;  3BAB A;  2FYU K;  4DW1 A;  4A7P A;  4IIJ B;  3IFM A;  1P4R A;  1TVK A;  3N7N A;  1URF A;  2LW7 A;  3B5N B;  2KZJ A;  3LID A;  4I1L A;  5A2Q N;  5B66 Z;  2AZ0 A;  1PPJ G;  3CE2 A;  4OWF A;  4JYA O;  3JD1 A;  1PD3 A;  1AP6 A;  1NTZ D;  3ZHT A;  3BRV B;  3THO A;  4YJ2 A;  3LW5 H;  2XT9 A;  1X79 B;  4H0L C;  4KHP B;  3H32 B;  3C1L A;  4ASU G;  2IU3 A;  4K8Z A;  2WSE H;  2UUA B;  2JDI G;  4JI4 B;  2M8R A;  2DMX A;  4JI5 B;  3CCS V;  1ZL8 B;  2CK3 G;  3FAV B;  1Y8A A;  2FY8 A;  3CLQ A;  3CCL P;  3T4D A;  2QWN B;  1NTZ H;  3OM3 B;  1QBZ A;  2WSC J;  5IE9 A;  1OCO C;  2N9B A;  4DK1 A;  1GU5 A;  3E83 A;  1YYC A;  2ILM A;  4ZOL B;  4KJM A;  1NWQ A;  2FFD C;  4UB8 Z;  4B08 A;  1NI8 A;  5CA1 A;  2QVA A;  3UT5 B;  1ZWI C;  1RF1 A;  2QKA A;  1FZA A;  4K0K O;  4FM0 A;  2UXB B;  2HJD A;  4X65 O;  1J1E C;  2N05 A;  3ZRS A;  1NH2 D;  1KYO I;  3CSX A;  3PLN A;  1IXB A;  1JR9 A;  3BAT A;  1VQN V;  1VQ4 P;  4JF3 A;  1AR1 B;  2GHY A;  3UM7 A;  2CTQ A;  2FXO A;  2WT7 A;  2L35 A;  3ABL C;  3N2G A;  3T4Z A;  2HEP A;  3H1I J;  1PGQ A;  1IC2 A;  4LF8 B;  2Q4P A;  2RN9 A;  1G1J A;  1VPC A;  1IBK O;  4CBC A;  2HP8 A;  2YXL A;  3D70 A;  4I9W A;  1L0L E;  2Q7G A;  1KQS U;  3AE2 C;  3A8T A;  5KUM A;  4UB6 H;  3FX7 A;  3E89 A;  3QNE A;  1LTG C;  3WG7 B;  3ASN B;  2KYV A;  5CJ4 A;  4M3L A;  3VTP C;  1IBL B;  1KB9 H;  5KLV G;  1PP9 G;  2RMK B;  3D6Y A;  4XE5 B;  3RN4 A;  3JCU E;  5IY5 B;  2IJH A;  3JD2 A;  4PD4 H;  1SQX D;  5JCO A;  1SA0 A;  1GN4 A;  3P7K A;  2Q7C A;  2D2C B;  2GUV A;  5B66 H;  1DH3 A;  2LGQ A;  1H2K A;  4BRY A;  2KS1 B;  3BCC J;  4YXW H;  3FYI B;  4TT3 H;  1OCC C;  1ZLZ A;  3SYA A;  1NVP D;  3M91 A;  4LF6 O;  3DTU B;  4NVP A;  4WF9 V;  5KAF E;  3SJQ C;  1OWA A;  1NTK G;  3BHP A;  4WWI A;  2IM9 A;  1VQO V;  2IBZ E;  4GX2 A;  4LP8 A;  1MV8 A;  1Q2N A;  2ZYG A;  4JI2 O;  1GW3 A;  3GG2 A;  1SQX H;  4AQY B;  4X1Y A;  2AGA A;  4LF4 O;  5JH7 A;  1AR4 A;  3CX5 F;  3CJH A;  4DR5 O;  2M6Y A;  1HNZ O;  1EZV I;  5LP6 A;  1L0L K;  1FFX B;  1LTB C;  2XTA A;  4W7Y A;  1SLQ A;  4Z2W A;  2I8D A;  4AIL C;  1XMQ O;  1JJO A;  2KNC B;  1M57 D;  3OMI B;  2QWQ B;  1BHB A;  1H2M A;  3HTK B;  2GTA A;  1DTO A;  4JI8 B;  3R2P A;  3JD0 A;  3Q4H A;  5AVU B;  4B3S B;  2BCC J;  1CI6 A;  1K04 A;  2WTY A;  3Q2Y A;  3HE5 A;  4I2L C;  4LFA O;  1NBM G;  2NPS A;  2QTO A;  1R5L A;  2VWK A;  3GF7 A;  3RK3 B;  2P2U A;  4JI7 O;  2E74 B;  1JB0 J;  5ITZ A;  3NFQ A;  5JJN B;  3K9A A;  3B5N D;  2PAJ A;  4I7Z B;  1AJQ A;  5D5P A;  1JCH A;  3SJB C;  2QGN A;  3D3I A;  1YJ9 V;  4FM2 A;  4WY4 B;  4DV6 B;  4LFC O;  3H1J D;  2C9L Y;  1S76 D;  2POH A;  4PHZ A;  3GHG B;  2WLH A;  2ZR3 A;  1U7M A;  2K1E A;  4U3F H;  1JM0 A;  2J58 A;  4P30 A;  1OW6 A;  3CRR A;  1EQ7 A;  1TU3 F;  3ETQ A;  2EIJ C;  3SR2 C;  5KA5 A;  4IYI A;  5CCH D;  4TV9 A;  5LMU O;  1MZE A;  4L8J A;  1XBL A;  3TYY A;  4B3R O;  4MT8 A;  1M7L A;  2BE3 A;  3JCU Z;  2KB1 A;  4R4L A;  1P84 E;  1BE3 G;  3JAR B;  2HHH B;  1ROP A;  3CXH E;  3CCE V;  2FTK A;  2AXT E;  1SFC C;  4H13 B;  3CWB J;  1S4X A;  1VQ8 P;  1URQ A;  1IFM A;  3M0D A;  4LF7 B;  1NT2 B;  1W59 A;  4DR6 B;  1ZLL A;  4IHJ A;  1QVF U;  3IJ4 A;  3K59 A;  2MKV A;  1KD1 W;  5KKZ C;  1MNG A;  4GKK B;  1KYO D;  2DYS B;  2NNU A;  4GZR B;  1Q8I A;  4DV3 O;  2Q3E A;  5CBG A;  1EFR G;  3P3N A;  3ZIA G;  2RKL A;  3V2N A;  1TUE B;  1NTZ J;  3IFX A;  1BGY G;  3SYC A;  5KLI B;  5FPR A;  1L0N D;  1DGS A;  2W6A A;  3GW6 A;  2GDS A;  4FLV A;  1LT9 B;  2E5L O;  2KLV A;  2YEV A;  1FD9 A;  2ZYA A;  1KYO H;  1Z5V A;  1N73 C;  1HW7 A;  4YIO A;  4CZZ A;  1BT8 A;  1P7G A;  4DV4 B;  4FZ1 A;  1FJP A;  1BCC G;  1SP4 A;  1Y47 A;  3L4F A;  3VYI A;  2EIL C;  1FAF A;  2PP6 A;  3S9O A;  3W68 A;  1SZT A;  4O4L A;  3RYF B;  3L36 A;  1VQM V;  4PDR A;  3T2M A;  3HE4 B;  1FZC A;  5KMG B;  3ML0 A;  2D2C D;  3WUT A;  1AI6 A;  4BW5 A;  3P8C E;  5APS A;  5IDJ A;  5EBM C;  4GDO A;  3O65 A;  3USS A;  1V9P A;  2W6J H;  3MHS C;  5HFM A;  1S5L X;  1YQ3 C;  1WAZ A;  2KKW A;  2HOD B;  2EIN B;  4FFB A;  3ETD A;  2OTL V;  1SET A;  3AG3 C;  2P4K A;  1J5E B;  4GCZ A;  2WLN A;  3RYC A;  3L73 G;  2W6I G;  1R8E A;  1SER A;  3SPC A;  1SF9 A;  4EFE A;  3G6B A;  3CS5 A;  3MHV A;  1QL2 A;  4C7R A;  1QVG O;  3NMD A;  3FYE B;  3D36 C;  4UUJ C;  3JCU H;  1WLE A;  1EZV D;  2OTL P;  1Y76 B;  1HH0 A;  4I55 B;  5KLV K;  4JI1 B;  4R8C A;  1K05 A;  1RE3 A;  4C7N B;  1ZSP A;  1SRY A;  1PIX A;  4FFK A;  3JCZ A;  4KHP O;  4PA6 A;  4PI2 A;  4EEQ A;  3AE6 C;  3V5B A;  5KAF H;  2UUA O;  3L72 D;  3OEE G;  1V54 B;  4WFE A;  2B1G A;  2EUL A;  4JI4 O;  2IJK A;  4JI5 O;  3H1I E;  3M0A A;  3V2P A;  1M57 C;  3RK3 D;  1NTK K;  3CPW U;  2WPD G;  4MVO A;  1HDJ A;  2E74 D;  3MUD A;  3ITK A;  4DXW A;  5AG2 A;  1A02 F;  2LJ2 A;  4MVZ A;  4X62 O;  3D3Q A;  3H1L D;  1W5C E;  4WY4 D;  1M4U A;  4FIP C;  2H88 C;  4EB6 A;  2N1T B;  4B3T B;  4LLH A;  1OCO B;  1S5L Z;  3B5N C;  2M3E A;  1RH5 B;  1M1J A;  5CB4 B;  2UXB O;  1KMI Z;  3SYO A;  2PUS A;  3ICX A;  3JAL A;  3QF7 A;  3C3T A;  1WA8 B;  4X1K A;  1Q7Y W;  2RDC A;  1ZRT D;  4LGD E;  3E35 A;  3PH0 A;  3W67 A;  2WA4 A;  2P06 A;  5AW9 B;  1FJG B;  2R32 A;  3BCC E;  3V4Q A;  3CRQ A;  3HKC A;  3S3X A;  4WFB V;  1NTM D;  1ZR4 A;  1MOF A;  4U3J A;  2BTO A;  4LF8 O;  5KX5 A;  2GSM B;  5F2V O;  3IF4 A;  3AK1 A;  4JTD B;  5CCH C;  4X66 B;  1RM1 B;  1G6U A;  1IK9 A;  4H13 D;  1YXB A;  2KG7 A;  2R9I A;  3MGN A;  3CXC U;  1L4A B;  3SFE C;  3ZCC A;  4AYC A;  1UPG A;  2A79 B;  1MZ9 A;  3Q5S A;  2Q0O C;  1IBL O;  2VQF B;  1Q81 W;  2IH3 C;  1BHA A;  1R3L C;  3CB2 A;  2NZ2 A;  4X8A A;  3LDE A;  2XAJ A;  2OWO A;  3H1J J;  3VQX A;  1PL0 A;  3N27 A;  2FBW C;  5AW5 B;  4TV8 A;  4X20 A;  2DWE C;  1NKZ B;  4DV1 O;  2PY5 A;  1G8M A;  2R9R B;  4OX9 B;  1P84 H;  4OH8 B;  3R66 A;  3AE3 C;  2BCC E;  4YXW G;  5JQG B;  2GBO A;  3OAK A;  4TT3 G;  2OAR A;  5APX A;  2PRR A;  2XUM A;  3HD7 A;  2CGO A;  1AR5 A;  2ZAE B;  4I9Q A;  1SS1 A;  1AI4 A;  4I0X A;  1SS3 A;  5L3C A;  3SPI A;  5BR8 O;  2B87 B;  1YSC A;  1F23 A;  3WB1 A;  4AQY O;  4DK0 A;  1SQX G;  1IFP A;  1YIJ P;  4Q20 A;  2Q8V A;  3NTN A;  2NRG A;  5APQ A;  5B1B B;  2JJ2 G;  3ASN C;  5KJ7 A;  1RSO B;  3MHH C;  2Q68 A;  2Q3I A;  4RO2 A;  3CCM P;  3M9B A;  3A0B Z;  2JJ1 G;  1EN6 A;  4MW3 A;  1XHZ A;  1GK4 A;  1S5L H;  1PNK A;  2XDJ A;  3AE8 C;  4XBF A;  1KIL B;  4JI8 O;  2N9Y B;  3AEI A;  2BOB C;  3ZED A;  2WLL A;  4B3S O;  2Y0E A;  5J2T A;  4LWS A;  3I55 P;  4ASW A;  2FL4 A;  1LJ2 A;  1H38 A;  1LUV A;  1XEQ A;  5IJ0 A;  2QSA A;  4X89 A;  1L0N J;  2ZKO A;  1GZL A;  3K03 A;  3B09 A;  2R3S A;  2FYZ A;  4C7U A;  1D2D A;  2ZM6 B;  2XNX A;  1NU1 D;  3CWB E;  2L91 A;  1AFO A;  4B3M B;  4O4J B;  3OGI B;  1E79 H;  4WFF A;  2FKW B;  2HR3 A;  3TNU B;  3VMY A;  1CW5 A;  1H88 A;  1ZME C;  3A2F A;  3G6E P;  2YS8 A;  1K97 A;  4U3F G;  2PYJ A;  2PI5 A;  1S77 D;  4UCR A;  4FM1 A;  1NTZ E;  1JFF B;  3CL3 D;  5CCG A;  4LNU A;  5EYP B;  3L74 D;  2WSC H;  2DN9 A;  1JVM A;  5AVS B;  3ZRW B;  4D7S A;  5A9G A;  5JWP A;  4HNA B;  2EIJ B;  3JAK A;  2CPB A;  3G80 A;  4WFH A;  3L70 G;  1RF0 A;  2D3O W;  4MVS A;  1JY3 P;  2KXP B;  1BQ0 A;  4PDM A;  3ZHR A;  4CS3 A;  2HHH O;  1TUB B;  3E8F A;  1K34 A;  5IJ9 A;  2N1T D;  4YHH B;  1GM7 A;  1PKX A;  4O2A B;  4I7Z C;  4LF7 O;  5JVD B;  4DR6 O;  1NJI W;  3E22 A;  3CCV V;  1SFC B;  5H6R A;  1N36 B;  4GKK O;  1U7J A;  1A02 J;  3H1I H;  3NR7 A;  1LTJ C;  1K73 W;  3FB5 C;  3ZX6 A;  1BZK A;  2VRS A;  1K4C C;  1IXM A;  3RWR D;  1D5A A;  2IYO A;  3EQ2 A;  1R1B A;  5DM6 V;  1WT6 A;  5KKZ B;  4FMT A;  2LFS A;  1I94 B;  4IT5 A;  5LHI A;  1OVV A;  3W7X A;  2RJZ A;  1G1X B;  3L72 J;  5EIB C;  2OYH C;  5EBW C;  1NTZ K;  3DXR A;  2YI8 A;  3KCY A;  2HG5 D;  3CRC A;  2WQY C;  3JSL A;  5J2U B;  1CPY A;  1GL2 B;  1LWU A;  4LCU C;  3A5T A;  1OW7 A;  4DV4 O;  2P10 A;  1HBW A;  1NGM B;  2LR2 A;  4HB1 A;  5B66 E;  1GM9 A;  5M1B A;  2LQT A;  3H1L J;  4HZ3 A;  4H13 C;  1N73 B;  1G1I A;  3VMX A;  3BCC H;  4O2B B;  1LP1 A;  4KT0 J;  5TIS Z;  2PI4 A;  1M5I A;  2JGU A;  4KXR A;  4QE7 A;  2XND G;  2WAM A;  3U11 A;  1SQV D;  3RGU A;  1RQV A;  3BFR A;  2UXC B;  1VQL P;  5K1P A;  1FXK C;  4W4L A;  2A9H A;  4PJ0 Z;  1Y9B A;  4C46 A;  1L0L G;  3CX5 I;  3RL0 C;  4R7C A;  5KLI C;  4DV3 B;  1J5E O;  2ZDI A;  5L8R J;  1YZB A;  2QA4 V;  4NXM B;  1NTM J;  2UUC B;  4L75 A;  2PGG A;  1FOS E;  2GUZ A;  3AG3 B;  4J10 A;  4FLT A;  1YTF B;  3VOP A;  4UB8 E;  4YTP C;  1SQV H;  1GDT A;  4PEL A;  5FLX N;  3H1H D;  4JI1 O;  1AB3 A;  2XAQ A;  1R3K C;  3CRM A;  2EJR A;  3I5C A;  2BCC H;  1H0T A;  4MTO A;  3F5W C;  5L3D A;  4MN4 C;  1KIL D;  3OE7 G;  3OGC C;  4PA9 A;  3MUD C;  1VF6 A;  4I50 B;  1OIP A;  1CZQ A;  4DW0 A;  1FBM A;  4RKU J;  2IBZ G;  3TGU D;  3SPJ A;  1XIL A;  1LTT C;  1WP8 A;  2K9J A;  1UIX A;  1K33 A;  4F6R A;  5KAI Z;  1J1D C;  1GK6 A;  3LUT B;  1SQX K;  4JZ2 A;  1HNX B;  2O3J A;  4GKJ B;  5D5Q A;  4JI3 B;  2H89 C;  2CPS A;  1A32 A;  4YIP A;  4B3T O;  1IFD A;  4TUY A;  4P9P A;  4QIW F;  5LHG A;  3I56 P;  3L9D A;  1GMG A;  4P2Z A;  3CWB D;  3QTC A;  1B04 A;  4ZKI A;  4UCV A;  1WB7 A;  3H1J E;  2PFX A;  3U59 A;  4DOJ A;  3M7M X;  3OTO O;  4N3Y B;  5L3G A;  2HPC B;  2WA3 A;  1GH6 A;  4BR6 A;  4U7N A;  5IYZ B;  1GK9 A;  1M8O B;  3N2G B;  1GN6 A;  2OYI A;  2ZE7 A;  4LF9 B;  3WB2 A;  1DF5 A;  1FJG O;  4DR3 B;  5TIS H;  3HB3 B;  1X4T A;  4Q6G A;  2CE4 A;  1V54 C;  2RH0 A;  5AVQ B;  1Z56 A;  3CWB H;  3F7Y C;  4MTG A;  1OHH G;  1LNQ A;  4X66 O;  2P7J A;  1PP9 J;  4JI0 O;  1IDS A;  4PJ0 H;  1I5X A;  3TK1 A;  1Q6I A;  1KP2 A;  4B86 A;  4BWA A;  1SFC D;  2YNY A;  3V6I A;  2VQF O;  4JAA A;  2C2A A;  1VQ9 V;  1K8A Q;  1B06 A;  4UVA A;  1NU1 J;  3L35 A;  2N1T C;  4X62 B;  2IYP A;  1SQQ D;  5BZB A;  2R5B A;  3V4W A;  2JEU A;  5GON A;  5L3E A;  5EBL C;  4DZO A;  1NR1 A;  4BRY B;  3CCS P;  1KYO E;  2AW9 A;  4OX9 O;  5CBF A;  4FLY A;  4R4M A;  4NR1 A;  2J59 M;  4O4I A;  1MKM A;  1X59 A;  2V7Q H;  3RYI A;  1UII A;  3L74 J;  4NPD A;  3KYQ A;  1N7S A;  3ZN0 A;  1GL2 D;  4BIU A;  3FGA D;  1L0N E;  4NPF X;  1YJN V;  1VF7 A;  1SQB D;  4H44 C;  2AZ2 A;  2QEX V;  1HP8 A;  3K5L A;  1YBK A;  4F6E A;  5JH7 B;  4DR2 B;  3JAW A;  1G4Y B;  3ZMS A;  1RM1 C;  3HUS A;  1ZOY C;  5KAI H;  2HG5 C;  2ZE6 A;  3JAT B;  1L4A C;  5LP6 B;  3EFF K;  1PZQ A;  4DV2 B;  1RHZ B;  1SQP D;  1R6K A;  1Q86 W;  1VQN P;  1VMG A;  2BTQ A;  3MDS A;  2YIU B;  2Q9L A;  2YIB A;  2ITA A;  1YJN P;  2KI7 B;  1RE4 A;  3GVM A;  2WLK A;  3HKD B;  2QEX P;  1MZF A;  2YKQ A;  2EJ7 A;  3DC5 A;  2Q0A A;  1WPB A;  3G3Z A;  1QVG U;  3SWK A;  4YXD C;  3G67 A;  3SYP A;  2OQQ A;  1CI6 B;  3BRT B;  2ZXW B;  1M93 A;  1AP5 A;  3CX5 D;  2M3B A;  1N34 B;  5CA3 A;  5AVT B;  2A45 G;  5B1O A;  1X8Y A;  5ITZ B;  3H32 A;  3T97 A;  1YTF D;  4GKG A;  4DV1 B;  3KPE A;  3GMA A;  4WBA A;  4KL1 A;  4FJC C;  2ZCE A;  2ZM6 O;  5B1N A;  1OVR A;  3IGA C;  4B3M O;  1LR1 A;  3K5O A;  1H89 A;  4WB4 A;  1NQT A;  4TQD A;  1L0N K;  4JPR A;  4U7J A;  1Q82 Q;  3LDD A;  2DJV A;  1XNQ O;  2JWD A;  5LHH A;  4RO0 A;  5BR8 B;  5B1B C;  1EZV E;  1IFN A;  4NTX A;  2JS3 A;  1WN7 A;  3Q5P A;  3APQ A;  1KB9 F;  1KP3 A;  2F23 A;  3OR7 C;  1FXH A;  3ZMT A;  2Q7E A;  1RQU A;  2Q6A A;  4TV9 B;  4NYK A;  3UT5 A;  3ABM C;  4DT0 A;  4JAV A;  4NPE A;  2FYU D;  1VQO P;  4UB8 H;  1KIL C;  1SQV J;  3L72 E;  3VQW A;  4JTC B;  1I0H A;  1EN4 A;  2E3C A;  1K73 Q;  1H2S B;  2YID A;  3FX0 A;  3RK3 E;  4XFJ A;  3FFQ A;  4TLF A;  4DV7 B;  4YHH O;  5CJ0 A;  1URQ B;  3E1I A;  5GTI Z;  2WMM A;  4UXN A;  3APO A;  2XAF A;  4W4K A;  4IHJ B;  1XI1 A;  3H1L E;  1ZN5 A;  1M90 Q;  1BGY J;  1HJ0 A;  1NS1 A;  3MIW A;  2KUB A;  4L74 A;  4UCT A;  1COW G;  1N36 O;  3WU2 E;  3V2Q A;  5GTH E;  2LXC B;  3H1I G;  3H1H J;  3N2K B;  5LMN B;  3EXA A;  1KFM A;  1LTS C;  2P67 A;  1SZX A;  3CMA V;  5BY1 A;  3ZS8 C;  1LTJ B;  2ZQM A;  1I94 O;  1ZRT E;  4W80 A;  4PDL A;  4TOI A;  4Y99 B;  4RUE A;  1XDC A;  3Q3D A;  2YEV B;  3TET A;  1LTI C;  1YDX A;  3W7U A;  4R6Z A;  1NTM E;  1N8R W;  3TGU J;  2ZNI A;  1MFT A;  1YJ9 P;  2LFR A;  2WSS G;  3RGB A;  1F7Y A;  3ABK C;  1R3J C;  2WPS A;  2OYH B;  4OPA A;  2KP8 A;  3K5B A;  3H1J H;  3CMA P;  5LGN A;  1VQ6 V;  1RPO A;  2ZT9 C;  3BA9 A;  1GM8 A;  4I4T A;  4O4L B;  4UCO A;  1FZC B;  2CTR A;  1YCI A;  1JMK C;  2QRX A;  3BCC G;  1EXI A;  5CN0 A;  3FKS G;  3TXQ A;  5LYJ A;  4JZG A;  1JY2 P;  1YTZ I;  1THZ A;  4RQF A;  1KUQ A;  3QO7 A;  2F43 G;  2ZXX A;  2UXC O;  4FFB B;  2IDB A;  4MTX A;  4D6T D;  1V55 B;  2Y9Z A;  1J2J B;  1FFX A;  4J7Z A;  1S72 V;  3QO8 A;  1R3I C;  1DEB A;  4HJG H;  3CCE P;  3M9H A;  4NXM O;  1FXK B;  1FDM A;  1FS0 E;  2UUC O;  1W0J G;  1KQL A;  2ADQ B;  1J95 A;  1KC8 W;  1DD3 A;  1EC5 A;  3RL0 B;  4X1I B;  1FZE A;  4JTA B;  4IGG A;  1KKC A;  3RK2 C;  3K79 A;  4LF5 B;  1T6A A;  3PTZ A;  1GL2 C;  1S5L E;  1KQG B;  1M1K Q;  2CGN A;  4D6T H;  2B9B A;  1VAR A;  2W8Z A;  4HYT B;  4O9B A;  3O6Q A;  2DQ0 A;  1VQK V;  5DN6 G;  1N7L A;  4G2K A;  5H6Q A;  4DJG A;  1IVS A;  3B71 A;  3PN1 A;  4QGP A;  2V7Q J;  1N33 B;  2BCC G;  3WUU A;  1EM1 A;  4NXN B;  1SQQ J;  3K0G A;  3L75 J;  1L0N H;  3PP5 A;  1XMO B;  2DOS A;  1M56 C;  5BMV A;  1K7D A;  5K1X A;  2H8P D;  5LA6 B;  3GHG A;  1WNS A;  1QGK B;  5GTH Z;  3WU2 Z;  5AW1 B;  1VQK P;  1JTH A;  3AEB C;  3F5T A;  5AVW B; 
#chains in the Genus database with same CATH homology
 5M1B A;  1DIP A;  4H13 C;  1OW6 A;  2WSE J;  3ABV C;  1DD4 A;  1PIX A;  1TU3 F;  2JO1 A;  1FDI A;  2J5U A;  2QIW A;  3AE6 C;  2E75 D;  1KQF B;  1HJ0 A;  4KT0 J;  4H44 D;  1PV3 A;  2E76 B;  3D6Z A;  1OW8 A;  1IK7 A;  3AE8 C;  1VL2 A;  3AE4 C;  1RQV A;  2O01 J;  3C8V A;  3GLM A;  3D70 A;  2E74 D;  4R4L A;  4H0L D;  3AE7 C;  1OMI A;  3AE2 C;  3AEF C;  3EWK A;  1Y9B A;  3AEG C;  1KTM A;  4R4M A;  3RL0 g;  2YMK A;  2ZT9 D;  5KLI C;  3GF3 A;  4H13 B;  2YIU C;  5L8R J;  1ZRT E;  1MKM A;  2QJP C;  3Q3D A;  2H88 C;  2K9Y A;  3FGA D;  1KIL E;  1WMK A;  2G8Y A;  4H44 C;  4YTP C;  3D6Y A;  2MKV A;  3AEA C;  1VF5 B;  4PV1 D;  5KKZ C;  4OGQ B;  1KMI Z;  2D2C B;  2QSI A;  2E74 C;  1ZOY C;  1EXJ A;  1ZME C;  3T97 B;  2G3A A;  1GMJ A;  1Q90 D;  2ZT9 C;  4TT3 H;  1ZP0 C;  2E76 D;  2JP3 A;  3AE5 C;  2QJY C;  1EXI A;  1YQ4 C;  4RKU J;  4YXD C;  2E75 C;  2QJK C;  2OQQ A;  1HF9 A;  4H13 D;  2IDB A;  1KOR A;  3IAO A;  1UIX A;  1FDO A;  1S1C X;  3SFE C;  3AEE C;  3Q5S A;  1NYH A;  3S9O A;  4H0L C;  1VF5 D;  3GMA A;  3AEC C;  4I7Z C;  3AE1 C;  1DD3 A;  2H89 C;  4OGQ D;  2D2C D;  2NZ2 A;  1AJY A;  4GDO A;  4Y28 J;  2FBW C;  2E75 B;  1PL5 A;  2BEQ D;  4U7J A;  1YQ3 C;  1KQG B;  1S5L X;  2FYN C;  4H44 B;  1K04 A;  3Q2Y A;  3G9R A;  4PV1 C;  3O6Q A;  3R4Y A;  2WSC J;  3AE3 C;  3GF7 A;  3Q5P A;  2E74 B;  1JB0 J;  1VF5 C;  3B71 A;  4H0L B;  2BEZ F;  2V7Q J;  3AED C;  2WSF J;  3H25 A;  1RQU A;  1R8E A;  4I7Z B;  2WPV B;  4OGQ C;  2D2C C;  2ZT9 B;  3SFD C;  3D71 A;  2E76 C;  3Q1M A;  2WQY C;  2FXP A;  4IL6 X;  4Z1M H;  1U57 A;  3LW5 J;  1OW7 A;  3IN6 A;  3RK3 E;  3Q5R A;  3AEB C;  4XFJ A;  2P10 A;  4PV1 B;  1K05 A;  1NGM B;  3AE9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...