4H13B

Crystal structure of the cytochrome b6f complex from mastigocladus laminosus with tds
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
160
structure length
160
Chain Sequence
MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Cytochrome b6
total genus 42
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4h13B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h13B01
4PV1B 2E75B 2QJYC 4H13B 1JB0J 4KT0J 5L8RJ 2O01J 2K9YA 1VF5B 2WSFJ 3LW5J 4H44B 4RKUJ 2YIUC 2FYNC 1Q90D 2QJPC 3C8VA 4I7ZB 5KKZC 4H0LB 2D2CB 4Y28J 2WPVB 5KLIC 2E74B 2QIWA 2WSCJ 2QSIA 2ZT9B 2QJKC 2E76B 2WSEJ 1ZRTE 4IL6X 4OGQB 1S5LX
chains in the Genus database with same CATH superfamily
2EJ7A 5BU8B 1FOSF 3TNUB 1CP9A 3VYIA 3UKMA 1HNXB 2K9YA 2B1IA 5DJTB 4AYCA 4JI5B 3ZHSA 2WWWA 1DD3A 1SQFA 2X7RB 1JA8A 1OVUA 2CK3H 3SYOA 1JY2O 5FPRA 3T1CA 1DIPA 3FX0A 2D2CB 5APVA 4LF8B 2P06A 2Q7HA 2F93B 5AVTB 2QIWA 2A45I 3SPGA 4DV6B 2BEQD 1SQBJ 2EIKB 3JARB 3I5CA 1SC5B 2OCHA 1S5JA 3H1IH 3ABMB 1OCRB 2QVAA 1M9NA 3AECC 4H0LC 4DR6O 5JJNB 1HR0O 3CXCU 4NXNB 1KD1Q 2BOCC 1OX3A 1USEA 4LF9O 1YJNV 4JI3O 2LW1A 4TLFA 1Y47A 2JDIH 3PTZA 1VF5B 3I5DA 1JFFB 1E1QG 3VMZA 3L73E 4BRYB 3CCQP 1YITP 1SQPE 1VQKV 4YIPA 1WPBA 2PYLA 2XU6A 3IC9A 2E75D 4DZOA 1BZKA 1R3LC 1M1KW 1CEZA 3RK2B 2POHA 3K0GA 2UUCB 2C2AA 1XNQB 1L0NK 1AILA 1CW5A 3HE4B 2DWEC 1VQ4P 4GODA 4LF4O 2UXBB 2QM7A 3Q2YA 2M8RA 1PZQA 2AZ2A 1VEWA 3H1HG 3JYCA 5EIBC 1KC8Q 1BQZA 1G8MA 4HNAA 4OXSA 5EFWB 4CC6A 1SQPK 2BE3A 4PD4I 3T1HO 2E42A 2W0XA 2K9PA 3FYEB 3WU2Z 2OTLV 4DV5O 1X0TA 1FYJA 3CWBJ 5E79E 2F66C 3ZMZA 4GKGA 5AVVB 5TISE 3ZMTA 1N8RQ 3RWRD 3UO2A 1RE3C 3U1CA 2FB5A 4EB6B 1SP4A 1NTZH 1WPXA 1KILE 5LOVB 3R2PA 1QVFU 5KJ7D 1XREA 1SQXH 1FZGA 2FYNC 5CCGA 1AQTA 3K03A 1AJYA 3JALB 3E8FA 1ZSPA 3JATB 4QGPA 2L91A 4RJTA 2WLIB 2YEVB 4GZRB 2WLLA 3CB2A 2VS0A 3RT3C 2WA4A 4UCUA 3H1HH 4YXWG 1K5QA 4R6ZA 3AG1C 4JTDB 1KILC 1QLEB 4PA4A 4YY3O 3MUDC 3L70J 4D6TJ 1K92A 1JJ2U 3PLNA 1XNRO 1BSHA 4PD4D 3QWOC 2CTQA 5KAFE 2EIMB 1YCIA 4HZ3A 1BSMA 1RE4A 1K05A 5IDJA 4XE5B 1GTWA 2NNUA 2E75C 4WY4A 3JD3A 1FD9A 1THZA 2ETNA 2OIEA 3SPJA 3ZRXA 3EWKA 2PTMA 4I1LA 3ETEA 2P4VA 3BY6A 2HHHO 2LKMA 1SZXA 3OUFA 4J7JA 4X1YA 3CC4V 2ZYDA 1FXKA 2Q9LA 3SYPA 1NTZG 1PP9E 1FKAO 1K73W 2N1TD 4B3SB 1NR1A 4FFKA 3G6EV 2IFNA 2KB7P 2FFDB 2P58A 1FZEA 1PGPA 4ZOLA 1Y76A 3WB1A 1T8ZA 2F95B 2Y9YA 1B3QA 1U7MA 1KQSU 2PF4E 1M90Q 1PGQA 4WWIA 1R1BA 5LXTB 3LIEA 1AA0A 2VQEB 1QCEA 3T97B 1L0LJ 2XNXA 4JI2O 3P8CD 4JASA 1VQNP 1KB9F 2JEEA 3CXHE 1SQVG 5CJ0A 4X20B 1KMIZ 2JEXA 5LYJB 4NTYA 1S76D 4HAMA 2QJPB 5AW4B 2L35A 1TUBB 2RH0A 2Y4UA 2WSSH 1K73Q 1AVYA 1M57D 1HTLC 1Q82W 2JKVA 4WFEA 1KD1W 3E83A 3O6QA 3LIDA 4F6RB 2KLUA 4HB1A 5IY5B 4UFZA 3VOUA 1NTMJ 4KHPB 1QBZA 4YXWH 5IT9N 2W6BA 3OJAB 3L72G 2GA1A 3CE2A 1NS1A 4B3MO 4LC1A 4RUEA 3JC22 5AW5B 5KA6A 3ABKC 2B87B 1SQPG 4LF7O 1IBKB 3HD7A 3FGAD 4JAVA 2WLLB 1P84F 1ROPA 1YJ9P 1IFJA 1LR1A 1MFZA 4HKZH 4UB8E 3CRQA 1AVOA 2E76D 1W59A 1VQPP 3JALA 1RF1A 1S3JA 2EINB 4AUWA 1P84I 4Q6GA 1UJWB 1Q7YQ 3W68A 3A5TA 3RW0A 4Y99C 5APYA 3EVKA 3RL0D 1TAEA 5CA3A 4Z1VA 3HTKB 2WLKA 2Z3YA 3LSUA 2Q1KA 1XOUA 2RJZA 1FC2C 3L75G 3L70G 1YIJP 3CCRP 1I08A 4GX2A 4DR1B 5BU5A 5KAIH 1EN5A 2EINC 2ZNIA 4DV3O 3H25A 4GKKB 1H8HG 3BASA 3SWYA 2HEPA 4JTCB 1RPRA 3P3PA 2WSFH 4JF7A 3UT5A 3QVNA 1N8RW 4AI8A 2LFRA 1ZXGA 1KFMA 4Q20A 4ZMDA 2OARA 4M3LA 1HW7A 3D36A 1HGZA 3OUSA 1PNLA 2AXTZ 5FLXN 1GKFA 1GK9A 3OR6C 4UV9A 2K3RA 2DW4A 3GWKC 3N2KA 5AW7B 2WLJA 5H2FZ 5KX5A 4R50A 1MNGA 2YI9A 1JO5A 1KECA 5CCHD 1X8YA 2OYQA 2LXBA 2J59M 4B3RO 3SYQA 2G3AA 3GB7C 4JZ2A 2V4HA 1FXHA 1MOFA 4BRYA 1LT1A 3TJTA 1OWAA 4GT1A 2WT7A 4XFJA 4JI1O 5AVYB 1N36O 2VWKA 2DYRB 2QSIA 1FOSE 1SQPH 1VQ9P 2XNDG 2M6YA 3FB7C 4QPKA 3HKEA 3SJBC 3UT5B 1SQQD 3W7SA 1FAVA 3CWBE 5KLVJ 4DR1O 1DLBA 1JJOA 3GVMA 3GF7A 4UB8H 4KUMA 3TGUH 3KZIH 1GU4A 1AVMA 4PA9A 1R8EA 2E5YA 5B5EZ 3ASOC 1ZRTD 1FFXB 4NB5A 4O4JB 3W67A 2JS5A 1AI5A 1XMQB 2R9AA 1S5LZ 4MTGA 4DXWA 1U57A 3BRTB 1FZCA 3UO3A 3CHXA 2IM9A 4D6TH 1YSCA 2DQ3A 5B1OA 4DK1A 4YJ2A 3M9HA 2ODMA 3CC7P 1NVOA 5KLVK 4RQFA 3E86A 3A0HH 4LR3A 3V4QA 1MKMA 2KSEA 3K9AA 3L73G 3ZMVA 3FB5C 5TISZ 4R8CA 2GUVA 3TETA 3CMEP 3RVYA 2GM4A 3CCVV 2IZ1A 1SQXJ 2QJKB 1OCCC 3LDDA 4WFGA 1NTZD 1PGJA 5LA6B 2XDJA 2OWOA 3KQGA 5APXA 2PY5A 2KYVA 3BHPA 1KBHA 5J2TA 4O4HB 5J2TB 3CCUP 3CJHA 3CWBH 3RYHA 2MKVA 2ZINA 2H8PC 1L4AA 1KB9D 3MHVA 1S72V 3U11A 1CZQA 2Z4EA 1LT9C 1Y66A 3FWNA 4EOTA 1KP2A 1R3KC 5J2UB 1PM9A 3L74D 1ZR2A 2A7WA 1G1IA 3CX5D 4PJ0Z 3SJAC 4XBFA 3ZX6A 3L71E 1Z56A 1VF7A 5KJ7C 5CA0A 1SQPD 1M1JC 4X65O 2H94A 3CXHF 1SQVD 1CXZB 2ATKC 5KUMA 3LDCA 4I55B 1VDFA 1OCZC 3OAKA 1L2PA 3H1KD 1FZCB 1GW3A 4DR3O 5K1XA 2DWDC 4JI8O 5A9GA 4B7EA 1XNRB 5KA5A 5KUKA 4O4JA 1LGHB 3B5NB 3APQA 2ZT9D 3HKDA 2WITA 3ZRWB 2A9HA 1LJ2A 4ZOLB 2QDOA 1N73A 1PPJH 2EILB 2AHZA 3CL3D 2P10A 4DV0B 2BCCG 3QO5A 3N4XA 1ZL8A 4GDOA 2CAZC 2O01J 2LO1A 4WF9V 1BS3A 3E1RA 3EFFK 2W0FC 2K9JB 4FFBB 5D5QA 5APQA 5C39A 4X1YB 1H38A 2V1DA 3C8VA 1T6AA 3AEGC 4TV8B 5AVWB 2XV5A 2L6LA 3L73H 4MVOA 4LF8O 4EKWA 3M06A 1SRYA 3H1IJ 2D3OW 1XEQA 1IURA 5AVXB 4U3JA 1HNWB 2OQQA 1LWUB 2ADQB 2H88C 2QE7G 2DN9A 3N2KB 5IY5C 1ZR4A 4QIWF 2HPCA 4EEQA 1NJIW 4I9QA 2GHYA 4GX5A 2LGQA 4GX1A 3L70E 2YKOA 1GDTA 5B1AC 4NPDA 3SR2C 4JBZA 3U10A 1XMOO 3CD6P 2Q68A 1H0TA 3RL0B 1NTKG 4DCKA 5KHIA 4J7ZA 3T1YB 1AP6A 4H33A 4DR7B 3HKCA 1XNQO 1J1DB 1HVVA 1KYOI 3RK3E 3ZJZA 2E5LO 1J2JB 3THOA 1N2DC 1RHZB 2Q8VA 1H88A 2AHYA 2A06H 1F7YA 2Y0CA 3GHGA 1Q90D 1WB7A 2YUAA 5E79Z 1BCCH 4NPFX 5E1AC 4QPJA 1BE3J 5DN6G 1X22A 4G28B 2FYUD 2W6AA 3ASNC 2O3JA 4GLXA 1YITV 5IWAB 2QWPB 4DR6B 3C9IA 1PKXA 1EDJA 2OYOA 1DF4A 4AHCA 2HP8A 3ASNB 5BZBA 1B06A 1A32A 1KILA 4XA4A 4WFFA 2X0LA 5C8YA 5KHGA 4PA7A 3SDLA 4NPEA 3P30A 2V4DA 2KP8A 3RK2D 1GZLA 2FYUH 4BWNA 2LR2A 1N33B 3ABLB 3C90A 5IYZA 1L0LE 4J11A 1FXVA 3A2FA 3IFMA 3P3NA 1EDKA 3G6BA 2QJ1A 4L75A 1SQQH 5B1BC 4IL6Z 1DEEG 3JD1A 2R9IA 4FFBA 5IE9A 4DV4O 3L71D 2JRIA 3O6QB 3WU2H 3QG5A 2QKCA 1P84E 2KQXA 3H32A 4J9ZB 1AI4A 1JB0J 3B8EB 1N86A 1RY3A 1RQVA 1T3UA 2CE4A 4UVAA 3S3XA 3ZN0A 2HKOA 1NTME 3KPEA 4IL6H 3QO7A 4LF5O 2O1JA 3FAVB 2ZXWC 5IYCO 4JYAB 1GAXA 4IOIH 5IWAO 1KZUB 5AW8B 2QA4P 3K5NA 3USSA 2Q0AA 2IJIA 4GKJB 1BCCG 3SJCC 3L75J 3L72E 2NR5A 1YIJV 2YO3A 3K08A 3ABLC 3T1YO 3ZDMA 1ZW0A 1FDOA 2IU0A 1MV8A 1SS1A 3TNUA 2FFDA 2QM4A 2QSAA 1YJNP 3L73D 2DW3A 3D3IA 1EM1A 2WSFJ 1SZTA 2UXNA 2E5LB 2IH1C 3BVHA 3APOA 4LNUA 3D8CA 2LGWA 3CXHI 1RF1C 2Q9IA 1XL4A 4NTWA 3B77A 4BXLA 4GCZA 5EK0A 4JYAO 4X88A 1UIXA 2EIMC 1L4AB 1PPJD 3H1LH 3GHGC 4QMAA 1XQ8A 3NXSA 5H6QA 1EZVE 2YXRB 2E74C 2R5DA 1B6QA 3ZHRA 4HYTB 3RK3C 4WBNA 4PI2A 5B66E 2GDSA 1H2KA 3E89A 1XMOB 1IBMO 4WVZA 5L3GA 3RBZA 5AVQB 3TGUG 1RFYA 3PJSK 1NH4A 2XUMA 1NJIQ 1SQQK 5LOVA 1LNQA 2ZT9B 1SA0A 4PA3A 1WN7A 2B5UA 2RMKB 5L3DA 4UV8A 2H8PD 2N74A 4DUZO 3RYFA 3W7TA 1NTMH 2EX3A 3A3YB 2WA3A 2JGDB 3CPWO 3K04A 4EB6A 4YJ3B 4DV0O 1JY2P 1VQMP 4P9OA 4L76A 4TT3G 4C46A 1F23A 1QL1A 5CJ4A 4TUYB 2QA4V 2NPSB 2ZFCA 1FFXA 1VPCA 1OXZA 1RM1C 4DO2A 3CEIA 4J10A 4H13C 2KS1B 3OGIB 2WPVB 5B3SC 1QLEC 3T1HB 1VQ7V 3MDSA 3AG1B 4HNAB 3H1IE 2XZRA 2QM8A 1CSBA 3A8TA 1KFNA 1DGSA 1L0LH 2GSMB 3M0AA 3HKEB 4RQEA 1DH3A 3P7KA 2E76B 2IFMA 1KQGB 3LNMB 3AG3C 3FWLA 3VP8A 2QWOB 2BSKB 1HJBA 5H2FE 1Z5VA 3VQYA 1HF9A 3E2EA 3U1AA 5ITZA 5AW1B 1L8DA 1T2KD 4JI7B 1G2CB 1URQB 5B1NA 3CC7V 1URQA 3H1JE 5M1BA 2QEXP 3SSUA 1SQBK 2A45H 4PV1D 3F5HA 3ZHTA 2UXDO 5JH7B 3H1LG 1IBLO 3KZIZ 4LFAO 1PP9D 2M3EA 3W7XA 2FYUG 4MTXA 4RUFA 5LMUO 4TWKA 1ZAUA 3TXQA 5BR8O 1KQLA 2Q5ZA 2R32A 2EBOA 1K5SA 1K34A 3BCCD 3L74H 3CCLV 4DV1O 1SQVK 5IYBO 1JNMA 2NPSA 2EULA 2ZNJA 3SJQC 4OX9B 1KQFB 2EIKC 4X1IA 1HUCA 4RKUJ 1PNMA 3TF5A 2KXPB 3IR9A 4K0KO 1KV4A 1NOHA 3CCSP 1P4RA 1AQ5A 3RYFB 3UCSC 2WVRA 1HP8A 4LFBO 4O2AA 4DW0A 1NU1E 1NKDA 2BCCJ 1SA0B 2N9BA 3F7VC 5B66Z 2AXTH 4AILC 2FYUJ 5IJ9A 4I55A 2NZ2A 3AG4C 3OE7G 4JI5O 2J5UA 3AEEC 1N36B 2WZ7A 2AGAA 1MZEA 4FM0A 3LUTB 1LUVA 4LFCO 1SVFA 3AEDC 5CCGC 5EBLC 5CBGA 1NAYA 2BCCH 2XNDH 2YIAA 4TQDA 1J1EC 2EILC 3B71A 5AW6B 4BWAA 1GN2A 4D6TD 1RSOB 1WJZA 3LNNA 5KHJA 1N4CA 1GL2A 1XUQA 2ZCEA 3GW6A 4WB4A 2JO1A 3B2EE 3CJHB 2W27A 3AK2A 5LP6B 1QX8A 3MUDA 1L4AD 5EC2C 3DXRB 1YDXA 5GONB 1BE3E 3G4SV 4MW3A 3BABA 4ZI7B 1NTKE 1FZCC 1N34B 1KYOE 4UB8Z 1OCZB 4CZZA 1IFIA 2JWDA 3M7MX 1BE3H 1IXBA 4DV2O 1MUUA 2KK7A 2QGNA 5E79H 1S1CX 2CPBA 1QVFO 1H2SB 3T97A 4FLYA 2RMZA 4U3FJ 3CMEV 1YZBA 2M0BA 4O4IB 1LT9B 1SQXG 2Z5UA 3HUSB 3OEHG 2P7TC 3S3WA 1SF9A 1O9GA 1ZX3A 1N7SB 3ASOB 3RYIA 2P4KA 1R5LA 1SQBG 3MD0A 2JGUA 4AQYO 4OGQD 5CBHA 2ZDIA 3QH9A 2JEUA 4O4LB 5FPOA 1H2MA 1FBMA 1G6UA 1F4NA 2R9RB 4HYOA 5EYPB 5AVUB 5GTIZ 2UUBO 2UXCO 1Y9BA 1NWQA 2FY8A 3HD7C 1NKZB 1K97A 5BVZA 1ZTEA 2ZE6A 1KKCA 3L73J 3FFQA 1QVGU 1K4CC 4MTOA 2J58A 2KB1A 1AROP 3WMM0 1V54B 3KHUA 3WB0A 4LH7A 2BTQB 4DR4O 1YQ3C 3JCUE 4BW9A 1LTJC 1D5NA 2IBZH 5GTHH 3M91A 4W80A 4C7NB 3GMAA 3WB2A 2OTLP 2UUBB 1XI1A 2IZ0A 4DOJA 2OYHC 4EIJA 2N1TC 3G4SP 4IIJB 1MG1A 4UCSA 5LGNA 1SQQE 2Q7CA 1Y6XA 2XAQA 3VBBA 5L3EA 1EDLA 2P7JA 3VTPC 2HFED 1JY2N 4PD4F 2FKXA 4EDFA 1QHTA 5JJJB 3LSQA 3M99B 5EZYA 2E3CA 2E75B 1SFCD 3CPWU 4TV9A 3ABTA 4RO2A 4G27B 1ZOYC 2CPSA 3H1IG 2KG7B 2IU3A 2AEFA 2HFEC 2R44A 3H1LJ 3QTCA 1QU7A 4JI2B 5CN0A 4D7TA 1FAFA 3AE3C 3AG4B 3OTOB 1JEKA 1U7JA 1VQKP 4J41A 3SYCA 1KILD 3GHGB 4LFAB 4P2ZA 1VQLP 2EZOA 5EC1C 2C9NY 1XILA 3M0DC 4FVMA 3H1HD 4X1IB 4X66B 1RF1B 3JCUZ 3CCEP 2WAMA 2HHHB 3AEFC 4UCTA 1AR4A 4FK5C 5KMGB 1VQ5V 1GW4A 2XTAA 4GOEA 3HB3B 2Q5UA 4MVMA 1VQ9V 3E22B 3B8NA 2RCVA 4IFMA 2BOBC 2ZE7A 1SFCC 5A2QN 3HD7D 5GTIH 3X2QB 3A0HZ 3JAWB 3IN6A 3EXAA 4KXRA 4Z2WA 1JY3P 2PGDA 3JD2A 4FZ1A 1ZN5A 1N34O 2Y4TA 3J80N 3E8GA 2P2UA 3D3QA 4NXMO 4FLXA 4A5UB 3I56V 1E1RG 2A06D 1SQVE 2WLNA 3CYOA 4DR5O 1H8EG 4I7ZC 1JX9A 2WPDG 1W0JG 4FLTA 1BGYG 5TJHA 3TSIA 2CUGA 3Q5SA 4QE9A 4ZIBA 2DYRC 2NLJC 1SQQJ 3K5LA 1AJPA 2LXCB 3AE9C 3CCMP 3A0HE 1MZFA 2K1AA 1BE3G 1MABG 1EZVI 4L74A 3AG3B 1SQPJ 3M8AA 3BCCJ 1YTZI 4PDLA 2KSJA 4DT0A 4IYHA 1GK4A 4PI0A 5KAFZ 2WSEJ 2MW2B 2ZR2A 1P7GA 2ZDIC 1VQ8V 4E4EA 2UWJE 2YMYA 1XDCA 3CCUV 4TSFG 1SQBD 1L4AC 1RPOA 2LJ2A 1K3EA 1PV0A 2VRSA 1Y74B 4JI0B 1WA8B 3CCMV 3RYIB 4H0LD 5J2UA 1FS0G 3VQVA 1JOCA 2I1JA 5AW3B 4NVPA 3VMYA 1NT2B 1YTFD 1NI8A 5JJEB 5K5GB 1BDCA 1EZVG 1XBLA 2PI5A 1HJ0A 1SQGA 3CRAA 5B66H 4J7KA 3DXRA 5LBQA 1K9MW 1WAZA 1LTTC 1M7LA 1LP1A 2P1JA 2XASA 5APSA 1LUWA 1BCCJ 1IX9A 4JQ0D 1P84H 4ZI7A 3LW5J 2ZXXA 1GU5A 4ABMA 3I56P 1MSDA 5KAIZ 3VP9A 5CHXA 1JCHA 3J81N 1LP1B 2Q7GA 3PN1A 1EC5A 3M9BA 1T3JA 1W0KG 2QWRB 4ZBMA 5LA6A 1VF6A 4O2BA 1NU1G 3WG7B 3STZC 1I5XA 1OCOC 1WA8A 1IFDA 3RL0C 1QNMA 3QF7A 1TUEB 3MZWB 5IJ9B 2H7HA 5CA1A 1L0ND 2M5AA 5B1BB 3K5BA 1K7DA 5CCGD 5HFLA 1BMFG 1JM0A 1Q82Q 3BAAA 3EHBB 2OTJV 4KJMA 4MS2A 2YC0A 3RFRA 4LLHA 1IBMB 4WFBV 1QQCA 2P5OA 5AVSB 4QJFB 1J5EB 4PV1C 2YKQA 2H3OA 2XAJA 2FXOA 4GOFA 1M93A 2YXQB 1RE3A 1OIPA 3O65A 2O01N 1HR0B 4ZKPA 1Q86W 3CD6V 4K3AA 3BATA 1KYOF 4I9WA 2QJYC 2CTWA 1NU1J 1SERA 2BCCE 2PAJA 3MHSC 2DQ0A 3FX7A 1SFCA 4LF6O 3E7KA 2ADPA 5JH7A 1F51A 4O9BA 4H13D 1VMGA 5KX5B 1K4DC 2YXLA 3BPZA 3H9VA 1HNXO 1G4YB 1W2BU 2CK3G 1Z2GA 2Y0IA 2NRGA 1KYOH 1JFFA 3P32A 4RESB 3CI9A 1W2BO 3JASA 2XAGA 1MA1A 3OMAB 3L72J 2PGGA 1CI6A 3CLQA 5CMZA 4JI4O 1VF5D 3IGAC 1OCOB 3WG7C 1I0HA 3OTFA 4U7OA 2Q6QA 4GYCB 4DR7O 4CBCA 4E2LA 1OW7A 3JARA 4YPCA 4JAAA 5LGTA 3CRMA 1BE3D 1M56C 3F89A 3ZMUA 4U3FE 3JD4A 2BTOA 2ZKOA 5KLVG 3SFDC 3JAMN 4YJ3A 1WB8A 4LH6A 4DW1A 4DV4B 1KYOD 1FU1A 3H1LD 2N05A 1QLED 3RL0g 2E74D 3H01A 3OGCC 3U0ZA 5KHHA 2RDCA 4EFBA 1OV9A 1N32B 1PV3A 4KT0J 2ZIMA 3VQXA 5DEDA 1FJGB 3HE5A 1Y8AA 3QO8A 3HTKA 2OGUA 3BCCG 4FM1A 2P6JA 1IFNA 3V2NA 4CH5A 1SQQG 3ZBHA 5LHGA 3AG2B 3A7OA 1PNKA 1S5LE 3JSVC 5F2VO 1JOYA 1VF6C 5HFMA 3V6IA 2FYUK 3OW2U 2A45G 1DEBA 1G1XB 4W4LA 1JY3N 2L5GB 2B87A 2R3SA 1J95A 1EQ7A 3AEAC 3EQ2A 2YXYA 2D2CC 4LWSB 5B1AB 4P9PA 4PV1B 2JR8A 1YBKA 2IJKA 1KC8W 2GTAA 3RN4A 2OTJP 1B04A 1FJGO 1QEXA 1USDA 3AE4C 5AVRB 3CXHH 3HR0A 1DX7A 1J5EO 3L74E 1D5AA 3IF4A 3IFXA 4UB6E 1N0NA 3R4YA 2HG5D 1ORQC 1K8AQ 1LWUC 1GMGA 4B7KA 1TVKA 5CB4A 4PDVA 2YIUB 4JF3A 3H1KE 1EXJA 4J80A 3FB6C 1L1FA 2HVJC 4YHHB 2ZVOB 3K06A 4D6TG 1XHXA 5LYJA 1D2DA 3Q5RA 3AG2C 1AP5A 3NMDA 4WBAA 1VQOP 3HPLC 1OVVA 1IXMA 4DYLA 3K9SA 1YYCA 2IYPA 2BEZF 1BGYE 2FXMA 5H2FH 1L0NG 1EZVD 2C0XA 3JAKB 3KXDA 3JAKA 1N73B 3S9OA 4JI0O 3ZRWA 1WP7A 3FAVA 1NVPD 1BQ0A 1E5WA 3JD0A 1ZUQA 1LT9A 3GLMA 1US6A 5BMVB 5JWPA 1UPGA 5AW9B 3SYAA 1AV1A 2ZE8A 2Q73A 5LL6Y 2SPZA 1FXKB 3L71G 1VARA 1OCCB 1Q3EA 1N7SA 3DTUB 2B88A 1HBWA 2IPPA 4PJ0E 1BDDA 2WPSA 4LCUC 4DR2B 1WLEA 4N23A 1N0JA 3H32B 3JCUH 4I2LC 4ZKUA 3F5WC 3H1JD 4JYYA 3A2AA 2EIJB 2OCCB 1AJNA 1FPOA 1J1DC 3AE1C 3GWOA 3H6PA 3G71P 2CDYA 2F4VO 4ASVA 3G9RA 2A0LA 5LMNB 3B40A 3SWFA 3CCEV 2UXXA 3SPHA 1OZ0A 4D7SA 1HNZB 2W83C 3N2GB 1GL2B 1I94O 5EBWC 4QE7A 1SQBH 3ETGA 3L70D 1AI7A 2UU9O 4IL6E 1M90W 2LP7A 2CTRA 2E43A 3SFEC 5BY1A 5CMUA 4FJCC 3K5MA 1TGOA 3X2QC 1J1EB 1RSOA 1PP9J 4JV5B 5KHKA 4NTXA 1YJWP 3OT7A 5DJUB 3OR7C 5JVDB 3G71V 4X64O 3WU2E 1S9KD 3CC4P 3ZRVA 2ITAA 2QTOA 1FZAA 4Z1MH 2DYSC 1NH2B 2IDBA 4O2AB 1FFTB 1NR7A 3ABKB 2OT5A 1H89A 1ENVA 2E5TA 1PP9H 4MVUA 4YJ2B 2UUAB 1I94B 1JY3O 5GTHZ 1KB9H 1URQC 1VQ4V 4ICGA 2KZJA 4JI8B 1KP3A 2Y0PA 2ZR3A 2G8YA 1YI2V 2PI4A 2ZIOA 4DUYB 3L36A 1PFIA 2KG7A 4A7PA 1X9VA 3K5OA 1I7FA 1QR9A 4ZKIA 4DV7O 1NTKH 4GX0A 5TISH 2OYIA 3BRCA 3ZIAG 3L35A 1H2NA 3JCZA 4P30A 2Q67A 2QWQB 3IAOA 1RP3B 1YEWA 3II6A 2ZM6B 1Q7YW 2NPSC 2WT7B 2QR4A 1GK6A 1IC2A 1LTSC 5AVZB 1GM9A 2V7QJ 4JAUA 4N21A 4HH2A 1IZNB 1OW8A 4I0XA 4X66O 3NFQA 4W7ZA 2Y9ZA 2N9YB 3V5BA 4X62O 1YI2P 3BRVB 5LP6C 4H37A 4DV3B 2HPCB 3L75H 3R66A 4FM2A 3MHHC 1EZVH 4W7YA 4WY4C 3TGUJ 1OHHG 2A06G 2FBWC 1G2CA 2F1MA 3L4FA 3M9QA 5KLVH 5D5PA 2ILMA 1LWUA 5IJ0A 3AE7C 1RH5B 1NGMB 3CX5H 3PHLA 5AW0B 1IFMA 4PJ0H 1VIBA 2ZYAA 4JYCA 1HH0A 3TK1A 2HR3A 3B4SA 1SS3A 5LHIA 2UU9B 1Y67A 3OMNB 5EYPA 1XMQO 3E1IA 2IW5A 1RM1B 5APWA 2ZE5A 1NHLA 3D70A 3SPIA 5CBNA 1MFTA 3G3ZA 4MN4C 1ZL8B 3L70H 4KFMA 3KG2A 3CXHD 2JK5C 1FE6A 1X79B 1AJQA 1F4MA 4B86A 2WLHA 4NXMB 1SQXK 1S77D 3CCQV 1P49A 5KAIE 3G6EP 3CX5I 2YSUB 4O4IA 2GUZA 4BR6A 4L87A 1GM7A 1L0NE 2DYSB 3IAYA 2M5AB 1GTOA 4OPAA 1U96A 3S1KA 4UCVA 2XHBA 3AE2C 2VQFO 1JPXA 5IYDO 2KLVA 5J9PC 1L0LG 1YQ4C 1PPJE 2YICA 1N32O 1FXKC 1R6NA 4ZNCA 2MJZA 2R5BA 3RYHB 4JI6O 4CC5A 5L3FA 1IVSA 1OMIA 2QKSA 2Y69C 4I7ZB 3UM7A 2VQEO 1XL6A 3BVOA 3I55V 2LW7A 3STLC 2KI7B 2N1TB 1YXBA 4LNUB 3EFGA 3CS5A 3L9DA 3AK1A 2Q3IA 3L37A 2IBZE 5GTHE 2Q69A 1SESA 1ZRTE 3ABVC 2GTSA 3HUSC 1KUQA 1NKNA 4OGQB 2Q7EA 3P8MC 1N7SC 2LQTA 4IHJB 3V2RA 2Q3EA 3ZN1A 1WRGA 4K8XA 2HODB 1YHQV 3L71H 4X1KB 1NH2D 1UFIA 2QWNB 1MZ9A 2QJPC 2OIGA 2QG4A 3L72H 5KLIC 1Q2NA 5BMVA 2IBZI 2GUZB 5H6RA 2QE7H 2R70A 2OYHA 2YDEA 3BFRA 1NTZE 3A0BE 4G2KA 4YHHO 2YNYA 3G80A 3SGIA 4YIOA 3ZHQA 2OTKE 2AXTE 1JTHB 1RF0C 2RN0A 4XDJA 4LF7B 3E35A 4I50A 1RQUA 2JJLA 3H1JG 3VOPA 3VN0A 1JUNA 3K58A 2HJDA 1XTGB 3AE6C 1MSWD 3OA7A 4L73A 1AR1B 3H1LE 4DV1B 1M5IA 3ABMC 4UXNA 1H2LA 2O01H 1SLQA 1DD4A 3CX5E 1QR8A 1R73A 2CGOA 4ASUG 3CCRV 4JGSA 3U59A 1V9PA 1JMMA 1GL2C 5IYZB 3SPCA 2YKPA 5L8RJ 4RWUA 2UXDB 1IO4A 4DJGA 2H89C 3L71J 1WMKA 4X62B 4U7NA 4F4LA 1TA8A 1M8OB 2PP6A 3BCCE 2I8DA 4I0XB 1BHAA 4OWFA 4MTFA 1LTIC 2B1GA 3H1KH 1LTJB 3KYQA 3IC7A 4CS3A 4U3FH 4FZ0A 1LTBC 5KJ7A 1ZLZA 3E22A 2AEJA 2F43G 4K8ZA 1YVWA 5DM6V 3UQ8A 2ZQMA 3CRRA 3DC5A 2C9LY 5KMGA 4HBNA 2XT9A 3AEBC 5BR8B 1YJ9V 3L75D 1SQXE 2JGDA 2LFSA 1OJHA 1IZ3A 1IBLB 1P84D 2AEMA 3LW5H 3N27A 3ZS8C 4LF6B 2ZVNB 1RE4C 3H1HJ 2UUCO 4TV9B 3C3TA 4CPGA 1DTOA 1EN6A 4PHZA 1X4TA 4NKGB 2UUAO 3D6ZA 1N7LA 1DK1A 4B3SO 3HKCB 1M57C 2O57A 1W2EA 4JPZB 2Q6AA 3CMAV 3WUVA 4EI2A 2QTSA 2GUSA 2QJYB 3Q1MA 1BGYH 4D6TE 1FJPA 1VQNV 1BGYD 2KKWA 4IL6X 3H1JH 1Q81W 4I4TA 1H0TB 2CTPA 2WQYC 5B3SB 3Q5PA 2V7QG 4H13B 1K33A 4X8AA 4FPPA 3W7UA 2MK3A 5JVDA 4WBNB 2W6IG 5L3CA 1WNSA 2YIDA 2XKMA 2YIBA 4YY3B 2DMXA 1HNWO 3N2GA 1NO4A 2YMKA 1BCCD 2BTQA 1D7MA 4LFBB 2YS8A 2ZAEB 3CCVP 1R6KA 3CRCA 3M0DA 2B9BA 1SETA 4R4LA 1BL8A 1JQ0A 4FIPC 4U3JB 2WSEH 1GM8A 3J7AU 4RO0A 1T5EA 2Q4PA 4UCRA 2X6CA 4DV5B 3O8ZA 2B9ZA 5LMNO 1EBOA 3ZCCA 2ITCC 2KZIA 3BCCH 3ZHUA 4OX9O 1X59A 1VL2A 1FDIA 1R3IC 2QKAA 3O9OA 3FXDA 1TUBA 4X89A 2HYNA 1M1KQ 4I50B 4UVCA 5B5EE 1VP7A 2P67A 4GUNA 2F23A 5JCOC 4H0LB 2IH3C 2BASA 1OW6A 2E74B 3CWBD 2NN4A 3ITKA 4J9YB 1YTFB 3RYCB 1N73C 2V7QH 1A02J 3HKDB 1Q81Q 2WMMA 4X65B 2VWJA 2ZXEB 1U97A 1AFOA 3PP5A 4MVSA 5CA1B 4CH4A 5H5NA 2UXBO 2IX7C 4L8JA 3MGNA 1NTKJ 1L0LD 2HODA 1UIIA 3KDPB 2IJJA 3UIAA 3D36C 5H9CA 2EIJC 1NU1D 3T4DA 5FNVA 2XAFA 3RVZA 3OD4A 1TVKB 5CB4B 4LF4B 1QLNA 1PIXA 2M3BA 2XOKG 2CH7A 2DJVA 5LP6A 4I6MC 2JIZG 3BA8A 3JSNA 3E8HA 2FMLA 4LBEC 5KLIB 1XHZA 5C93A 1NAFA 1OZHA 1COWG 5GONA 4KP4A 1NTMD 4B08A 1VQMV 3ZEDA 3DC6A 2H43A 4JI3B 3OW2O 4PELA 1SKVA 5C8YB 2QRXA 5CCHA 1M57B 1SQVH 1K04A 2YIBD 3FB8C 4WFAV 3B5ND 1E79H 1N7SD 1IJDB 2WSSG 3F7YC 2HLDG 2YO2A 2JDIG 1AB3A 4FLZA 4LP8A 4DV6O 1L0NJ 3MIWA 3CMAP 3R65A 2ARHA 5EIBD 3AG7A 1ZMEC 3F5TA 3HE5B 3L75E 2Q0OC 5APUA 2DOSA 5JCOA 1Y74A 1FJKA 1S5LX 4CS4A 1NVPB 4DK0A 1JMKC 5CBOA 1K8AW 3B5NC 1GN3A 4DR4B 3V4WA 4W4KA 1M56B 2X6AA 4RAIA 3K79A 3WUTA 1M4UA 4FLWA 3D6YA 2XAHA 2W8ZA 3D71A 3KCXA 5IJ0B 4UB6H 1S0VA 2ZYGA 3CCJP 4DR5B 1YF2A 2FYZA 4MVQA 4WY4D 2UXCB 2GV9A 1EFRG 1NQTA 3JASB 1Q6UA 4JI4B 2JVDA 4ZHQB 2FL4A 2KIKA 1FS0E 3TYYA 2Z5IA 2JWAA 2I1KA 4KHXA 2W6JH 3OTOO 2Y69B 4AQYB 1OCRC 2A06E 2NPSD 3ETDA 2G38A 5ITZB 3W7WA 1V54C 4ZHQA 3RK3B 2KOGA 2C0WA 4JTAB 4GKJO 2HLOA 1LTAC 1EZJA 1SFCB 4IFFA 3JAWA 1IK7A 1OFCX 2QJKC 3ETQA 3JSLA 1FZFA 5KAFH 4JI6B 1FDMA 3KZIE 3TGUE 1OVRA 1Z5WA 2BSKA 4Z1MG 2M7WA 1PL4A 4IGGA 4DV2B 2GBOA 4BIOA 4EFEA 5K1PA 1KN7A 4GKKO 2Y0DA 2P90A 4PDRA 1S4XA 2AXCA 2OYIB 5LHHA 4JPRA 1URQD 2K37A 3FD9A 5AW2B 5KLVD 1SQBE 4OPHA 1KU9A 1S72P 3GG2A 2Z5HA 4OGQC 1DF5A 3FKSG 4TT3H 2OYHB 1CPYA 2WSCJ 1ZP0C 1YHQP 4FLUA 1HWTC 3OEEG 4YTPC 4H44C 1N33O 1RF0A 4MVZA 4X1KA 2WTYA 3AK3A 3VQWA 5KKZB 2ZXWB 3OM3B 3HD7B 4KL1A 4MSWC 3FYIB 2HVKC 5CA0B 4IHJA 2ZD9A 3CCLP 4DR3B 5JQGB 1W5CE 4H44D 2KUBA 4NR1A 3H1JJ 4B3MB 4OVNF 1EXIA 1BGYJ 1S5LH 5KKZC 3MP7B 3MAQA 3Q4HA 4Y28J 1I5YA 1KTMA 1R5SA 5B5EH 1V55B 5KLVE 1NTZJ 2RNBA 1BT8A 1Q86Q 2IBZG 4O4HA 1R6TA 3VMXA 2WLMA 1ZLLA 3CP1A 2IJHA 3DGEA 4IYIA 2ZM6O 1NZ6A 2R72A 5FNVB 4F6RA 1A02F 3CC2P 1BHBA 2CH7B 4HJGH 1R3JC 3C3SA 1ZWIC 3L74G 1QVGO 4EYYQ 2Z0AA 4C7UA 1VQ6V 3L74J 1LTGC 3HKBB 1MMMA 5GTIE 1M1JB 4XDKA 3TCUA 1VQ7P 1E79G 1HDJA 3H1KG 5LXTA 3AE5C 4DRXB 3H1KJ 1K9MQ 3C1LA 2AW9A 4JI7O 2DE0X 3T4ZA 2PFXA 4IT5A 4PD4H 5KTBA 3RGUA 1Y76B 3RYCA 1GN4A 2ZT9C 4Y99B 2VQFB 1WP8A 1Q6IA 4TQFA 1KB9E 2PUSA 2BCCD 1NU1H 2HG5C 3NR7A 4UB6Z 1VQ6P 3HUSA 1GL2D 2FYNB 1GRJA 4F6EA 4LGDE 4WCEV 1NTKD 4WY4B 3K57A 4DUYO 1SQXD 1ZV8A 2Y48A 4UUJC 4JI1B 3VMAA 3SWKA 1KB9I 3H1HE 3FXEA 4JV5O 1PD3A 2EZPA 4K0KB 3ZHVA 4DUZB 3ZMSA 3AE8C 1NTMG 4R7CA 4B3TB 2KNCA 1T2KC 3S4RA 1QL2A 2ITDC 4I5SA 2F4VB 3B8MA 4BW5A 1QGKB 3KCYA 4CH6A 3PH0A 3CCSV 4B3TO 1KILB 3A0BZ 4LWSA 4LFCB 1L0NH 1S2EA 3GF3A 4QNHB 3TGUD 1HWYA 5CBFA 2YXHA 4PA6A 1VQOV 1AI6A 2RKLA 4CH3A 2OYIC 1EDIA 3CCJV 3Q3DA 1GD2E 1H8AA 2JJ1G 3AEIA 1SQVJ 2WLIA 2YEVA 4I4TB 1NTKK 1XTCC 3E8BA 1VQ5P 4U3FD 4MW8A 1IDSA 1KKDA 4OH8B 2W90A 2K88A 3P8CE 1BCCE 4R4MA 2IYOA 3A0BH 2Y0EA 4DR2O 1M56D 1VQ8P 1WT6A 1YTZT 2PRRA 3MTUE 1G1JA 3LDEA 2D2CD 2PYJA 1IFPA 4N78D 4NYKA 1VF5C 2B89A 2VRZA 1JVMA 4BAYA 2W6JG 1NTZK 3TXSA 4DV7B 3RBXA 4CS2A 5EBMC 5LGUA 2ZJSE 3V2PA 3KKYA 1CI6B 4MT8A 5LMUB 1L0LK 4U7JA 3HE4A 1TU3F 4JZGA 4GIFA 2O1KA 1PL0A 2YI8A 4U3FG 1Q8IA 3LSSA 4H44B 1NU1K 3K3WA 1P7BA 5EZYB 2OCCC 3H1ID 2AZ0A 2R3CA 4K35A 2JJ2G 4TOIA 1YJWV 3RK3D 2PZSA 1LTJA 5APTA 3WFVA 2WSCH 3NTNA 1Q6HA 4LF5B 1GMJA 4C7NA 2JP3A 4BIZA 1NTMK 3PRJA 4IIJA 5CCHC 3CX5F 1PP9G 4N78E 2KNCB 2FTKA 1HGVA 4UVBA 1VQPV 1NYHA 4TV8A 1Q43A 4KHPO 2WPQA 4LF9B 4X64B 2A3QA 4NXNO 4FLVA 2CGNA 1S5HC 2WPRA 4X20A 3ML0A 2RN9A 2A79B 3V2QA 2FXPA 5DECA 3OFNG 3T2MA 2K9JA 1Q5OA 2EJRA 2K1EA 1PL5A 2KS1A 1IBKO 3CC2V 1JTHA 1HNZO 3ABUA 3B5NA 1EN4A 2RQ6A 2QEXV 4TUYA 1URFA 3CWBG 3OAAG 1PGOA 4B3RB 4BIUA 1VQLV 4PDMA 1Y4MA 4O4LA 2IBZD 1KQSO 4FMTA 4XDLA 2P22C 5L3BA 5AG2A 3I55P 4ASWA 3IJ4A 4MVRA 2YIUC 1V55C 4DRXA 2JS3A 2X6BA 1AR5A 4AQRD 2E76C 1M1JA 4IFDK 2KSDA 1H2GA 2FYUE 3B09A 4UCOA 1NBMG 3BA9A 3HKBA 3BEHA 1JCCA 3ICXA 4O2BB 3WUUA 4JYBA 4C7RA 1BSNA 4WFHA 1JMBA 4J42A 1GN6A 3CSXA 1JR9A 3HRNA 4X9QA 3K59A 2FKWB 5FL7G 3RK2C 1PPJG 3N7NA 2N1TA 3A0RA 4N3YB 1KORA 1GO3F 1JCDA 3QNEA 3DSQA 3Q4HB 4PD4E 3ZRSA 1FZBA 3L72D 4N6JA 5GW7A 3RGBA 1S9KE 1O9HA 1GH6A 2N04A 4YXDC 2FFDC 5JQGA 3JATA 5BXZA 1IK9A 3G67A 3OMIB 3K0DA 3TDKA 2HJFC
chains in the Genus database with same CATH topology
2WQYC 4PV1B 3Q5PA 4H13B 3H25A 4U7JA 1TU3F 2K9YA 3AE4C 1K05A 4H44B 1S1CX 1DD3A 2E75C 2YMKA 2QJPC 1DIPA 3D6YA 3IAOA 4H13C 2D2CB 3EWKA 2WPVB 3IN6A 3R4YA 4PV1C 5KLIC 2QIWA 3D71A 2BEQD 4R4LA 1GMJA 1EXJA 2ZT9D 2JP3A 2V7QJ 2E76B 1KQGB 3AE5C 3AECC 1OW8A 4H0LC 3Q5RA 4OGQD 1NYHA 2P10A 1HF9A 1VL2A 1FDIA 2QJYC 1JB0J 4I7ZC 4GDOA 2O01J 1RQVA 2BEZF 1VF5B 2ZT9C 1RQUA 2G3AA 3Q5SA 2FBWC 5M1BA 3S9OA 3AE6C 3AE9C 3C8VA 4PV1D 1Y9BA 3AEGC 2FXPA 4H13D 4H0LB 3AE7C 3GLMA 4XFJA 1OW6A 2E74B 1NGMB 2E75D 1PL5A 1IK7A 2QSIA 2QJKC 1DD4A 3T97B 2WSEJ 2OQQA 2H88C 1KMIZ 1FDOA 1YQ3C 3GF7A 5L8RJ 3D70A 3AE1C 3Q2YA 1R8EA 2H89C 3GMAA 1WMKA 2WSFJ 1VF5D 3AE8C 3G9RA 1KQFB 4RKUJ 2YIUC 3O6QA 4OGQC 1U57A 4TT3H 1OW7A 4H0LD 3GF3A 2E76C 2WSCJ 1PIXA 1ZP0C 4YTPC 4H44C 3SFDC 1UIXA 3RK3E 3SFEC 3Q3DA 1MKMA 3AEBC 1HJ0A 2NZ2A 3RL0g 3AE2C 2E74D 2E74C 2J5UA 1Q90D 3AEEC 2E75B 1PV3A 4KT0J 1YQ4C 1ZOYC 3FGAD 4H44D 1KILE 4R4MA 1K04A 3LW5J 4Z1MH 3AEDC 1KORA 2FYNC 1OMIA 2IDBA 1EXIA 2E76D 4I7ZB 3AE3C 5KKZC 2D2CD 1AJYA 3B71A 4Y28J 1KTMA 2MKVA 3D6ZA 4YXDC 2JO1A 2ZT9B 1VF5C 1ZMEC 3Q1MA 1ZRTE 3ABVC 4IL6X 3AEAC 3AEFC 2G8YA 4OGQB 1S5LX 2D2CC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PV1 B;  2E75 B;  2QJY C;  4H13 B;  1JB0 J;  4KT0 J;  5L8R J;  2O01 J;  2K9Y A;  1VF5 B;  2WSF J;  3LW5 J;  4H44 B;  4RKU J;  2YIU C;  2FYN C;  1Q90 D;  2QJP C;  3C8V A;  4I7Z B;  5KKZ C;  4H0L B;  2D2C B;  4Y28 J;  2WPV B;  5KLI C;  2E74 B;  2QIW A;  2WSC J;  2QSI A;  2ZT9 B;  2QJK C;  2E76 B;  2WSE J;  1ZRT E;  4IL6 X;  4OGQ B;  1S5L X; 
#chains in the Genus database with same CATH topology
 2EJ7 A;  5BU8 B;  1FOS F;  3TNU B;  1CP9 A;  3VYI A;  3UKM A;  1HNX B;  2K9Y A;  2B1I A;  5DJT B;  4AYC A;  4JI5 B;  3ZHS A;  2WWW A;  1DD3 A;  1SQF A;  2X7R B;  1JA8 A;  1OVU A;  2CK3 H;  3SYO A;  1JY2 O;  5FPR A;  3T1C A;  1DIP A;  3FX0 A;  2D2C B;  5APV A;  4LF8 B;  2P06 A;  2Q7H A;  2F93 B;  5AVT B;  2QIW A;  2A45 I;  3SPG A;  4DV6 B;  2BEQ D;  1SQB J;  2EIK B;  3JAR B;  3I5C A;  1SC5 B;  2OCH A;  1S5J A;  3H1I H;  3ABM B;  1OCR B;  2QVA A;  1M9N A;  3AEC C;  4H0L C;  4DR6 O;  5JJN B;  1HR0 O;  3CXC U;  4NXN B;  1KD1 Q;  2BOC C;  1OX3 A;  1USE A;  4LF9 O;  1YJN V;  4JI3 O;  2LW1 A;  4TLF A;  1Y47 A;  2JDI H;  3PTZ A;  1VF5 B;  3I5D A;  1JFF B;  1E1Q G;  3VMZ A;  3L73 E;  4BRY B;  3CCQ P;  1YIT P;  1SQP E;  1VQK V;  4YIP A;  1WPB A;  2PYL A;  2XU6 A;  3IC9 A;  2E75 D;  4DZO A;  1BZK A;  1R3L C;  1M1K W;  1CEZ A;  3RK2 B;  2POH A;  3K0G A;  2UUC B;  2C2A A;  1XNQ B;  1L0N K;  1AIL A;  1CW5 A;  3HE4 B;  2DWE C;  1VQ4 P;  4GOD A;  4LF4 O;  2UXB B;  2QM7 A;  3Q2Y A;  2M8R A;  1PZQ A;  2AZ2 A;  1VEW A;  3H1H G;  3JYC A;  5EIB C;  1KC8 Q;  1BQZ A;  1G8M A;  4HNA A;  4OXS A;  5EFW B;  4CC6 A;  1SQP K;  2BE3 A;  4PD4 I;  3T1H O;  2E42 A;  2W0X A;  2K9P A;  3FYE B;  3WU2 Z;  2OTL V;  4DV5 O;  1X0T A;  1FYJ A;  3CWB J;  5E79 E;  2F66 C;  3ZMZ A;  4GKG A;  5AVV B;  5TIS E;  3ZMT A;  1N8R Q;  3RWR D;  3UO2 A;  1RE3 C;  3U1C A;  2FB5 A;  4EB6 B;  1SP4 A;  1NTZ H;  1WPX A;  1KIL E;  5LOV B;  3R2P A;  1QVF U;  5KJ7 D;  1XRE A;  1SQX H;  1FZG A;  2FYN C;  5CCG A;  1AQT A;  3K03 A;  1AJY A;  3JAL B;  3E8F A;  1ZSP A;  3JAT B;  4QGP A;  2L91 A;  4RJT A;  2WLI B;  2YEV B;  4GZR B;  2WLL A;  3CB2 A;  2VS0 A;  3RT3 C;  2WA4 A;  4UCU A;  3H1H H;  4YXW G;  1K5Q A;  4R6Z A;  3AG1 C;  4JTD B;  1KIL C;  1QLE B;  4PA4 A;  4YY3 O;  3MUD C;  3L70 J;  4D6T J;  1K92 A;  1JJ2 U;  3PLN A;  1XNR O;  1BSH A;  4PD4 D;  3QWO C;  2CTQ A;  5KAF E;  2EIM B;  1YCI A;  4HZ3 A;  1BSM A;  1RE4 A;  1K05 A;  5IDJ A;  4XE5 B;  1GTW A;  2NNU A;  2E75 C;  4WY4 A;  3JD3 A;  1FD9 A;  1THZ A;  2ETN A;  2OIE A;  3SPJ A;  3ZRX A;  3EWK A;  2PTM A;  4I1L A;  3ETE A;  2P4V A;  3BY6 A;  2HHH O;  2LKM A;  1SZX A;  3OUF A;  4J7J A;  4X1Y A;  3CC4 V;  2ZYD A;  1FXK A;  2Q9L A;  3SYP A;  1NTZ G;  1PP9 E;  1FKA O;  1K73 W;  2N1T D;  4B3S B;  1NR1 A;  4FFK A;  3G6E V;  2IFN A;  2KB7 P;  2FFD B;  2P58 A;  1FZE A;  1PGP A;  4ZOL A;  1Y76 A;  3WB1 A;  1T8Z A;  2F95 B;  2Y9Y A;  1B3Q A;  1U7M A;  1KQS U;  2PF4 E;  1M90 Q;  1PGQ A;  4WWI A;  1R1B A;  5LXT B;  3LIE A;  1AA0 A;  2VQE B;  1QCE A;  3T97 B;  1L0L J;  2XNX A;  4JI2 O;  3P8C D;  4JAS A;  1VQN P;  1KB9 F;  2JEE A;  3CXH E;  1SQV G;  5CJ0 A;  4X20 B;  1KMI Z;  2JEX A;  5LYJ B;  4NTY A;  1S76 D;  4HAM A;  2QJP B;  5AW4 B;  2L35 A;  1TUB B;  2RH0 A;  2Y4U A;  2WSS H;  1K73 Q;  1AVY A;  1M57 D;  1HTL C;  1Q82 W;  2JKV A;  4WFE A;  1KD1 W;  3E83 A;  3O6Q A;  3LID A;  4F6R B;  2KLU A;  4HB1 A;  5IY5 B;  4UFZ A;  3VOU A;  1NTM J;  4KHP B;  1QBZ A;  4YXW H;  5IT9 N;  2W6B A;  3OJA B;  3L72 G;  2GA1 A;  3CE2 A;  1NS1 A;  4B3M O;  4LC1 A;  4RUE A;  3JC2 2;  5AW5 B;  5KA6 A;  3ABK C;  2B87 B;  1SQP G;  4LF7 O;  1IBK B;  3HD7 A;  3FGA D;  4JAV A;  2WLL B;  1P84 F;  1ROP A;  1YJ9 P;  1IFJ A;  1LR1 A;  1MFZ A;  4HKZ H;  4UB8 E;  3CRQ A;  1AVO A;  2E76 D;  1W59 A;  1VQP P;  3JAL A;  1RF1 A;  1S3J A;  2EIN B;  4AUW A;  1P84 I;  4Q6G A;  1UJW B;  1Q7Y Q;  3W68 A;  3A5T A;  3RW0 A;  4Y99 C;  5APY A;  3EVK A;  3RL0 D;  1TAE A;  5CA3 A;  4Z1V A;  3HTK B;  2WLK A;  2Z3Y A;  3LSU A;  2Q1K A;  1XOU A;  2RJZ A;  1FC2 C;  3L75 G;  3L70 G;  1YIJ P;  3CCR P;  1I08 A;  4GX2 A;  4DR1 B;  5BU5 A;  5KAI H;  1EN5 A;  2EIN C;  2ZNI A;  4DV3 O;  3H25 A;  4GKK B;  1H8H G;  3BAS A;  3SWY A;  2HEP A;  4JTC B;  1RPR A;  3P3P A;  2WSF H;  4JF7 A;  3UT5 A;  3QVN A;  1N8R W;  4AI8 A;  2LFR A;  1ZXG A;  1KFM A;  4Q20 A;  4ZMD A;  2OAR A;  4M3L A;  1HW7 A;  3D36 A;  1HGZ A;  3OUS A;  1PNL A;  2AXT Z;  5FLX N;  1GKF A;  1GK9 A;  3OR6 C;  4UV9 A;  2K3R A;  2DW4 A;  3GWK C;  3N2K A;  5AW7 B;  2WLJ A;  5H2F Z;  5KX5 A;  4R50 A;  1MNG A;  2YI9 A;  1JO5 A;  1KEC A;  5CCH D;  1X8Y A;  2OYQ A;  2LXB A;  2J59 M;  4B3R O;  3SYQ A;  2G3A A;  3GB7 C;  4JZ2 A;  2V4H A;  1FXH A;  1MOF A;  4BRY A;  1LT1 A;  3TJT A;  1OWA A;  4GT1 A;  2WT7 A;  4XFJ A;  4JI1 O;  5AVY B;  1N36 O;  2VWK A;  2DYR B;  2QSI A;  1FOS E;  1SQP H;  1VQ9 P;  2XND G;  2M6Y A;  3FB7 C;  4QPK A;  3HKE A;  3SJB C;  3UT5 B;  1SQQ D;  3W7S A;  1FAV A;  3CWB E;  5KLV J;  4DR1 O;  1DLB A;  1JJO A;  3GVM A;  3GF7 A;  4UB8 H;  4KUM A;  3TGU H;  3KZI H;  1GU4 A;  1AVM A;  4PA9 A;  1R8E A;  2E5Y A;  5B5E Z;  3ASO C;  1ZRT D;  1FFX B;  4NB5 A;  4O4J B;  3W67 A;  2JS5 A;  1AI5 A;  1XMQ B;  2R9A A;  1S5L Z;  4MTG A;  4DXW A;  1U57 A;  3BRT B;  1FZC A;  3UO3 A;  3CHX A;  2IM9 A;  4D6T H;  1YSC A;  2DQ3 A;  5B1O A;  4DK1 A;  4YJ2 A;  3M9H A;  2ODM A;  3CC7 P;  1NVO A;  5KLV K;  4RQF A;  3E86 A;  3A0H H;  4LR3 A;  3V4Q A;  1MKM A;  2KSE A;  3K9A A;  3L73 G;  3ZMV A;  3FB5 C;  5TIS Z;  4R8C A;  2GUV A;  3TET A;  3CME P;  3RVY A;  2GM4 A;  3CCV V;  2IZ1 A;  1SQX J;  2QJK B;  1OCC C;  3LDD A;  4WFG A;  1NTZ D;  1PGJ A;  5LA6 B;  2XDJ A;  2OWO A;  3KQG A;  5APX A;  2PY5 A;  2KYV A;  3BHP A;  1KBH A;  5J2T A;  4O4H B;  5J2T B;  3CCU P;  3CJH A;  3CWB H;  3RYH A;  2MKV A;  2ZIN A;  2H8P C;  1L4A A;  1KB9 D;  3MHV A;  1S72 V;  3U11 A;  1CZQ A;  2Z4E A;  1LT9 C;  1Y66 A;  3FWN A;  4EOT A;  1KP2 A;  1R3K C;  5J2U B;  1PM9 A;  3L74 D;  1ZR2 A;  2A7W A;  1G1I A;  3CX5 D;  4PJ0 Z;  3SJA C;  4XBF A;  3ZX6 A;  3L71 E;  1Z56 A;  1VF7 A;  5KJ7 C;  5CA0 A;  1SQP D;  1M1J C;  4X65 O;  2H94 A;  3CXH F;  1SQV D;  1CXZ B;  2ATK C;  5KUM A;  3LDC A;  4I55 B;  1VDF A;  1OCZ C;  3OAK A;  1L2P A;  3H1K D;  1FZC B;  1GW3 A;  4DR3 O;  5K1X A;  2DWD C;  4JI8 O;  5A9G A;  4B7E A;  1XNR B;  5KA5 A;  5KUK A;  4O4J A;  1LGH B;  3B5N B;  3APQ A;  2ZT9 D;  3HKD A;  2WIT A;  3ZRW B;  2A9H A;  1LJ2 A;  4ZOL B;  2QDO A;  1N73 A;  1PPJ H;  2EIL B;  2AHZ A;  3CL3 D;  2P10 A;  4DV0 B;  2BCC G;  3QO5 A;  3N4X A;  1ZL8 A;  4GDO A;  2CAZ C;  2O01 J;  2LO1 A;  4WF9 V;  1BS3 A;  3E1R A;  3EFF K;  2W0F C;  2K9J B;  4FFB B;  5D5Q A;  5APQ A;  5C39 A;  4X1Y B;  1H38 A;  2V1D A;  3C8V A;  1T6A A;  3AEG C;  4TV8 B;  5AVW B;  2XV5 A;  2L6L A;  3L73 H;  4MVO A;  4LF8 O;  4EKW A;  3M06 A;  1SRY A;  3H1I J;  2D3O W;  1XEQ A;  1IUR A;  5AVX B;  4U3J A;  1HNW B;  2OQQ A;  1LWU B;  2ADQ B;  2H88 C;  2QE7 G;  2DN9 A;  3N2K B;  5IY5 C;  1ZR4 A;  4QIW F;  2HPC A;  4EEQ A;  1NJI W;  4I9Q A;  2GHY A;  4GX5 A;  2LGQ A;  4GX1 A;  3L70 E;  2YKO A;  1GDT A;  5B1A C;  4NPD A;  3SR2 C;  4JBZ A;  3U10 A;  1XMO O;  3CD6 P;  2Q68 A;  1H0T A;  3RL0 B;  1NTK G;  4DCK A;  5KHI A;  4J7Z A;  3T1Y B;  1AP6 A;  4H33 A;  4DR7 B;  3HKC A;  1XNQ O;  1J1D B;  1HVV A;  1KYO I;  3RK3 E;  3ZJZ A;  2E5L O;  1J2J B;  3THO A;  1N2D C;  1RHZ B;  2Q8V A;  1H88 A;  2AHY A;  2A06 H;  1F7Y A;  2Y0C A;  3GHG A;  1Q90 D;  1WB7 A;  2YUA A;  5E79 Z;  1BCC H;  4NPF X;  5E1A C;  4QPJ A;  1BE3 J;  5DN6 G;  1X22 A;  4G28 B;  2FYU D;  2W6A A;  3ASN C;  2O3J A;  4GLX A;  1YIT V;  5IWA B;  2QWP B;  4DR6 B;  3C9I A;  1PKX A;  1EDJ A;  2OYO A;  1DF4 A;  4AHC A;  2HP8 A;  3ASN B;  5BZB A;  1B06 A;  1A32 A;  1KIL A;  4XA4 A;  4WFF A;  2X0L A;  5C8Y A;  5KHG A;  4PA7 A;  3SDL A;  4NPE A;  3P30 A;  2V4D A;  2KP8 A;  3RK2 D;  1GZL A;  2FYU H;  4BWN A;  2LR2 A;  1N33 B;  3ABL B;  3C90 A;  5IYZ A;  1L0L E;  4J11 A;  1FXV A;  3A2F A;  3IFM A;  3P3N A;  1EDK A;  3G6B A;  2QJ1 A;  4L75 A;  1SQQ H;  5B1B C;  4IL6 Z;  1DEE G;  3JD1 A;  2R9I A;  4FFB A;  5IE9 A;  4DV4 O;  3L71 D;  2JRI A;  3O6Q B;  3WU2 H;  3QG5 A;  2QKC A;  1P84 E;  2KQX A;  3H32 A;  4J9Z B;  1AI4 A;  1JB0 J;  3B8E B;  1N86 A;  1RY3 A;  1RQV A;  1T3U A;  2CE4 A;  4UVA A;  3S3X A;  3ZN0 A;  2HKO A;  1NTM E;  3KPE A;  4IL6 H;  3QO7 A;  4LF5 O;  2O1J A;  3FAV B;  2ZXW C;  5IYC O;  4JYA B;  1GAX A;  4IOI H;  5IWA O;  1KZU B;  5AW8 B;  2QA4 P;  3K5N A;  3USS A;  2Q0A A;  2IJI A;  4GKJ B;  1BCC G;  3SJC C;  3L75 J;  3L72 E;  2NR5 A;  1YIJ V;  2YO3 A;  3K08 A;  3ABL C;  3T1Y O;  3ZDM A;  1ZW0 A;  1FDO A;  2IU0 A;  1MV8 A;  1SS1 A;  3TNU A;  2FFD A;  2QM4 A;  2QSA A;  1YJN P;  3L73 D;  2DW3 A;  3D3I A;  1EM1 A;  2WSF J;  1SZT A;  2UXN A;  2E5L B;  2IH1 C;  3BVH A;  3APO A;  4LNU A;  3D8C A;  2LGW A;  3CXH I;  1RF1 C;  2Q9I A;  1XL4 A;  4NTW A;  3B77 A;  4BXL A;  4GCZ A;  5EK0 A;  4JYA O;  4X88 A;  1UIX A;  2EIM C;  1L4A B;  1PPJ D;  3H1L H;  3GHG C;  4QMA A;  1XQ8 A;  3NXS A;  5H6Q A;  1EZV E;  2YXR B;  2E74 C;  2R5D A;  1B6Q A;  3ZHR A;  4HYT B;  3RK3 C;  4WBN A;  4PI2 A;  5B66 E;  2GDS A;  1H2K A;  3E89 A;  1XMO B;  1IBM O;  4WVZ A;  5L3G A;  3RBZ A;  5AVQ B;  3TGU G;  1RFY A;  3PJS K;  1NH4 A;  2XUM A;  1NJI Q;  1SQQ K;  5LOV A;  1LNQ A;  2ZT9 B;  1SA0 A;  4PA3 A;  1WN7 A;  2B5U A;  2RMK B;  5L3D A;  4UV8 A;  2H8P D;  2N74 A;  4DUZ O;  3RYF A;  3W7T A;  1NTM H;  2EX3 A;  3A3Y B;  2WA3 A;  2JGD B;  3CPW O;  3K04 A;  4EB6 A;  4YJ3 B;  4DV0 O;  1JY2 P;  1VQM P;  4P9O A;  4L76 A;  4TT3 G;  4C46 A;  1F23 A;  1QL1 A;  5CJ4 A;  4TUY B;  2QA4 V;  2NPS B;  2ZFC A;  1FFX A;  1VPC A;  1OXZ A;  1RM1 C;  4DO2 A;  3CEI A;  4J10 A;  4H13 C;  2KS1 B;  3OGI B;  2WPV B;  5B3S C;  1QLE C;  3T1H B;  1VQ7 V;  3MDS A;  3AG1 B;  4HNA B;  3H1I E;  2XZR A;  2QM8 A;  1CSB A;  3A8T A;  1KFN A;  1DGS A;  1L0L H;  2GSM B;  3M0A A;  3HKE B;  4RQE A;  1DH3 A;  3P7K A;  2E76 B;  2IFM A;  1KQG B;  3LNM B;  3AG3 C;  3FWL A;  3VP8 A;  2QWO B;  2BSK B;  1HJB A;  5H2F E;  1Z5V A;  3VQY A;  1HF9 A;  3E2E A;  3U1A A;  5ITZ A;  5AW1 B;  1L8D A;  1T2K D;  4JI7 B;  1G2C B;  1URQ B;  5B1N A;  3CC7 V;  1URQ A;  3H1J E;  5M1B A;  2QEX P;  3SSU A;  1SQB K;  2A45 H;  4PV1 D;  3F5H A;  3ZHT A;  2UXD O;  5JH7 B;  3H1L G;  1IBL O;  3KZI Z;  4LFA O;  1PP9 D;  2M3E A;  3W7X A;  2FYU G;  4MTX A;  4RUF A;  5LMU O;  4TWK A;  1ZAU A;  3TXQ A;  5BR8 O;  1KQL A;  2Q5Z A;  2R32 A;  2EBO A;  1K5S A;  1K34 A;  3BCC D;  3L74 H;  3CCL V;  4DV1 O;  1SQV K;  5IYB O;  1JNM A;  2NPS A;  2EUL A;  2ZNJ A;  3SJQ C;  4OX9 B;  1KQF B;  2EIK C;  4X1I A;  1HUC A;  4RKU J;  1PNM A;  3TF5 A;  2KXP B;  3IR9 A;  4K0K O;  1KV4 A;  1NOH A;  3CCS P;  1P4R A;  1AQ5 A;  3RYF B;  3UCS C;  2WVR A;  1HP8 A;  4LFB O;  4O2A A;  4DW0 A;  1NU1 E;  1NKD A;  2BCC J;  1SA0 B;  2N9B A;  3F7V C;  5B66 Z;  2AXT H;  4AIL C;  2FYU J;  5IJ9 A;  4I55 A;  2NZ2 A;  3AG4 C;  3OE7 G;  4JI5 O;  2J5U A;  3AEE C;  1N36 B;  2WZ7 A;  2AGA A;  1MZE A;  4FM0 A;  3LUT B;  1LUV A;  4LFC O;  1SVF A;  3AED C;  5CCG C;  5EBL C;  5CBG A;  1NAY A;  2BCC H;  2XND H;  2YIA A;  4TQD A;  1J1E C;  2EIL C;  3B71 A;  5AW6 B;  4BWA A;  1GN2 A;  4D6T D;  1RSO B;  1WJZ A;  3LNN A;  5KHJ A;  1N4C A;  1GL2 A;  1XUQ A;  2ZCE A;  3GW6 A;  4WB4 A;  2JO1 A;  3B2E E;  3CJH B;  2W27 A;  3AK2 A;  5LP6 B;  1QX8 A;  3MUD A;  1L4A D;  5EC2 C;  3DXR B;  1YDX A;  5GON B;  1BE3 E;  3G4S V;  4MW3 A;  3BAB A;  4ZI7 B;  1NTK E;  1FZC C;  1N34 B;  1KYO E;  4UB8 Z;  1OCZ B;  4CZZ A;  1IFI A;  2JWD A;  3M7M X;  1BE3 H;  1IXB A;  4DV2 O;  1MUU A;  2KK7 A;  2QGN A;  5E79 H;  1S1C X;  2CPB A;  1QVF O;  1H2S B;  3T97 A;  4FLY A;  2RMZ A;  4U3F J;  3CME V;  1YZB A;  2M0B A;  4O4I B;  1LT9 B;  1SQX G;  2Z5U A;  3HUS B;  3OEH G;  2P7T C;  3S3W A;  1SF9 A;  1O9G A;  1ZX3 A;  1N7S B;  3ASO B;  3RYI A;  2P4K A;  1R5L A;  1SQB G;  3MD0 A;  2JGU A;  4AQY O;  4OGQ D;  5CBH A;  2ZDI A;  3QH9 A;  2JEU A;  4O4L B;  5FPO A;  1H2M A;  1FBM A;  1G6U A;  1F4N A;  2R9R B;  4HYO A;  5EYP B;  5AVU B;  5GTI Z;  2UUB O;  2UXC O;  1Y9B A;  1NWQ A;  2FY8 A;  3HD7 C;  1NKZ B;  1K97 A;  5BVZ A;  1ZTE A;  2ZE6 A;  1KKC A;  3L73 J;  3FFQ A;  1QVG U;  1K4C C;  4MTO A;  2J58 A;  2KB1 A;  1ARO P;  3WMM 0;  1V54 B;  3KHU A;  3WB0 A;  4LH7 A;  2BTQ B;  4DR4 O;  1YQ3 C;  3JCU E;  4BW9 A;  1LTJ C;  1D5N A;  2IBZ H;  5GTH H;  3M91 A;  4W80 A;  4C7N B;  3GMA A;  3WB2 A;  2OTL P;  2UUB B;  1XI1 A;  2IZ0 A;  4DOJ A;  2OYH C;  4EIJ A;  2N1T C;  3G4S P;  4IIJ B;  1MG1 A;  4UCS A;  5LGN A;  1SQQ E;  2Q7C A;  1Y6X A;  2XAQ A;  3VBB A;  5L3E A;  1EDL A;  2P7J A;  3VTP C;  2HFE D;  1JY2 N;  4PD4 F;  2FKX A;  4EDF A;  1QHT A;  5JJJ B;  3LSQ A;  3M99 B;  5EZY A;  2E3C A;  2E75 B;  1SFC D;  3CPW U;  4TV9 A;  3ABT A;  4RO2 A;  4G27 B;  1ZOY C;  2CPS A;  3H1I G;  2KG7 B;  2IU3 A;  2AEF A;  2HFE C;  2R44 A;  3H1L J;  3QTC A;  1QU7 A;  4JI2 B;  5CN0 A;  4D7T A;  1FAF A;  3AE3 C;  3AG4 B;  3OTO B;  1JEK A;  1U7J A;  1VQK P;  4J41 A;  3SYC A;  1KIL D;  3GHG B;  4LFA B;  4P2Z A;  1VQL P;  2EZO A;  5EC1 C;  2C9N Y;  1XIL A;  3M0D C;  4FVM A;  3H1H D;  4X1I B;  4X66 B;  1RF1 B;  3JCU Z;  3CCE P;  2WAM A;  2HHH B;  3AEF C;  4UCT A;  1AR4 A;  4FK5 C;  5KMG B;  1VQ5 V;  1GW4 A;  2XTA A;  4GOE A;  3HB3 B;  2Q5U A;  4MVM A;  1VQ9 V;  3E22 B;  3B8N A;  2RCV A;  4IFM A;  2BOB C;  2ZE7 A;  1SFC C;  5A2Q N;  3HD7 D;  5GTI H;  3X2Q B;  3A0H Z;  3JAW B;  3IN6 A;  3EXA A;  4KXR A;  4Z2W A;  1JY3 P;  2PGD A;  3JD2 A;  4FZ1 A;  1ZN5 A;  1N34 O;  2Y4T A;  3J80 N;  3E8G A;  2P2U A;  3D3Q A;  4NXM O;  4FLX A;  4A5U B;  3I56 V;  1E1R G;  2A06 D;  1SQV E;  2WLN A;  3CYO A;  4DR5 O;  1H8E G;  4I7Z C;  1JX9 A;  2WPD G;  1W0J G;  4FLT A;  1BGY G;  5TJH A;  3TSI A;  2CUG A;  3Q5S A;  4QE9 A;  4ZIB A;  2DYR C;  2NLJ C;  1SQQ J;  3K5L A;  1AJP A;  2LXC B;  3AE9 C;  3CCM P;  3A0H E;  1MZF A;  2K1A A;  1BE3 G;  1MAB G;  1EZV I;  4L74 A;  3AG3 B;  1SQP J;  3M8A A;  3BCC J;  1YTZ I;  4PDL A;  2KSJ A;  4DT0 A;  4IYH A;  1GK4 A;  4PI0 A;  5KAF Z;  2WSE J;  2MW2 B;  2ZR2 A;  1P7G A;  2ZDI C;  1VQ8 V;  4E4E A;  2UWJ E;  2YMY A;  1XDC A;  3CCU V;  4TSF G;  1SQB D;  1L4A C;  1RPO A;  2LJ2 A;  1K3E A;  1PV0 A;  2VRS A;  1Y74 B;  4JI0 B;  1WA8 B;  3CCM V;  3RYI B;  4H0L D;  5J2U A;  1FS0 G;  3VQV A;  1JOC A;  2I1J A;  5AW3 B;  4NVP A;  3VMY A;  1NT2 B;  1YTF D;  1NI8 A;  5JJE B;  5K5G B;  1BDC A;  1EZV G;  1XBL A;  2PI5 A;  1HJ0 A;  1SQG A;  3CRA A;  5B66 H;  4J7K A;  3DXR A;  5LBQ A;  1K9M W;  1WAZ A;  1LTT C;  1M7L A;  1LP1 A;  2P1J A;  2XAS A;  5APS A;  1LUW A;  1BCC J;  1IX9 A;  4JQ0 D;  1P84 H;  4ZI7 A;  3LW5 J;  2ZXX A;  1GU5 A;  4ABM A;  3I56 P;  1MSD A;  5KAI Z;  3VP9 A;  5CHX A;  1JCH A;  3J81 N;  1LP1 B;  2Q7G A;  3PN1 A;  1EC5 A;  3M9B A;  1T3J A;  1W0K G;  2QWR B;  4ZBM A;  5LA6 A;  1VF6 A;  4O2B A;  1NU1 G;  3WG7 B;  3STZ C;  1I5X A;  1OCO C;  1WA8 A;  1IFD A;  3RL0 C;  1QNM A;  3QF7 A;  1TUE B;  3MZW B;  5IJ9 B;  2H7H A;  5CA1 A;  1L0N D;  2M5A A;  5B1B B;  3K5B A;  1K7D A;  5CCG D;  5HFL A;  1BMF G;  1JM0 A;  1Q82 Q;  3BAA A;  3EHB B;  2OTJ V;  4KJM A;  4MS2 A;  2YC0 A;  3RFR A;  4LLH A;  1IBM B;  4WFB V;  1QQC A;  2P5O A;  5AVS B;  4QJF B;  1J5E B;  4PV1 C;  2YKQ A;  2H3O A;  2XAJ A;  2FXO A;  4GOF A;  1M93 A;  2YXQ B;  1RE3 A;  1OIP A;  3O65 A;  2O01 N;  1HR0 B;  4ZKP A;  1Q86 W;  3CD6 V;  4K3A A;  3BAT A;  1KYO F;  4I9W A;  2QJY C;  2CTW A;  1NU1 J;  1SER A;  2BCC E;  2PAJ A;  3MHS C;  2DQ0 A;  3FX7 A;  1SFC A;  4LF6 O;  3E7K A;  2ADP A;  5JH7 A;  1F51 A;  4O9B A;  4H13 D;  1VMG A;  5KX5 B;  1K4D C;  2YXL A;  3BPZ A;  3H9V A;  1HNX O;  1G4Y B;  1W2B U;  2CK3 G;  1Z2G A;  2Y0I A;  2NRG A;  1KYO H;  1JFF A;  3P32 A;  4RES B;  3CI9 A;  1W2B O;  3JAS A;  2XAG A;  1MA1 A;  3OMA B;  3L72 J;  2PGG A;  1CI6 A;  3CLQ A;  5CMZ A;  4JI4 O;  1VF5 D;  3IGA C;  1OCO B;  3WG7 C;  1I0H A;  3OTF A;  4U7O A;  2Q6Q A;  4GYC B;  4DR7 O;  4CBC A;  4E2L A;  1OW7 A;  3JAR A;  4YPC A;  4JAA A;  5LGT A;  3CRM A;  1BE3 D;  1M56 C;  3F89 A;  3ZMU A;  4U3F E;  3JD4 A;  2BTO A;  2ZKO A;  5KLV G;  3SFD C;  3JAM N;  4YJ3 A;  1WB8 A;  4LH6 A;  4DW1 A;  4DV4 B;  1KYO D;  1FU1 A;  3H1L D;  2N05 A;  1QLE D;  3RL0 g;  2E74 D;  3H01 A;  3OGC C;  3U0Z A;  5KHH A;  2RDC A;  4EFB A;  1OV9 A;  1N32 B;  1PV3 A;  4KT0 J;  2ZIM A;  3VQX A;  5DED A;  1FJG B;  3HE5 A;  1Y8A A;  3QO8 A;  3HTK A;  2OGU A;  3BCC G;  4FM1 A;  2P6J A;  1IFN A;  3V2N A;  4CH5 A;  1SQQ G;  3ZBH A;  5LHG A;  3AG2 B;  3A7O A;  1PNK A;  1S5L E;  3JSV C;  5F2V O;  1JOY A;  1VF6 C;  5HFM A;  3V6I A;  2FYU K;  3OW2 U;  2A45 G;  1DEB A;  1G1X B;  4W4L A;  1JY3 N;  2L5G B;  2B87 A;  2R3S A;  1J95 A;  1EQ7 A;  3AEA C;  3EQ2 A;  2YXY A;  2D2C C;  4LWS B;  5B1A B;  4P9P A;  4PV1 B;  2JR8 A;  1YBK A;  2IJK A;  1KC8 W;  2GTA A;  3RN4 A;  2OTJ P;  1B04 A;  1FJG O;  1QEX A;  1USD A;  3AE4 C;  5AVR B;  3CXH H;  3HR0 A;  1DX7 A;  1J5E O;  3L74 E;  1D5A A;  3IF4 A;  3IFX A;  4UB6 E;  1N0N A;  3R4Y A;  2HG5 D;  1ORQ C;  1K8A Q;  1LWU C;  1GMG A;  4B7K A;  1TVK A;  5CB4 A;  4PDV A;  2YIU B;  4JF3 A;  3H1K E;  1EXJ A;  4J80 A;  3FB6 C;  1L1F A;  2HVJ C;  4YHH B;  2ZVO B;  3K06 A;  4D6T G;  1XHX A;  5LYJ A;  1D2D A;  3Q5R A;  3AG2 C;  1AP5 A;  3NMD A;  4WBA A;  1VQO P;  3HPL C;  1OVV A;  1IXM A;  4DYL A;  3K9S A;  1YYC A;  2IYP A;  2BEZ F;  1BGY E;  2FXM A;  5H2F H;  1L0N G;  1EZV D;  2C0X A;  3JAK B;  3KXD A;  3JAK A;  1N73 B;  3S9O A;  4JI0 O;  3ZRW A;  1WP7 A;  3FAV A;  1NVP D;  1BQ0 A;  1E5W A;  3JD0 A;  1ZUQ A;  1LT9 A;  3GLM A;  1US6 A;  5BMV B;  5JWP A;  1UPG A;  5AW9 B;  3SYA A;  1AV1 A;  2ZE8 A;  2Q73 A;  5LL6 Y;  2SPZ A;  1FXK B;  3L71 G;  1VAR A;  1OCC B;  1Q3E A;  1N7S A;  3DTU B;  2B88 A;  1HBW A;  2IPP A;  4PJ0 E;  1BDD A;  2WPS A;  4LCU C;  4DR2 B;  1WLE A;  4N23 A;  1N0J A;  3H32 B;  3JCU H;  4I2L C;  4ZKU A;  3F5W C;  3H1J D;  4JYY A;  3A2A A;  2EIJ B;  2OCC B;  1AJN A;  1FPO A;  1J1D C;  3AE1 C;  3GWO A;  3H6P A;  3G71 P;  2CDY A;  2F4V O;  4ASV A;  3G9R A;  2A0L A;  5LMN B;  3B40 A;  3SWF A;  3CCE V;  2UXX A;  3SPH A;  1OZ0 A;  4D7S A;  1HNZ B;  2W83 C;  3N2G B;  1GL2 B;  1I94 O;  5EBW C;  4QE7 A;  1SQB H;  3ETG A;  3L70 D;  1AI7 A;  2UU9 O;  4IL6 E;  1M90 W;  2LP7 A;  2CTR A;  2E43 A;  3SFE C;  5BY1 A;  5CMU A;  4FJC C;  3K5M A;  1TGO A;  3X2Q C;  1J1E B;  1RSO A;  1PP9 J;  4JV5 B;  5KHK A;  4NTX A;  1YJW P;  3OT7 A;  5DJU B;  3OR7 C;  5JVD B;  3G71 V;  4X64 O;  3WU2 E;  1S9K D;  3CC4 P;  3ZRV A;  2ITA A;  2QTO A;  1FZA A;  4Z1M H;  2DYS C;  1NH2 B;  2IDB A;  4O2A B;  1FFT B;  1NR7 A;  3ABK B;  2OT5 A;  1H89 A;  1ENV A;  2E5T A;  1PP9 H;  4MVU A;  4YJ2 B;  2UUA B;  1I94 B;  1JY3 O;  5GTH Z;  1KB9 H;  1URQ C;  1VQ4 V;  4ICG A;  2KZJ A;  4JI8 B;  1KP3 A;  2Y0P A;  2ZR3 A;  2G8Y A;  1YI2 V;  2PI4 A;  2ZIO A;  4DUY B;  3L36 A;  1PFI A;  2KG7 A;  4A7P A;  1X9V A;  3K5O A;  1I7F A;  1QR9 A;  4ZKI A;  4DV7 O;  1NTK H;  4GX0 A;  5TIS H;  2OYI A;  3BRC A;  3ZIA G;  3L35 A;  1H2N A;  3JCZ A;  4P30 A;  2Q67 A;  2QWQ B;  3IAO A;  1RP3 B;  1YEW A;  3II6 A;  2ZM6 B;  1Q7Y W;  2NPS C;  2WT7 B;  2QR4 A;  1GK6 A;  1IC2 A;  1LTS C;  5AVZ B;  1GM9 A;  2V7Q J;  4JAU A;  4N21 A;  4HH2 A;  1IZN B;  1OW8 A;  4I0X A;  4X66 O;  3NFQ A;  4W7Z A;  2Y9Z A;  2N9Y B;  3V5B A;  4X62 O;  1YI2 P;  3BRV B;  5LP6 C;  4H37 A;  4DV3 B;  2HPC B;  3L75 H;  3R66 A;  4FM2 A;  3MHH C;  1EZV H;  4W7Y A;  4WY4 C;  3TGU J;  1OHH G;  2A06 G;  2FBW C;  1G2C A;  2F1M A;  3L4F A;  3M9Q A;  5KLV H;  5D5P A;  2ILM A;  1LWU A;  5IJ0 A;  3AE7 C;  1RH5 B;  1NGM B;  3CX5 H;  3PHL A;  5AW0 B;  1IFM A;  4PJ0 H;  1VIB A;  2ZYA A;  4JYC A;  1HH0 A;  3TK1 A;  2HR3 A;  3B4S A;  1SS3 A;  5LHI A;  2UU9 B;  1Y67 A;  3OMN B;  5EYP A;  1XMQ O;  3E1I A;  2IW5 A;  1RM1 B;  5APW A;  2ZE5 A;  1NHL A;  3D70 A;  3SPI A;  5CBN A;  1MFT A;  3G3Z A;  4MN4 C;  1ZL8 B;  3L70 H;  4KFM A;  3KG2 A;  3CXH D;  2JK5 C;  1FE6 A;  1X79 B;  1AJQ A;  1F4M A;  4B86 A;  2WLH A;  4NXM B;  1SQX K;  1S77 D;  3CCQ V;  1P49 A;  5KAI E;  3G6E P;  3CX5 I;  2YSU B;  4O4I A;  2GUZ A;  4BR6 A;  4L87 A;  1GM7 A;  1L0N E;  2DYS B;  3IAY A;  2M5A B;  1GTO A;  4OPA A;  1U96 A;  3S1K A;  4UCV A;  2XHB A;  3AE2 C;  2VQF O;  1JPX A;  5IYD O;  2KLV A;  5J9P C;  1L0L G;  1YQ4 C;  1PPJ E;  2YIC A;  1N32 O;  1FXK C;  1R6N A;  4ZNC A;  2MJZ A;  2R5B A;  3RYH B;  4JI6 O;  4CC5 A;  5L3F A;  1IVS A;  1OMI A;  2QKS A;  2Y69 C;  4I7Z B;  3UM7 A;  2VQE O;  1XL6 A;  3BVO A;  3I55 V;  2LW7 A;  3STL C;  2KI7 B;  2N1T B;  1YXB A;  4LNU B;  3EFG A;  3CS5 A;  3L9D A;  3AK1 A;  2Q3I A;  3L37 A;  2IBZ E;  5GTH E;  2Q69 A;  1SES A;  1ZRT E;  3ABV C;  2GTS A;  3HUS C;  1KUQ A;  1NKN A;  4OGQ B;  2Q7E A;  3P8M C;  1N7S C;  2LQT A;  4IHJ B;  3V2R A;  2Q3E A;  3ZN1 A;  1WRG A;  4K8X A;  2HOD B;  1YHQ V;  3L71 H;  4X1K B;  1NH2 D;  1UFI A;  2QWN B;  1MZ9 A;  2QJP C;  2OIG A;  2QG4 A;  3L72 H;  5KLI C;  1Q2N A;  5BMV A;  2IBZ I;  2GUZ B;  5H6R A;  2QE7 H;  2R70 A;  2OYH A;  2YDE A;  3BFR A;  1NTZ E;  3A0B E;  4G2K A;  4YHH O;  2YNY A;  3G80 A;  3SGI A;  4YIO A;  3ZHQ A;  2OTK E;  2AXT E;  1JTH B;  1RF0 C;  2RN0 A;  4XDJ A;  4LF7 B;  3E35 A;  4I50 A;  1RQU A;  2JJL A;  3H1J G;  3VOP A;  3VN0 A;  1JUN A;  3K58 A;  2HJD A;  1XTG B;  3AE6 C;  1MSW D;  3OA7 A;  4L73 A;  1AR1 B;  3H1L E;  4DV1 B;  1M5I A;  3ABM C;  4UXN A;  1H2L A;  2O01 H;  1SLQ A;  1DD4 A;  3CX5 E;  1QR8 A;  1R73 A;  2CGO A;  4ASU G;  3CCR V;  4JGS A;  3U59 A;  1V9P A;  1JMM A;  1GL2 C;  5IYZ B;  3SPC A;  2YKP A;  5L8R J;  4RWU A;  2UXD B;  1IO4 A;  4DJG A;  2H89 C;  3L71 J;  1WMK A;  4X62 B;  4U7N A;  4F4L A;  1TA8 A;  1M8O B;  2PP6 A;  3BCC E;  2I8D A;  4I0X B;  1BHA A;  4OWF A;  4MTF A;  1LTI C;  2B1G A;  3H1K H;  1LTJ B;  3KYQ A;  3IC7 A;  4CS3 A;  4U3F H;  4FZ0 A;  1LTB C;  5KJ7 A;  1ZLZ A;  3E22 A;  2AEJ A;  2F43 G;  4K8Z A;  1YVW A;  5DM6 V;  3UQ8 A;  2ZQM A;  3CRR A;  3DC5 A;  2C9L Y;  5KMG A;  4HBN A;  2XT9 A;  3AEB C;  5BR8 B;  1YJ9 V;  3L75 D;  1SQX E;  2JGD A;  2LFS A;  1OJH A;  1IZ3 A;  1IBL B;  1P84 D;  2AEM A;  3LW5 H;  3N27 A;  3ZS8 C;  4LF6 B;  2ZVN B;  1RE4 C;  3H1H J;  2UUC O;  4TV9 B;  3C3T A;  4CPG A;  1DTO A;  1EN6 A;  4PHZ A;  1X4T A;  4NKG B;  2UUA O;  3D6Z A;  1N7L A;  1DK1 A;  4B3S O;  3HKC B;  1M57 C;  2O57 A;  1W2E A;  4JPZ B;  2Q6A A;  3CMA V;  3WUV A;  4EI2 A;  2QTS A;  2GUS A;  2QJY B;  3Q1M A;  1BGY H;  4D6T E;  1FJP A;  1VQN V;  1BGY D;  2KKW A;  4IL6 X;  3H1J H;  1Q81 W;  4I4T A;  1H0T B;  2CTP A;  2WQY C;  5B3S B;  3Q5P A;  2V7Q G;  4H13 B;  1K33 A;  4X8A A;  4FPP A;  3W7U A;  2MK3 A;  5JVD A;  4WBN B;  2W6I G;  5L3C A;  1WNS A;  2YID A;  2XKM A;  2YIB A;  4YY3 B;  2DMX A;  1HNW O;  3N2G A;  1NO4 A;  2YMK A;  1BCC D;  2BTQ A;  1D7M A;  4LFB B;  2YS8 A;  2ZAE B;  3CCV P;  1R6K A;  3CRC A;  3M0D A;  2B9B A;  1SET A;  4R4L A;  1BL8 A;  1JQ0 A;  4FIP C;  4U3J B;  2WSE H;  1GM8 A;  3J7A U;  4RO0 A;  1T5E A;  2Q4P A;  4UCR A;  2X6C A;  4DV5 B;  3O8Z A;  2B9Z A;  5LMN O;  1EBO A;  3ZCC A;  2ITC C;  2KZI A;  3BCC H;  3ZHU A;  4OX9 O;  1X59 A;  1VL2 A;  1FDI A;  1R3I C;  2QKA A;  3O9O A;  3FXD A;  1TUB A;  4X89 A;  2HYN A;  1M1K Q;  4I50 B;  4UVC A;  5B5E E;  1VP7 A;  2P67 A;  4GUN A;  2F23 A;  5JCO C;  4H0L B;  2IH3 C;  2BAS A;  1OW6 A;  2E74 B;  3CWB D;  2NN4 A;  3ITK A;  4J9Y B;  1YTF B;  3RYC B;  1N73 C;  2V7Q H;  1A02 J;  3HKD B;  1Q81 Q;  2WMM A;  4X65 B;  2VWJ A;  2ZXE B;  1U97 A;  1AFO A;  3PP5 A;  4MVS A;  5CA1 B;  4CH4 A;  5H5N A;  2UXB O;  2IX7 C;  4L8J A;  3MGN A;  1NTK J;  1L0L D;  2HOD A;  1UII A;  3KDP B;  2IJJ A;  3UIA A;  3D36 C;  5H9C A;  2EIJ C;  1NU1 D;  3T4D A;  5FNV A;  2XAF A;  3RVZ A;  3OD4 A;  1TVK B;  5CB4 B;  4LF4 B;  1QLN A;  1PIX A;  2M3B A;  2XOK G;  2CH7 A;  2DJV A;  5LP6 A;  4I6M C;  2JIZ G;  3BA8 A;  3JSN A;  3E8H A;  2FML A;  4LBE C;  5KLI B;  1XHZ A;  5C93 A;  1NAF A;  1OZH A;  1COW G;  5GON A;  4KP4 A;  1NTM D;  4B08 A;  1VQM V;  3ZED A;  3DC6 A;  2H43 A;  4JI3 B;  3OW2 O;  4PEL A;  1SKV A;  5C8Y B;  2QRX A;  5CCH A;  1M57 B;  1SQV H;  1K04 A;  2YIB D;  3FB8 C;  4WFA V;  3B5N D;  1E79 H;  1N7S D;  1IJD B;  2WSS G;  3F7Y C;  2HLD G;  2YO2 A;  2JDI G;  1AB3 A;  4FLZ A;  4LP8 A;  4DV6 O;  1L0N J;  3MIW A;  3CMA P;  3R65 A;  2ARH A;  5EIB D;  3AG7 A;  1ZME C;  3F5T A;  3HE5 B;  3L75 E;  2Q0O C;  5APU A;  2DOS A;  5JCO A;  1Y74 A;  1FJK A;  1S5L X;  4CS4 A;  1NVP B;  4DK0 A;  1JMK C;  5CBO A;  1K8A W;  3B5N C;  1GN3 A;  4DR4 B;  3V4W A;  4W4K A;  1M56 B;  2X6A A;  4RAI A;  3K79 A;  3WUT A;  1M4U A;  4FLW A;  3D6Y A;  2XAH A;  2W8Z A;  3D71 A;  3KCX A;  5IJ0 B;  4UB6 H;  1S0V A;  2ZYG A;  3CCJ P;  4DR5 B;  1YF2 A;  2FYZ A;  4MVQ A;  4WY4 D;  2UXC B;  2GV9 A;  1EFR G;  1NQT A;  3JAS B;  1Q6U A;  4JI4 B;  2JVD A;  4ZHQ B;  2FL4 A;  2KIK A;  1FS0 E;  3TYY A;  2Z5I A;  2JWA A;  2I1K A;  4KHX A;  2W6J H;  3OTO O;  2Y69 B;  4AQY B;  1OCR C;  2A06 E;  2NPS D;  3ETD A;  2G38 A;  5ITZ B;  3W7W A;  1V54 C;  4ZHQ A;  3RK3 B;  2KOG A;  2C0W A;  4JTA B;  4GKJ O;  2HLO A;  1LTA C;  1EZJ A;  1SFC B;  4IFF A;  3JAW A;  1IK7 A;  1OFC X;  2QJK C;  3ETQ A;  3JSL A;  1FZF A;  5KAF H;  4JI6 B;  1FDM A;  3KZI E;  3TGU E;  1OVR A;  1Z5W A;  2BSK A;  4Z1M G;  2M7W A;  1PL4 A;  4IGG A;  4DV2 B;  2GBO A;  4BIO A;  4EFE A;  5K1P A;  1KN7 A;  4GKK O;  2Y0D A;  2P90 A;  4PDR A;  1S4X A;  2AXC A;  2OYI B;  5LHH A;  4JPR A;  1URQ D;  2K37 A;  3FD9 A;  5AW2 B;  5KLV D;  1SQB E;  4OPH A;  1KU9 A;  1S72 P;  3GG2 A;  2Z5H A;  4OGQ C;  1DF5 A;  3FKS G;  4TT3 H;  2OYH B;  1CPY A;  2WSC J;  1ZP0 C;  1YHQ P;  4FLU A;  1HWT C;  3OEE G;  4YTP C;  4H44 C;  1N33 O;  1RF0 A;  4MVZ A;  4X1K A;  2WTY A;  3AK3 A;  3VQW A;  5KKZ B;  2ZXW B;  3OM3 B;  3HD7 B;  4KL1 A;  4MSW C;  3FYI B;  2HVK C;  5CA0 B;  4IHJ A;  2ZD9 A;  3CCL P;  4DR3 B;  5JQG B;  1W5C E;  4H44 D;  2KUB A;  4NR1 A;  3H1J J;  4B3M B;  4OVN F;  1EXI A;  1BGY J;  1S5L H;  5KKZ C;  3MP7 B;  3MAQ A;  3Q4H A;  4Y28 J;  1I5Y A;  1KTM A;  1R5S A;  5B5E H;  1V55 B;  5KLV E;  1NTZ J;  2RNB A;  1BT8 A;  1Q86 Q;  2IBZ G;  4O4H A;  1R6T A;  3VMX A;  2WLM A;  1ZLL A;  3CP1 A;  2IJH A;  3DGE A;  4IYI A;  2ZM6 O;  1NZ6 A;  2R72 A;  5FNV B;  4F6R A;  1A02 F;  3CC2 P;  1BHB A;  2CH7 B;  4HJG H;  1R3J C;  3C3S A;  1ZWI C;  3L74 G;  1QVG O;  4EYY Q;  2Z0A A;  4C7U A;  1VQ6 V;  3L74 J;  1LTG C;  3HKB B;  1MMM A;  5GTI E;  1M1J B;  4XDK A;  3TCU A;  1VQ7 P;  1E79 G;  1HDJ A;  3H1K G;  5LXT A;  3AE5 C;  4DRX B;  3H1K J;  1K9M Q;  3C1L A;  2AW9 A;  4JI7 O;  2DE0 X;  3T4Z A;  2PFX A;  4IT5 A;  4PD4 H;  5KTB A;  3RGU A;  1Y76 B;  3RYC A;  1GN4 A;  2ZT9 C;  4Y99 B;  2VQF B;  1WP8 A;  1Q6I A;  4TQF A;  1KB9 E;  2PUS A;  2BCC D;  1NU1 H;  2HG5 C;  3NR7 A;  4UB6 Z;  1VQ6 P;  3HUS A;  1GL2 D;  2FYN B;  1GRJ A;  4F6E A;  4LGD E;  4WCE V;  1NTK D;  4WY4 B;  3K57 A;  4DUY O;  1SQX D;  1ZV8 A;  2Y48 A;  4UUJ C;  4JI1 B;  3VMA A;  3SWK A;  1KB9 I;  3H1H E;  3FXE A;  4JV5 O;  1PD3 A;  2EZP A;  4K0K B;  3ZHV A;  4DUZ B;  3ZMS A;  3AE8 C;  1NTM G;  4R7C A;  4B3T B;  2KNC A;  1T2K C;  3S4R A;  1QL2 A;  2ITD C;  4I5S A;  2F4V B;  3B8M A;  4BW5 A;  1QGK B;  3KCY A;  4CH6 A;  3PH0 A;  3CCS V;  4B3T O;  1KIL B;  3A0B Z;  4LWS A;  4LFC B;  1L0N H;  1S2E A;  3GF3 A;  4QNH B;  3TGU D;  1HWY A;  5CBF A;  2YXH A;  4PA6 A;  1VQO V;  1AI6 A;  2RKL A;  4CH3 A;  2OYI C;  1EDI A;  3CCJ V;  3Q3D A;  1GD2 E;  1H8A A;  2JJ1 G;  3AEI A;  1SQV J;  2WLI A;  2YEV A;  4I4T B;  1NTK K;  1XTC C;  3E8B A;  1VQ5 P;  4U3F D;  4MW8 A;  1IDS A;  1KKD A;  4OH8 B;  2W90 A;  2K88 A;  3P8C E;  1BCC E;  4R4M A;  2IYO A;  3A0B H;  2Y0E A;  4DR2 O;  1M56 D;  1VQ8 P;  1WT6 A;  1YTZ T;  2PRR A;  3MTU E;  1G1J A;  3LDE A;  2D2C D;  2PYJ A;  1IFP A;  4N78 D;  4NYK A;  1VF5 C;  2B89 A;  2VRZ A;  1JVM A;  4BAY A;  2W6J G;  1NTZ K;  3TXS A;  4DV7 B;  3RBX A;  4CS2 A;  5EBM C;  5LGU A;  2ZJS E;  3V2P A;  3KKY A;  1CI6 B;  4MT8 A;  5LMU B;  1L0L K;  4U7J A;  3HE4 A;  1TU3 F;  4JZG A;  4GIF A;  2O1K A;  1PL0 A;  2YI8 A;  4U3F G;  1Q8I A;  3LSS A;  4H44 B;  1NU1 K;  3K3W A;  1P7B A;  5EZY B;  2OCC C;  3H1I D;  2AZ0 A;  2R3C A;  4K35 A;  2JJ2 G;  4TOI A;  1YJW V;  3RK3 D;  2PZS A;  1LTJ A;  5APT A;  3WFV A;  2WSC H;  3NTN A;  1Q6H A;  4LF5 B;  1GMJ A;  4C7N A;  2JP3 A;  4BIZ A;  1NTM K;  3PRJ A;  4IIJ A;  5CCH C;  3CX5 F;  1PP9 G;  4N78 E;  2KNC B;  2FTK A;  1HGV A;  4UVB A;  1VQP V;  1NYH A;  4TV8 A;  1Q43 A;  4KHP O;  2WPQ A;  4LF9 B;  4X64 B;  2A3Q A;  4NXN O;  4FLV A;  2CGN A;  1S5H C;  2WPR A;  4X20 A;  3ML0 A;  2RN9 A;  2A79 B;  3V2Q A;  2FXP A;  5DEC A;  3OFN G;  3T2M A;  2K9J A;  1Q5O A;  2EJR A;  2K1E A;  1PL5 A;  2KS1 A;  1IBK O;  3CC2 V;  1JTH A;  1HNZ O;  3ABU A;  3B5N A;  1EN4 A;  2RQ6 A;  2QEX V;  4TUY A;  1URF A;  3CWB G;  3OAA G;  1PGO A;  4B3R B;  4BIU A;  1VQL V;  4PDM A;  1Y4M A;  4O4L A;  2IBZ D;  1KQS O;  4FMT A;  4XDL A;  2P22 C;  5L3B A;  5AG2 A;  3I55 P;  4ASW A;  3IJ4 A;  4MVR A;  2YIU C;  1V55 C;  4DRX A;  2JS3 A;  2X6B A;  1AR5 A;  4AQR D;  2E76 C;  1M1J A;  4IFD K;  2KSD A;  1H2G A;  2FYU E;  3B09 A;  4UCO A;  1NBM G;  3BA9 A;  3HKB A;  3BEH A;  1JCC A;  3ICX A;  4O2B B;  3WUU A;  4JYB A;  4C7R A;  1BSN A;  4WFH A;  1JMB A;  4J42 A;  1GN6 A;  3CSX A;  1JR9 A;  3HRN A;  4X9Q A;  3K59 A;  2FKW B;  5FL7 G;  3RK2 C;  1PPJ G;  3N7N A;  2N1T A;  3A0R A;  4N3Y B;  1KOR A;  1GO3 F;  1JCD A;  3QNE A;  3DSQ A;  3Q4H B;  4PD4 E;  3ZRS A;  1FZB A;  3L72 D;  4N6J A;  5GW7 A;  3RGB A;  1S9K E;  1O9H A;  1GH6 A;  2N04 A;  4YXD C;  2FFD C;  5JQG A;  3JAT A;  5BXZ A;  1IK9 A;  3G67 A;  3OMI B;  3K0D A;  3TDK A;  2HJF C; 
#chains in the Genus database with same CATH homology
 2WQY C;  4PV1 B;  3Q5P A;  4H13 B;  3H25 A;  4U7J A;  1TU3 F;  2K9Y A;  3AE4 C;  1K05 A;  4H44 B;  1S1C X;  1DD3 A;  2E75 C;  2YMK A;  2QJP C;  1DIP A;  3D6Y A;  3IAO A;  4H13 C;  2D2C B;  3EWK A;  2WPV B;  3IN6 A;  3R4Y A;  4PV1 C;  5KLI C;  2QIW A;  3D71 A;  2BEQ D;  4R4L A;  1GMJ A;  1EXJ A;  2ZT9 D;  2JP3 A;  2V7Q J;  2E76 B;  1KQG B;  3AE5 C;  3AEC C;  1OW8 A;  4H0L C;  3Q5R A;  4OGQ D;  1NYH A;  2P10 A;  1HF9 A;  1VL2 A;  1FDI A;  2QJY C;  1JB0 J;  4I7Z C;  4GDO A;  2O01 J;  1RQV A;  2BEZ F;  1VF5 B;  2ZT9 C;  1RQU A;  2G3A A;  3Q5S A;  2FBW C;  5M1B A;  3S9O A;  3AE6 C;  3AE9 C;  3C8V A;  4PV1 D;  1Y9B A;  3AEG C;  2FXP A;  4H13 D;  4H0L B;  3AE7 C;  3GLM A;  4XFJ A;  1OW6 A;  2E74 B;  1NGM B;  2E75 D;  1PL5 A;  1IK7 A;  2QSI A;  2QJK C;  1DD4 A;  3T97 B;  2WSE J;  2OQQ A;  2H88 C;  1KMI Z;  1FDO A;  1YQ3 C;  3GF7 A;  5L8R J;  3D70 A;  3AE1 C;  3Q2Y A;  1R8E A;  2H89 C;  3GMA A;  1WMK A;  2WSF J;  1VF5 D;  3AE8 C;  3G9R A;  1KQF B;  4RKU J;  2YIU C;  3O6Q A;  4OGQ C;  1U57 A;  4TT3 H;  1OW7 A;  4H0L D;  3GF3 A;  2E76 C;  2WSC J;  1PIX A;  1ZP0 C;  4YTP C;  4H44 C;  3SFD C;  1UIX A;  3RK3 E;  3SFE C;  3Q3D A;  1MKM A;  3AEB C;  1HJ0 A;  2NZ2 A;  3RL0 g;  3AE2 C;  2E74 D;  2E74 C;  2J5U A;  1Q90 D;  3AEE C;  2E75 B;  1PV3 A;  4KT0 J;  1YQ4 C;  1ZOY C;  3FGA D;  4H44 D;  1KIL E;  4R4M A;  1K04 A;  3LW5 J;  4Z1M H;  3AED C;  1KOR A;  2FYN C;  1OMI A;  2IDB A;  1EXI A;  2E76 D;  4I7Z B;  3AE3 C;  5KKZ C;  2D2C D;  1AJY A;  3B71 A;  4Y28 J;  1KTM A;  2MKV A;  3D6Z A;  4YXD C;  2JO1 A;  2ZT9 B;  1VF5 C;  1ZME C;  3Q1M A;  1ZRT E;  3ABV C;  4IL6 X;  3AEA C;  3AEF C;  2G8Y A;  4OGQ B;  1S5L X;  2D2C C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...