4H13B

Crystal structure of the cytochrome b6f complex from mastigocladus laminosus with tds
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
160
structure length
160
Chain Sequence
b'MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b6
publication title Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
pubmed doi rcsb
molecule tags Photosynthesis
total genus 42
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2012-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 4h13B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 4h13B01
2E74B 1ZRTE 4I7ZB 2WPVB 5KLIC 2O01J 1JB0J 2WSEJ 4H13B 4IL6X 2E76B 1S5LX 4H0LB 2QJKC 2QJYC 5KKZC 1Q90D 2YIUC 2QJPC 2WSCJ 2D2CB 2QSIA 4RKUJ 4H44B 2ZT9B 4OGQB 4PV1B 2E75B 2WSFJ 1VF5B 2FYNC 2QIWA 2K9YA 5L8RJ 3LW5J 4Y28J 4KT0J 3C8VA
chains in the Genus database with same CATH superfamily
5B1AC 2E74B 3T1HO 3HD7A 4QMAA 3CX5E 3F5HA 2Q9LA 5CB4B 1W0KG 1FZEA 5B66H 3EFGA 1V55C 5APVA 1SQFA 3VMXA 3ITKA 5FNVA 3L71D 2OARA 1NAYA 1MSDA 1AI7A 3G3ZA 1ZTEA 2A0LA 3VBBA 2IBZI 2RH0A 2YXLA 4LFCO 2H94A 5H9CA 2Q1KA 2NPSA 4JPZB 1SQQG 3DTUB 4G2KA 4OPHA 4MVRA 2M5AA 2IPPA 3GG2A 4RJTA 3IC7A 1RF0A 1J1DC 1SA0A 1Y47A 4YIPA 3JSVC 3M8AA 1IBMB 1BSHA 3IFXA 3OD4A 5EK0A 1GW3A 5CHXA 1PM9A 3OE7G 3A3YB 2CH7B 3L75G 2Q5UA 3CX5H 2PI5A 4H0LD 1N86A 3L70J 1NTKD 4D6TE 2ITDC 2AZ2A 1HWYA 2ITCC 1L0NK 1SQPD 3G80A 3P30A 3STZC 4DR4O 1KU9A 2BE3A 1TAEA 4WFGA 3CRCA 2QG4A 3ZN1A 4JI2B 1VF5D 2P4KA 1KB9I 1PNKA 1K5QA 1M9NA 4G27B 3JD4A 4GX5A 4X9QA 1KYOF 1BGYG 3PHLA 5CB4A 2Y4UA 2M6YA 1AVYA 3HD7D 4C7RA 2HEPA 1RFYA 2B5UA 1KQSO 3JD1A 2EBOA 2WLJA 4J7KA 3RYFB 4ZNCA 1W0JG 2YI9A 1Q81Q 1IXMA 3GHGC 4D6TH 4O9BA 3RYCB 1OW7A 3KZIE 5KLVD 2YICA 5CBOA 2NPSD 3D3IA 3AE2C 4DRXB 4EEQA 1DD4A 4RQFA 2A45I 3M9HA 4U3FE 1W2BO 4HH2A 3CMAV 1K34A 1L0LE 1LP1A 2GUSA 3CCJV 3BAAA 2K1AA 3M7MX 1HNWO 1EZVE 2KSEA 2DW3A 4NXNB 3M0AA 1KD1Q 4BWAA 3K0DA 1KILE 1AI5A 3KZIZ 2UXNA 3CS5A 1NU1J 1S5LX 1VQPP 2XAHA 4Z1VA 4FM2A 2ITAA 3CWBJ 1BCCJ 4J41A 1S77D 2YKPA 2XASA 1TVKB 2UXDO 4CS4A 4WFFA 1WA8B 1RQVA 3KZIH 3UT5B 2FYUJ 1HBWA 2OTKE 1QBZA 1KQGB 2IZ1A 3S9OA 5AVRB 1W59A 5KHJA 2ZYGA 4UB8E 2Y9ZA 4U3FH 2E74D 1PGOA 4FZ1A 3HE4B 4LF8O 3C8VA 1L0LH 4F6RB 2JK5C 4B3MB 1JM0A 2P6JA 3RYFA 1S76D 1LGHB 2ZT9C 2ZXWC 4KXRA 2WA3A 1EZVH 2DYRB 4FFBA 2CK3H 3AE6C 2LXCB 3ZRWA 1I7FA 1SQBD 4QE7A 3R66A 3CCJP 4DZOA 3H1LG 1JX9A 1YCIA 5EYPB 2RJZA 4UB8Z 1Y76B 1PGPA 3RWRD 3CXCU 4HBNA 2RNBA 3ZRXA 3WB2A 1SQVJ 2IFNA 5A9GA 1L0NE 4UB8H 3SYOA 3SFEC 5EBMC 1SQXJ 1N7LA 2ZVOB 2F1MA 1LNQA 1FOSF 1B04A 4JZ2A 3E8FA 3HKCB 1A02J 1BL8A 1TVKA 2BEZF 1XTGB 1HGVA 1WA8A 4I1LA 4FIPC 3P3NA 3UT5A 4DV2B 5B3SB 5DEDA 4DV0O 3HE4A 2XOKG 3ASNC 4F6RA 2XZRA 1L1FA 4NXMO 3L35A 2JJ1G 2W8ZA 2EINB 2RN0A 2XNDG 2V7QG 1PP9J 3CRRA 1L0NH 2HG5D 4IGGA 1OCZC 5AW6B 1RY3A 1M90Q 5LHIA 1MFTA 4RUFA 1O9HA 3DC6A 2XAGA 2E76B 4J9YB 1NH2B 4LF5O 5EYPA 4JYAO 2CGNA 1IZNB 4JBZA 1JQ0A 1FS0G 1Z5WA 4WBNB 1X9VA 1M57C 2YXYA 3PN1A 3HKDB 2WPQA 4WY4C 3OGIB 4LH6A 1PPJG 1I0HA 4DR1O 1GU4A 1E1QG 3AE8C 1T2KD 4EIJA 3P8MC 4XDJA 3K5BA 1YTZI 4PA3A 2I1JA 4QJFB 2ZFCA 1UPGA 2OIGA 1RPRA 3ASOC 4NKGB 2IYPA 4JI6O 1GH6A 2XUMA 3U11A 1FAFA 2N1TB 3K58A 4GLXA 3HKCA 2L5GB 2HODA 3AECC 2OGUA 2UXCO 2QWOB 5EZYA 4EFBA 1XMOO 2W27A 2IM9A 2ZYDA 5AW1B 5IJ0B 2LGWA 4XDLA 1KECA 4RKUJ 2B88A 4AUWA 1VQOP 2ZR3A 2HPCB 3K59A 2GA1A 4L8JA 4FLUA 3H01A 1NTMG 1Q5OA 1MG1A 2E3CA 3W7TA 5EIBC 3ZHTA 2ZM6O 1HUCA 1HP8A 2Q7HA 4DR6B 4BRYB 4WBNA 4Y99C 1VQNV 3CXHI 3LSQA 4W4LA 2XKMA 1QVFU 3CYOA 5HFLA 1FXKB 2Z0AA 3D36A 4LFBB 2PP6A 1EDJA 2YO2A 1ROPA 4H13C 3A0HZ 3I5DA 2DYSC 3K79A 4B7KA 3D8CA 4HJGH 1N7SB 3M9BA 1WJZA 1PIXA 2A06E 1IBLB 1QGKB 1N36O 3SPCA 1IK7A 3TGUG 5IDJA 4WFHA 4PDVA 2VQEO 3H1HE 3R2PA 4AILC 1Q81W 2N1TA 1SFCC 1HGZA 1MOFA 2GTSA 4B3RO 2DWEC 2RMKB 1Q43A 2DE0X 4R7CA 5APUA 3H1IG 3CRQA 3F5TA 3WB1A 2QR4A 4LF4B 4J11A 4UCRA 4DR3O 1QLEB 3BVOA 3TETA 4I6MC 1OCRC 5KHGA 5KJ7C 1P84I 4C7UA 1BDCA 2E5LO 2IH1C 2UUAB 1VQNP 1RE3A 4YY3O 1ORQC 5AVYB 2YNYA 3JARB 3CLQA 2HPCA 2F66C 2A06H 2YS8A 1KD1W 1JUNA 4RWUA 4CS3A 4BRYA 3H1HH 3OW2U 2VS0A 5KLIC 4ZKPA 1JCCA 2E76D 3SWKA 1LTJC 1FXKA 2E5TA 4JPRA 3VMYA 1QLNA 3BA9A 1XNRO 1S5JA 1GMGA 2P4VA 4QPJA 2QJPC 3GVMA 1OCCB 1N7SA 1SQQD 3MGNA 3B40A 4H0LC 4K0KB 3H1KE 3EVKA 3TK1A 3LSSA 1KYOD 1K7DA 1CXZB 4UXNA 3G71V 4LBEC 3I55V 1EDLA 1QR8A 3BABA 1NTZJ 5AVVB 1ZSPA 3C3SA 1HJ0A 2N1TD 1JY3P 1B6QA 3SJCC 5JJJB 3L75D 1YI2P 4K35A 4DV4B 1URQC 2Y48A 2YDEA 3I56V 3AEEC 3PLNA 2CUGA 3M0DA 4KUMA 2POHA 3N4XA 1NHLA 2JO1A 1MMMA 3U1AA 1XHZA 4EDFA 4NTXA 4PD4I 2WLNA 4LLHA 4XFJA 1AQTA 3OGCC 3H1KH 1H2LA 4LFCB 1L4AB 1BGYD 1OMIA 3CCEV 2CTQA 4PA6A 3ZX6A 1J95A 1VL2A 1DH3A 2UXXA 3HKEB 1QVGU 5CCGA 3N2GB 3G71P 2O57A 4UCSA 3I55P 5AVUB 3J80N 1Q90D 1VQ6P 1VEWA 1M93A 3RK3D 1N7SD 3I56P 5KUKA 5KA6A 1ZOYC 3SJBC 2BOCC 2WPRA 4X20B 4DR4B 1B06A 4PHZA 2ILMA 3L73J 1RF1B 2JJLA 3H32B 2QEXP 4DK0A 1M90W 3AG3B 1VPCA 3KKYA 5EC1C 1HR0O 4D6TG 5KA5A 1R8EA 2WPVB 3T4ZA 1RM1C 2R70A 3ZHQA 4KHPO 2L6LA 3CCUP 4MVZA 1NH4A 1XBLA 1EN6A 2E74C 1QLED 2JRIA 4DXWA 2M7WA 1M1KQ 2Q3IA 2FFDC 1FOSE 2W6BA 1D5AA 1NS1A 5APXA 1Y67A 2KSJA 4IFFA 3E2EA 4B3TO 5K5GB 5KTBA 2YC0A 2Y0EA 2WPSA 1L4AA 3CI9A 4DUYO 1OV9A 2PYJA 5FL7G 3AE9C 1S2EA 1MNGA 3SFDC 4JAAA 4U7NA 3VP9A 5IYBO 2CPBA 1Q82W 3HKEA 3N2GA 1USDA 4JAUA 3QO5A 3K08A 5B1BB 5CMUA 4GDOA 3CB2A 4R8CA 4O4JB 1HNWB 3AEAC 1H2NA 2IFMA 3H1LD 4U3FG 3BCCE 4UV9A 5AG2A 1CPYA 2HHHO 1L0LG 3KYQA 2EX3A 4X20A 3THOA 2BCCE 2J58A 4U7OA 1EZVG 5JQGA 3H32A 2CK3G 4YJ2B 3Q1MA 1AR5A 2UXDB 4CS2A 1A02F 4TQDA 3C9IA 1BE3J 2QJKB 3R4YA 3E1RA 3K9SA 4O4LB 5LP6B 2DQ3A 1X8YA 1YQ3C 1RE4C 1JMBA 4UB6H 2ZE6A 4LF8B 3DSQA 3TXSA 3A0RA 1HJBA 5L3BA 1WB7A 3E83A 1NWQA 4R4MA 2NNUA 2P1JA 3CCSV 4MS2A 2BCCH 2F95B 1N2DC 4ZKIA 4MVSA 1J1EB 1KB9F 3KQGA 5AVSB 4O4JA 3OEEG 4HYOA 1G8MA 3A0BE 1OVVA 3IJ4A 4I4TB 3FWNA 1CW5A 3ML0A 4PDLA 4EOTA 1PPJD 1WLEA 1JOYA 5ITZB 2PAJA 2ZIMA 1DLBA 3SR2C 1L0NG 1FJKA 1Q6UA 3BA8A 3BFRA 4K3AA 1AJPA 1NT2B 3LW5J 2Q7CA 3ETDA 3A0BZ 5DM6V 4O4LA 4PDRA 1S5LE 3U10A 3RN4A 4DV0B 2K1EA 3CCSP 1XHXA 1R3JC 3H1JJ 4NXMB 1OW8A 3Q5SA 3RL0g 2K9PA 1EXIA 1Y4MA 1D2DA 1GAXA 3A0BH 3L4FA 2DYRC 1IJDB 4X1KB 1NU1K 3WFVA 2Y0CA 1K9MQ 3CCLV 4LF5B 4JYAB 3AE1C 1S5LZ 4NYKA 3BCCJ 2PI4A 4GOEA 4KJMA 2AGAA 5LGNA 3W68A 1R3KC 2A9HA 3MHHC 2FYUK 2YXQB 1KQSU 3P8CE 1ZRTE 2AW9A 2QJYB 4HNAB 4DR1B 1SQGA 1NTMD 1J2JB 2LW1A 1H8HG 5JH7B 1Q2NA 3L72J 1S5LH 3KCXA 4I4TA 1R3IC 1O9GA 2YUAA 3FYIB 2CTRA 2EIMB 1MZ9A 3K5LA 1EZJA 2IJHA 5ITZA 1IFMA 1AVMA 1R5LA 1IFNA 3CC4V 4JI6B 3P7KA 1AI6A 2IYOA 1M1JB 3K5MA 3V2NA 1W2BU 2OTJP 2UXCB 1WMKA 3QVNA 2PFXA 4AYCA 5F2VO 3OUFA 1XMOB 1VF5B 3E8GA 2QWQB 1YIJV 3GMAA 3HUSB 1HH0A 2OYHA 3MUDC 4WBAA 1KKDA 3TGUD 3D6ZA 1G1IA 3L70E 1SQVK 4LF4O 2AXTE 4NVPA 1BSNA 1IFIA 3BEHA 3CCLP 4MTFA 1KFMA 3HD7B 3L36A 4J9ZB 3VQVA 1SQXK 4GX2A 2JDIH 1NYHA 3H1ID 3AK2A 2EINC 2VQFO 4X8AA 1KORA 3CJHB 2AHZA 1FFXB 1ZMEC 4GCZA 3VQWA 5A2QN 4N3YB 3PRJA 4DUZO 1GN3A 1IFDA 2K3RA 2AXTZ 2CTWA 3ZMTA 1H38A 3CC4P 2D2CC 2YKOA 1VP7A 2EZOA 2OIEA 2Q69A 5JH7A 4N21A 1AFOA 3L70H 2ZJSE 1M1KW 1ZP0C 3OMIB 2AXTH 4JTCB 1M56B 1YVWA 1YIJP 1N36B 4HYTB 2VQEB 2ZKOA 4PA4A 2Z5UA 3GF7A 3LIEA 3ICXA 1M1JA 3EHBB 2PTMA 4W7YA 1IO4A 2FXMA 2A06G 4B3RB 2E75D 4D7TA 3F7YC 3HUSA 3H1HG 3ABMB 2F23A 5BU8B 1I08A 1ZLLA 4N78D 5L8RJ 1DEEG 2JKVA 2E5LB 3EFFK 1JTHB 2V4DA 1NU1E 1AJNA 1KILB 4YY3B 1AR1B 3HTKA 3CWBE 3Q3DA 1BCCE 2KZIA 2GUZA 2Q73A 4X1IA 3CJHA 1FFXA 5AW5B 2FYUE 3B8MA 2EJ7A 5E79E 2YEVA 4JF3A 3FXDA 1RQUA 1X4TA 1NKDA 2W90A 1PV0A 2O3JA 1XNRB 4ASWA 1FXKC 4GKJO 3ZJZA 5KHKA 3CX5D 3JSNA 5C8YB 3ABLB 1LP1B 1FE6A 3AE3C 5E79Z 1NU1H 5IY5B 1Y66A 4J7ZA 3WUTA 1DF5A 1BS3A 1URFA 2HJDA 5J2UB 3CWBH 1BCCH 3H1KG 4Z1MH 3M91A 2FYUH 2Y4TA 4DV3O 1SQVE 5E79H 3RGBA 1NR1A 1GL2B 4G28B 2P7TC 1WT6A 1QLEC 1SQXE 3M0DC 1GDTA 1LTSC 3OR7C 1XEQA 1JTHA 3KDPB 4K8ZA 1KILA 4X89A 4B3SB 2IBZE 1VQPV 4YIOA 3I5CA 1LT9B 4DV6O 2YIDA 1CZQA 1JY2N 1UIXA 1SZXA 4D6TD 1EM1A 4TV9B 3BATA 2WLHA 1QNMA 1SETA 4CH3A 4RAIA 2M3EA 3KXDA 4AQYO 1KQLA 2OQQA 1VQ7P 2RQ6A 1I94O 2UXBO 4R6ZA 4FFBB 2KIKA 3ZRWB 3QO7A 1GK6A 1MZFA 1OJHA 1ZWIC 4MVQA 4JASA 3OEHG 4OX9O 1SQVH 2RMZA 5CCGC 1PP9E 4K8XA 1ZXGA 1BMFG 1ZR2A 5C8YA 5B1NA 4J80A 3II6A 3N2KB 5EC2C 1SQXH 1RH5B 1OCCC 2Y0IA 3QO8A 1V9PA 1HVVA 3TF5A 2JS5A 2IBZH 4M3LA 1M56D 2PUSA 4JI0O 4DYLA 4B7EA 4EYYQ 3GWOA 5J2UA 1KB9E 3GF3A 3CEIA 2HKOA 3E1IA 4AQRD 1I5YA 3JAMN 3L74E 2Y0PA 4I7ZC 1K9MW 2Z3YA 5D5PA 3V6IA 1HR0B 5K1XA 2HLOA 4U3FD 3N27A 2QTOA 1PNMA 3RFRA 1GL2A 4KHPB 2HR3A 1L0LD 2FL4A 1CP9A 5BXZA 2EIJB 1EZVD 3L71J 5LGUA 1X22A 1LT9A 3AG1B 1PP9H 5HFMA 1KILD 4TV9A 4DR2O 4B3TB 3AG4B 4MTOA 2CAZC 3QTCA 3TSIA 2X0LA 4DUYB 4TSFG 1T5EA 1L4AC 1V54B 1NTZK 1FDOA 1KB9H 2ZXXA 5L3GA 1HTLC 3MIWA 5APSA 1PL0A 2LO1A 3K3WA 1GM8A 1P49A 2Q3EA 2HLDG 3GW6A 3RL0B 3GWKC 1NAFA 2WSCJ 2RCVA 4YHHO 2Q5ZA 5LBQA 4JYBA 4UCVA 3N2KA 2GBOA 1NTKJ 3TYYA 2PZSA 2Z5IA 4GKGA 2DMXA 3VOUA 1SQPJ 3MHSC 1PGJA 3LSUA 2HHHB 2LGQA 2QKSA 4IHJB 1T8ZA 3FFQA 1YBKA 1X79B 2OTLP 1WPBA 1K33A 4PA9A 3BCCG 1RF1C 4DR5O 2A45H 3AG3C 1QQCA 1G1JA 3TNUA 2BCCG 1LTBC 2HODB 2KG7B 2FYNB 5KUMA 3SJQC 1GL2D 5EZYB 3IR9A 5AVQB 1OZ0A 1GMJA 3BRVB 4LR3A 1L0ND 2H8PD 5AVTB 5CBHA 3O6QB 1AA0A 4TUYB 1YJ9V 2IH3C 1LWUA 1MV8A 3BHPA 5KLVJ 3ZN0A 1OVUA 1S5HC 1KZUB 1JA8A 2FB5A 5JCOC 2IW5A 2K37A 3K04A 3T4DA 4RQEA 4CH4A 1K8AQ 4GX0A 5CCHC 2QRXA 1JNMA 1ZAUA 4WCEV 2PRRA 2EILB 1VQOV 5B1BC 3D3QA 4JZGA 2W83C 3IN6A 4NPFX 2OCCB 1FJPA 2GTAA 4PI0A 1S3JA 1G2CB 3LNNA 3L74J 1CSBA 1R6NA 1K5SA 3PJSK 4OXSA 3AEFC 4IHJA 2I1KA 3AG7A 5D5QA 3WMM0 1KQFB 1N73B 2WLMA 1RSOB 1Y74B 1FFTB 4LNUB 5K1PA 1YJ9P 2R32A 2KG7A 3FX0A 2QJKC 1PZQA 2V1DA 3WG7B 5LP6C 2X7RB 3ZHRA 4ZHQA 1Z56A 1JFFB 1FDIA 3O6QA 4TUYA 1WB8A 2X6CA 1MUUA 2KB7P 1NTZE 4PA7A 1SQBJ 3CHXA 2XDJA 3E8BA 3A7OA 3VN0A 2ETNA 3A0HE 1Z5VA 2EIKB 1M4UA 3Q4HB 4LFAO 1GN2A 2P22C 5C39A 4ZI7B 1J1EC 1AJQA 1ZV8A 1K4CC 3AG2B 3RL0D 1CI6A 4CC6A 4ZOLB 2N05A 1G2CA 3D70A 1QL1A 1FZFA 2RN9A 3S3WA 3CPWO 2FTKA 4QPKA 1KFNA 2ZD9A 3W7SA 4FVMA 3RK3B 1VF6A 4R4LA 1OX3A 4MVMA 2JDIG 1NTZH 3GB7C 2ZYAA 3JYCA 1S0VA 1L2PA 4DCKA 1K4DC 3APOA 1T3JA 2Z5HA 2CDYA 1N73A 1RSOA 1Y74A 2LFSA 4LNUA 2QTSA 3A0HH 2XAJA 2ZVNB 5BY1A 1VMGA 3K9AA 5JVDB 1M7LA 2JVDA 2HFED 3JCUE 4OPAA 1COWG 2H43A 1JFFA 1J1DB 1R6KA 1TUEB 3FKSG 1NKNA 3AEGC 5L3DA 1KYOI 2A06D 1GKFA 4JI8O 1K73Q 2JS3A 3HB3B 3L73E 4H44B 4LP8A 2VQFB 3L70G 1AR4A 3H1HD 3CXHE 4WFBV 5C93A 4PDMA 1YI2V 3Q4HA 5LGTA 1AJYA 1F4MA 2P58A 2K9JB 4ABMA 3UO3A 4YJ3B 1BSMA 3JCUZ 3JC22 1VQ5P 4DUZB 2OYOA 4ZI7A 4MW8A 3ZMUA 2FMLA 1M5IA 2WVRA 2AXCA 1YEWA 4ZOLA 1DEBA 3K0GA 3L9DA 4IYHA 2R9IA 3JCUH 5L3CA 3B71A 1WP7A 4O2AA 1WP8A 2EIMC 3M06A 1VQMP 4LF9O 2M0BA 4O2BB 3FB5C 5AVXB 1YDXA 1AQ5A 3L73H 2JIZG 1IZ3A 3AE5C 3CXHH 1M1JC 3OJAB 4Y28J 3CC7P 1AP6A 1BZKA 1P84E 1XOUA 2QJ1A 4ZBMA 1FAVA 5JVDA 1EDKA 5BZBA 1VF5C 1VQ6V 3HUSC 3FGAD 2NLJC 2E5YA 3MZWB 2KNCB 1TU3F 1N33O 1NI8A 4NTWA 3H1KD 2FY8A 3HD7C 2WMMA 3CL3D 2QEXV 4B3SO 1LJ2A 1OIPA 4CH6A 1OVRA 1BE3E 1NU1G 2K9JA 1S1CX 2ZR2A 1ZX3A 4YJ3A 3CCUV 4O4HA 3CWBG 1BCCG 3JD3A 4Z1MG 3STLC 3RVYA 2NPSC 1P84H 2FYUG 2YIUB 4GKJB 2ARHA 1RF0C 3UM7A 2LFRA 1WRGA 2OYIB 2Q7EA 2HVJC 4JTAB 4FMTA 4O2BA 1HNXO 1BQZA 1BHBA 4GUNA 4MT8A 3SDLA 3LDDA 2ZT9B 3RBZA 2DN9A 4L73A 4OGQB 2RDCA 2ATKC 1BHAA 1BE3H 4OWFA 4DV3B 4RESB 4ZMDA 5JQGB 1ZLZA 1IFPA 1K8AW 3ABMC 2KNCA 5BR8B 4PD4E 4A5UB 3ABVC 2OT5A 4NPEA 4P9OA 2WA4A 1SQVG 4PI2A 1KILC 4DV6B 3U1CA 2YIAA 3OTOO 3B8EB 2NZ2A 1SQXG 3LNMB 2VWJA 5IT9N 4H44D 4AQYB 2UUBO 2J59M 4LWSA 5B1OA 5KHIA 1I94B 2UXBB 2IBZG 2KS1B 1KP2A 5KX5B 1LUWA 2Q8VA 3H1JE 4OX9B 2QWNB 2ZQMA 2XNXA 2ZDIA 2C0XA 4FM1A 1SQQJ 2UUCO 4BAYA 4GYCB 2OYIA 3ABLC 2C9NY 1R5SA 4MVUA 3ZIAG 2P06A 5IY5C 5LHHA 4JI0B 1PP9G 1XI1A 2IDBA 1H8AA 4JAVA 3L75J 4MVOA 1F51A 2DJVA 1MABG 3LW5H 1G6UA 3E8HA 1X59A 4X62O 1GW4A 3B5NB 1SLQA 3L72E 1HWTC 2UWJE 1M57B 3H1JH 2JWAA 5KAIE 3L74G 4J42A 4I9WA 2ZNIA 1P7GA 2R44A 5BU5A 3BCCD 1U7JA 1LT9C 1KP3A 4DR2B 3LIDA 3CD6P 2BCCD 3CCRP 3OT7A 1BGYJ 2JGUA 4LF6O 2HG5C 4H33A 1IBKO 1LT1A 2KS1A 3PTZA 4UVBA 1N4CA 5APQA 5GTIE 3BCCH 4TV8B 5KX5A 2N74A 2KUBA 2P10A 1N34O 5KAIZ 1Y6XA 1ZL8B 2OYQA 2PYLA 3EWKA 2VWKA 3RVZA 2UU9O 1FDMA 5BMVB 4YHHB 2A45G 5IJ9A 5LXTB 3L72H 5KKZB 1BQ0A 2QM7A 5J2TA 4UFZA 1HDJA 4TLFA 2WSEJ 1T2KC 2LR2A 5GTIZ 1H88A 3AE7C 3ZHUA 2KXPB 3O65A 1G4YB 4D7SA 4Q20A 2ZT9D 1YTFB 3FB7C 2A79B 3K5NA 4DR5B 1LTAC 4OGQD 3SWYA 4WWIA 3B5NA 2W0XA 1LR1A 5GTIH 4PV1B 2E75B 2WSFJ 2KLVA 3JALB 3GLMA 2B1GA 1HF9A 2WAMA 1JOCA 3SSUA 1LUVA 2JEUA 2KB1A 2WZ7A 2YKQA 1Q8IA 3MHVA 2Q0OC 4DV5B 2OYHB 3DGEA 1WPXA 3QH9A 4ASUG 1VQ9P 2KK7A 2WWWA 2OTJV 3T1YO 2ZINA 2JP3A 3PH0A 4A7PA 1DD3A 1PL5A 1VQ4V 2AEMA 4L75A 2IJJA 4TV8A 1MA1A 2ADQB 2KSDA 1YITV 4FFKA 1ZL8A 5AW9B 1W2EA 1OCOB 4GODA 1VQKV 5JJEB 3RL0C 5BMVA 3SGIA 1VQ8V 4MSWC 5LXTA 4FM0A 4P9PA 4XE5B 3H1LJ 3PP5A 4ICGA 1OCRB 3RK2B 1SF9A 2RKLA 1NQTA 2Y0DA 3H25A 2AHYA 2N9BA 4BWNA 1NVOA 1KTMA 3CRAA 1J5EO 4DT0A 2Q7GA 4DV7O 1DTOA 2Z4EA 3JALA 3P8CD 1MZEA 3E7KA 2HFEC 4TOIA 1ZRTD 3B5ND 2P5OA 1VQ4P 2FYNC 2PGDA 2O1JA 4JI4O 3H6PA 1M57D 1KC8Q 1YITP 2JEXA 3QG5A 5B3SC 1QR9A 1NTKK 5CMZA 1H2GA 1SQPK 1PL4A 2F4VB 1JEKA 2QJPB 1YF2A 1VDFA 1VQKP 4KP4A 5J9PC 5LMUB 3NMDA 1VQ8P 2QM8A 3DXRB 4DK1A 4LFAB 3HTKB 3V2PA 2P90A 2ZAEB 1FD9A 2XHBA 4ZKUA 2GUZB 2Q68A 4X1IB 1B3QA 4CH5A 1NTZG 2FKWB 2V7QJ 3IFMA 2YEVB 3OAAG 2XAQA 4FLXA 4UCTA 2E76C 1D7MA 1S72P 2QKAA 4O4IB 3HKBB 4QNHB 1Y8AA 3L70D 2E43A 1JO5A 2O1KA 4JI5O 1EBOA 2W6JG 4DO2A 1URQB 5AVWB 1XDCA 1NO4A 3D36C 5KJ7A 3ETEA 1Q7YQ 2KQXA 3A8TA 4IYIA 4BR6A 2QA4V 5KLVK 4Z2WA 3WU2E 4X65B 1ZUQA 1KBHA 4IFDK 1S9KE 2R9AA 1YTFD 4GOFA 4CBCA 3ZBHA 2QGNA 4B08A 4JV5O 2KYVA 2N1TC 3CX5I 2WTYA 4MW3A 5EIBD 2R3CA 4W4KA 4PV1D 1F23A 3WG7C 3W7WA 5DJUB 2ZNJA 4LC1A 1LTIC 4JI8B 5LOVB 1H2SB 4WFEA 1YJNP 3WU2Z 4H13D 4GKKB 1OHHG 3B8NA 3DXRA 1U57A 1RE3C 5CA3A 2QM4A 2Q67A 3G6EV 2EIKC 3F7VC 4FZ0A 5IYZB 4BXLA 2CPSA 3JAKB 4BW5A 2XTAA 3L73G 3SPJA 3A2FA 3WU2H 2XT9A 2F93B 2GDSA 4WVZA 3L71E 1FC2C 1NTMJ 2QSAA 3HKBA 4O4IA 5FPRA 2QA4P 2KOGA 1FXHA 3AG2C 4KFMA 1H89A 3CP1A 3KCYA 1URQA 2B89A 1BT8A 1NU1D 3T97B 3RYHB 1P4RA 3MTUE 3HR0A 1NZ6A 1VQ7V 1GK4A 4R50A 2JWDA 3CWBD 3T1CA 3RK2D 4LF9B 1BCCD 5KJ7D 1SQBK 2FFDB 5AW7B 3RK3C 1N7SC 2FYUD 3JD2A 5AVZB 2HP8A 2L91A 3ZMSA 1YYCA 3TGUJ 4CPGA 3ZS8C 1OW6A 1NTKE 1H0TB 2WSSH 1MSWD 2X6BA 2DOSA 5FPOA 3CXHF 1SQPE 3L71H 3G4SV 1PD3A 4IOIH 4RO0A 1N33B 3G6EP 1THZA 4X66O 3H1IJ 5BR8O 5LOVA 3K06A 1LTGC 5DN6G 2NR5A 5B5EE 5EFWB 2R9RB 3B4SA 4H44C 2SPZA 2IJIA 5IYZA 2O01J 5LL6Y 5FLXN 3JAKA 5IWAO 3ZHSA 1SQVD 1EFRG 3SYQA 1XMQB 2WSCH 3B2EE 5TISE 1BE3G 1UJWB 1EQ7A 1SQXD 1YXBA 1EZVI 1NVPD 1WAZA 2R5BA 1U97A 1NTKH 3T97A 4WFAV 1K3EA 3RYHA 5B5EZ 2IBZD 1VARA 5KLVE 1SQPH 1URQD 5IE9A 3RT3C 4UCUA 2FFDA 1P84F 1MKMA 3C1LA 1HNXB 4UUJC 2R72A 1T3UA 1VIBA 2R3SA 3G4SP 1OWAA 3S1KA 3UKMA 4EB6B 5B5EH 5TISZ 3W7UA 4EKWA 4YPCA 4FJCC 2GUVA 1JJOA 4DJGA 1H0TA 5LMNO 2Y69B 4E4EA 2WLKA 3CPWU 1PP9D 3TNUB 5TISH 1FJGO 2K88A 3B5NC 3TCUA 2C2AA 3ZEDA 4X64O 2X6AA 3E22B 3ABUA 4EFEA 1XQ8A 1GM7A 2PGGA 2OTLV 2BEQD 3OTOB 4GIFA 3UIAA 5KLVH 2CH7A 5IYDO 1KB9D 2UUBB 2QKCA 3C3TA 2QE7H 3L74D 5CA1B 1LWUB 2XU6A 3O8ZA 4HKZH 5JWPA 3OR6C 4YTPC 3P3PA 2F43G 1TUBB 3ZMVA 2YIUC 1JY3N 2ZDIC 3L74H 1SQBE 1E79G 4JF7A 2UUCB 2ZE8A 3E35A 4NPDA 4W7ZA 1N8RQ 3H1JG 2OYIC 4LF7O 1KC8W 1EXJA 1RE4A 1DX7A 3U0ZA 2JGDB 4JI7O 3KHUA 2MW2B 4EB6A 3Q5RA 4PD4F 3AE4C 4MN4C 2Q9IA 3A2AA 4OGQC 4JI3O 5CA0B 3CMAP 1N32O 1M8OB 2QWRB 4U3JB 4X62B 1KN7A 3RYCA 2A7WA 1G1XB 4GX1A 5CBFA 1AVOA 4TWKA 3A5TA 1VF7A 3UCSC 4DRXA 5L3EA 2DWDC 4D6TJ 3E22A 3NTNA 2FXPA 4YXWH 1ZN5A 2N9YB 3L72G 1SQBH 2WLIB 1HNZO 4ZHQB 4P2ZA 3CCMV 1SC5B 3X2QB 4DV5O 2Q6QA 1Q7YW 3CRMA 4KL1A 4BW9A 4LF6B 3UO2A 3SPGA 1JCDA 1IBKB 5CA1A 4UCOA 3BPZA 3AEDC 2L35A 1PKXA 3V5BA 3MD0A 3NFQA 4I0XB 1SKVA 1TUBA 1N34B 2AEFA 1IVSA 1XUQA 4TQFA 2GM4A 1XNQO 2UU9B 1GN6A 4XDKA 4C46A 3E89A 2LJ2A 1MFZA 1NBMG 5BVZA 1CI6B 2XAFA 2YXHA 2G8YA 2EJRA 2P7JA 2JGDA 1QEXA 5LYJB 4JI1O 1SS1A 1SZTA 5CA0A 4U3FJ 2PF4E 3FAVB 4F4LA 1CEZA 4U3JA 1FPOA 1L0LJ 3VOPA 3CCMP 2IJKA 1JB0J 1JJ2U 1FXVA 1W5CE 2JJ2G 2Y9YA 1DGSA 1WNSA 4FPPA 1SQQK 1Y76A 3SYCA 4J10A 2G3AA 5AW2B 2WT7B 2D2CB 2WLIA 1S4XA 5L3FA 2IU0A 3T1YB 3FXEA 4LGDE 2BTQB 2D3OW 1OZHA 2F4VO 2BASA 5LMUO 4IIJB 5DECA 1RHZB 4I0XA 1UIIA 3W7XA 4LH7A 1IURA 2QVAA 1K04A 1Q82Q 4U7JA 1GM9A 4DV1O 2IZ0A 3OFNG 5KKZC 3MUDA 4TT3H 1WN7A 2WITA 3IC9A 1D5NA 4GZRB 1FZCB 3ABKB 3RBXA 1NJIQ 1NGMB 1NTZD 2C0WA 4WF9V 3BRTB 5B1AB 1YSCA 3RYIB 5LYJA 1VQ5V 4O2AB 2P67A 5APYA 1RP3B 1SS3A 2EULA 3SPHA 1J5EB 1V55B 3FAVA 3QNEA 1SRYA 4IL6E 4DV7B 4X65O 1XL4A 2E75C 4PV1C 2M8RA 5KMGB 1H8EG 4J7JA 2AZ0A 1GO3F 1L0NJ 3OAKA 5H6RA 2E42A 1KMIZ 3HKDA 1FKAO 5KHHA 1VQMV 4JI4B 4DR7O 2W6JH 3FB8C 1SERA 1QCEA 3CSXA 2EZPA 5E1AC 1FYJA 1A32A 2WT7A 1FZAA 2OYHC 2AEJA 4HZ3A 3CC7V 5APTA 2BTQA 1JY2P 2I8DA 2Q6AA 4IL6Z 1Q86Q 3JATB 2A3QA 3IAOA 4IIJA 4GKKO 3DC5A 4XBFA 1FZBA 2VRSA 4LCUC 2ADPA 4N23A 4NR1A 4IL6H 1OCOC 2PY5A 4O4HB 3VMZA 1Q6HA 5GW7A 4JI5B 2LXBA 3LDEA 3OUSA 1FZCA 5IJ0A 1SP4A 2QJYC 3M9QA 3RK2C 3L73D 4ZIBA 3F89A 4QIWF 2NN4A 1R6TA 3M99B 3RYIA 3CXHD 1RPOA 2W0FC 2QSIA 5LA6B 3EQ2A 1SQQE 1HW7A 4JV5B 2QWPB 1YJWV 2KLUA 1BDDA 3JCZA 5KMGA 3GHGB 4P30A 5JJNB 1KYOE 5CJ0A 1NH2D 2JEEA 3FD9A 4L87A 1JY2O 3BRCA 2KZJA 1NKZB 3NR7A 1E1RG 3WUVA 1U7MA 4JGSA 2YO3A 3P32A 3L75E 2H3OA 1N8RW 2D2CD 1ENVA 4YXDC 3CMEV 1IBMO 3C90A 3J81N 3JATA 1GU5A 3FWLA 1USEA 2M3BA 4RUEA 1P84D 3V4QA 1FZGA 3N7NA 1DF4A 3SYPA 4LWSB 3JASB 1EDIA 2CTPA 1SQQH 4I7ZB 3CCQV 4N6JA 1IK9A 5KAFE 1H2MA 4KHXA 1XMQO 1XILA 1SVFA 1AI4A 4QE9A 2WSSG 1KYOH 4FLWA 1BGYE 4JI2O 1R3LC 3EXAA 3T1HB 3L71G 3SJAC 1YJWP 3ZDMA 1K05A 3CC2V 4I5SA 3K03A 3L75H 1BE3D 3IAYA 1M56C 1FBMA 4C7NB 1JVMA 5LA6A 3JARA 3MP7B 5AW4B 3V4WA 5KAFZ 4PJ0E 2ZXWB 1GK9A 3VMAA 4DOJA 3HPLC 3GHGA 1R1BA 3RK3E 2B9ZA 3TDKA 3CMEP 4JYCA 1OXZA 3WUUA 4FLVA 2VRZA 3S4RA 3L37A 4MTGA 1YQ4C 3B77A 4X66B 5KAFH 4JYYA 4BIOA 2H7HA 3AK1A 3H1HJ 3QF7A 1NTKG 5H5NA 2IU3A 1BGYH 2ZIOA 4UVCA 2WPDG 1DK1A 1SQPG 3CCQP 3ETQA 1N0NA 4PJ0Z 1KKCA 2HJFC 1IXBA 3OM3B 3TJTA 1JY3O 5APWA 1U96A 3JSLA 3IGAC 5IWAB 2B1IA 5AW8B 3USSA 4NXNO 2FXOA 3JASA 4JQ0D 3CC2P 1YZBA 4PJ0H 3CX5F 4FK5C 4PD4D 2H89C 4OH8B 2R5DA 3CD6V 1GTWA 2BTOA 2MK3A 2WSEH 3CCRV 3KG2A 1F7YA 4RO2A 3KPEA 5IJ9B 2YMYA 4I9QA 5GTHE 5J2TB 4PD4H 3CCEP 4IFMA 3R65A 1NR7A 3RGUA 3ASNB 4C7NA 4HAMA 1QVFO 5KLVG 1JPXA 2N04A 3ZCCA 4AHCA 4B3MO 2WSFH 2B87B 1N0JA 5CN0A 1KUQA 3H1LE 4ASVA 3H1JD 2QE7G 1OCZB 5LMNB 1XTCC 1NTMK 1DIPA 3VTPC 1X0TA 1YHQV 4CC5A 1UFIA 4B86A 4X88A 3S3XA 3TXQA 3H1KJ 1FJGB 2LQTA 5GTHZ 1E79H 4X64B 4QGPA 1GL2C 3HE5B 3K5OA 4UB6E 1GRJA 4WY4B 2YXRB 1P7BA 2H8PC 1OFCX 3Q2YA 5CCGD 1IC2A 5GONB 1NJIW 1JR9A 2DQ0A 5LHGA 5GTHH 3AK3A 1AB3A 3LUTB 2FBWC 4W80A 3MDSA 1AV1A 3L72D 3ASOB 3J7AU 1RF1A 1ZW0A 1XL6A 3H1LH 4UVAA 4UB6Z 3UQ8A 1VQ9V 2KI7B 4KT0J 2BOBC 1AILA 2MJZA 4DW0A 2G38A 4LF7B 4DV2O 4XA4A 4YXWG 3OW2O 5KAIH 1YHQP 4JI7B 2MKVA 4IL6X 1SQBG 2W6AA 4DW1A 1PV3A 1K73W 4X1YB 4JI3B 3ZMZA 1AROP 1Q86W 2B87A 1I5XA 1Z2GA 2HVKC 1N32B 3W67A 5JCOA 1FS0E 5H2FE 1ZR4A 3BVHA 1Q3EA 4H37A 1PFIA 1IX9A 4OVNF 2C9LY 2Y69C 1L4AD 1PPJE 1Y9BA 5CCHA 3Q5PA 2Q4PA 3U59A 3SWFA 3HE5A 3IF4A 2GV9A 4Y99B 1TGOA 1GD2E 2LKMA 4L74A 4UV8A 2LP7A 4WY4A 1QX8A 2KKWA 3O9OA 3VQXA 1HNZB 2HYNA 5CJ4A 2WQYC 4L76A 5GONA 2EIJC 1NOHA 3AG1C 4H13B 2DYSB 2Q0AA 5AW0B 5H2FZ 2O01N 1QHTA 1VQLV 2KP8A 2XNDH 2V7QH 3AG4C 4AI8A 3D71A 3VP8A 1LWUC 4Q6GA 2CE4A 4GT1A 1V54C 4YJ2A 1XNQB 2IX7C 2CGOA 5H2FH 4WB4A 3WB0A 1SFCB 3SPIA 2K9YA 1FU1A 1PPJH 3FYEB 3T2MA 3E86A 5LP6A 1K92A 2H88C 2LW7A 1QU7A 2JR8A 4I55B 2QDOA 3APQA 2ZCEA 2NRGA 4JI1B 4E2LA 1US6A 4X1YA 1S72V 1NTME 4MTXA 1QVGO 2GSMB 1YTZT 1TA8A 1KV4A 2BSKB 2OWOA 5H6QA 3ABTA 3CCVV 1IDSA 1PGQA 1SESA 3OA7A 1VQLP 3JAWB 5KLIB 1JCHA 2YI8A 5CCHD 4DR6O 1LTJB 1F4NA 1GN4A 2BCCJ 4EI2A 2DW4A 2B9BA 3VYIA 1Q6IA 4TT3G 1EN5A 4WY4D 2V4HA 3X2QC 3OMAB 4LFBO 3TGUE 4PELA 2P2UA 4BIUA 1H2KA 4H0LB 4IT5A 3HRNA 2WLLB 4I50B 2W6IG 3OMNB 1NTMH 1IBLO 4F6EA 4HB1A 3H1IE 2YSUB 2ZE5A 1SFCA 1YJNV 2YIBA 4DV1B 1NVPB 3ZRVA 2FYZA 5AW3B 2EILC 4FLTA 4FLYA 5DJTB 5IYCO 1JMMA 3BASA 2OCCC 3V2QA 4I55A 3G67A 4I2LC 1LTTC 3NXSA 5TJHA 3D6YA 3CCVP 3SYAA 1GTOA 3TGUH 2UUAO 5CBNA 4X1KA 1VF6C 2BSKA 4BIZA 3AEBC 2ZM6B 4FLZA 5FNVB 2FKXA 1N73C 1PNLA 1EN4A 3H9VA 4DR7B 3H1IH 3JAWA 2NPSB 3QWOC 3VQYA 1LTJA 3G9RA 3AEIA 3G6BA 4HNAA 1AP5A 2M5AB 2J5UA 1EC5A 1QL2A 3ETGA 3ZRSA 3JD0A 1SA0B 5B66E 1JMKC 2O01H 1IFJA 4NB5A 4N78E 4CZZA 2XV5A 2YMKA 3OTFA 5EBWC 2OCHA 1T6AA 2WLLA 3K57A 1S9KD 4I50A 1E5WA 3FB6C 4K0KO 1L0LK 2ZXEB 1GZLA 3V2RA 5EBLC 1XREA 3F5WC 3MAQA 3BY6A 1R73A 3CE2A 3FX7A 3RW0A 3ZHVA 1SFCD 2ZE7A 2YIBD 4JTDB 3B09A 1K97A 5B66Z 4DR3B 2QIWA 1RM1B 1FZCC 3ABKC 2GHYA 4NTYA 5CBGA 5M1BA 2ODMA 4DV4O 1L8DA 3LDCA
chains in the Genus database with same CATH topology
2E74B 4H44C 1OMIA 2H88C 3AEDC 2ZT9C 1VF5C 1KQFB 1ZP0C 1VL2A 2O01J 3FGAD 3GF3A 3AE6C 1TU3F 2QJKC 4I7ZC 2QJYC 3GF7A 1Q90D 2V7QJ 4H13C 1FDIA 3O6QA 2E75D 2G8YA 2E76C 2QSIA 2P10A 1ZOYC 1PIXA 1DIPA 1S1CX 3EWKA 5L8RJ 1MKMA 3LW5J 1IK7A 3SFEC 1R8EA 2WPVB 3Q2YA 1JB0J 2WSEJ 4H0LD 3Q3DA 1OW8A 3Q5SA 3RL0g 1FDOA 2E74C 4H0LB 1EXIA 2G3AA 3AE7C 2BEZF 2D2CD 1RQUA 3D70A 2WSCJ 2FBWC 2D2CB 4YXDC 2ZT9D 1VF5D 4OGQD 4PV1D 3AE1C 2ZT9B 4OGQB 4PV1B 2E75B 2BEQD 2WSFJ 4R4LA 3AE9C 3GLMA 1HF9A 4KT0J 3SFDC 1ZRTE 4I7ZB 3AE3C 4H13D 3D6YA 5KLIC 1U57A 2E76D 3ABVC 1K04A 4YTPC 2MKVA 4GDOA 2E76B 4IL6X 2JP3A 4U7JA 5KKZC 1DD3A 1PL5A 1K05A 3AEBC 4TT3H 1PV3A 3AEAC 4Z1MH 1OW7A 2NZ2A 2YIUC 3AEGC 2QJPC 1NGMB 4H44D 1GMJA 3AE2C 4H0LC 1WMKA 4H44B 1DD4A 1Y9BA 3AE8C 3G9RA 1EXJA 3GMAA 3Q5PA 1VF5B 3T97B 1AJYA 2J5UA 3Q1MA 3RK3E 3D6ZA 3Q5RA 3R4YA 3AE4C 1UIXA 1HJ0A 1YQ4C 2E75C 4OGQC 4PV1C 2YMKA 2WQYC 1KILE 3H25A 1KMIZ 4H13B 2OQQA 3AEEC 1YQ3C 1NYHA 1S5LX 3AECC 1KORA 1KTMA 3D71A 1OW6A 3B71A 2JO1A 2IDBA 3IN6A 4R4MA 1ZMEC 2FXPA 1RQVA 4RKUJ 4XFJA 1KQGB 3S9OA 3IAOA 2QIWA 2FYNC 2K9YA 5M1BA 3AE5C 2E74D 3AEFC 4Y28J 2H89C 2D2CC 3C8VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E74 B;  1ZRT E;  4I7Z B;  2WPV B;  5KLI C;  2O01 J;  1JB0 J;  2WSE J;  4H13 B;  4IL6 X;  2E76 B;  1S5L X;  4H0L B;  2QJK C;  2QJY C;  5KKZ C;  1Q90 D;  2YIU C;  2QJP C;  2WSC J;  2D2C B;  2QSI A;  4RKU J;  4H44 B;  2ZT9 B;  4OGQ B;  4PV1 B;  2E75 B;  2WSF J;  1VF5 B;  2FYN C;  2QIW A;  2K9Y A;  5L8R J;  3LW5 J;  4Y28 J;  4KT0 J;  3C8V A; 
#chains in the Genus database with same CATH topology
 5B1A C;  2E74 B;  3T1H O;  3HD7 A;  4QMA A;  3CX5 E;  3F5H A;  2Q9L A;  5CB4 B;  1W0K G;  1FZE A;  5B66 H;  3EFG A;  1V55 C;  5APV A;  1SQF A;  3VMX A;  3ITK A;  5FNV A;  3L71 D;  2OAR A;  1NAY A;  1MSD A;  1AI7 A;  3G3Z A;  1ZTE A;  2A0L A;  3VBB A;  2IBZ I;  2RH0 A;  2YXL A;  4LFC O;  2H94 A;  5H9C A;  2Q1K A;  2NPS A;  4JPZ B;  1SQQ G;  3DTU B;  4G2K A;  4OPH A;  4MVR A;  2M5A A;  2IPP A;  3GG2 A;  4RJT A;  3IC7 A;  1RF0 A;  1J1D C;  1SA0 A;  1Y47 A;  4YIP A;  3JSV C;  3M8A A;  1IBM B;  1BSH A;  3IFX A;  3OD4 A;  5EK0 A;  1GW3 A;  5CHX A;  1PM9 A;  3OE7 G;  3A3Y B;  2CH7 B;  3L75 G;  2Q5U A;  3CX5 H;  2PI5 A;  4H0L D;  1N86 A;  3L70 J;  1NTK D;  4D6T E;  2ITD C;  2AZ2 A;  1HWY A;  2ITC C;  1L0N K;  1SQP D;  3G80 A;  3P30 A;  3STZ C;  4DR4 O;  1KU9 A;  2BE3 A;  1TAE A;  4WFG A;  3CRC A;  2QG4 A;  3ZN1 A;  4JI2 B;  1VF5 D;  2P4K A;  1KB9 I;  1PNK A;  1K5Q A;  1M9N A;  4G27 B;  3JD4 A;  4GX5 A;  4X9Q A;  1KYO F;  1BGY G;  3PHL A;  5CB4 A;  2Y4U A;  2M6Y A;  1AVY A;  3HD7 D;  4C7R A;  2HEP A;  1RFY A;  2B5U A;  1KQS O;  3JD1 A;  2EBO A;  2WLJ A;  4J7K A;  3RYF B;  4ZNC A;  1W0J G;  2YI9 A;  1Q81 Q;  1IXM A;  3GHG C;  4D6T H;  4O9B A;  3RYC B;  1OW7 A;  3KZI E;  5KLV D;  2YIC A;  5CBO A;  2NPS D;  3D3I A;  3AE2 C;  4DRX B;  4EEQ A;  1DD4 A;  4RQF A;  2A45 I;  3M9H A;  4U3F E;  1W2B O;  4HH2 A;  3CMA V;  1K34 A;  1L0L E;  1LP1 A;  2GUS A;  3CCJ V;  3BAA A;  2K1A A;  3M7M X;  1HNW O;  1EZV E;  2KSE A;  2DW3 A;  4NXN B;  3M0A A;  1KD1 Q;  4BWA A;  3K0D A;  1KIL E;  1AI5 A;  3KZI Z;  2UXN A;  3CS5 A;  1NU1 J;  1S5L X;  1VQP P;  2XAH A;  4Z1V A;  4FM2 A;  2ITA A;  3CWB J;  1BCC J;  4J41 A;  1S77 D;  2YKP A;  2XAS A;  1TVK B;  2UXD O;  4CS4 A;  4WFF A;  1WA8 B;  1RQV A;  3KZI H;  3UT5 B;  2FYU J;  1HBW A;  2OTK E;  1QBZ A;  1KQG B;  2IZ1 A;  3S9O A;  5AVR B;  1W59 A;  5KHJ A;  2ZYG A;  4UB8 E;  2Y9Z A;  4U3F H;  2E74 D;  1PGO A;  4FZ1 A;  3HE4 B;  4LF8 O;  3C8V A;  1L0L H;  4F6R B;  2JK5 C;  4B3M B;  1JM0 A;  2P6J A;  3RYF A;  1S76 D;  1LGH B;  2ZT9 C;  2ZXW C;  4KXR A;  2WA3 A;  1EZV H;  2DYR B;  4FFB A;  2CK3 H;  3AE6 C;  2LXC B;  3ZRW A;  1I7F A;  1SQB D;  4QE7 A;  3R66 A;  3CCJ P;  4DZO A;  3H1L G;  1JX9 A;  1YCI A;  5EYP B;  2RJZ A;  4UB8 Z;  1Y76 B;  1PGP A;  3RWR D;  3CXC U;  4HBN A;  2RNB A;  3ZRX A;  3WB2 A;  1SQV J;  2IFN A;  5A9G A;  1L0N E;  4UB8 H;  3SYO A;  3SFE C;  5EBM C;  1SQX J;  1N7L A;  2ZVO B;  2F1M A;  1LNQ A;  1FOS F;  1B04 A;  4JZ2 A;  3E8F A;  3HKC B;  1A02 J;  1BL8 A;  1TVK A;  2BEZ F;  1XTG B;  1HGV A;  1WA8 A;  4I1L A;  4FIP C;  3P3N A;  3UT5 A;  4DV2 B;  5B3S B;  5DED A;  4DV0 O;  3HE4 A;  2XOK G;  3ASN C;  4F6R A;  2XZR A;  1L1F A;  4NXM O;  3L35 A;  2JJ1 G;  2W8Z A;  2EIN B;  2RN0 A;  2XND G;  2V7Q G;  1PP9 J;  3CRR A;  1L0N H;  2HG5 D;  4IGG A;  1OCZ C;  5AW6 B;  1RY3 A;  1M90 Q;  5LHI A;  1MFT A;  4RUF A;  1O9H A;  3DC6 A;  2XAG A;  2E76 B;  4J9Y B;  1NH2 B;  4LF5 O;  5EYP A;  4JYA O;  2CGN A;  1IZN B;  4JBZ A;  1JQ0 A;  1FS0 G;  1Z5W A;  4WBN B;  1X9V A;  1M57 C;  2YXY A;  3PN1 A;  3HKD B;  2WPQ A;  4WY4 C;  3OGI B;  4LH6 A;  1PPJ G;  1I0H A;  4DR1 O;  1GU4 A;  1E1Q G;  3AE8 C;  1T2K D;  4EIJ A;  3P8M C;  4XDJ A;  3K5B A;  1YTZ I;  4PA3 A;  2I1J A;  4QJF B;  2ZFC A;  1UPG A;  2OIG A;  1RPR A;  3ASO C;  4NKG B;  2IYP A;  4JI6 O;  1GH6 A;  2XUM A;  3U11 A;  1FAF A;  2N1T B;  3K58 A;  4GLX A;  3HKC A;  2L5G B;  2HOD A;  3AEC C;  2OGU A;  2UXC O;  2QWO B;  5EZY A;  4EFB A;  1XMO O;  2W27 A;  2IM9 A;  2ZYD A;  5AW1 B;  5IJ0 B;  2LGW A;  4XDL A;  1KEC A;  4RKU J;  2B88 A;  4AUW A;  1VQO P;  2ZR3 A;  2HPC B;  3K59 A;  2GA1 A;  4L8J A;  4FLU A;  3H01 A;  1NTM G;  1Q5O A;  1MG1 A;  2E3C A;  3W7T A;  5EIB C;  3ZHT A;  2ZM6 O;  1HUC A;  1HP8 A;  2Q7H A;  4DR6 B;  4BRY B;  4WBN A;  4Y99 C;  1VQN V;  3CXH I;  3LSQ A;  4W4L A;  2XKM A;  1QVF U;  3CYO A;  5HFL A;  1FXK B;  2Z0A A;  3D36 A;  4LFB B;  2PP6 A;  1EDJ A;  2YO2 A;  1ROP A;  4H13 C;  3A0H Z;  3I5D A;  2DYS C;  3K79 A;  4B7K A;  3D8C A;  4HJG H;  1N7S B;  3M9B A;  1WJZ A;  1PIX A;  2A06 E;  1IBL B;  1QGK B;  1N36 O;  3SPC A;  1IK7 A;  3TGU G;  5IDJ A;  4WFH A;  4PDV A;  2VQE O;  3H1H E;  3R2P A;  4AIL C;  1Q81 W;  2N1T A;  1SFC C;  1HGZ A;  1MOF A;  2GTS A;  4B3R O;  2DWE C;  2RMK B;  1Q43 A;  2DE0 X;  4R7C A;  5APU A;  3H1I G;  3CRQ A;  3F5T A;  3WB1 A;  2QR4 A;  4LF4 B;  4J11 A;  4UCR A;  4DR3 O;  1QLE B;  3BVO A;  3TET A;  4I6M C;  1OCR C;  5KHG A;  5KJ7 C;  1P84 I;  4C7U A;  1BDC A;  2E5L O;  2IH1 C;  2UUA B;  1VQN P;  1RE3 A;  4YY3 O;  1ORQ C;  5AVY B;  2YNY A;  3JAR B;  3CLQ A;  2HPC A;  2F66 C;  2A06 H;  2YS8 A;  1KD1 W;  1JUN A;  4RWU A;  4CS3 A;  4BRY A;  3H1H H;  3OW2 U;  2VS0 A;  5KLI C;  4ZKP A;  1JCC A;  2E76 D;  3SWK A;  1LTJ C;  1FXK A;  2E5T A;  4JPR A;  3VMY A;  1QLN A;  3BA9 A;  1XNR O;  1S5J A;  1GMG A;  2P4V A;  4QPJ A;  2QJP C;  3GVM A;  1OCC B;  1N7S A;  1SQQ D;  3MGN A;  3B40 A;  4H0L C;  4K0K B;  3H1K E;  3EVK A;  3TK1 A;  3LSS A;  1KYO D;  1K7D A;  1CXZ B;  4UXN A;  3G71 V;  4LBE C;  3I55 V;  1EDL A;  1QR8 A;  3BAB A;  1NTZ J;  5AVV B;  1ZSP A;  3C3S A;  1HJ0 A;  2N1T D;  1JY3 P;  1B6Q A;  3SJC C;  5JJJ B;  3L75 D;  1YI2 P;  4K35 A;  4DV4 B;  1URQ C;  2Y48 A;  2YDE A;  3I56 V;  3AEE C;  3PLN A;  2CUG A;  3M0D A;  4KUM A;  2POH A;  3N4X A;  1NHL A;  2JO1 A;  1MMM A;  3U1A A;  1XHZ A;  4EDF A;  4NTX A;  4PD4 I;  2WLN A;  4LLH A;  4XFJ A;  1AQT A;  3OGC C;  3H1K H;  1H2L A;  4LFC B;  1L4A B;  1BGY D;  1OMI A;  3CCE V;  2CTQ A;  4PA6 A;  3ZX6 A;  1J95 A;  1VL2 A;  1DH3 A;  2UXX A;  3HKE B;  1QVG U;  5CCG A;  3N2G B;  3G71 P;  2O57 A;  4UCS A;  3I55 P;  5AVU B;  3J80 N;  1Q90 D;  1VQ6 P;  1VEW A;  1M93 A;  3RK3 D;  1N7S D;  3I56 P;  5KUK A;  5KA6 A;  1ZOY C;  3SJB C;  2BOC C;  2WPR A;  4X20 B;  4DR4 B;  1B06 A;  4PHZ A;  2ILM A;  3L73 J;  1RF1 B;  2JJL A;  3H32 B;  2QEX P;  4DK0 A;  1M90 W;  3AG3 B;  1VPC A;  3KKY A;  5EC1 C;  1HR0 O;  4D6T G;  5KA5 A;  1R8E A;  2WPV B;  3T4Z A;  1RM1 C;  2R70 A;  3ZHQ A;  4KHP O;  2L6L A;  3CCU P;  4MVZ A;  1NH4 A;  1XBL A;  1EN6 A;  2E74 C;  1QLE D;  2JRI A;  4DXW A;  2M7W A;  1M1K Q;  2Q3I A;  2FFD C;  1FOS E;  2W6B A;  1D5A A;  1NS1 A;  5APX A;  1Y67 A;  2KSJ A;  4IFF A;  3E2E A;  4B3T O;  5K5G B;  5KTB A;  2YC0 A;  2Y0E A;  2WPS A;  1L4A A;  3CI9 A;  4DUY O;  1OV9 A;  2PYJ A;  5FL7 G;  3AE9 C;  1S2E A;  1MNG A;  3SFD C;  4JAA A;  4U7N A;  3VP9 A;  5IYB O;  2CPB A;  1Q82 W;  3HKE A;  3N2G A;  1USD A;  4JAU A;  3QO5 A;  3K08 A;  5B1B B;  5CMU A;  4GDO A;  3CB2 A;  4R8C A;  4O4J B;  1HNW B;  3AEA C;  1H2N A;  2IFM A;  3H1L D;  4U3F G;  3BCC E;  4UV9 A;  5AG2 A;  1CPY A;  2HHH O;  1L0L G;  3KYQ A;  2EX3 A;  4X20 A;  3THO A;  2BCC E;  2J58 A;  4U7O A;  1EZV G;  5JQG A;  3H32 A;  2CK3 G;  4YJ2 B;  3Q1M A;  1AR5 A;  2UXD B;  4CS2 A;  1A02 F;  4TQD A;  3C9I A;  1BE3 J;  2QJK B;  3R4Y A;  3E1R A;  3K9S A;  4O4L B;  5LP6 B;  2DQ3 A;  1X8Y A;  1YQ3 C;  1RE4 C;  1JMB A;  4UB6 H;  2ZE6 A;  4LF8 B;  3DSQ A;  3TXS A;  3A0R A;  1HJB A;  5L3B A;  1WB7 A;  3E83 A;  1NWQ A;  4R4M A;  2NNU A;  2P1J A;  3CCS V;  4MS2 A;  2BCC H;  2F95 B;  1N2D C;  4ZKI A;  4MVS A;  1J1E B;  1KB9 F;  3KQG A;  5AVS B;  4O4J A;  3OEE G;  4HYO A;  1G8M A;  3A0B E;  1OVV A;  3IJ4 A;  4I4T B;  3FWN A;  1CW5 A;  3ML0 A;  4PDL A;  4EOT A;  1PPJ D;  1WLE A;  1JOY A;  5ITZ B;  2PAJ A;  2ZIM A;  1DLB A;  3SR2 C;  1L0N G;  1FJK A;  1Q6U A;  3BA8 A;  3BFR A;  4K3A A;  1AJP A;  1NT2 B;  3LW5 J;  2Q7C A;  3ETD A;  3A0B Z;  5DM6 V;  4O4L A;  4PDR A;  1S5L E;  3U10 A;  3RN4 A;  4DV0 B;  2K1E A;  3CCS P;  1XHX A;  1R3J C;  3H1J J;  4NXM B;  1OW8 A;  3Q5S A;  3RL0 g;  2K9P A;  1EXI A;  1Y4M A;  1D2D A;  1GAX A;  3A0B H;  3L4F A;  2DYR C;  1IJD B;  4X1K B;  1NU1 K;  3WFV A;  2Y0C A;  1K9M Q;  3CCL V;  4LF5 B;  4JYA B;  3AE1 C;  1S5L Z;  4NYK A;  3BCC J;  2PI4 A;  4GOE A;  4KJM A;  2AGA A;  5LGN A;  3W68 A;  1R3K C;  2A9H A;  3MHH C;  2FYU K;  2YXQ B;  1KQS U;  3P8C E;  1ZRT E;  2AW9 A;  2QJY B;  4HNA B;  4DR1 B;  1SQG A;  1NTM D;  1J2J B;  2LW1 A;  1H8H G;  5JH7 B;  1Q2N A;  3L72 J;  1S5L H;  3KCX A;  4I4T A;  1R3I C;  1O9G A;  2YUA A;  3FYI B;  2CTR A;  2EIM B;  1MZ9 A;  3K5L A;  1EZJ A;  2IJH A;  5ITZ A;  1IFM A;  1AVM A;  1R5L A;  1IFN A;  3CC4 V;  4JI6 B;  3P7K A;  1AI6 A;  2IYO A;  1M1J B;  3K5M A;  3V2N A;  1W2B U;  2OTJ P;  2UXC B;  1WMK A;  3QVN A;  2PFX A;  4AYC A;  5F2V O;  3OUF A;  1XMO B;  1VF5 B;  3E8G A;  2QWQ B;  1YIJ V;  3GMA A;  3HUS B;  1HH0 A;  2OYH A;  3MUD C;  4WBA A;  1KKD A;  3TGU D;  3D6Z A;  1G1I A;  3L70 E;  1SQV K;  4LF4 O;  2AXT E;  4NVP A;  1BSN A;  1IFI A;  3BEH A;  3CCL P;  4MTF A;  1KFM A;  3HD7 B;  3L36 A;  4J9Z B;  3VQV A;  1SQX K;  4GX2 A;  2JDI H;  1NYH A;  3H1I D;  3AK2 A;  2EIN C;  2VQF O;  4X8A A;  1KOR A;  3CJH B;  2AHZ A;  1FFX B;  1ZME C;  4GCZ A;  3VQW A;  5A2Q N;  4N3Y B;  3PRJ A;  4DUZ O;  1GN3 A;  1IFD A;  2K3R A;  2AXT Z;  2CTW A;  3ZMT A;  1H38 A;  3CC4 P;  2D2C C;  2YKO A;  1VP7 A;  2EZO A;  2OIE A;  2Q69 A;  5JH7 A;  4N21 A;  1AFO A;  3L70 H;  2ZJS E;  1M1K W;  1ZP0 C;  3OMI B;  2AXT H;  4JTC B;  1M56 B;  1YVW A;  1YIJ P;  1N36 B;  4HYT B;  2VQE B;  2ZKO A;  4PA4 A;  2Z5U A;  3GF7 A;  3LIE A;  3ICX A;  1M1J A;  3EHB B;  2PTM A;  4W7Y A;  1IO4 A;  2FXM A;  2A06 G;  4B3R B;  2E75 D;  4D7T A;  3F7Y C;  3HUS A;  3H1H G;  3ABM B;  2F23 A;  5BU8 B;  1I08 A;  1ZLL A;  4N78 D;  5L8R J;  1DEE G;  2JKV A;  2E5L B;  3EFF K;  1JTH B;  2V4D A;  1NU1 E;  1AJN A;  1KIL B;  4YY3 B;  1AR1 B;  3HTK A;  3CWB E;  3Q3D A;  1BCC E;  2KZI A;  2GUZ A;  2Q73 A;  4X1I A;  3CJH A;  1FFX A;  5AW5 B;  2FYU E;  3B8M A;  2EJ7 A;  5E79 E;  2YEV A;  4JF3 A;  3FXD A;  1RQU A;  1X4T A;  1NKD A;  2W90 A;  1PV0 A;  2O3J A;  1XNR B;  4ASW A;  1FXK C;  4GKJ O;  3ZJZ A;  5KHK A;  3CX5 D;  3JSN A;  5C8Y B;  3ABL B;  1LP1 B;  1FE6 A;  3AE3 C;  5E79 Z;  1NU1 H;  5IY5 B;  1Y66 A;  4J7Z A;  3WUT A;  1DF5 A;  1BS3 A;  1URF A;  2HJD A;  5J2U B;  3CWB H;  1BCC H;  3H1K G;  4Z1M H;  3M91 A;  2FYU H;  2Y4T A;  4DV3 O;  1SQV E;  5E79 H;  3RGB A;  1NR1 A;  1GL2 B;  4G28 B;  2P7T C;  1WT6 A;  1QLE C;  1SQX E;  3M0D C;  1GDT A;  1LTS C;  3OR7 C;  1XEQ A;  1JTH A;  3KDP B;  4K8Z A;  1KIL A;  4X89 A;  4B3S B;  2IBZ E;  1VQP V;  4YIO A;  3I5C A;  1LT9 B;  4DV6 O;  2YID A;  1CZQ A;  1JY2 N;  1UIX A;  1SZX A;  4D6T D;  1EM1 A;  4TV9 B;  3BAT A;  2WLH A;  1QNM A;  1SET A;  4CH3 A;  4RAI A;  2M3E A;  3KXD A;  4AQY O;  1KQL A;  2OQQ A;  1VQ7 P;  2RQ6 A;  1I94 O;  2UXB O;  4R6Z A;  4FFB B;  2KIK A;  3ZRW B;  3QO7 A;  1GK6 A;  1MZF A;  1OJH A;  1ZWI C;  4MVQ A;  4JAS A;  3OEH G;  4OX9 O;  1SQV H;  2RMZ A;  5CCG C;  1PP9 E;  4K8X A;  1ZXG A;  1BMF G;  1ZR2 A;  5C8Y A;  5B1N A;  4J80 A;  3II6 A;  3N2K B;  5EC2 C;  1SQX H;  1RH5 B;  1OCC C;  2Y0I A;  3QO8 A;  1V9P A;  1HVV A;  3TF5 A;  2JS5 A;  2IBZ H;  4M3L A;  1M56 D;  2PUS A;  4JI0 O;  4DYL A;  4B7E A;  4EYY Q;  3GWO A;  5J2U A;  1KB9 E;  3GF3 A;  3CEI A;  2HKO A;  3E1I A;  4AQR D;  1I5Y A;  3JAM N;  3L74 E;  2Y0P A;  4I7Z C;  1K9M W;  2Z3Y A;  5D5P A;  3V6I A;  1HR0 B;  5K1X A;  2HLO A;  4U3F D;  3N27 A;  2QTO A;  1PNM A;  3RFR A;  1GL2 A;  4KHP B;  2HR3 A;  1L0L D;  2FL4 A;  1CP9 A;  5BXZ A;  2EIJ B;  1EZV D;  3L71 J;  5LGU A;  1X22 A;  1LT9 A;  3AG1 B;  1PP9 H;  5HFM A;  1KIL D;  4TV9 A;  4DR2 O;  4B3T B;  3AG4 B;  4MTO A;  2CAZ C;  3QTC A;  3TSI A;  2X0L A;  4DUY B;  4TSF G;  1T5E A;  1L4A C;  1V54 B;  1NTZ K;  1FDO A;  1KB9 H;  2ZXX A;  5L3G A;  1HTL C;  3MIW A;  5APS A;  1PL0 A;  2LO1 A;  3K3W A;  1GM8 A;  1P49 A;  2Q3E A;  2HLD G;  3GW6 A;  3RL0 B;  3GWK C;  1NAF A;  2WSC J;  2RCV A;  4YHH O;  2Q5Z A;  5LBQ A;  4JYB A;  4UCV A;  3N2K A;  2GBO A;  1NTK J;  3TYY A;  2PZS A;  2Z5I A;  4GKG A;  2DMX A;  3VOU A;  1SQP J;  3MHS C;  1PGJ A;  3LSU A;  2HHH B;  2LGQ A;  2QKS A;  4IHJ B;  1T8Z A;  3FFQ A;  1YBK A;  1X79 B;  2OTL P;  1WPB A;  1K33 A;  4PA9 A;  3BCC G;  1RF1 C;  4DR5 O;  2A45 H;  3AG3 C;  1QQC A;  1G1J A;  3TNU A;  2BCC G;  1LTB C;  2HOD B;  2KG7 B;  2FYN B;  5KUM A;  3SJQ C;  1GL2 D;  5EZY B;  3IR9 A;  5AVQ B;  1OZ0 A;  1GMJ A;  3BRV B;  4LR3 A;  1L0N D;  2H8P D;  5AVT B;  5CBH A;  3O6Q B;  1AA0 A;  4TUY B;  1YJ9 V;  2IH3 C;  1LWU A;  1MV8 A;  3BHP A;  5KLV J;  3ZN0 A;  1OVU A;  1S5H C;  1KZU B;  1JA8 A;  2FB5 A;  5JCO C;  2IW5 A;  2K37 A;  3K04 A;  3T4D A;  4RQE A;  4CH4 A;  1K8A Q;  4GX0 A;  5CCH C;  2QRX A;  1JNM A;  1ZAU A;  4WCE V;  2PRR A;  2EIL B;  1VQO V;  5B1B C;  3D3Q A;  4JZG A;  2W83 C;  3IN6 A;  4NPF X;  2OCC B;  1FJP A;  2GTA A;  4PI0 A;  1S3J A;  1G2C B;  3LNN A;  3L74 J;  1CSB A;  1R6N A;  1K5S A;  3PJS K;  4OXS A;  3AEF C;  4IHJ A;  2I1K A;  3AG7 A;  5D5Q A;  3WMM 0;  1KQF B;  1N73 B;  2WLM A;  1RSO B;  1Y74 B;  1FFT B;  4LNU B;  5K1P A;  1YJ9 P;  2R32 A;  2KG7 A;  3FX0 A;  2QJK C;  1PZQ A;  2V1D A;  3WG7 B;  5LP6 C;  2X7R B;  3ZHR A;  4ZHQ A;  1Z56 A;  1JFF B;  1FDI A;  3O6Q A;  4TUY A;  1WB8 A;  2X6C A;  1MUU A;  2KB7 P;  1NTZ E;  4PA7 A;  1SQB J;  3CHX A;  2XDJ A;  3E8B A;  3A7O A;  3VN0 A;  2ETN A;  3A0H E;  1Z5V A;  2EIK B;  1M4U A;  3Q4H B;  4LFA O;  1GN2 A;  2P22 C;  5C39 A;  4ZI7 B;  1J1E C;  1AJQ A;  1ZV8 A;  1K4C C;  3AG2 B;  3RL0 D;  1CI6 A;  4CC6 A;  4ZOL B;  2N05 A;  1G2C A;  3D70 A;  1QL1 A;  1FZF A;  2RN9 A;  3S3W A;  3CPW O;  2FTK A;  4QPK A;  1KFN A;  2ZD9 A;  3W7S A;  4FVM A;  3RK3 B;  1VF6 A;  4R4L A;  1OX3 A;  4MVM A;  2JDI G;  1NTZ H;  3GB7 C;  2ZYA A;  3JYC A;  1S0V A;  1L2P A;  4DCK A;  1K4D C;  3APO A;  1T3J A;  2Z5H A;  2CDY A;  1N73 A;  1RSO A;  1Y74 A;  2LFS A;  4LNU A;  2QTS A;  3A0H H;  2XAJ A;  2ZVN B;  5BY1 A;  1VMG A;  3K9A A;  5JVD B;  1M7L A;  2JVD A;  2HFE D;  3JCU E;  4OPA A;  1COW G;  2H43 A;  1JFF A;  1J1D B;  1R6K A;  1TUE B;  3FKS G;  1NKN A;  3AEG C;  5L3D A;  1KYO I;  2A06 D;  1GKF A;  4JI8 O;  1K73 Q;  2JS3 A;  3HB3 B;  3L73 E;  4H44 B;  4LP8 A;  2VQF B;  3L70 G;  1AR4 A;  3H1H D;  3CXH E;  4WFB V;  5C93 A;  4PDM A;  1YI2 V;  3Q4H A;  5LGT A;  1AJY A;  1F4M A;  2P58 A;  2K9J B;  4ABM A;  3UO3 A;  4YJ3 B;  1BSM A;  3JCU Z;  3JC2 2;  1VQ5 P;  4DUZ B;  2OYO A;  4ZI7 A;  4MW8 A;  3ZMU A;  2FML A;  1M5I A;  2WVR A;  2AXC A;  1YEW A;  4ZOL A;  1DEB A;  3K0G A;  3L9D A;  4IYH A;  2R9I A;  3JCU H;  5L3C A;  3B71 A;  1WP7 A;  4O2A A;  1WP8 A;  2EIM C;  3M06 A;  1VQM P;  4LF9 O;  2M0B A;  4O2B B;  3FB5 C;  5AVX B;  1YDX A;  1AQ5 A;  3L73 H;  2JIZ G;  1IZ3 A;  3AE5 C;  3CXH H;  1M1J C;  3OJA B;  4Y28 J;  3CC7 P;  1AP6 A;  1BZK A;  1P84 E;  1XOU A;  2QJ1 A;  4ZBM A;  1FAV A;  5JVD A;  1EDK A;  5BZB A;  1VF5 C;  1VQ6 V;  3HUS C;  3FGA D;  2NLJ C;  2E5Y A;  3MZW B;  2KNC B;  1TU3 F;  1N33 O;  1NI8 A;  4NTW A;  3H1K D;  2FY8 A;  3HD7 C;  2WMM A;  3CL3 D;  2QEX V;  4B3S O;  1LJ2 A;  1OIP A;  4CH6 A;  1OVR A;  1BE3 E;  1NU1 G;  2K9J A;  1S1C X;  2ZR2 A;  1ZX3 A;  4YJ3 A;  3CCU V;  4O4H A;  3CWB G;  1BCC G;  3JD3 A;  4Z1M G;  3STL C;  3RVY A;  2NPS C;  1P84 H;  2FYU G;  2YIU B;  4GKJ B;  2ARH A;  1RF0 C;  3UM7 A;  2LFR A;  1WRG A;  2OYI B;  2Q7E A;  2HVJ C;  4JTA B;  4FMT A;  4O2B A;  1HNX O;  1BQZ A;  1BHB A;  4GUN A;  4MT8 A;  3SDL A;  3LDD A;  2ZT9 B;  3RBZ A;  2DN9 A;  4L73 A;  4OGQ B;  2RDC A;  2ATK C;  1BHA A;  1BE3 H;  4OWF A;  4DV3 B;  4RES B;  4ZMD A;  5JQG B;  1ZLZ A;  1IFP A;  1K8A W;  3ABM C;  2KNC A;  5BR8 B;  4PD4 E;  4A5U B;  3ABV C;  2OT5 A;  4NPE A;  4P9O A;  2WA4 A;  1SQV G;  4PI2 A;  1KIL C;  4DV6 B;  3U1C A;  2YIA A;  3OTO O;  3B8E B;  2NZ2 A;  1SQX G;  3LNM B;  2VWJ A;  5IT9 N;  4H44 D;  4AQY B;  2UUB O;  2J59 M;  4LWS A;  5B1O A;  5KHI A;  1I94 B;  2UXB B;  2IBZ G;  2KS1 B;  1KP2 A;  5KX5 B;  1LUW A;  2Q8V A;  3H1J E;  4OX9 B;  2QWN B;  2ZQM A;  2XNX A;  2ZDI A;  2C0X A;  4FM1 A;  1SQQ J;  2UUC O;  4BAY A;  4GYC B;  2OYI A;  3ABL C;  2C9N Y;  1R5S A;  4MVU A;  3ZIA G;  2P06 A;  5IY5 C;  5LHH A;  4JI0 B;  1PP9 G;  1XI1 A;  2IDB A;  1H8A A;  4JAV A;  3L75 J;  4MVO A;  1F51 A;  2DJV A;  1MAB G;  3LW5 H;  1G6U A;  3E8H A;  1X59 A;  4X62 O;  1GW4 A;  3B5N B;  1SLQ A;  3L72 E;  1HWT C;  2UWJ E;  1M57 B;  3H1J H;  2JWA A;  5KAI E;  3L74 G;  4J42 A;  4I9W A;  2ZNI A;  1P7G A;  2R44 A;  5BU5 A;  3BCC D;  1U7J A;  1LT9 C;  1KP3 A;  4DR2 B;  3LID A;  3CD6 P;  2BCC D;  3CCR P;  3OT7 A;  1BGY J;  2JGU A;  4LF6 O;  2HG5 C;  4H33 A;  1IBK O;  1LT1 A;  2KS1 A;  3PTZ A;  4UVB A;  1N4C A;  5APQ A;  5GTI E;  3BCC H;  4TV8 B;  5KX5 A;  2N74 A;  2KUB A;  2P10 A;  1N34 O;  5KAI Z;  1Y6X A;  1ZL8 B;  2OYQ A;  2PYL A;  3EWK A;  2VWK A;  3RVZ A;  2UU9 O;  1FDM A;  5BMV B;  4YHH B;  2A45 G;  5IJ9 A;  5LXT B;  3L72 H;  5KKZ B;  1BQ0 A;  2QM7 A;  5J2T A;  4UFZ A;  1HDJ A;  4TLF A;  2WSE J;  1T2K C;  2LR2 A;  5GTI Z;  1H88 A;  3AE7 C;  3ZHU A;  2KXP B;  3O65 A;  1G4Y B;  4D7S A;  4Q20 A;  2ZT9 D;  1YTF B;  3FB7 C;  2A79 B;  3K5N A;  4DR5 B;  1LTA C;  4OGQ D;  3SWY A;  4WWI A;  3B5N A;  2W0X A;  1LR1 A;  5GTI H;  4PV1 B;  2E75 B;  2WSF J;  2KLV A;  3JAL B;  3GLM A;  2B1G A;  1HF9 A;  2WAM A;  1JOC A;  3SSU A;  1LUV A;  2JEU A;  2KB1 A;  2WZ7 A;  2YKQ A;  1Q8I A;  3MHV A;  2Q0O C;  4DV5 B;  2OYH B;  3DGE A;  1WPX A;  3QH9 A;  4ASU G;  1VQ9 P;  2KK7 A;  2WWW A;  2OTJ V;  3T1Y O;  2ZIN A;  2JP3 A;  3PH0 A;  4A7P A;  1DD3 A;  1PL5 A;  1VQ4 V;  2AEM A;  4L75 A;  2IJJ A;  4TV8 A;  1MA1 A;  2ADQ B;  2KSD A;  1YIT V;  4FFK A;  1ZL8 A;  5AW9 B;  1W2E A;  1OCO B;  4GOD A;  1VQK V;  5JJE B;  3RL0 C;  5BMV A;  3SGI A;  1VQ8 V;  4MSW C;  5LXT A;  4FM0 A;  4P9P A;  4XE5 B;  3H1L J;  3PP5 A;  4ICG A;  1OCR B;  3RK2 B;  1SF9 A;  2RKL A;  1NQT A;  2Y0D A;  3H25 A;  2AHY A;  2N9B A;  4BWN A;  1NVO A;  1KTM A;  3CRA A;  1J5E O;  4DT0 A;  2Q7G A;  4DV7 O;  1DTO A;  2Z4E A;  3JAL A;  3P8C D;  1MZE A;  3E7K A;  2HFE C;  4TOI A;  1ZRT D;  3B5N D;  2P5O A;  1VQ4 P;  2FYN C;  2PGD A;  2O1J A;  4JI4 O;  3H6P A;  1M57 D;  1KC8 Q;  1YIT P;  2JEX A;  3QG5 A;  5B3S C;  1QR9 A;  1NTK K;  5CMZ A;  1H2G A;  1SQP K;  1PL4 A;  2F4V B;  1JEK A;  2QJP B;  1YF2 A;  1VDF A;  1VQK P;  4KP4 A;  5J9P C;  5LMU B;  3NMD A;  1VQ8 P;  2QM8 A;  3DXR B;  4DK1 A;  4LFA B;  3HTK B;  3V2P A;  2P90 A;  2ZAE B;  1FD9 A;  2XHB A;  4ZKU A;  2GUZ B;  2Q68 A;  4X1I B;  1B3Q A;  4CH5 A;  1NTZ G;  2FKW B;  2V7Q J;  3IFM A;  2YEV B;  3OAA G;  2XAQ A;  4FLX A;  4UCT A;  2E76 C;  1D7M A;  1S72 P;  2QKA A;  4O4I B;  3HKB B;  4QNH B;  1Y8A A;  3L70 D;  2E43 A;  1JO5 A;  2O1K A;  4JI5 O;  1EBO A;  2W6J G;  4DO2 A;  1URQ B;  5AVW B;  1XDC A;  1NO4 A;  3D36 C;  5KJ7 A;  3ETE A;  1Q7Y Q;  2KQX A;  3A8T A;  4IYI A;  4BR6 A;  2QA4 V;  5KLV K;  4Z2W A;  3WU2 E;  4X65 B;  1ZUQ A;  1KBH A;  4IFD K;  1S9K E;  2R9A A;  1YTF D;  4GOF A;  4CBC A;  3ZBH A;  2QGN A;  4B08 A;  4JV5 O;  2KYV A;  2N1T C;  3CX5 I;  2WTY A;  4MW3 A;  5EIB D;  2R3C A;  4W4K A;  4PV1 D;  1F23 A;  3WG7 C;  3W7W A;  5DJU B;  2ZNJ A;  4LC1 A;  1LTI C;  4JI8 B;  5LOV B;  1H2S B;  4WFE A;  1YJN P;  3WU2 Z;  4H13 D;  4GKK B;  1OHH G;  3B8N A;  3DXR A;  1U57 A;  1RE3 C;  5CA3 A;  2QM4 A;  2Q67 A;  3G6E V;  2EIK C;  3F7V C;  4FZ0 A;  5IYZ B;  4BXL A;  2CPS A;  3JAK B;  4BW5 A;  2XTA A;  3L73 G;  3SPJ A;  3A2F A;  3WU2 H;  2XT9 A;  2F93 B;  2GDS A;  4WVZ A;  3L71 E;  1FC2 C;  1NTM J;  2QSA A;  3HKB A;  4O4I A;  5FPR A;  2QA4 P;  2KOG A;  1FXH A;  3AG2 C;  4KFM A;  1H89 A;  3CP1 A;  3KCY A;  1URQ A;  2B89 A;  1BT8 A;  1NU1 D;  3T97 B;  3RYH B;  1P4R A;  3MTU E;  3HR0 A;  1NZ6 A;  1VQ7 V;  1GK4 A;  4R50 A;  2JWD A;  3CWB D;  3T1C A;  3RK2 D;  4LF9 B;  1BCC D;  5KJ7 D;  1SQB K;  2FFD B;  5AW7 B;  3RK3 C;  1N7S C;  2FYU D;  3JD2 A;  5AVZ B;  2HP8 A;  2L91 A;  3ZMS A;  1YYC A;  3TGU J;  4CPG A;  3ZS8 C;  1OW6 A;  1NTK E;  1H0T B;  2WSS H;  1MSW D;  2X6B A;  2DOS A;  5FPO A;  3CXH F;  1SQP E;  3L71 H;  3G4S V;  1PD3 A;  4IOI H;  4RO0 A;  1N33 B;  3G6E P;  1THZ A;  4X66 O;  3H1I J;  5BR8 O;  5LOV A;  3K06 A;  1LTG C;  5DN6 G;  2NR5 A;  5B5E E;  5EFW B;  2R9R B;  3B4S A;  4H44 C;  2SPZ A;  2IJI A;  5IYZ A;  2O01 J;  5LL6 Y;  5FLX N;  3JAK A;  5IWA O;  3ZHS A;  1SQV D;  1EFR G;  3SYQ A;  1XMQ B;  2WSC H;  3B2E E;  5TIS E;  1BE3 G;  1UJW B;  1EQ7 A;  1SQX D;  1YXB A;  1EZV I;  1NVP D;  1WAZ A;  2R5B A;  1U97 A;  1NTK H;  3T97 A;  4WFA V;  1K3E A;  3RYH A;  5B5E Z;  2IBZ D;  1VAR A;  5KLV E;  1SQP H;  1URQ D;  5IE9 A;  3RT3 C;  4UCU A;  2FFD A;  1P84 F;  1MKM A;  3C1L A;  1HNX B;  4UUJ C;  2R72 A;  1T3U A;  1VIB A;  2R3S A;  3G4S P;  1OWA A;  3S1K A;  3UKM A;  4EB6 B;  5B5E H;  5TIS Z;  3W7U A;  4EKW A;  4YPC A;  4FJC C;  2GUV A;  1JJO A;  4DJG A;  1H0T A;  5LMN O;  2Y69 B;  4E4E A;  2WLK A;  3CPW U;  1PP9 D;  3TNU B;  5TIS H;  1FJG O;  2K88 A;  3B5N C;  3TCU A;  2C2A A;  3ZED A;  4X64 O;  2X6A A;  3E22 B;  3ABU A;  4EFE A;  1XQ8 A;  1GM7 A;  2PGG A;  2OTL V;  2BEQ D;  3OTO B;  4GIF A;  3UIA A;  5KLV H;  2CH7 A;  5IYD O;  1KB9 D;  2UUB B;  2QKC A;  3C3T A;  2QE7 H;  3L74 D;  5CA1 B;  1LWU B;  2XU6 A;  3O8Z A;  4HKZ H;  5JWP A;  3OR6 C;  4YTP C;  3P3P A;  2F43 G;  1TUB B;  3ZMV A;  2YIU C;  1JY3 N;  2ZDI C;  3L74 H;  1SQB E;  1E79 G;  4JF7 A;  2UUC B;  2ZE8 A;  3E35 A;  4NPD A;  4W7Z A;  1N8R Q;  3H1J G;  2OYI C;  4LF7 O;  1KC8 W;  1EXJ A;  1RE4 A;  1DX7 A;  3U0Z A;  2JGD B;  4JI7 O;  3KHU A;  2MW2 B;  4EB6 A;  3Q5R A;  4PD4 F;  3AE4 C;  4MN4 C;  2Q9I A;  3A2A A;  4OGQ C;  4JI3 O;  5CA0 B;  3CMA P;  1N32 O;  1M8O B;  2QWR B;  4U3J B;  4X62 B;  1KN7 A;  3RYC A;  2A7W A;  1G1X B;  4GX1 A;  5CBF A;  1AVO A;  4TWK A;  3A5T A;  1VF7 A;  3UCS C;  4DRX A;  5L3E A;  2DWD C;  4D6T J;  3E22 A;  3NTN A;  2FXP A;  4YXW H;  1ZN5 A;  2N9Y B;  3L72 G;  1SQB H;  2WLI B;  1HNZ O;  4ZHQ B;  4P2Z A;  3CCM V;  1SC5 B;  3X2Q B;  4DV5 O;  2Q6Q A;  1Q7Y W;  3CRM A;  4KL1 A;  4BW9 A;  4LF6 B;  3UO2 A;  3SPG A;  1JCD A;  1IBK B;  5CA1 A;  4UCO A;  3BPZ A;  3AED C;  2L35 A;  1PKX A;  3V5B A;  3MD0 A;  3NFQ A;  4I0X B;  1SKV A;  1TUB A;  1N34 B;  2AEF A;  1IVS A;  1XUQ A;  4TQF A;  2GM4 A;  1XNQ O;  2UU9 B;  1GN6 A;  4XDK A;  4C46 A;  3E89 A;  2LJ2 A;  1MFZ A;  1NBM G;  5BVZ A;  1CI6 B;  2XAF A;  2YXH A;  2G8Y A;  2EJR A;  2P7J A;  2JGD A;  1QEX A;  5LYJ B;  4JI1 O;  1SS1 A;  1SZT A;  5CA0 A;  4U3F J;  2PF4 E;  3FAV B;  4F4L A;  1CEZ A;  4U3J A;  1FPO A;  1L0L J;  3VOP A;  3CCM P;  2IJK A;  1JB0 J;  1JJ2 U;  1FXV A;  1W5C E;  2JJ2 G;  2Y9Y A;  1DGS A;  1WNS A;  4FPP A;  1SQQ K;  1Y76 A;  3SYC A;  4J10 A;  2G3A A;  5AW2 B;  2WT7 B;  2D2C B;  2WLI A;  1S4X A;  5L3F A;  2IU0 A;  3T1Y B;  3FXE A;  4LGD E;  2BTQ B;  2D3O W;  1OZH A;  2F4V O;  2BAS A;  5LMU O;  4IIJ B;  5DEC A;  1RHZ B;  4I0X A;  1UII A;  3W7X A;  4LH7 A;  1IUR A;  2QVA A;  1K04 A;  1Q82 Q;  4U7J A;  1GM9 A;  4DV1 O;  2IZ0 A;  3OFN G;  5KKZ C;  3MUD A;  4TT3 H;  1WN7 A;  2WIT A;  3IC9 A;  1D5N A;  4GZR B;  1FZC B;  3ABK B;  3RBX A;  1NJI Q;  1NGM B;  1NTZ D;  2C0W A;  4WF9 V;  3BRT B;  5B1A B;  1YSC A;  3RYI B;  5LYJ A;  1VQ5 V;  4O2A B;  2P67 A;  5APY A;  1RP3 B;  1SS3 A;  2EUL A;  3SPH A;  1J5E B;  1V55 B;  3FAV A;  3QNE A;  1SRY A;  4IL6 E;  4DV7 B;  4X65 O;  1XL4 A;  2E75 C;  4PV1 C;  2M8R A;  5KMG B;  1H8E G;  4J7J A;  2AZ0 A;  1GO3 F;  1L0N J;  3OAK A;  5H6R A;  2E42 A;  1KMI Z;  3HKD A;  1FKA O;  5KHH A;  1VQM V;  4JI4 B;  4DR7 O;  2W6J H;  3FB8 C;  1SER A;  1QCE A;  3CSX A;  2EZP A;  5E1A C;  1FYJ A;  1A32 A;  2WT7 A;  1FZA A;  2OYH C;  2AEJ A;  4HZ3 A;  3CC7 V;  5APT A;  2BTQ A;  1JY2 P;  2I8D A;  2Q6A A;  4IL6 Z;  1Q86 Q;  3JAT B;  2A3Q A;  3IAO A;  4IIJ A;  4GKK O;  3DC5 A;  4XBF A;  1FZB A;  2VRS A;  4LCU C;  2ADP A;  4N23 A;  4NR1 A;  4IL6 H;  1OCO C;  2PY5 A;  4O4H B;  3VMZ A;  1Q6H A;  5GW7 A;  4JI5 B;  2LXB A;  3LDE A;  3OUS A;  1FZC A;  5IJ0 A;  1SP4 A;  2QJY C;  3M9Q A;  3RK2 C;  3L73 D;  4ZIB A;  3F89 A;  4QIW F;  2NN4 A;  1R6T A;  3M99 B;  3RYI A;  3CXH D;  1RPO A;  2W0F C;  2QSI A;  5LA6 B;  3EQ2 A;  1SQQ E;  1HW7 A;  4JV5 B;  2QWP B;  1YJW V;  2KLU A;  1BDD A;  3JCZ A;  5KMG A;  3GHG B;  4P30 A;  5JJN B;  1KYO E;  5CJ0 A;  1NH2 D;  2JEE A;  3FD9 A;  4L87 A;  1JY2 O;  3BRC A;  2KZJ A;  1NKZ B;  3NR7 A;  1E1R G;  3WUV A;  1U7M A;  4JGS A;  2YO3 A;  3P32 A;  3L75 E;  2H3O A;  1N8R W;  2D2C D;  1ENV A;  4YXD C;  3CME V;  1IBM O;  3C90 A;  3J81 N;  3JAT A;  1GU5 A;  3FWL A;  1USE A;  2M3B A;  4RUE A;  1P84 D;  3V4Q A;  1FZG A;  3N7N A;  1DF4 A;  3SYP A;  4LWS B;  3JAS B;  1EDI A;  2CTP A;  1SQQ H;  4I7Z B;  3CCQ V;  4N6J A;  1IK9 A;  5KAF E;  1H2M A;  4KHX A;  1XMQ O;  1XIL A;  1SVF A;  1AI4 A;  4QE9 A;  2WSS G;  1KYO H;  4FLW A;  1BGY E;  4JI2 O;  1R3L C;  3EXA A;  3T1H B;  3L71 G;  3SJA C;  1YJW P;  3ZDM A;  1K05 A;  3CC2 V;  4I5S A;  3K03 A;  3L75 H;  1BE3 D;  3IAY A;  1M56 C;  1FBM A;  4C7N B;  1JVM A;  5LA6 A;  3JAR A;  3MP7 B;  5AW4 B;  3V4W A;  5KAF Z;  4PJ0 E;  2ZXW B;  1GK9 A;  3VMA A;  4DOJ A;  3HPL C;  3GHG A;  1R1B A;  3RK3 E;  2B9Z A;  3TDK A;  3CME P;  4JYC A;  1OXZ A;  3WUU A;  4FLV A;  2VRZ A;  3S4R A;  3L37 A;  4MTG A;  1YQ4 C;  3B77 A;  4X66 B;  5KAF H;  4JYY A;  4BIO A;  2H7H A;  3AK1 A;  3H1H J;  3QF7 A;  1NTK G;  5H5N A;  2IU3 A;  1BGY H;  2ZIO A;  4UVC A;  2WPD G;  1DK1 A;  1SQP G;  3CCQ P;  3ETQ A;  1N0N A;  4PJ0 Z;  1KKC A;  2HJF C;  1IXB A;  3OM3 B;  3TJT A;  1JY3 O;  5APW A;  1U96 A;  3JSL A;  3IGA C;  5IWA B;  2B1I A;  5AW8 B;  3USS A;  4NXN O;  2FXO A;  3JAS A;  4JQ0 D;  3CC2 P;  1YZB A;  4PJ0 H;  3CX5 F;  4FK5 C;  4PD4 D;  2H89 C;  4OH8 B;  2R5D A;  3CD6 V;  1GTW A;  2BTO A;  2MK3 A;  2WSE H;  3CCR V;  3KG2 A;  1F7Y A;  4RO2 A;  3KPE A;  5IJ9 B;  2YMY A;  4I9Q A;  5GTH E;  5J2T B;  4PD4 H;  3CCE P;  4IFM A;  3R65 A;  1NR7 A;  3RGU A;  3ASN B;  4C7N A;  4HAM A;  1QVF O;  5KLV G;  1JPX A;  2N04 A;  3ZCC A;  4AHC A;  4B3M O;  2WSF H;  2B87 B;  1N0J A;  5CN0 A;  1KUQ A;  3H1L E;  4ASV A;  3H1J D;  2QE7 G;  1OCZ B;  5LMN B;  1XTC C;  1NTM K;  1DIP A;  3VTP C;  1X0T A;  1YHQ V;  4CC5 A;  1UFI A;  4B86 A;  4X88 A;  3S3X A;  3TXQ A;  3H1K J;  1FJG B;  2LQT A;  5GTH Z;  1E79 H;  4X64 B;  4QGP A;  1GL2 C;  3HE5 B;  3K5O A;  4UB6 E;  1GRJ A;  4WY4 B;  2YXR B;  1P7B A;  2H8P C;  1OFC X;  3Q2Y A;  5CCG D;  1IC2 A;  5GON B;  1NJI W;  1JR9 A;  2DQ0 A;  5LHG A;  5GTH H;  3AK3 A;  1AB3 A;  3LUT B;  2FBW C;  4W80 A;  3MDS A;  1AV1 A;  3L72 D;  3ASO B;  3J7A U;  1RF1 A;  1ZW0 A;  1XL6 A;  3H1L H;  4UVA A;  4UB6 Z;  3UQ8 A;  1VQ9 V;  2KI7 B;  4KT0 J;  2BOB C;  1AIL A;  2MJZ A;  4DW0 A;  2G38 A;  4LF7 B;  4DV2 O;  4XA4 A;  4YXW G;  3OW2 O;  5KAI H;  1YHQ P;  4JI7 B;  2MKV A;  4IL6 X;  1SQB G;  2W6A A;  4DW1 A;  1PV3 A;  1K73 W;  4X1Y B;  4JI3 B;  3ZMZ A;  1ARO P;  1Q86 W;  2B87 A;  1I5X A;  1Z2G A;  2HVK C;  1N32 B;  3W67 A;  5JCO A;  1FS0 E;  5H2F E;  1ZR4 A;  3BVH A;  1Q3E A;  4H37 A;  1PFI A;  1IX9 A;  4OVN F;  2C9L Y;  2Y69 C;  1L4A D;  1PPJ E;  1Y9B A;  5CCH A;  3Q5P A;  2Q4P A;  3U59 A;  3SWF A;  3HE5 A;  3IF4 A;  2GV9 A;  4Y99 B;  1TGO A;  1GD2 E;  2LKM A;  4L74 A;  4UV8 A;  2LP7 A;  4WY4 A;  1QX8 A;  2KKW A;  3O9O A;  3VQX A;  1HNZ B;  2HYN A;  5CJ4 A;  2WQY C;  4L76 A;  5GON A;  2EIJ C;  1NOH A;  3AG1 C;  4H13 B;  2DYS B;  2Q0A A;  5AW0 B;  5H2F Z;  2O01 N;  1QHT A;  1VQL V;  2KP8 A;  2XND H;  2V7Q H;  3AG4 C;  4AI8 A;  3D71 A;  3VP8 A;  1LWU C;  4Q6G A;  2CE4 A;  4GT1 A;  1V54 C;  4YJ2 A;  1XNQ B;  2IX7 C;  2CGO A;  5H2F H;  4WB4 A;  3WB0 A;  1SFC B;  3SPI A;  2K9Y A;  1FU1 A;  1PPJ H;  3FYE B;  3T2M A;  3E86 A;  5LP6 A;  1K92 A;  2H88 C;  2LW7 A;  1QU7 A;  2JR8 A;  4I55 B;  2QDO A;  3APQ A;  2ZCE A;  2NRG A;  4JI1 B;  4E2L A;  1US6 A;  4X1Y A;  1S72 V;  1NTM E;  4MTX A;  1QVG O;  2GSM B;  1YTZ T;  1TA8 A;  1KV4 A;  2BSK B;  2OWO A;  5H6Q A;  3ABT A;  3CCV V;  1IDS A;  1PGQ A;  1SES A;  3OA7 A;  1VQL P;  3JAW B;  5KLI B;  1JCH A;  2YI8 A;  5CCH D;  4DR6 O;  1LTJ B;  1F4N A;  1GN4 A;  2BCC J;  4EI2 A;  2DW4 A;  2B9B A;  3VYI A;  1Q6I A;  4TT3 G;  1EN5 A;  4WY4 D;  2V4H A;  3X2Q C;  3OMA B;  4LFB O;  3TGU E;  4PEL A;  2P2U A;  4BIU A;  1H2K A;  4H0L B;  4IT5 A;  3HRN A;  2WLL B;  4I50 B;  2W6I G;  3OMN B;  1NTM H;  1IBL O;  4F6E A;  4HB1 A;  3H1I E;  2YSU B;  2ZE5 A;  1SFC A;  1YJN V;  2YIB A;  4DV1 B;  1NVP B;  3ZRV A;  2FYZ A;  5AW3 B;  2EIL C;  4FLT A;  4FLY A;  5DJT B;  5IYC O;  1JMM A;  3BAS A;  2OCC C;  3V2Q A;  4I55 A;  3G67 A;  4I2L C;  1LTT C;  3NXS A;  5TJH A;  3D6Y A;  3CCV P;  3SYA A;  1GTO A;  3TGU H;  2UUA O;  5CBN A;  4X1K A;  1VF6 C;  2BSK A;  4BIZ A;  3AEB C;  2ZM6 B;  4FLZ A;  5FNV B;  2FKX A;  1N73 C;  1PNL A;  1EN4 A;  3H9V A;  4DR7 B;  3H1I H;  3JAW A;  2NPS B;  3QWO C;  3VQY A;  1LTJ A;  3G9R A;  3AEI A;  3G6B A;  4HNA A;  1AP5 A;  2M5A B;  2J5U A;  1EC5 A;  1QL2 A;  3ETG A;  3ZRS A;  3JD0 A;  1SA0 B;  5B66 E;  1JMK C;  2O01 H;  1IFJ A;  4NB5 A;  4N78 E;  4CZZ A;  2XV5 A;  2YMK A;  3OTF A;  5EBW C;  2OCH A;  1T6A A;  2WLL A;  3K57 A;  1S9K D;  4I50 A;  1E5W A;  3FB6 C;  4K0K O;  1L0L K;  2ZXE B;  1GZL A;  3V2R A;  5EBL C;  1XRE A;  3F5W C;  3MAQ A;  3BY6 A;  1R73 A;  3CE2 A;  3FX7 A;  3RW0 A;  3ZHV A;  1SFC D;  2ZE7 A;  2YIB D;  4JTD B;  3B09 A;  1K97 A;  5B66 Z;  4DR3 B;  2QIW A;  1RM1 B;  1FZC C;  3ABK C;  2GHY A;  4NTY A;  5CBG A;  5M1B A;  2ODM A;  4DV4 O;  1L8D A;  3LDC A; 
#chains in the Genus database with same CATH homology
 2E74 B;  4H44 C;  1OMI A;  2H88 C;  3AED C;  2ZT9 C;  1VF5 C;  1KQF B;  1ZP0 C;  1VL2 A;  2O01 J;  3FGA D;  3GF3 A;  3AE6 C;  1TU3 F;  2QJK C;  4I7Z C;  2QJY C;  3GF7 A;  1Q90 D;  2V7Q J;  4H13 C;  1FDI A;  3O6Q A;  2E75 D;  2G8Y A;  2E76 C;  2QSI A;  2P10 A;  1ZOY C;  1PIX A;  1DIP A;  1S1C X;  3EWK A;  5L8R J;  1MKM A;  3LW5 J;  1IK7 A;  3SFE C;  1R8E A;  2WPV B;  3Q2Y A;  1JB0 J;  2WSE J;  4H0L D;  3Q3D A;  1OW8 A;  3Q5S A;  3RL0 g;  1FDO A;  2E74 C;  4H0L B;  1EXI A;  2G3A A;  3AE7 C;  2BEZ F;  2D2C D;  1RQU A;  3D70 A;  2WSC J;  2FBW C;  2D2C B;  4YXD C;  2ZT9 D;  1VF5 D;  4OGQ D;  4PV1 D;  3AE1 C;  2ZT9 B;  4OGQ B;  4PV1 B;  2E75 B;  2BEQ D;  2WSF J;  4R4L A;  3AE9 C;  3GLM A;  1HF9 A;  4KT0 J;  3SFD C;  1ZRT E;  4I7Z B;  3AE3 C;  4H13 D;  3D6Y A;  5KLI C;  1U57 A;  2E76 D;  3ABV C;  1K04 A;  4YTP C;  2MKV A;  4GDO A;  2E76 B;  4IL6 X;  2JP3 A;  4U7J A;  5KKZ C;  1DD3 A;  1PL5 A;  1K05 A;  3AEB C;  4TT3 H;  1PV3 A;  3AEA C;  4Z1M H;  1OW7 A;  2NZ2 A;  2YIU C;  3AEG C;  2QJP C;  1NGM B;  4H44 D;  1GMJ A;  3AE2 C;  4H0L C;  1WMK A;  4H44 B;  1DD4 A;  1Y9B A;  3AE8 C;  3G9R A;  1EXJ A;  3GMA A;  3Q5P A;  1VF5 B;  3T97 B;  1AJY A;  2J5U A;  3Q1M A;  3RK3 E;  3D6Z A;  3Q5R A;  3R4Y A;  3AE4 C;  1UIX A;  1HJ0 A;  1YQ4 C;  2E75 C;  4OGQ C;  4PV1 C;  2YMK A;  2WQY C;  1KIL E;  3H25 A;  1KMI Z;  4H13 B;  2OQQ A;  3AEE C;  1YQ3 C;  1NYH A;  1S5L X;  3AEC C;  1KOR A;  1KTM A;  3D71 A;  1OW6 A;  3B71 A;  2JO1 A;  2IDB A;  3IN6 A;  4R4M A;  1ZME C;  2FXP A;  1RQV A;  4RKU J;  4XFJ A;  1KQG B;  3S9O A;  3IAO A;  2QIW A;  2FYN C;  2K9Y A;  5M1B A;  3AE5 C;  2E74 D;  3AEF C;  4Y28 J;  2H89 C;  2D2C C;  3C8V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...