3TNUA

Heterocomplex of coil 2b domains of human intermediate filament proteins, keratin 5 (krt5) and keratin 14 (krt14)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
90
structure length
90
Chain Sequence
b'SELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Keratin, type I cytoskeletal 14
molecule tags Cytosolic protein
source organism Homo sapiens
publication title Structural basis for heteromeric assembly and perinuclear organization of keratin filaments.
pubmed doi rcsb
total genus 44
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3tnuA00
3L37A 2C9NY 2P67A 1A02J 5APQA 2Z5HA 5AW0B 3L36A 1OXZA 2Q7CA 3MD0A 1NWQA 3M0DA 5AVXB 2WPRA 3VYIA 4C46A 1FOSF 1GD2E 1FAVA 3VMYA 5APSA 3IR9A 1S9KD 3T97A 2Q3IA 3SWFA 1NAFA 4I6MC 2WTYA 1HUCA 1MV8A 1SP4A 3A7OA 2ZFCA 3M91A 2C9LY 1H89A 2Q5UA 5APVA 1CZQA 1CSBA 3TK1A 5AW7B 1HWTC 4AUWA 1G2CB 1T2KD 3UIAA 2VRSA 2E42A 3M9HA 2BASA 5AVTB 1SLQA 3P8MC 3HTKA 2H7HA 3M9BA 3V4QA 2XU6A 3P32A 2KP8A 4GKGA 3V5BA 2W27A 3M0AA 4M3LA 3NFQA 4LC1A 5APUA 3HE5B 5AVQB 3A3YB 2QM8A 5CMZA 3HE5A 1YYCA 1T2KC 2N9BA 1CI6A 5AW9B 1FOSE 2E43A 2JJLA 4DZOA 2WPQA 3LIDA 1MFZA 3TNUB 3HE4A 5AW8B 5APWA 4I2LC 1JNMA 2IPPA 5AW2B 4RESB 1OWAA 2R32A 5AVSB 5APTA 1CI6B 5APXA 5AW6B 4AYCA 1S9KE 5AVVB 5AW3B 1KQLA 2YNYA 1GU5A 1J2JB 2YO2A 3VN0A 2W6AA 3P7KA 3O8ZA 2XV5A 4EOTA 1HJBA 2R3CA 5AVZB 5APYA 1IO4A 3TNUA 5AVYB 3OAKA 2R5BA 4AQRD 2ZXEB 2QM7A 3TYYA 3LIEA 3A2AA 1X8YA 5AVRB 2WWWA 1MUUA 3I5CA 2R5DA 3NMDA 3VMZA 5AW4B 4KHXA 1A02F 1GU4A 5AVWB 4XE5B 4JYCA 3VTPC 1DH3A 3HE4B 3NXSA 1HBWA 1H8AA 5AW1B 2P2UA 3V4WA 1H88A 1GK4A 3B8EB 4C7NA 5AW5B 2XZRA 2WT7B 2P7JA 3VMXA 3KQGA 4GT1A 4JYBA 1GTWA 1GZLA 2Z5IA 3L35A 3M06A 2WPSA 4B86A 1JUNA 3MGNA 2YO3A 2WT7A 3NTNA 4HYTB 1GK6A 4C7NB 5AVUB 3KDPB 3A5TA
chains in the Genus database with same CATH superfamily
1MFTA 1NTMG 1W2EA 1IFMA 1ZRTD 3L37A 1FZAA 2G3AA 2P67A 2O1JA 2B87B 1BSNA 1J1EC 3H1LE 4JBZA 1GU5A 1OVUA 1K9MQ 1OFCX 1SVFA 3L36A 4JF7A 2Q7CA 1YIJP 1K8AQ 4BXLA 5TJHA 5AVXB 1GD2E 1X22A 1VQPP 1FAVA 4PJ0H 2NPSD 3W67A 1E5WA 1L0NE 2R3SA 3SWFA 3V2RA 1HUCA 1MV8A 1URQD 3A7OA 4ASWA 3VMAA 1AFOA 2W83C 3M91A 3H1HD 1AQTA 2C9LY 1N86A 3H1IG 2O01N 2RMZA 3GG2A 2R44A 1ZP0C 2YXQB 2H89C 3SSUA 1G2CB 3L70G 5GTHE 1EXJA 3C8VA 1T2KD 3H1JE 1NO4A 4TLFA 3WU2E 2AEMA 2HR3A 2WQYC 5AVTB 2IX7C 2KSJA 3V4QA 2JEEA 1USDA 4GDOA 4IFFA 4QMAA 1BDDA 2K88A 3PP5A 5CCGC 3P32A 3W68A 2KP8A 1BSHA 2KZJA 4GKGA 1JB0J 2M5AA 4YXWH 2IFNA 1CW5A 1BE3E 2KNCA 2H8PD 2AEJA 1Y47A 1UIIA 1JEKA 2W27A 3H32A 1L4AA 3KHUA 3M0AA 4W7YA 1P84H 1Q86Q 1JCDA 1L4AB 1Q2NA 2FKWB 5CJ4A 2ZAEB 2QA4P 1KMIZ 3CC2P 2QM8A 5CMZA 1T2KC 1L4AC 1FDIA 3H1ID 1VQ6P 1M57D 4DT0A 2W6JH 1M1JA 1FOSE 2E43A 2W90A 2IYPA 4DZOA 3RBXA 2GA1A 5K5GB 3F5HA 2WPVB 2KYVA 2ZT9B 2KOGA 3G9RA 3HD7C 5AW2B 4RESB 4GOEA 4IL6H 2OYIB 5B5EH 3EFFK 1JMMA 1DH3A 1EXIA 3ABVC 5AVSB 2BCCD 5L8RJ 1SQVJ 1YJWP 1NTZG 3L72G 4KJMA 1VQKP 2B89A 1EDJA 5AVVB 3D71A 1SQPD 2H88C 2ZYAA 4D6TJ 2YNYA 3BRTB 1J2JB 2FYUJ 1LT9A 5DJTB 2O01J 1AJYA 2W6AA 3JCUH 4UB8E 2QJKB 1RF0C 3GHGA 1N73C 1RH5B 2A45G 3K5BA 1WRGA 1K05A 2B9BA 4PV1D 3CCLP 1NTKD 1NOHA 3TNUA 2E75D 2W8ZA 1VF5C 4I7ZB 2R5BA 3PLNA 4W7ZA 1KYOE 3KZIE 1S3JA 2QRXA 3V6IA 1KQFB 1RF1C 2YIUB 1S72P 3A2AA 2E5TA 2WWWA 1MUUA 1LP1A 3V2PA 1HF9A 2YMYA 1J1EB 3H1HJ 1GDTA 3R2PA 4Z1MH 1R5LA 1T3UA 5TISE 1EDKA 4Y99B 2OARA 3H1JG 1HJ0A 2DW3A 3L72D 3L74E 1YJNP 1JOCA 1BCCJ 2HG5D 4JYCA 1NU1E 1PP9J 3VTPC 1VQNP 1URQB 5CCGA 3AEAC 4U3FE 3BASA 4PD4E 2IZ1A 2E74B 2P2UA 3H1IE 1EZVD 3PTZA 4WY4C 2NPSC 4A7PA 2KIKA 1SQQG 2HFED 1SQQK 1SFCB 1GTWA 3N7NA 4UB6E 1LJ2A 2ZT9C 1PPJG 1SS1A 3L35A 4D6TE 4B86A 1AV1A 1W5CE 3MGNA 3U1AA 3CCSP 3AE6C 2K1AA 1FJKA 2ZVNB 2WT7A 1VQ8P 4EDFA 1GK6A 1SQXE 3OW2O 2BCCJ 2WSSH 5AVUB 1BE3G 1JY2O 3GW6A 1PGJA 2M0BA 3HD7A 5GTIE 3CX5D 3PJSK 1PGPA 2CK3H 2FYZA 5APQA 5AW0B 1U7MA 1QL1A 3BCCJ 4K3AA 1NWQA 1ZMEC 1GL2D 3TSIA 1N7SB 1KC8Q 3M0DA 3VYIA 4NPFX 2OYHC 1AA0A 1EZVG 5APSA 1KV4A 3Q2YA 3B5NC 4H44C 4ZKPA 1DX7A 2L91A 3Q5PA 1NJIQ 1U7JA 4O9BA 4UB8H 4N78D 3RL0C 3B4SA 1T3JA 1SP4A 2QJKC 1M1JB 2KZIA 5KLIB 1IK7A 1VL2A 4H0LC 2IFMA 1H89A 3H25A 1FZFA 2M3EA 1PZQA 3A0HE 1CZQA 2Y0CA 1CSBA 3EFGA 3TK1A 1S5LE 3IFMA 4L76A 5AW7B 4BRYB 2D2CC 1Z56A 1FC2C 2KS1B 1OVVA 1DD4A 1ZRTE 1KZUB 1P84I 1P84E 2KXPB 3UIAA 5KLVJ 3P8CE 1SQBE 3OJAB 1YJ9P 2E42A 1S5LH 3RL0B 1J1DB 1IJDB 1JY2P 1TU3F 1UIXA 2J58A 1NTKJ 4HB1A 4JPZB 3GMAA 3E1RA 4U3FD 2O3JA 3GF7A 5E79H 2BEQD 3MP7B 4OGQC 1JCCA 3AECC 4WVZA 1FZCB 1GL2B 3CCVP 1N7SC 2PGDA 2OYHB 2E5YA 1Y9BA 4PV1B 5KAFE 1G1JA 3FGAD 1ZV8A 2FXMA 2IBZI 1R8EA 2HODB 4M3LA 1RQVA 1KB9E 1SQPK 3MUDA 3NFQA 4H0LD 2WZ7A 1PFIA 2ITAA 2O1KA 2OTKE 2WSFJ 1FJPA 2C0XA 3G3ZA 5C39A 5CBOA 2HPCA 2D2CD 1L0NG 4YXDC 3G71P 1NKNA 2AXCA 5E79E 1ZR4A 2E76D 1PV3A 1IFJA 1YQ4C 3FXDA 3HTKB 1SQBG 1OZHA 5EFWB 1SQVE 5CJ0A 3H1LG 1NKZB 3HD7D 4U3FG 1LTAC 1NTZJ 2E76B 2GUVA 3SWYA 1QL2A 2Y9YA 3KXDA 1SQXG 1FE6A 1AQ5A 3VOPA 3CCRP 1KORA 2V7QH 4RKUJ 2WMMA 1SQQE 4RO0A 5AW6B 1IC2A 1M8OB 1N8RQ 1OW6A 3II6A 2FYUG 3CPWO 4D6TG 4OVNF 3AEDC 1PGQA 4Y99C 4H0LB 2NPSA 4ZNCA 3L71E 1JY2N 3P7KA 3O8ZA 3WUVA 4N3YB 4U7JA 4GIFA 3MZWB 5AVZB 3E1IA 1X0TA 1QEXA 2I8DA 1SFCC 3OAKA 5AVYB 1FZGA 1AVOA 3CCUP 3L75D 1QVGO 1HVVA 5CCGD 3L73D 1FBMA 2HLOA 2QM7A 3H1HE 2NZ2A 1LTSC 4NPDA 1X8YA 2E74C 5AVRB 3AE5C 3VMZA 2CPSA 2I1KA 3HE5B 1WMKA 5AW4B 4KHXA 2LKMA 3I55P 5CHXA 2J59M 1E79H 1LWUA 1U57A 1KB9D 2FYUD 3N4XA 1YTZT 3HE4B 2B87A 1KFNA 2WSFH 3RGUA 4D6TD 1N2DC 1OVRA 3NXSA 5KLVK 2K9YA 1N7LA 3T97B 3V4WA 1IZNB 1NTZE 3B8EB 1LTGC 1Y8AA 3FXEA 2YIUC 3MUDC 2E76C 1ZLLA 2SPZA 1G1IA 4R4LA 5CCHD 3CL3D 2WT7B 1LTJA 2FFDC 1OMIA 1SQQJ 3KQGA 4GT1A 3WU2H 4H13D 1YHQP 1ZN5A 1ZW0A 2Z5IA 3L73G 1SQVD 4NPEA 5BVZA 3L4FA 1RY3A 3H1HG 1JUNA 2WSEH 2YO3A 2N1TD 3NTNA 5KKZB 1LWUB 1YITP 1VDFA 2JWDA 3L75E 3HUSC 3L70E 1P84D 2JP3A 2A06E 4LLHA 1BCCD 3E7KA 1M90Q 3JC22 1DIPA 2QJYC 4Y28J 2AXTE 5KJ7C 1BGYJ 3L71D 3H1KE 5CCHA 1RF1B 2ZVOB 4H13C 3PH0A 4R4MA 3CX5I 4WY4B 5KAIH 3VMYA 1FZCC 2WSCJ 3HD7B 1IFNA 3GLMA 3IR9A 1X79B 1SQBK 2FYNC 3L74G 3TGUG 1S9KD 2Q3IA 1VQLP 1S4XA 1NAFA 1JY3N 3B5ND 1URQC 4H44D 4I6MC 2IBZD 2WTYA 1L0LG 1SQPE 2M5AB 2WSEJ 3AE3C 3H1KG 1SQVG 3L73J 3VP8A 3U1CA 1RE4A 2N1TC 3CMAP 1HGZA 1SFCA 3PRJA 1KILE 2KB7P 2P1JA 5KLVE 5APVA 2G8YA 2QJPC 1BE3J 3B71A 5KTBA 2FXOA 4PD4I 1LGHB 2QEXP 2IDBA 3S4RA 3D6YA 1OIPA 4WBAA 2BCCE 4AUWA 5KJ7D 1KB9H 3HUSA 3S1KA 1NTMD 3TF5A 1YQ3C 3CC4P 3M9HA 2BASA 4PD4H 1SLQA 1BCCG 3CXHI 3P8MC 2BEZF 3MHVA 2FXPA 3M9BA 2H7HA 2HYNA 1RHZB 1HGVA 2XU6A 3JCUE 3U59A 2WSCH 2KS1A 2GM4A 2YKOA 3RK3D 2JKVA 2BCCG 3SWKA 1RE3A 2E75C 2WITA 2YMKA 1HTLC 1NTZD 2QE7H 3RL0g 5B66H 1XTCC 3L74D 1VQ7P 3F89A 2OYIA 3TGUD 1KYOH 2Q6QA 3TDKA 1KTMA 1LNQA 3HRNA 3IAOA 2YKPA 4K35A 1L0LD 2QIWA 3H1KD 3H1JJ 1KYOD 1LP1B 3QH9A 1IK9A 3M0DC 1BGYE 1VPCA 1YYCA 3CXHH 2QSIA 4IL6X 1KQGB 1QLED 4BRYA 3BCCD 4DJGA 5GTHH 1GL2A 2N9BA 5AW9B 4DCKA 4DOJA 2KSEA 4PJ0E 2WPQA 3L70D 1MFZA 4EI2A 4L74A 1EDIA 3TNUB 3WMM0 1GL2C 5AW8B 1NH4A 3CWBJ 1FS0E 5APWA 3V2QA 1EC5A 3L73E 5CBNA 4IFDK 1PGOA 4RJTA 3USSA 3CWBD 2YXRB 1AVYA 2NPSB 1OWAA 2MKVA 2P10A 1S1CX 1J1DC 1XTGB 1SQVK 2UWJE 5APTA 1FU1A 1CI6B 2M8RA 3O6QA 5H2FH 1K73Q 2ZXXA 1EZVE 1PL5A 1NYHA 1GW3A 4AYCA 1IFIA 1JY3P 1M56D 2D2CB 2QG4A 3AE4C 1S9KE 2OTLP 1USEA 2QJPB 2FYUK 3GHGC 5AW3B 3I56P 2B88A 2GUSA 2IBZE 2K3RA 2RN0A 3A0BH 3AE7C 3BRVB 3OA7A 1LTJC 5KLVD 3VN0A 4C7RA 1URQA 3L72J 1BGYG 4PV1C 2XV5A 4CPGA 3BCCG 4L75A 1HJBA 1VQ4P 2FY8A 1PP9D 5APYA 1OW7A 4N78E 2HPCB 1LTTC 2C0WA 2PAJA 4KT0J 4WB4A 2OQQA 1NTMJ 1EQ7A 4GOFA 2YKQA 4U3FJ 4WWIA 1NVOA 1SFCD 2A45I 2MJZA 3AE8C 2Y9ZA 1PPJE 2ZJSE 3AE1C 3LIEA 3CWBG 3CX5E 2XKMA 3O6QB 2Y0EA 3I5CA 1N73B 3Q3DA 1NGMB 2E74D 4OWFA 2XNDH 1FZCA 1JTHB 3CCJP 4AQRD 1BE3D 2PRRA 3HUSB 1LT9B 1A02F 1GU4A 3WUUA 4HJGH 1Q81Q 1LWUC 5AVWB 3CWBE 3AEBC 2JR8A 1L0LE 1SQPG 2JDIH 4XE5B 1NTMK 2M3BA 3FX0A 5KLVG 1HBWA 1S5LX 2AXTH 1H88A 1GK4A 1ZXGA 1BGYD 3L71J 2KK7A 3EWKA 4ZMDA 1L0NJ 4C7NA 2XZRA 1PP9G 1NTKK 3IF4A 2I1JA 5DJUB 1NTKG 2OYIC 2FFDA 4TT3H 4WY4D 3VMXA 3AE9C 3SFDC 5BU8B 2ZT9D 1KILA 1GZLA 1IFDA 1VQ5P 2H43A 1IFPA 1LTBC 3RK3E 5KAFH 3EQ2A 4OGQD 2WPSA 2KLVA 3TGUJ 3QWOC 1NU1J 1PP9E 3AEGC 3D70A 4IOIH 1QVFO 1SQXK 5TISH 3R4YA 4LGDE 1QX8A 3A5TA 3RK2B 2C9NY 3KPEA 3V2NA 3H1JD 3H1KJ 1NTME 2Q1KA 3S9OA 2Z5HA 4XFJA 3LW5J 1OXZA 2PFXA 2OGUA 3MD0A 2E75B 2WPRA 1HH0A 4C46A 5B66E 2FFDB 1SQBJ 1WT6A 3AEEC 1FOSF 1VF5B 3CCEP 1R5SA 3MIWA 3T97A 1SQQD 1KD1Q 5KKZC 1SQXJ 1NTKE 1YI2P 3CMEP 1DEBA 1L0LJ 1L0LK 2LXCB 1PPJD 2ZFCA 3RK3C 2JO1A 2W6BA 2PP6A 1ZR2A 1KB9I 2Q5UA 1NU1K 3CXHE 1YBKA 3BCCE 1HWTC 1S2EA 3CCMP 3WUTA 3MTUE 2QVAA 3GF3A 3CX5H 2VRSA 3L75J 3LW5H 1L0NK 1PIXA 3G6EP 3D6ZA 1GW4A 3HTKA 3KYQA 1N7SA 2AEFA 4PD4D 1KN7A 1G2CA 2K37A 2V4HA 1Q7YQ 1N7SD 2OYHA 3CC7P 1NHLA 4N6JA 5KJ7A 3RBZA 3V5BA 2OTJP 1LTJB 3AEFC 4IFMA 4OH8B 2K9JA 1KFMA 2O01H 2RKLA 4LC1A 2FYUE 3GHGB 5APUA 2HODA 1L4AD 4YPCA 4I1LA 1SQPJ 1NAYA 2P58A 2Q3EA 1KILD 2WVRA 2FBWC 3A3YB 2L5GB 1Q90D 3HE5A 5H2FE 3Q5RA 1DD3A 3JSVC 3FWNA 2LXBA 2CPBA 2N1TB 1MZ9A 1M1JC 1CI6A 4UB6H 3H32B 1FZBA 1RE4C 2JJLA 2N1TA 5KLIC 3LIDA 2KNCB 3L75G 3HE4A 1K04A 2FYNB 3H6PA 4I2LC 1JNMA 3B5NB 4H44B 2IPPA 1FZEA 1Q82Q 1KYOI 3RL0D 3BVHA 1DEEG 2Z4EA 3BATA 3CD6P 2R32A 1VQMP 2QJYB 3A0HH 2IYOA 3CI9A 1NTZK 3PHLA 1JM0A 4EIJA 2Q9IA 2KI7B 5APXA 1YTZI 1FDMA 3L74J 1M1KQ 1BCCE 3L72E 3AE2C 2A06D 1GMJA 1M7LA 3C1LA 5BU5A 1A02J 1KILC 1KQLA 5M1BA 1NU1D 2NRGA 3RK2D 4HH2A 1L2PA 1LT9C 2YO2A 2ZYGA 2IZ0A 3C9IA 3H1IJ 2OYOA 4HKZH 1FDOA 3RK3B 5B5EE 5GTIH 3G4SP 1EDLA 3ITKA 5AVQB 4EOTA 1VQOP 1L0ND 2R3CA 3B5NA 1VF5D 3A0BE 1KQSO 1X9VA 1JMBA 2POHA 1IO4A 2RH0A 4OGQB 4W80A 5KAIE 3P8CD 2ZXEB 1H0TA 1JTHA 4XA4A 3H1LJ 4H13B 3TYYA 1SQBD 1H0TB 2K9JB 1OW8A 1RQUA 3H1LD 2ZYDA 4YTPC 4BWNA 2JWAA 1JY3O 2R5DA 2Y0DA 3NMDA 1EZVI 4GODA 4IL6E 4JQ0D 4ZKUA 1SQXD 4MN4C 3RK2C 1W2BO 2XNXA 3Q5SA 4L73A 2LR2A 2KUBA 3CCQP 1JO5A 2A06G 2V7QJ 1RE3C 1NU1G 1N73A 2KLUA 2J5UA 3L71G 3IN6A 2A45H 3ZDMA 1H8AA 5AW1B 4EYYQ 3L70J 4ASVA 1ZOYC 3VP9A 1MKMA 1T6AA 5AW5B 1VQ9P 4WY4A 1LTIC 3CLQA 1D7MA 2P7JA 3Q1MA 1RF1A 5CCHC 1OX3A 4JYBA 3TGUE 4I7ZC 2IBZG 1LT1A 1BDCA 2N9YB 1T8ZA 3FWLA 3KZIH 3M06A 2XDJA 3M9QA 3SFEC 1RF0A 4HYTB 1QGKB 3CXHD 4C7NB 1KILB 3KDPB
chains in the Genus database with same CATH topology
3L37A 1W2EA 1IFMA 1FZAA 2P67A 1A02J 2O1JA 1J1EC 1SVFA 3L36A 4JF7A 2Q7CA 5AVXB 1GD2E 1FAVA 2NPSD 1E5WA 3SWFA 3V2RA 1HUCA 1MV8A 1URQD 3A7OA 3M91A 2C9LY 1N86A 1G2CB 1T2KD 1NO4A 5AVTB 2IX7C 2KSJA 3V4QA 2JEEA 4IFFA 3PP5A 5CCGC 3P32A 2KP8A 4GKGA 2IFNA 1CW5A 2H8PD 3H32A 2W27A 3M0AA 1L4AA 4W7YA 1JCDA 1L4AB 2FKWB 5CJ4A 2QM8A 5CMZA 1T2KC 1L4AC 1M1JA 1FOSE 2E43A 4DZOA 2KYVA 2KOGA 3HD7C 5AW2B 4RESB 2OYIB 1JMMA 5AVSB 5AVVB 2YNYA 3BRTB 1J2JB 1LT9A 2W6AA 3GHGA 1RF0C 1N73C 2A45G 1WRGA 3TNUA 1NOHA 2R5BA 4W7ZA 1RF1C 3A2AA 2WWWA 1MUUA 3V2PA 2YMYA 1J1EB 3R2PA 1T3UA 4Y99B 2OARA 1JOCA 2HG5D 4JYCA 3VTPC 1URQB 5CCGA 3BASA 2P2UA 4WY4C 2NPSC 2HFED 1SQQK 1SFCB 1GTWA 3N7NA 3L35A 4B86A 3U1AA 3MGNA 1FJKA 2WT7A 1GK6A 5AVUB 1JY2O 3HD7A 5APQA 2FYZA 5AW0B 1QL1A 1NWQA 1GL2D 3TSIA 1N7SB 2OYHC 3M0DA 3VYIA 5APSA 3B5NC 4ZKPA 4O9BA 3RL0C 4N78D 1T3JA 1SP4A 1M1JB 2IFMA 1H89A 1FZFA 3EFGA 1CZQA 1CSBA 3TK1A 3IFMA 5AW7B 1FDMA 1Z56A 1KZUB 3UIAA 2E42A 3P8CE 3OJAB 3RL0B 1J1DB 1IJDB 1JY2P 2J58A 1JCCA 1FZCB 1GL2B 1N7SC 2OYHB 1G1JA 1ZV8A 2FXMA 2HODB 4M3LA 1SQPK 3MUDA 3NFQA 2WZ7A 1PFIA 2O1KA 1FJPA 2C0XA 3G3ZA 2HPCA 1NKNA 1ZR4A 1IFJA 3HTKB 5CJ0A 1NKZB 3HD7D 1LTAC 2GUVA 3SWYA 1QL2A 1AQ5A 3VOPA 5AW6B 1IC2A 3II6A 4Y99C 2NPSA 1JY2N 3P7KA 3O8ZA 4N3YB 4GIFA 5AVZB 3E1IA 1SFCC 3OAKA 5AVYB 1FZGA 1HVVA 5CCGD 1FBMA 2HLOA 2QM7A 1LTSC 1X8YA 5AVRB 3VMZA 2CPSA 2I1KA 5AW4B 4KHXA 2LKMA 5CHXA 2J59M 1LWUA 3N4XA 1YTZT 3HE4B 1DH3A 1KFNA 2WSFH 1GDTA 1N2DC 5KLVK 3NXSA 1N7LA 3V4WA 5CCHA 3B8EB 1LTGC 1ZLLA 1G1IA 5CCHD 2WT7B 3CL3D 2FFDC 1LTJA 3KQGA 4GT1A 1ZN5A 2Z5IA 5BVZA 3L4FA 1RY3A 1JUNA 2WSEH 2YO3A 2N1TD 3NTNA 1LWUB 1VDFA 3HUSC 4LLHA 5KJ7C 1RF1B 1FZCC 4WY4B 3VMYA 3HD7B 1IFNA 3IR9A 1S9KD 1X79B 1SQBK 2Q3IA 1NAFA 1JY3N 3B5ND 1URQC 4I6MC 2WTYA 1AFOA 3VP8A 3U1CA 1RE4A 2N1TC 1HGZA 1SFCA 2KB7P 2P1JA 5APVA 5KTBA 1LGHB 4AUWA 4WBAA 5KJ7D 3HUSA 3M9HA 2BASA 1SLQA 3P8MC 2H7HA 3M9BA 2HYNA 2XU6A 1HGVA 2GM4A 3U59A 2WSCH 2YKOA 1RE3A 2WITA 1HTLC 1XTCC 2OYIA 3HRNA 2YKPA 1IK9A 3M0DC 1VPCA 1YYCA 1GL2A 2N9BA 5AW9B 4DOJA 2WPQA 1MFZA 3TNUB 3WMM0 1GL2C 5AW8B 1NH4A 5APWA 3V2QA 4IFDK 2NPSB 1OWAA 1XTGB 1J1DC 1SQVK 5APTA 1FU1A 1CI6B 2M8RA 1GW3A 4AYCA 1IFIA 1JY3P 1S9KE 2FYUK 3GHGC 5AW3B 2GUSA 3OA7A 3BRVB 1LTJC 3VN0A 4C7RA 1URQA 1DX7A 2XV5A 1HJBA 5APYA 4N78E 2HPCB 1LTTC 2C0WA 2PAJA 4WB4A 4AQRD 1EQ7A 2YKQA 2A45I 1SFCD 2MJZA 3LIEA 2XKMA 3I5CA 1N73B 1FZCA 1JTHB 3HUSB 1A02F 1LT9B 1GU4A 1LWUC 5AVWB 4XE5B 1NTMK 2M3BA 1HBWA 1H88A 1GK4A 4C7NA 2XZRA 2FFDA 1NTKK 2OYIC 2I1JA 3VMXA 4WY4D 5BU8B 2H43A 1KILA 1GZLA 1IFDA 1LTBC 3EQ2A 2WPSA 2KLVA 1SQXK 4LGDE 3A5TA 3RK2B 2C9NY 3KPEA 3V2NA 2Z5HA 1OXZA 3MD0A 2WPRA 4C46A 1HH0A 2FFDB 1FOSF 1WT6A 3MIWA 3T97A 1DEBA 1L0LK 2ZFCA 3RK3C 2W6BA 2PP6A 1ZR2A 2Q5UA 1NU1K 1HWTC 3MTUE 2VRSA 3LW5H 1L0NK 1GW4A 3HTKA 3KYQA 1N7SA 1G2CA 2OYHA 1N7SD 1NHLA 4N6JA 5KJ7A 3V5BA 1LTJB 4IFMA 4OH8B 1KFMA 2O01H 3RK3D 4LC1A 3GHGB 5APUA 2HODA 1L4AD 4I1LA 3HE5B 5AVQB 3A3YB 1KILD 2L5GB 3HE5A 2N1TB 2CPBA 1MZ9A 1M1JC 1CI6A 3H32B 1FZBA 1RE4C 2JJLA 2N1TA 3LIDA 3HE4A 3H6PA 4I2LC 1JNMA 3B5NB 2IPPA 1FZEA 3RL0D 3BVHA 2Z4EA 3BATA 2R32A 3CI9A 1NTZK 4EIJA 2Q9IA 5APXA 1YTZI 5BU5A 1M7LA 1KILC 1KQLA 3RK2D 1GU5A 4HH2A 1LT9C 2YO2A 3C9IA 3RK3B 4EOTA 2R3CA 3B5NA 1X9VA 2POHA 1IO4A 4W80A 3P8CD 2ZXEB 1JTHA 4XA4A 3TYYA 1JY3O 2R5DA 3NMDA 4ZKUA 3RK2C 2XNXA 1JO5A 1RE3C 1N73A 2A45H 1H8AA 5AW1B 3VP9A 5AW5B 4WY4A 1LTIC 3CLQA 2P7JA 1RF1A 5CCHC 4JYBA 1T8ZA 3M06A 2XDJA 3M9QA 1RF0A 4HYTB 4C7NB 1KILB 3KDPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L37 A;  2C9N Y;  2P67 A;  1A02 J;  5APQ A;  2Z5H A;  5AW0 B;  3L36 A;  1OXZ A;  2Q7C A;  3MD0 A;  1NWQ A;  3M0D A;  5AVX B;  2WPR A;  3VYI A;  4C46 A;  1FOS F;  1GD2 E;  1FAV A;  3VMY A;  5APS A;  3IR9 A;  1S9K D;  3T97 A;  2Q3I A;  3SWF A;  1NAF A;  4I6M C;  2WTY A;  1HUC A;  1MV8 A;  1SP4 A;  3A7O A;  2ZFC A;  3M91 A;  2C9L Y;  1H89 A;  2Q5U A;  5APV A;  1CZQ A;  1CSB A;  3TK1 A;  5AW7 B;  1HWT C;  4AUW A;  1G2C B;  1T2K D;  3UIA A;  2VRS A;  2E42 A;  3M9H A;  2BAS A;  5AVT B;  1SLQ A;  3P8M C;  3HTK A;  2H7H A;  3M9B A;  3V4Q A;  2XU6 A;  3P32 A;  2KP8 A;  4GKG A;  3V5B A;  2W27 A;  3M0A A;  4M3L A;  3NFQ A;  4LC1 A;  5APU A;  3HE5 B;  5AVQ B;  3A3Y B;  2QM8 A;  5CMZ A;  3HE5 A;  1YYC A;  1T2K C;  2N9B A;  1CI6 A;  5AW9 B;  1FOS E;  2E43 A;  2JJL A;  4DZO A;  2WPQ A;  3LID A;  1MFZ A;  3TNU B;  3HE4 A;  5AW8 B;  5APW A;  4I2L C;  1JNM A;  2IPP A;  5AW2 B;  4RES B;  1OWA A;  2R32 A;  5AVS B;  5APT A;  1CI6 B;  5APX A;  5AW6 B;  4AYC A;  1S9K E;  5AVV B;  5AW3 B;  1KQL A;  2YNY A;  1GU5 A;  1J2J B;  2YO2 A;  3VN0 A;  2W6A A;  3P7K A;  3O8Z A;  2XV5 A;  4EOT A;  1HJB A;  2R3C A;  5AVZ B;  5APY A;  1IO4 A;  3TNU A;  5AVY B;  3OAK A;  2R5B A;  4AQR D;  2ZXE B;  2QM7 A;  3TYY A;  3LIE A;  3A2A A;  1X8Y A;  5AVR B;  2WWW A;  1MUU A;  3I5C A;  2R5D A;  3NMD A;  3VMZ A;  5AW4 B;  4KHX A;  1A02 F;  1GU4 A;  5AVW B;  4XE5 B;  4JYC A;  3VTP C;  1DH3 A;  3HE4 B;  3NXS A;  1HBW A;  1H8A A;  5AW1 B;  2P2U A;  3V4W A;  1H88 A;  1GK4 A;  3B8E B;  4C7N A;  5AW5 B;  2XZR A;  2WT7 B;  2P7J A;  3VMX A;  3KQG A;  4GT1 A;  4JYB A;  1GTW A;  1GZL A;  2Z5I A;  3L35 A;  3M06 A;  2WPS A;  4B86 A;  1JUN A;  3MGN A;  2YO3 A;  2WT7 A;  3NTN A;  4HYT B;  1GK6 A;  4C7N B;  5AVU B;  3KDP B;  3A5T A; 
#chains in the Genus database with same CATH topology
 1MFT A;  1NTM G;  1W2E A;  1IFM A;  1ZRT D;  3L37 A;  1FZA A;  2G3A A;  2P67 A;  2O1J A;  2B87 B;  1BSN A;  1J1E C;  3H1L E;  4JBZ A;  1GU5 A;  1OVU A;  1K9M Q;  1OFC X;  1SVF A;  3L36 A;  4JF7 A;  2Q7C A;  1YIJ P;  1K8A Q;  4BXL A;  5TJH A;  5AVX B;  1GD2 E;  1X22 A;  1VQP P;  1FAV A;  4PJ0 H;  2NPS D;  3W67 A;  1E5W A;  1L0N E;  2R3S A;  3SWF A;  3V2R A;  1HUC A;  1MV8 A;  1URQ D;  3A7O A;  4ASW A;  3VMA A;  1AFO A;  2W83 C;  3M91 A;  3H1H D;  1AQT A;  2C9L Y;  1N86 A;  3H1I G;  2O01 N;  2RMZ A;  3GG2 A;  2R44 A;  1ZP0 C;  2YXQ B;  2H89 C;  3SSU A;  1G2C B;  3L70 G;  5GTH E;  1EXJ A;  3C8V A;  1T2K D;  3H1J E;  1NO4 A;  4TLF A;  3WU2 E;  2AEM A;  2HR3 A;  2WQY C;  5AVT B;  2IX7 C;  2KSJ A;  3V4Q A;  2JEE A;  1USD A;  4GDO A;  4IFF A;  4QMA A;  1BDD A;  2K88 A;  3PP5 A;  5CCG C;  3P32 A;  3W68 A;  2KP8 A;  1BSH A;  2KZJ A;  4GKG A;  1JB0 J;  2M5A A;  4YXW H;  2IFN A;  1CW5 A;  1BE3 E;  2KNC A;  2H8P D;  2AEJ A;  1Y47 A;  1UII A;  1JEK A;  2W27 A;  3H32 A;  1L4A A;  3KHU A;  3M0A A;  4W7Y A;  1P84 H;  1Q86 Q;  1JCD A;  1L4A B;  1Q2N A;  2FKW B;  5CJ4 A;  2ZAE B;  2QA4 P;  1KMI Z;  3CC2 P;  2QM8 A;  5CMZ A;  1T2K C;  1L4A C;  1FDI A;  3H1I D;  1VQ6 P;  1M57 D;  4DT0 A;  2W6J H;  1M1J A;  1FOS E;  2E43 A;  2W90 A;  2IYP A;  4DZO A;  3RBX A;  2GA1 A;  5K5G B;  3F5H A;  2WPV B;  2KYV A;  2ZT9 B;  2KOG A;  3G9R A;  3HD7 C;  5AW2 B;  4RES B;  4GOE A;  4IL6 H;  2OYI B;  5B5E H;  3EFF K;  1JMM A;  1DH3 A;  1EXI A;  3ABV C;  5AVS B;  2BCC D;  5L8R J;  1SQV J;  1YJW P;  1NTZ G;  3L72 G;  4KJM A;  1VQK P;  2B89 A;  1EDJ A;  5AVV B;  3D71 A;  1SQP D;  2H88 C;  2ZYA A;  4D6T J;  2YNY A;  3BRT B;  1J2J B;  2FYU J;  1LT9 A;  5DJT B;  2O01 J;  1AJY A;  2W6A A;  3JCU H;  4UB8 E;  2QJK B;  1RF0 C;  3GHG A;  1N73 C;  1RH5 B;  2A45 G;  3K5B A;  1WRG A;  1K05 A;  2B9B A;  4PV1 D;  3CCL P;  1NTK D;  1NOH A;  3TNU A;  2E75 D;  2W8Z A;  1VF5 C;  4I7Z B;  2R5B A;  3PLN A;  4W7Z A;  1KYO E;  3KZI E;  1S3J A;  2QRX A;  3V6I A;  1KQF B;  1RF1 C;  2YIU B;  1S72 P;  3A2A A;  2E5T A;  2WWW A;  1MUU A;  1LP1 A;  3V2P A;  1HF9 A;  2YMY A;  1J1E B;  3H1H J;  1GDT A;  3R2P A;  4Z1M H;  1R5L A;  1T3U A;  5TIS E;  1EDK A;  4Y99 B;  2OAR A;  3H1J G;  1HJ0 A;  2DW3 A;  3L72 D;  3L74 E;  1YJN P;  1JOC A;  1BCC J;  2HG5 D;  4JYC A;  1NU1 E;  1PP9 J;  3VTP C;  1VQN P;  1URQ B;  5CCG A;  3AEA C;  4U3F E;  3BAS A;  4PD4 E;  2IZ1 A;  2E74 B;  2P2U A;  3H1I E;  1EZV D;  3PTZ A;  4WY4 C;  2NPS C;  4A7P A;  2KIK A;  1SQQ G;  2HFE D;  1SQQ K;  1SFC B;  1GTW A;  3N7N A;  4UB6 E;  1LJ2 A;  2ZT9 C;  1PPJ G;  1SS1 A;  3L35 A;  4D6T E;  4B86 A;  1AV1 A;  1W5C E;  3MGN A;  3U1A A;  3CCS P;  3AE6 C;  2K1A A;  1FJK A;  2ZVN B;  2WT7 A;  1VQ8 P;  4EDF A;  1GK6 A;  1SQX E;  3OW2 O;  2BCC J;  2WSS H;  5AVU B;  1BE3 G;  1JY2 O;  3GW6 A;  1PGJ A;  2M0B A;  3HD7 A;  5GTI E;  3CX5 D;  3PJS K;  1PGP A;  2CK3 H;  2FYZ A;  5APQ A;  5AW0 B;  1U7M A;  1QL1 A;  3BCC J;  4K3A A;  1NWQ A;  1ZME C;  1GL2 D;  3TSI A;  1N7S B;  1KC8 Q;  3M0D A;  3VYI A;  4NPF X;  2OYH C;  1AA0 A;  1EZV G;  5APS A;  1KV4 A;  3Q2Y A;  3B5N C;  4H44 C;  4ZKP A;  1DX7 A;  2L91 A;  3Q5P A;  1NJI Q;  1U7J A;  4O9B A;  4UB8 H;  4N78 D;  3RL0 C;  3B4S A;  1T3J A;  1SP4 A;  2QJK C;  1M1J B;  2KZI A;  5KLI B;  1IK7 A;  1VL2 A;  4H0L C;  2IFM A;  1H89 A;  3H25 A;  1FZF A;  2M3E A;  1PZQ A;  3A0H E;  1CZQ A;  2Y0C A;  1CSB A;  3EFG A;  3TK1 A;  1S5L E;  3IFM A;  4L76 A;  5AW7 B;  4BRY B;  2D2C C;  1Z56 A;  1FC2 C;  2KS1 B;  1OVV A;  1DD4 A;  1ZRT E;  1KZU B;  1P84 I;  1P84 E;  2KXP B;  3UIA A;  5KLV J;  3P8C E;  1SQB E;  3OJA B;  1YJ9 P;  2E42 A;  1S5L H;  3RL0 B;  1J1D B;  1IJD B;  1JY2 P;  1TU3 F;  1UIX A;  2J58 A;  1NTK J;  4HB1 A;  4JPZ B;  3GMA A;  3E1R A;  4U3F D;  2O3J A;  3GF7 A;  5E79 H;  2BEQ D;  3MP7 B;  4OGQ C;  1JCC A;  3AEC C;  4WVZ A;  1FZC B;  1GL2 B;  3CCV P;  1N7S C;  2PGD A;  2OYH B;  2E5Y A;  1Y9B A;  4PV1 B;  5KAF E;  1G1J A;  3FGA D;  1ZV8 A;  2FXM A;  2IBZ I;  1R8E A;  2HOD B;  4M3L A;  1RQV A;  1KB9 E;  1SQP K;  3MUD A;  3NFQ A;  4H0L D;  2WZ7 A;  1PFI A;  2ITA A;  2O1K A;  2OTK E;  2WSF J;  1FJP A;  2C0X A;  3G3Z A;  5C39 A;  5CBO A;  2HPC A;  2D2C D;  1L0N G;  4YXD C;  3G71 P;  1NKN A;  2AXC A;  5E79 E;  1ZR4 A;  2E76 D;  1PV3 A;  1IFJ A;  1YQ4 C;  3FXD A;  3HTK B;  1SQB G;  1OZH A;  5EFW B;  1SQV E;  5CJ0 A;  3H1L G;  1NKZ B;  3HD7 D;  4U3F G;  1LTA C;  1NTZ J;  2E76 B;  2GUV A;  3SWY A;  1QL2 A;  2Y9Y A;  3KXD A;  1SQX G;  1FE6 A;  1AQ5 A;  3VOP A;  3CCR P;  1KOR A;  2V7Q H;  4RKU J;  2WMM A;  1SQQ E;  4RO0 A;  5AW6 B;  1IC2 A;  1M8O B;  1N8R Q;  1OW6 A;  3II6 A;  2FYU G;  3CPW O;  4D6T G;  4OVN F;  3AED C;  1PGQ A;  4Y99 C;  4H0L B;  2NPS A;  4ZNC A;  3L71 E;  1JY2 N;  3P7K A;  3O8Z A;  3WUV A;  4N3Y B;  4U7J A;  4GIF A;  3MZW B;  5AVZ B;  3E1I A;  1X0T A;  1QEX A;  2I8D A;  1SFC C;  3OAK A;  5AVY B;  1FZG A;  1AVO A;  3CCU P;  3L75 D;  1QVG O;  1HVV A;  5CCG D;  3L73 D;  1FBM A;  2HLO A;  2QM7 A;  3H1H E;  2NZ2 A;  1LTS C;  4NPD A;  1X8Y A;  2E74 C;  5AVR B;  3AE5 C;  3VMZ A;  2CPS A;  2I1K A;  3HE5 B;  1WMK A;  5AW4 B;  4KHX A;  2LKM A;  3I55 P;  5CHX A;  2J59 M;  1E79 H;  1LWU A;  1U57 A;  1KB9 D;  2FYU D;  3N4X A;  1YTZ T;  3HE4 B;  2B87 A;  1KFN A;  2WSF H;  3RGU A;  4D6T D;  1N2D C;  1OVR A;  3NXS A;  5KLV K;  2K9Y A;  1N7L A;  3T97 B;  3V4W A;  1IZN B;  1NTZ E;  3B8E B;  1LTG C;  1Y8A A;  3FXE A;  2YIU C;  3MUD C;  2E76 C;  1ZLL A;  2SPZ A;  1G1I A;  4R4L A;  5CCH D;  3CL3 D;  2WT7 B;  1LTJ A;  2FFD C;  1OMI A;  1SQQ J;  3KQG A;  4GT1 A;  3WU2 H;  4H13 D;  1YHQ P;  1ZN5 A;  1ZW0 A;  2Z5I A;  3L73 G;  1SQV D;  4NPE A;  5BVZ A;  3L4F A;  1RY3 A;  3H1H G;  1JUN A;  2WSE H;  2YO3 A;  2N1T D;  3NTN A;  5KKZ B;  1LWU B;  1YIT P;  1VDF A;  2JWD A;  3L75 E;  3HUS C;  3L70 E;  1P84 D;  2JP3 A;  2A06 E;  4LLH A;  1BCC D;  3E7K A;  1M90 Q;  3JC2 2;  1DIP A;  2QJY C;  4Y28 J;  2AXT E;  5KJ7 C;  1BGY J;  3L71 D;  3H1K E;  5CCH A;  1RF1 B;  2ZVO B;  4H13 C;  3PH0 A;  4R4M A;  3CX5 I;  4WY4 B;  5KAI H;  3VMY A;  1FZC C;  2WSC J;  3HD7 B;  1IFN A;  3GLM A;  3IR9 A;  1X79 B;  1SQB K;  2FYN C;  3L74 G;  3TGU G;  1S9K D;  2Q3I A;  1VQL P;  1S4X A;  1NAF A;  1JY3 N;  3B5N D;  1URQ C;  4H44 D;  4I6M C;  2IBZ D;  2WTY A;  1L0L G;  1SQP E;  2M5A B;  2WSE J;  3AE3 C;  3H1K G;  1SQV G;  3L73 J;  3VP8 A;  3U1C A;  1RE4 A;  2N1T C;  3CMA P;  1HGZ A;  1SFC A;  3PRJ A;  1KIL E;  2KB7 P;  2P1J A;  5KLV E;  5APV A;  2G8Y A;  2QJP C;  1BE3 J;  3B71 A;  5KTB A;  2FXO A;  4PD4 I;  1LGH B;  2QEX P;  2IDB A;  3S4R A;  3D6Y A;  1OIP A;  4WBA A;  2BCC E;  4AUW A;  5KJ7 D;  1KB9 H;  3HUS A;  3S1K A;  1NTM D;  3TF5 A;  1YQ3 C;  3CC4 P;  3M9H A;  2BAS A;  4PD4 H;  1SLQ A;  1BCC G;  3CXH I;  3P8M C;  2BEZ F;  3MHV A;  2FXP A;  3M9B A;  2H7H A;  2HYN A;  1RHZ B;  1HGV A;  2XU6 A;  3JCU E;  3U59 A;  2WSC H;  2KS1 A;  2GM4 A;  2YKO A;  3RK3 D;  2JKV A;  2BCC G;  3SWK A;  1RE3 A;  2E75 C;  2WIT A;  2YMK A;  1HTL C;  1NTZ D;  2QE7 H;  3RL0 g;  5B66 H;  1XTC C;  3L74 D;  1VQ7 P;  3F89 A;  2OYI A;  3TGU D;  1KYO H;  2Q6Q A;  3TDK A;  1KTM A;  1LNQ A;  3HRN A;  3IAO A;  2YKP A;  4K35 A;  1L0L D;  2QIW A;  3H1K D;  3H1J J;  1KYO D;  1LP1 B;  3QH9 A;  1IK9 A;  3M0D C;  1BGY E;  1VPC A;  1YYC A;  3CXH H;  2QSI A;  4IL6 X;  1KQG B;  1QLE D;  4BRY A;  3BCC D;  4DJG A;  5GTH H;  1GL2 A;  2N9B A;  5AW9 B;  4DCK A;  4DOJ A;  2KSE A;  4PJ0 E;  2WPQ A;  3L70 D;  1MFZ A;  4EI2 A;  4L74 A;  1EDI A;  3TNU B;  3WMM 0;  1GL2 C;  5AW8 B;  1NH4 A;  3CWB J;  1FS0 E;  5APW A;  3V2Q A;  1EC5 A;  3L73 E;  5CBN A;  4IFD K;  1PGO A;  4RJT A;  3USS A;  3CWB D;  2YXR B;  1AVY A;  2NPS B;  1OWA A;  2MKV A;  2P10 A;  1S1C X;  1J1D C;  1XTG B;  1SQV K;  2UWJ E;  5APT A;  1FU1 A;  1CI6 B;  2M8R A;  3O6Q A;  5H2F H;  1K73 Q;  2ZXX A;  1EZV E;  1PL5 A;  1NYH A;  1GW3 A;  4AYC A;  1IFI A;  1JY3 P;  1M56 D;  2D2C B;  2QG4 A;  3AE4 C;  1S9K E;  2OTL P;  1USE A;  2QJP B;  2FYU K;  3GHG C;  5AW3 B;  3I56 P;  2B88 A;  2GUS A;  2IBZ E;  2K3R A;  2RN0 A;  3A0B H;  3AE7 C;  3BRV B;  3OA7 A;  1LTJ C;  5KLV D;  3VN0 A;  4C7R A;  1URQ A;  3L72 J;  1BGY G;  4PV1 C;  2XV5 A;  4CPG A;  3BCC G;  4L75 A;  1HJB A;  1VQ4 P;  2FY8 A;  1PP9 D;  5APY A;  1OW7 A;  4N78 E;  2HPC B;  1LTT C;  2C0W A;  2PAJ A;  4KT0 J;  4WB4 A;  2OQQ A;  1NTM J;  1EQ7 A;  4GOF A;  2YKQ A;  4U3F J;  4WWI A;  1NVO A;  1SFC D;  2A45 I;  2MJZ A;  3AE8 C;  2Y9Z A;  1PPJ E;  2ZJS E;  3AE1 C;  3LIE A;  3CWB G;  3CX5 E;  2XKM A;  3O6Q B;  2Y0E A;  3I5C A;  1N73 B;  3Q3D A;  1NGM B;  2E74 D;  4OWF A;  2XND H;  1FZC A;  1JTH B;  3CCJ P;  4AQR D;  1BE3 D;  2PRR A;  3HUS B;  1LT9 B;  1A02 F;  1GU4 A;  3WUU A;  4HJG H;  1Q81 Q;  1LWU C;  5AVW B;  3CWB E;  3AEB C;  2JR8 A;  1L0L E;  1SQP G;  2JDI H;  4XE5 B;  1NTM K;  2M3B A;  3FX0 A;  5KLV G;  1HBW A;  1S5L X;  2AXT H;  1H88 A;  1GK4 A;  1ZXG A;  1BGY D;  3L71 J;  2KK7 A;  3EWK A;  4ZMD A;  1L0N J;  4C7N A;  2XZR A;  1PP9 G;  1NTK K;  3IF4 A;  2I1J A;  5DJU B;  1NTK G;  2OYI C;  2FFD A;  4TT3 H;  4WY4 D;  3VMX A;  3AE9 C;  3SFD C;  5BU8 B;  2ZT9 D;  1KIL A;  1GZL A;  1IFD A;  1VQ5 P;  2H43 A;  1IFP A;  1LTB C;  3RK3 E;  5KAF H;  3EQ2 A;  4OGQ D;  2WPS A;  2KLV A;  3TGU J;  3QWO C;  1NU1 J;  1PP9 E;  3AEG C;  3D70 A;  4IOI H;  1QVF O;  1SQX K;  5TIS H;  3R4Y A;  4LGD E;  1QX8 A;  3A5T A;  3RK2 B;  2C9N Y;  3KPE A;  3V2N A;  3H1J D;  3H1K J;  1NTM E;  2Q1K A;  3S9O A;  2Z5H A;  4XFJ A;  3LW5 J;  1OXZ A;  2PFX A;  2OGU A;  3MD0 A;  2E75 B;  2WPR A;  1HH0 A;  4C46 A;  5B66 E;  2FFD B;  1SQB J;  1WT6 A;  3AEE C;  1FOS F;  1VF5 B;  3CCE P;  1R5S A;  3MIW A;  3T97 A;  1SQQ D;  1KD1 Q;  5KKZ C;  1SQX J;  1NTK E;  1YI2 P;  3CME P;  1DEB A;  1L0L J;  1L0L K;  2LXC B;  1PPJ D;  2ZFC A;  3RK3 C;  2JO1 A;  2W6B A;  2PP6 A;  1ZR2 A;  1KB9 I;  2Q5U A;  1NU1 K;  3CXH E;  1YBK A;  3BCC E;  1HWT C;  1S2E A;  3CCM P;  3WUT A;  3MTU E;  2QVA A;  3GF3 A;  3CX5 H;  2VRS A;  3L75 J;  3LW5 H;  1L0N K;  1PIX A;  3G6E P;  3D6Z A;  1GW4 A;  3HTK A;  3KYQ A;  1N7S A;  2AEF A;  4PD4 D;  1KN7 A;  1G2C A;  2K37 A;  2V4H A;  1Q7Y Q;  1N7S D;  2OYH A;  3CC7 P;  1NHL A;  4N6J A;  5KJ7 A;  3RBZ A;  3V5B A;  2OTJ P;  1LTJ B;  3AEF C;  4IFM A;  4OH8 B;  2K9J A;  1KFM A;  2O01 H;  2RKL A;  4LC1 A;  2FYU E;  3GHG B;  5APU A;  2HOD A;  1L4A D;  4YPC A;  4I1L A;  1SQP J;  1NAY A;  2P58 A;  2Q3E A;  1KIL D;  2WVR A;  2FBW C;  3A3Y B;  2L5G B;  1Q90 D;  3HE5 A;  5H2F E;  3Q5R A;  1DD3 A;  3JSV C;  3FWN A;  2LXB A;  2CPB A;  2N1T B;  1MZ9 A;  1M1J C;  1CI6 A;  4UB6 H;  3H32 B;  1FZB A;  1RE4 C;  2JJL A;  2N1T A;  5KLI C;  3LID A;  2KNC B;  3L75 G;  3HE4 A;  1K04 A;  2FYN B;  3H6P A;  4I2L C;  1JNM A;  3B5N B;  4H44 B;  2IPP A;  1FZE A;  1Q82 Q;  1KYO I;  3RL0 D;  3BVH A;  1DEE G;  2Z4E A;  3BAT A;  3CD6 P;  2R32 A;  1VQM P;  2QJY B;  3A0H H;  2IYO A;  3CI9 A;  1NTZ K;  3PHL A;  1JM0 A;  4EIJ A;  2Q9I A;  2KI7 B;  5APX A;  1YTZ I;  1FDM A;  3L74 J;  1M1K Q;  1BCC E;  3L72 E;  3AE2 C;  2A06 D;  1GMJ A;  1M7L A;  3C1L A;  5BU5 A;  1A02 J;  1KIL C;  1KQL A;  5M1B A;  1NU1 D;  2NRG A;  3RK2 D;  4HH2 A;  1L2P A;  1LT9 C;  2YO2 A;  2ZYG A;  2IZ0 A;  3C9I A;  3H1I J;  2OYO A;  4HKZ H;  1FDO A;  3RK3 B;  5B5E E;  5GTI H;  3G4S P;  1EDL A;  3ITK A;  5AVQ B;  4EOT A;  1VQO P;  1L0N D;  2R3C A;  3B5N A;  1VF5 D;  3A0B E;  1KQS O;  1X9V A;  1JMB A;  2POH A;  1IO4 A;  2RH0 A;  4OGQ B;  4W80 A;  5KAI E;  3P8C D;  2ZXE B;  1H0T A;  1JTH A;  4XA4 A;  3H1L J;  4H13 B;  3TYY A;  1SQB D;  1H0T B;  2K9J B;  1OW8 A;  1RQU A;  3H1L D;  2ZYD A;  4YTP C;  4BWN A;  2JWA A;  1JY3 O;  2R5D A;  2Y0D A;  3NMD A;  1EZV I;  4GOD A;  4IL6 E;  4JQ0 D;  4ZKU A;  1SQX D;  4MN4 C;  3RK2 C;  1W2B O;  2XNX A;  3Q5S A;  4L73 A;  2LR2 A;  2KUB A;  3CCQ P;  1JO5 A;  2A06 G;  2V7Q J;  1RE3 C;  1NU1 G;  1N73 A;  2KLU A;  2J5U A;  3L71 G;  3IN6 A;  2A45 H;  3ZDM A;  1H8A A;  5AW1 B;  4EYY Q;  3L70 J;  4ASV A;  1ZOY C;  3VP9 A;  1MKM A;  1T6A A;  5AW5 B;  1VQ9 P;  4WY4 A;  1LTI C;  3CLQ A;  1D7M A;  2P7J A;  3Q1M A;  1RF1 A;  5CCH C;  1OX3 A;  4JYB A;  3TGU E;  4I7Z C;  2IBZ G;  1LT1 A;  1BDC A;  2N9Y B;  1T8Z A;  3FWL A;  3KZI H;  3M06 A;  2XDJ A;  3M9Q A;  3SFE C;  1RF0 A;  4HYT B;  1QGK B;  3CXH D;  4C7N B;  1KIL B;  3KDP B; 
#chains in the Genus database with same CATH homology
 3L37 A;  1W2E A;  1IFM A;  1FZA A;  2P67 A;  1A02 J;  2O1J A;  1J1E C;  1SVF A;  3L36 A;  4JF7 A;  2Q7C A;  5AVX B;  1GD2 E;  1FAV A;  2NPS D;  1E5W A;  3SWF A;  3V2R A;  1HUC A;  1MV8 A;  1URQ D;  3A7O A;  3M91 A;  2C9L Y;  1N86 A;  1G2C B;  1T2K D;  1NO4 A;  5AVT B;  2IX7 C;  2KSJ A;  3V4Q A;  2JEE A;  4IFF A;  3PP5 A;  5CCG C;  3P32 A;  2KP8 A;  4GKG A;  2IFN A;  1CW5 A;  2H8P D;  3H32 A;  2W27 A;  3M0A A;  1L4A A;  4W7Y A;  1JCD A;  1L4A B;  2FKW B;  5CJ4 A;  2QM8 A;  5CMZ A;  1T2K C;  1L4A C;  1M1J A;  1FOS E;  2E43 A;  4DZO A;  2KYV A;  2KOG A;  3HD7 C;  5AW2 B;  4RES B;  2OYI B;  1JMM A;  5AVS B;  5AVV B;  2YNY A;  3BRT B;  1J2J B;  1LT9 A;  2W6A A;  3GHG A;  1RF0 C;  1N73 C;  2A45 G;  1WRG A;  3TNU A;  1NOH A;  2R5B A;  4W7Z A;  1RF1 C;  3A2A A;  2WWW A;  1MUU A;  3V2P A;  2YMY A;  1J1E B;  3R2P A;  1T3U A;  4Y99 B;  2OAR A;  1JOC A;  2HG5 D;  4JYC A;  3VTP C;  1URQ B;  5CCG A;  3BAS A;  2P2U A;  4WY4 C;  2NPS C;  2HFE D;  1SQQ K;  1SFC B;  1GTW A;  3N7N A;  3L35 A;  4B86 A;  3U1A A;  3MGN A;  1FJK A;  2WT7 A;  1GK6 A;  5AVU B;  1JY2 O;  3HD7 A;  5APQ A;  2FYZ A;  5AW0 B;  1QL1 A;  1NWQ A;  1GL2 D;  3TSI A;  1N7S B;  2OYH C;  3M0D A;  3VYI A;  5APS A;  3B5N C;  4ZKP A;  4O9B A;  3RL0 C;  4N78 D;  1T3J A;  1SP4 A;  1M1J B;  2IFM A;  1H89 A;  1FZF A;  3EFG A;  1CZQ A;  1CSB A;  3TK1 A;  3IFM A;  5AW7 B;  1FDM A;  1Z56 A;  1KZU B;  3UIA A;  2E42 A;  3P8C E;  3OJA B;  3RL0 B;  1J1D B;  1IJD B;  1JY2 P;  2J58 A;  1JCC A;  1FZC B;  1GL2 B;  1N7S C;  2OYH B;  1G1J A;  1ZV8 A;  2FXM A;  2HOD B;  4M3L A;  1SQP K;  3MUD A;  3NFQ A;  2WZ7 A;  1PFI A;  2O1K A;  1FJP A;  2C0X A;  3G3Z A;  2HPC A;  1NKN A;  1ZR4 A;  1IFJ A;  3HTK B;  5CJ0 A;  1NKZ B;  3HD7 D;  1LTA C;  2GUV A;  3SWY A;  1QL2 A;  1AQ5 A;  3VOP A;  5AW6 B;  1IC2 A;  3II6 A;  4Y99 C;  2NPS A;  1JY2 N;  3P7K A;  3O8Z A;  4N3Y B;  4GIF A;  5AVZ B;  3E1I A;  1SFC C;  3OAK A;  5AVY B;  1FZG A;  1HVV A;  5CCG D;  1FBM A;  2HLO A;  2QM7 A;  1LTS C;  1X8Y A;  5AVR B;  3VMZ A;  2CPS A;  2I1K A;  5AW4 B;  4KHX A;  2LKM A;  5CHX A;  2J59 M;  1LWU A;  3N4X A;  1YTZ T;  3HE4 B;  1DH3 A;  1KFN A;  2WSF H;  1GDT A;  1N2D C;  5KLV K;  3NXS A;  1N7L A;  3V4W A;  5CCH A;  3B8E B;  1LTG C;  1ZLL A;  1G1I A;  5CCH D;  2WT7 B;  3CL3 D;  2FFD C;  1LTJ A;  3KQG A;  4GT1 A;  1ZN5 A;  2Z5I A;  5BVZ A;  3L4F A;  1RY3 A;  1JUN A;  2WSE H;  2YO3 A;  2N1T D;  3NTN A;  1LWU B;  1VDF A;  3HUS C;  4LLH A;  5KJ7 C;  1RF1 B;  1FZC C;  4WY4 B;  3VMY A;  3HD7 B;  1IFN A;  3IR9 A;  1S9K D;  1X79 B;  1SQB K;  2Q3I A;  1NAF A;  1JY3 N;  3B5N D;  1URQ C;  4I6M C;  2WTY A;  1AFO A;  3VP8 A;  3U1C A;  1RE4 A;  2N1T C;  1HGZ A;  1SFC A;  2KB7 P;  2P1J A;  5APV A;  5KTB A;  1LGH B;  4AUW A;  4WBA A;  5KJ7 D;  3HUS A;  3M9H A;  2BAS A;  1SLQ A;  3P8M C;  2H7H A;  3M9B A;  2HYN A;  2XU6 A;  1HGV A;  2GM4 A;  3U59 A;  2WSC H;  2YKO A;  1RE3 A;  2WIT A;  1HTL C;  1XTC C;  2OYI A;  3HRN A;  2YKP A;  1IK9 A;  3M0D C;  1VPC A;  1YYC A;  1GL2 A;  2N9B A;  5AW9 B;  4DOJ A;  2WPQ A;  1MFZ A;  3TNU B;  3WMM 0;  1GL2 C;  5AW8 B;  1NH4 A;  5APW A;  3V2Q A;  4IFD K;  2NPS B;  1OWA A;  1XTG B;  1J1D C;  1SQV K;  5APT A;  1FU1 A;  1CI6 B;  2M8R A;  1GW3 A;  4AYC A;  1IFI A;  1JY3 P;  1S9K E;  2FYU K;  3GHG C;  5AW3 B;  2GUS A;  3OA7 A;  3BRV B;  1LTJ C;  3VN0 A;  4C7R A;  1URQ A;  1DX7 A;  2XV5 A;  1HJB A;  5APY A;  4N78 E;  2HPC B;  1LTT C;  2C0W A;  2PAJ A;  4WB4 A;  4AQR D;  1EQ7 A;  2YKQ A;  2A45 I;  1SFC D;  2MJZ A;  3LIE A;  2XKM A;  3I5C A;  1N73 B;  1FZC A;  1JTH B;  3HUS B;  1A02 F;  1LT9 B;  1GU4 A;  1LWU C;  5AVW B;  4XE5 B;  1NTM K;  2M3B A;  1HBW A;  1H88 A;  1GK4 A;  4C7N A;  2XZR A;  2FFD A;  1NTK K;  2OYI C;  2I1J A;  3VMX A;  4WY4 D;  5BU8 B;  2H43 A;  1KIL A;  1GZL A;  1IFD A;  1LTB C;  3EQ2 A;  2WPS A;  2KLV A;  1SQX K;  4LGD E;  3A5T A;  3RK2 B;  2C9N Y;  3KPE A;  3V2N A;  2Z5H A;  1OXZ A;  3MD0 A;  2WPR A;  4C46 A;  1HH0 A;  2FFD B;  1FOS F;  1WT6 A;  3MIW A;  3T97 A;  1DEB A;  1L0L K;  2ZFC A;  3RK3 C;  2W6B A;  2PP6 A;  1ZR2 A;  2Q5U A;  1NU1 K;  1HWT C;  3MTU E;  2VRS A;  3LW5 H;  1L0N K;  1GW4 A;  3HTK A;  3KYQ A;  1N7S A;  1G2C A;  2OYH A;  1N7S D;  1NHL A;  4N6J A;  5KJ7 A;  3V5B A;  1LTJ B;  4IFM A;  4OH8 B;  1KFM A;  2O01 H;  3RK3 D;  4LC1 A;  3GHG B;  5APU A;  2HOD A;  1L4A D;  4I1L A;  3HE5 B;  5AVQ B;  3A3Y B;  1KIL D;  2L5G B;  3HE5 A;  2N1T B;  2CPB A;  1MZ9 A;  1M1J C;  1CI6 A;  3H32 B;  1FZB A;  1RE4 C;  2JJL A;  2N1T A;  3LID A;  3HE4 A;  3H6P A;  4I2L C;  1JNM A;  3B5N B;  2IPP A;  1FZE A;  3RL0 D;  3BVH A;  2Z4E A;  3BAT A;  2R32 A;  3CI9 A;  1NTZ K;  4EIJ A;  2Q9I A;  5APX A;  1YTZ I;  5BU5 A;  1M7L A;  1KIL C;  1KQL A;  3RK2 D;  1GU5 A;  4HH2 A;  1LT9 C;  2YO2 A;  3C9I A;  3RK3 B;  4EOT A;  2R3C A;  3B5N A;  1X9V A;  2POH A;  1IO4 A;  4W80 A;  3P8C D;  2ZXE B;  1JTH A;  4XA4 A;  3TYY A;  1JY3 O;  2R5D A;  3NMD A;  4ZKU A;  3RK2 C;  2XNX A;  1JO5 A;  1RE3 C;  1N73 A;  2A45 H;  1H8A A;  5AW1 B;  3VP9 A;  5AW5 B;  4WY4 A;  1LTI C;  3CLQ A;  2P7J A;  1RF1 A;  5CCH C;  4JYB A;  1T8Z A;  3M06 A;  2XDJ A;  3M9Q A;  1RF0 A;  4HYT B;  4C7N B;  1KIL B;  3KDP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...