3TNUA

Heterocomplex of coil 2b domains of human intermediate filament proteins, keratin 5 (krt5) and keratin 14 (krt14)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
90
structure length
90
Chain Sequence
SELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Keratin, type I cytoskeletal 14
publication title Structural basis for heteromeric assembly and perinuclear organization of keratin filaments.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytosolic protein
total genus 44
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3tnuA00
1H89A 5APYA 4XE5B 1H8AA 4AQRD 5AW1B 5AVSB 5APTA 1CZQA 1CI6B 3VYIA 3M9HA 5APSA 2P2UA 1GK6A 3HTKA 2JJLA 3TNUA 1T2KC 5AVWB 2ZFCA 1FOSF 2QM7A 1S9KD 1KQLA 3I5CA 1FOSE 5AVYB 3HE5B 2P67A 2XU6A 3HE5A 4HYTB 2H7HA 2Q5UA 2E42A 3V5BA 2XZRA 4B86A 1FAVA 4C46A 4EOTA 1JNMA 2VRSA 3V4QA 3VN0A 1DH3A 4RESB 5AW8B 3KDPB 2R32A 4I2LC 5APWA 1CSBA 4JYCA 3P32A 1X8YA 3A3YB 1CI6A 3LIEA 1GTWA 1GU5A 1GZLA 1OWAA 5AW6B 2XV5A 2R5DA 3NMDA 4AYCA 5APUA 1MV8A 4DZOA 2C9NY 2WPSA 2WTYA 1GK4A 5AW4B 5AVTB 5AVXB 2Z5HA 2BASA 3IR9A 4I6MC 2WPRA 4GT1A 1HUCA 1NWQA 3MGNA 3VMYA 3M91A 1SLQA 1T2KD 1HBWA 3VTPC 3L36A 5CMZA 5AVZB 2R5BA 1JUNA 3A5TA 1SP4A 5AVQB 5AVVB 2C9LY 1G2CB 5APQA 1S9KE 3M9BA 2YNYA 3NTNA 3TYYA 3A2AA 2R3CA 1H88A 1IO4A 1J2JB 2IPPA 1OXZA 2Q3IA 3V4WA 4GKGA 3P8MC 4M3LA 3HE4B 5AW2B 3L35A 3OAKA 3B8EB 3P7KA 2Q7CA 3T97A 1NAFA 4KHXA 1HWTC 5AW0B 2N9BA 2Z5IA 2QM8A 2W27A 2WWWA 2ZXEB 4JYBA 3NXSA 5AW9B 3UIAA 5AVUB 3A7OA 3KQGA 3LIDA 5APVA 3O8ZA 1MUUA 5AVRB 3TK1A 1A02F 1A02J 5AW7B 1YYCA 1GU4A 3TNUB 1MFZA 2W6AA 3MD0A 5AW5B 4LC1A 3M06A 4C7NA 4C7NB 3M0AA 3L37A 3HE4A 4AUWA 2WPQA 1HJBA 5AW3B 2KP8A 3NFQA 3SWFA 2YO2A 5APXA 2WT7A 2P7JA 3VMZA 2WT7B 2E43A 3M0DA 1GD2E 2YO3A 3VMXA
chains in the Genus database with same CATH superfamily
2Y0DA 1EZVE 1KZUB 2W83C 3M9HA 3CI9A 1NTKG 3TNUA 1SS1A 4HYTB 2J5UA 2XU6A 1L4AD 1JOCA 3V5BA 2XZRA 3BRTB 4C46A 4JQ0D 4BRYA 1FZAA 2Y9YA 1JEKA 1L4AA 3RL0g 2FYUJ 1X8YA 3L71J 3MIWA 3CD6P 3Q5PA 1KYOH 2WSFJ 4DZOA 1IZNB 2WPSA 5CJ4A 1HUCA 1EDIA 3D6YA 3MUDA 2E76C 1ZRTE 4H0LC 1EZVD 2H8PD 3GF3A 2N1TC 3TYYA 3A2AA 3D6ZA 2OQQA 2ZAEB 3E7KA 1JY2O 1Q81Q 4Z1MH 1L4AC 1IJDB 3KQGA 1RQUA 4R4MA 1K73Q 1EZVG 1SQVD 3MP7B 3BRVB 2AXTE 3MD0A 4OWFA 4ASWA 1ZN5A 1R5LA 5KTBA 1HJBA 3FWLA 2BCCE 2WT7B 1EXIA 3MUDC 3L72D 1ZRTD 1D7MA 3W67A 1MFTA 1SQVG 3HE5A 1M1JA 3CCUP 3E1IA 4ZKUA 1S2EA 2HYNA 1FZBA 1Q82Q 2RH0A 3A0HH 2J59M 3CX5I 1YBKA 2R32A 2WSCH 1FZEA 3LW5H 4UB6E 1Y8AA 1Q2NA 3KYQA 5KAIE 5CCGD 1NU1E 1IFJA 1OZHA 2BCCD 3AEEC 1T2KD 4OGQB 3C1LA 2FY8A 1NTKJ 1PV3A 3V2QA 1KB9D 4MN4C 5CCGA 1HGZA 1NTZE 2O01H 1Z56A 3NTNA 1PPJE 1M1JC 4NPDA 3R4YA 1NH4A 1HWTC 1RF1A 3NXSA 3UIAA 2BCCG 1NJIQ 1URQC 2Y0EA 1MFZA 1JTHA 2YXQB 2G3AA 2ZJSE 4C7NB 3M0AA 5AW3B 3B4SA 1H0TA 3O6QB 4GODA 3H1LE 5CCGC 1ZW0A 3RGUA 1KORA 2P2UA 4H0LB 1GK6A 3Q2YA 1T2KC 1NTZD 1KQLA 1PPJD 2N1TB 2ZYAA 4RKUJ 3SSUA 1N73A 4L75A 1SQQK 1NU1G 4DT0A 2K3RA 3VMAA 1L4AB 1VQ4P 1DD3A 1GW4A 2QVAA 1ZLLA 3HUSC 1HJ0A 1KQFB 1YTZI 1NTZG 2R44A 1EC5A 1PPJG 5KLIC 1FS0E 4WY4D 4WBAA 4LGDE 4YXWH 1NWQA 1BGYD 2FFDA 1SQVJ 3H1LD 4RO0A 4WY4A 3VP9A 2E5TA 2Y9ZA 4U3FE 2R3CA 1NHLA 3W68A 3CWBE 2Q3IA 4M3LA 1IK7A 5H2FH 1N73C 1BE3E 1LTSC 3P7KA 2Q7CA 3II6A 2QJYC 3L72J 3S9OA 1XTGB 1BGYG 3AE8C 2OTLP 3H1LG 3U1AA 2AXTH 3HE4A 2WPQA 1LWUA 2FYUK 1VQ5P 4XFJA 3WU2H 4PD4H 1EDJA 3WUVA 1DEEG 4KJMA 2FFDC 1H8AA 5APTA 2AEFA 2JP3A 4EDFA 1PL5A 4N6JA 2WQYC 1SVFA 2B9BA 3HE5B 1M1JB 3CWBD 2BCCJ 1NOHA 5KJ7D 5M1BA 5TISH 1BDDA 2WPVB 1CSBA 2E75D 1OWAA 5KJ7A 1W5CE 4UB6H 2C9NY 1LWUC 5AW4B 2BASA 2HPCA 3CWBG 1KV4A 3G9RA 3IN6A 4IFDK 4GOEA 3L36A 4DJGA 1LT1A 3AE6C 3TDKA 1KTMA 3CXHH 1RF0A 4KHXA 2YXRB 5GTIE 2ZYGA 4JYBA 2KZIA 1RF1B 3JSVC 2M5AA 2V7QJ 5AW9B 1YHQP 4YPCA 2DW3A 1NTZJ 2NPSD 1JTHB 1USEA 2FXOA 2KZJA 1LTIC 3P8CD 3KHUA 5KLIB 2NPSA 1H89A 1X9VA 2W8ZA 2OTJP 3SWKA 1KYOD 2QM7A 1FJKA 2FYNC 2IZ1A 1NTKK 1RF0C 2Q5UA 1FAVA 1N73B 2VRSA 1BGYJ 1NTME 1DH3A 1MKMA 3H1LJ 1JY3O 2QJYB 2LKMA 4IFMA 3EFGA 3WUUA 5AW6B 1N7LA 1LNQA 1MV8A 4WWIA 1DIPA 3A0HE 2NPSC 3USSA 1L0NE 1FE6A 2FFDB 5CMZA 4WY4B 2OYIA 3JC22 3D71A 3C9IA 4GKGA 2XDJA 1IFPA 2QM8A 2W27A 1AV1A 1NTMD 3BATA 1MUUA 1VDFA 1JO5A 2Q6QA 2G8YA 5CJ0A 2P58A 3CWBJ 3H32A 4LC1A 3RK2D 1LWUB 2NRGA 1T8ZA 4LLHA 5EFWB 2NZ2A 5AW1B 1NTMG 2OYIC 1PGQA 1L0ND 1S72P 1ZV8A 3HTKA 2JJLA 4HKZH 1FU1A 2ZFCA 2P67A 1JCCA 2FBWC 2OTKE 1M8OB 1L2PA 2W6JH 1SQVK 2CPBA 4B86A 2E76D 3V4QA 3KZIH 3IAOA 4RESB 1UIIA 1WMKA 3V6IA 1JMBA 3MHVA 1L0NG 1OIPA 2KYVA 1K9MQ 1VPCA 1QLED 3AE5C 2N1TA 2M3EA 1IFMA 2E75B 3AE4C 2HPCB 4GT1A 3Q5SA 1IC2A 1HGVA 1HBWA 3AE3C 3VTPC 3RK2C 2JDIH 2PAJA 2Q3EA 1GL2D 3QWOC 1K04A 5APQA 4R4LA 2IBZE 2M0BA 1NVOA 1P84I 3V4WA 2FYNB 1AVOA 4QMAA 2L5GB 1L0LE 4PV1C 1RHZB 2M5AB 1SQXE 1U7MA 2I1KA 5AVRB 5GTIH 1VQOP 1WRGA 3H1JE 5H2FE 1M90Q 2KNCA 4JF7A 4L74A 2WITA 3G4SP 1JCDA 4HH2A 2D2CC 3AEBC 2NPSB 3BVHA 5L8RJ 3CCJP 2A45I 1HTLC 1JMMA 1GL2C 2IBZD 1VF5D 3WU2E 1LGHB 4PD4E 3CMEP 3M0DC 2IX7C 1L0LD 1ZR4A 3VN0A 1S1CX 4H13D 1BDCA 2E5YA 1KC8Q 2E74D 2GUVA 1GK4A 1K05A 5TISE 2P10A 2IBZG 1NTZK 1URQD 2QSIA 1NTMJ 1SLQA 3PRJA 1L0LG 4GDOA 3HD7C 3JCUE 1IFIA 2R5BA 3A5TA 2I1JA 2KOGA 2OYIB 2YNYA 2RKLA 1URQA 4RJTA 3AE2C 1H88A 3H1JG 5AW2B 2YMYA 3T97A 1KQGB 2Z5IA 4PD4D 2O1JA 2Y0CA 1JY2P 2ZVNB 1YJ9P 1VF5C 3LW5J 1L0NJ 3AEDC 3BASA 3CXHE 2H88C 1J1EC 5DJTB 3H32B 1OW6A 2MJZA 3ITKA 3HRNA 4H13C 1YI2P 5CBOA 2HLOA 2E74C 1LTBC 1X22A 3TGUE 2O01J 3RK2B 3HTKB 3H1HE 4KT0J 2KIKA 3HUSA 4ZKPA 1OMIA 1LTJA 1NU1D 3I55P 2K9YA 2K1AA 1YITP 3PJSK 2QEXP 3F5HA 2E76B 3RBXA 3CXHD 5APUA 1GMJA 3FX0A 3CCQP 3CLQA 2Z5HA 3VMYA 3FXEA 3H25A 2XNXA 2YIUC 3TGUD 3AECC 1YQ3C 1G2CA 1EZVI 3L73E 4YXDC 3H1HD 2IPPA 2R3SA 1LTJC 1GL2B 1GDTA 5B5EE 3B5ND 2J58A 3L74E 5APVA 3H1IE 1Q86Q 1G1IA 3R2PA 3TGUG 1VQLP 3B5NA 2KNCB 3SFEC 3GG2A 3H1HG 1QL2A 2IYPA 1N86A 1LP1B 2KP8A 1L0LJ 3OW2O 3F89A 1VQ6P 3FWNA 1PZQA 5GTHH 1CI6B 3GLMA 5CCHD 3C8VA 2PP6A 3L73D 1M7LA 4L76A 2W6BA 4EOTA 2C0XA 2L91A 1JNMA 1NYHA 1FZFA 5AW8B 2ZT9D 2K37A 1VF5B 2JKVA 3B5NC 4HJGH 3H1ID 5KAFH 3L70E 2R5DA 5CBNA 1HVVA 1S4XA 1QVFO 4N78E 4H44D 4U3FD 1YJWP 1S5LH 3L73G 3KZIE 3SWYA 2XNDH 3KPEA 4H13B 1BE3D 1UIXA 3MGNA 4OH8B 2HODA 1ZMEC 2E74B 5AVZB 1X0TA 2AEJA 4TT3H 1AQTA 1S9KE 3JCUH 1URQB 1KB9I 3H1IG 4IL6X 4W7YA 1S5LX 5KKZC 3T97B 4U3FG 5CCHC 2IFMA 2YKPA 1BE3G 1SQPE 1W2EA 1WT6A 4ZNCA 1M1KQ 1P84E 3PH0A 2W6AA 2ZT9C 2JO1A 1NKNA 3M06A 3AE9C 3L37A 2OYHC 5KLVE 1NU1J 2C0WA 1OFCX 3OA7A 4H44C 1GD2E 1PGJA 1DX7A 3VMXA 1EDKA 2HG5D 4Y99C 3WMM0 2YIUB 2OGUA 3ZDMA 2Q9IA 4PJ0H 1NTMK 1S9KD 1KILE 3B71A 3HUSB 3L70G 5TJHA 3OJAB 2E42A 2UWJE 1LTJB 3TGUJ 3L4FA 3KDPB 1LTTC 4W7ZA 1LJ2A 2M3BA 1BSNA 1SQPD 3A3YB 4W80A 3H1HJ 2HFED 2WSEH 3EQ2A 2RMZA 1VQNP 1Q90D 1U57A 5AVTB 5KLVD 2WVRA 1JM0A 1R5SA 1VQ7P 1G2CB 5E79H 2YMKA 1J1DC 3M9BA 4ZMDA 1SQPG 4OVNF 1KILD 2Q1KA 1QEXA 3B8EB 3CX5E 1FZCC 2Z4EA 3CL3D 2H89C 5KLVG 5B5EH 1KILA 5AW7B 3L73J 3B5NB 1OW7A 1PGOA 2CPSA 1LT9A 1ZP0C 3CPWO 4AUWA 1BSHA 2FXPA 3K5BA 4XA4A 1MZ9A 2P7JA 2PGDA 3GMAA 1NTKE 3H1IJ 5AVSB 3VYIA 2QJKC 2M8RA 3IF4A 4U3FJ 3I5CA 4CPGA 4A7PA 1N8RQ 1BE3J 5KKZB 1OVUA 2MKVA 1OVRA 1IK9A 1KILC 4NPFX 2BEQD 3CCRP 5B66E 1JY3P 1GU5A 2QE7H 4JPZB 1LT9C 4AYCA 1QL1A 4PV1D 2QJPC 1FBMA 2ZT9B 4L73A 3EWKA 2A06E 1RE3C 2OYHB 3CCLP 1OW8A 1BCCE 2KB7P 1SQBE 2HODB 3H1KE 4H44B 1JUNA 4Y99B 2C9LY 1L0LK 4O9BA 2D2CD 1YIJP 1IO4A 1HH0A 5AW0B 1SFCD 3N7NA 5AVUB 1RQVA 1VL2A 3TK1A 1A02J 1RY3A 2WMMA 2GUSA 1P84H 1SFCA 4WB4A 3GW6A 4EIJA 4WVZA 1HF9A 2WSFH 3NFQA 4DOJA 1GL2A 2A06D 1JB0J 4K3AA 3M0DA 1RE4A 1BCCD 2KSEA 5APYA 1SQBD 1SQPJ 3H1KD 2POHA 1SQVE 1QVGO 3CCSP 1J1DB 1FOSE 5AVYB 2YKOA 1KYOI 1FDIA 3U1CA 5KLVJ 3HD7D 1LP1A 1FZCB 3AEFC 3GF7A 2A06G 5GTHE 3L72E 1M56D 1N7SD 1BCCG 5APWA 2IZ0A 2A45H 2OYOA 1SQBG 1CI6A 1SFCC 3H1KG 1VQKP 2I8DA 3HD7A 2XV5A 2O01N 4UB8H 2V4HA 3GHGA 2GA1A 1N7SA 1CW5A 1Q7YQ 5AVXB 1RE4C 1OVVA 2ZVOB 5KAFE 1SQXD 3L75E 2OARA 1EXJA 1NU1K 1ZOYC 4IL6E 5BU8B 3H1JD 2QJKB 1S5LE 2JWAA 1KN7A 2B87A 3AE1C 3P8MC 3CCEP 4HB1A 2IDBA 2ZXEB 3CX5H 2YKQA 3A7OA 1KB9E 1KFNA 2KS1A 2SPZA 3V2NA 1KILB 1KQSO 4BXLA 1AVYA 1SQXG 1YTZT 3GHGC 3CC4P 3CC2P 1FC2C 1N7SC 1LT9B 2AEMA 3RBZA 5C39A 2JWDA 2QJPB 1VQPP 1R8EA 2HR3A 2FYZA 3VMZA 1JY2N 1GTWA 2WSCJ 3Q5RA 3A0BH 1S3JA 2GM4A 4D6TE 3L72G 1NGMB 5APSA 3L75D 1NAYA 2KSJA 2O1KA 1NKZB 1PIXA 3G71P 5DJUB 2QRXA 2CK3H 1ZR2A 1KFMA 4I1LA 4PJ0E 2B88A 3NMDA 3CCVP 5B66H 3L75G 3QH9A 2QG4A 4I6MC 3IFMA 1EDLA 5CHXA 2WPRA 1ZXGA 4IOIH 3M91A 4PV1B 1YQ4C 2KI7B 2ITAA 1DEBA 3BCCE 3V2RA 4YTPC 4I7ZC 4D6TD 1KMIZ 3G6EP 1PP9E 3OAKA 3AE7C 3M9QA 1VQMP 1BGYE 2WWWA 1BCCJ 3RK3E 1SQBJ 2D2CB 3H1KJ 3KXDA 5E79E 1AJYA 1GU4A 3TNUB 2WSSH 1SFCB 4D6TG 1W2BO 1XTCC 3AEGC 3SFDC 1IFNA 1RF1C 1EQ7A 1G1JA 4BRYB 3G3ZA 3Q1MA 2E43A 3CCMP 2ZYDA 3BCCD 1FOSF 2QIWA 2FKWB 4U7JA 1PP9D 2IBZI 2B89A 1X79B 1T3UA 3RK3D 1SQXJ 2LR2A 4JYCA 3P32A 3H1JJ 3LIEA 3HD7B 3BCCG 1SQQE 3GHGB 3Q3DA 2KLUA 3V2PA 3ABVC 1N7SB 1LTAC 2ZXXA 3RL0D 2IYOA 2QA4P 3CMAP 1PP9G 5CCHA 1AQ5A 3N4XA 2H43A 2O3JA 1Y9BA 3L74D 3I56P 5K5GB 2B87B 1OXZA 2PFXA 4IL6H 3PP5A 1LTGC 1SQPK 2AXCA 1J1EB 3L35A 4GIFA 1NAFA 1FZGA 4EI2A 2OYHA 2KK7A 4PD4I 1TU3F 4WY4C 1T6AA 2K9JA 2KS1B 1Y47A 3L75J 5KLVK 1KB9H 1FDOA 3L74G 3RK3C 3PTZA 3PLNA 1SQQD 3FXDA 5BVZA 4GOFA 2YO3A 2FXMA 1CZQA 3RL0C 2FYUE 3L71E 2KUBA 5AVWB 4BWNA 4I7ZB 3L70D 2H7HA 4N78D 3P8CE 1FJPA 1SQQG 3AEAC 2W90A 5KAIH 2RN0A 2V7QH 4D6TJ 1M57D 1KYOE 1GZLA 4Y28J 3CXHI 4N3YB 2LXBA 3WUTA 3IR9A 3D70A 2XKMA 3E1RA 1FZCA 5KJ7C 1E5WA 5AVQB 5AVVB 4UB8E 2FYUD 1P84D 3L71D 3TSIA 2E75C 3FGAD 1YJNP 1L0NK 2LXCB 1H0TB 3PHLA 2KLVA 2PRRA 2JEEA 1OX3A 3BCCJ 2IFNA 1YYCA 2WSEJ 3S1KA 5AW5B 2FYUG 3L71G 1PP9J 2JR8A 1USDA 1DD4A 1VQ9P 5APXA 4C7RA 2WT7A 4XE5B 4AQRD 4TLFA 4K35A 2WZ7A 3VOPA 1PGPA 4ASVA 1E79H 3H6PA 2KXPB 1QGKB 3U59A 2BEZF 1U7JA 3A0BE 1RE3A 3MZWB 3L74J 1N2DC 1NO4A 1T3JA 4I2LC 2A45G 2N9YB 1GW3A 4OGQD 1SQBK 4IFFA 3RK3B 1RH5B 1K8AQ 2WTYA 3TF5A 3CX5D 4JBZA 1IFDA 1SP4A 1JY3N 1QX8A 1PFIA 3RL0B 3CC7P 1SQQJ 1VQ8P 1J2JB 3MTUE 3HE4B 5BU5A 3EFFK 2N9BA 3LIDA 3O8ZA 2K9JB 1A02F 4EYYQ 1NTKD 3L70J 3VP8A 4NPEA 1AA0A 1SQXK 4C7NA 1FDMA 3S4RA 1AFOA 2P1JA 4H0LD 4OGQC 1KD1Q 2YO2A 4DCKA 3SWFA 2K88A 3O6QA 2N1TD
chains in the Genus database with same CATH topology
1H89A 1X9VA 2GM4A 1CI6B 1KZUB 3M9HA 5APSA 3CI9A 5CCHD 3TNUA 2PP6A 2QM7A 1FJKA 4HYTB 2KSJA 2XU6A 1NTKK 1RF0C 1L4AD 2Q5UA 2O1KA 1NKZB 1JOCA 1M7LA 3V5BA 2W6BA 2XZRA 3BRTB 1FAVA 4C46A 4EOTA 2C0XA 1N73B 1JNMA 2VRSA 1FZFA 1DH3A 5AW8B 1FZAA 1L4AA 1JY3O 1ZR2A 1KFMA 4I1LA 2LKMA 1X8YA 4IFMA 3B5NC 3MIWA 3EFGA 5AW6B 1N7LA 2R5DA 1HVVA 3NMDA 4N78E 1MV8A 4DZOA 2WPSA 5CJ4A 3SWYA 2NPSC 4I6MC 3IFMA 3KPEA 5CHXA 2WPRA 1HUCA 3MGNA 4OH8B 3M91A 2HODA 3MUDA 1DEBA 2FFDB 5CMZA 5AVZB 3V2RA 2H8PD 4WY4B 2OYIA 1S9KE 1URQB 2N1TC 3TYYA 3A2AA 3C9IA 4W7YA 4GKGA 2XDJA 3OAKA 3M9QA 5CCHC 1JY2O 2IFMA 2QM8A 2W27A 2WWWA 1L4AC 2YKPA 1IJDB 3KQGA 3BATA 1MUUA 1VDFA 1W2EA 1WT6A 1JO5A 1GU4A 3TNUB 5CJ0A 2W6AA 1SFCB 3BRVB 3MD0A 1NKNA 1ZN5A 3H32A 4LC1A 3M06A 5KTBA 3L37A 1XTCC 3RK2D 2OYHC 1IFNA 1HJBA 1RF1C 1LWUB 1EQ7A 1T8ZA 2WT7B 1G1JA 3G3ZA 4LLHA 2E43A 2C0WA 3OA7A 1DX7A 1GD2E 3VMXA 2HG5D 4Y99C 5AW1B 2OYIC 3WMM0 2Q9IA 1ZV8A 3HTKA 2JJLA 1FU1A 1NTMK 2ZFCA 1FOSF 1S9KD 3HE5A 2P67A 3HUSB 1M1JA 1JCCA 3E1IA 4ZKUA 3OJAB 2E42A 2FKWB 2HYNA 1SQVK 1FZBA 2CPBA 4B86A 1LTJB 3V4QA 1X79B 1T3UA 2J59M 4RESB 3RK3D 3L4FA 3KDPB 2R32A 1LTTC 4W7ZA 2M3BA 2WSCH 1FZEA 3P32A 4JYCA 3LW5H 3A3YB 3LIEA 4W80A 3HD7B 2KYVA 2HFED 1VPCA 2WSEH 3EQ2A 3KYQA 3GHGB 2N1TA 3V2PA 1N7SB 5AVTB 5CCGD 1IFMA 1IFJA 2HPCB 1LTAC 3RL0D 4GT1A 5CCHA 1AQ5A 3N4XA 1IC2A 1HGVA 1T2KD 2H43A 1HBWA 3VTPC 3RK2C 2PAJA 3V2QA 1GL2D 1G2CB 5APQA 1HGZA 5CCGA 2O01H 1J1DC 1Z56A 3M9BA 3NTNA 1M1JC 1OXZA 3V4WA 1KILD 1NH4A 3PP5A 1LTGC 1SQPK 1J1EB 3L35A 3B8EB 4GIFA 1NAFA 2L5GB 1FZCC 1HWTC 1FZGA 2Z4EA 2OYHA 3CL3D 1RF1A 3NXSA 3UIAA 2I1KA 4WY4C 5AVRB 1WRGA 1KILA 1URQC 5KLVK 5AW7B 1MFZA 1JTHA 3B5NB 3RK3C 2CPSA 1LT9A 4JF7A 4C7NB 3M0AA 2WITA 1JCDA 4HH2A 5BVZA 4AUWA 5AW3B 4XA4A 1MZ9A 2P7JA 2NPSB 3BVHA 2YO3A 2FXMA 5CCGC 5AVSB 1CZQA 3VYIA 3RL0C 2P2UA 2A45I 1GK6A 2M8RA 1T2KC 5AVWB 1KQLA 3I5CA 1HTLC 2N1TB 1JMMA 2H7HA 1GL2C 4N78D 3P8CE 1FJPA 1LGHB 3M0DC 1N73A 2IX7C 1ZR4A 3VN0A 1IK9A 1SQQK 1KILC 1L4AB 1GW4A 1JY3P 1GU5A 1GZLA 1ZLLA 3HUSC 1LT9C 4AYCA 1QL1A 1YTZI 1FBMA 2GUVA 4N3YB 1GK4A 4WY4D 1RE3C 3IR9A 1NTZK 2OYHB 4WBAA 1URQD 4LGDE 1NWQA 2KB7P 1SLQA 2XKMA 1FZCA 2HODB 2FFDA 3HD7C 1IFIA 2R5BA 1E5WA 5KJ7C 1JUNA 3A5TA 2I1JA 2KOGA 4Y99B 4WY4A 5AVQB 5AVVB 3VP9A 1L0LK 2C9LY 2OYIB 4O9BA 2YNYA 1URQA 2R3CA 1NHLA 1H88A 3TSIA 1IO4A 2Q3IA 5AW2B 2YMYA 4M3LA 1L0NK 1N73C 1LTSC 3P7KA 2Q7CA 3T97A 3II6A 1HH0A 5AW0B 2Z5IA 2O1JA 1SFCD 1JY2P 2KLVA 3N7NA 2JEEA 5AVUB 3TK1A 1XTGB 2IFNA 1A02J 1RY3A 2GUSA 3BASA 1YYCA 1SFCA 1J1EC 4WB4A 5AW5B 3U1AA 3H32B 4EIJA 2MJZA 3HRNA 3HE4A 2WSFH 2WPQA 1LWUA 2FYUK 3NFQA 4DOJA 1GL2A 2HLOA 5APXA 4C7RA 2WT7A 3M0DA 2FFDC 1RE4A 1LTBC 5APYA 4XE5B 1H8AA 4AQRD 2POHA 5APTA 3RK2B 3HTKB 4N6JA 1J1DB 2WZ7A 1FOSE 1SVFA 5AVYB 2YKOA 3VOPA 3HE5B 3HUSA 1M1JB 4ZKPA 3U1CA 3H6PA 1NOHA 3HD7D 3U59A 5KJ7D 1LTJA 1FZCB 1RE3A 1N2DC 1NO4A 1T3JA 1N7SD 4I2LC 5APWA 1CSBA 2A45H 1CI6A 1SFCC 2A45G 3HD7A 1GW3A 1OWAA 5KJ7A 2XV5A 5APUA 1SQBK 4IFFA 3GHGA 2C9NY 3RK3B 1LWUC 2WTYA 1N7SA 5AW4B 1CW5A 5AVXB 3CLQA 2Z5HA 2BASA 2HPCA 1RE4C 4IFDK 3VMYA 2XNXA 3L36A 1IFDA 1SP4A 2OARA 1G2CA 1JY3N 1NU1K 1PFIA 5BU8B 3RL0B 1J2JB 2IPPA 3MTUE 3P8MC 3HE4B 5BU5A 1LTJC 1RF0A 1GL2B 4KHXA 1GDTA 2N9BA 3B5ND 2ZXEB 4JYBA 2J58A 1RF1B 5AW9B 2YKQA 3A7OA 5APVA 3LIDA 3O8ZA 1KFNA 3V2NA 1KILB 1A02F 1G1IA 3R2PA 1YTZT 2NPSD 3GHGC 1JTHB 3B5NA 3VP8A 1N7SC 1LT9B 1SQXK 4C7NA 1FDMA 1AFOA 1QL2A 2P1JA 1N86A 2KP8A 1LTIC 3P8CD 3SWFA 2YO2A 2FYZA 2NPSA 3VMZA 1JY2N 1GTWA 2N1TD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H89 A;  5APY A;  4XE5 B;  1H8A A;  4AQR D;  5AW1 B;  5AVS B;  5APT A;  1CZQ A;  1CI6 B;  3VYI A;  3M9H A;  5APS A;  2P2U A;  1GK6 A;  3HTK A;  2JJL A;  3TNU A;  1T2K C;  5AVW B;  2ZFC A;  1FOS F;  2QM7 A;  1S9K D;  1KQL A;  3I5C A;  1FOS E;  5AVY B;  3HE5 B;  2P67 A;  2XU6 A;  3HE5 A;  4HYT B;  2H7H A;  2Q5U A;  2E42 A;  3V5B A;  2XZR A;  4B86 A;  1FAV A;  4C46 A;  4EOT A;  1JNM A;  2VRS A;  3V4Q A;  3VN0 A;  1DH3 A;  4RES B;  5AW8 B;  3KDP B;  2R32 A;  4I2L C;  5APW A;  1CSB A;  4JYC A;  3P32 A;  1X8Y A;  3A3Y B;  1CI6 A;  3LIE A;  1GTW A;  1GU5 A;  1GZL A;  1OWA A;  5AW6 B;  2XV5 A;  2R5D A;  3NMD A;  4AYC A;  5APU A;  1MV8 A;  4DZO A;  2C9N Y;  2WPS A;  2WTY A;  1GK4 A;  5AW4 B;  5AVT B;  5AVX B;  2Z5H A;  2BAS A;  3IR9 A;  4I6M C;  2WPR A;  4GT1 A;  1HUC A;  1NWQ A;  3MGN A;  3VMY A;  3M91 A;  1SLQ A;  1T2K D;  1HBW A;  3VTP C;  3L36 A;  5CMZ A;  5AVZ B;  2R5B A;  1JUN A;  3A5T A;  1SP4 A;  5AVQ B;  5AVV B;  2C9L Y;  1G2C B;  5APQ A;  1S9K E;  3M9B A;  2YNY A;  3NTN A;  3TYY A;  3A2A A;  2R3C A;  1H88 A;  1IO4 A;  1J2J B;  2IPP A;  1OXZ A;  2Q3I A;  3V4W A;  4GKG A;  3P8M C;  4M3L A;  3HE4 B;  5AW2 B;  3L35 A;  3OAK A;  3B8E B;  3P7K A;  2Q7C A;  3T97 A;  1NAF A;  4KHX A;  1HWT C;  5AW0 B;  2N9B A;  2Z5I A;  2QM8 A;  2W27 A;  2WWW A;  2ZXE B;  4JYB A;  3NXS A;  5AW9 B;  3UIA A;  5AVU B;  3A7O A;  3KQG A;  3LID A;  5APV A;  3O8Z A;  1MUU A;  5AVR B;  3TK1 A;  1A02 F;  1A02 J;  5AW7 B;  1YYC A;  1GU4 A;  3TNU B;  1MFZ A;  2W6A A;  3MD0 A;  5AW5 B;  4LC1 A;  3M06 A;  4C7N A;  4C7N B;  3M0A A;  3L37 A;  3HE4 A;  4AUW A;  2WPQ A;  1HJB A;  5AW3 B;  2KP8 A;  3NFQ A;  3SWF A;  2YO2 A;  5APX A;  2WT7 A;  2P7J A;  3VMZ A;  2WT7 B;  2E43 A;  3M0D A;  1GD2 E;  2YO3 A;  3VMX A; 
#chains in the Genus database with same CATH topology
 2Y0D A;  1EZV E;  1KZU B;  2W83 C;  3M9H A;  3CI9 A;  1NTK G;  3TNU A;  1SS1 A;  4HYT B;  2J5U A;  2XU6 A;  1L4A D;  1JOC A;  3V5B A;  2XZR A;  3BRT B;  4C46 A;  4JQ0 D;  4BRY A;  1FZA A;  2Y9Y A;  1JEK A;  1L4A A;  3RL0 g;  2FYU J;  1X8Y A;  3L71 J;  3MIW A;  3CD6 P;  3Q5P A;  1KYO H;  2WSF J;  4DZO A;  1IZN B;  2WPS A;  5CJ4 A;  1HUC A;  1EDI A;  3D6Y A;  3MUD A;  2E76 C;  1ZRT E;  4H0L C;  1EZV D;  2H8P D;  3GF3 A;  2N1T C;  3TYY A;  3A2A A;  3D6Z A;  2OQQ A;  2ZAE B;  3E7K A;  1JY2 O;  1Q81 Q;  4Z1M H;  1L4A C;  1IJD B;  3KQG A;  1RQU A;  4R4M A;  1K73 Q;  1EZV G;  1SQV D;  3MP7 B;  3BRV B;  2AXT E;  3MD0 A;  4OWF A;  4ASW A;  1ZN5 A;  1R5L A;  5KTB A;  1HJB A;  3FWL A;  2BCC E;  2WT7 B;  1EXI A;  3MUD C;  3L72 D;  1ZRT D;  1D7M A;  3W67 A;  1MFT A;  1SQV G;  3HE5 A;  1M1J A;  3CCU P;  3E1I A;  4ZKU A;  1S2E A;  2HYN A;  1FZB A;  1Q82 Q;  2RH0 A;  3A0H H;  2J59 M;  3CX5 I;  1YBK A;  2R32 A;  2WSC H;  1FZE A;  3LW5 H;  4UB6 E;  1Y8A A;  1Q2N A;  3KYQ A;  5KAI E;  5CCG D;  1NU1 E;  1IFJ A;  1OZH A;  2BCC D;  3AEE C;  1T2K D;  4OGQ B;  3C1L A;  2FY8 A;  1NTK J;  1PV3 A;  3V2Q A;  1KB9 D;  4MN4 C;  5CCG A;  1HGZ A;  1NTZ E;  2O01 H;  1Z56 A;  3NTN A;  1PPJ E;  1M1J C;  4NPD A;  3R4Y A;  1NH4 A;  1HWT C;  1RF1 A;  3NXS A;  3UIA A;  2BCC G;  1NJI Q;  1URQ C;  2Y0E A;  1MFZ A;  1JTH A;  2YXQ B;  2G3A A;  2ZJS E;  4C7N B;  3M0A A;  5AW3 B;  3B4S A;  1H0T A;  3O6Q B;  4GOD A;  3H1L E;  5CCG C;  1ZW0 A;  3RGU A;  1KOR A;  2P2U A;  4H0L B;  1GK6 A;  3Q2Y A;  1T2K C;  1NTZ D;  1KQL A;  1PPJ D;  2N1T B;  2ZYA A;  4RKU J;  3SSU A;  1N73 A;  4L75 A;  1SQQ K;  1NU1 G;  4DT0 A;  2K3R A;  3VMA A;  1L4A B;  1VQ4 P;  1DD3 A;  1GW4 A;  2QVA A;  1ZLL A;  3HUS C;  1HJ0 A;  1KQF B;  1YTZ I;  1NTZ G;  2R44 A;  1EC5 A;  1PPJ G;  5KLI C;  1FS0 E;  4WY4 D;  4WBA A;  4LGD E;  4YXW H;  1NWQ A;  1BGY D;  2FFD A;  1SQV J;  3H1L D;  4RO0 A;  4WY4 A;  3VP9 A;  2E5T A;  2Y9Z A;  4U3F E;  2R3C A;  1NHL A;  3W68 A;  3CWB E;  2Q3I A;  4M3L A;  1IK7 A;  5H2F H;  1N73 C;  1BE3 E;  1LTS C;  3P7K A;  2Q7C A;  3II6 A;  2QJY C;  3L72 J;  3S9O A;  1XTG B;  1BGY G;  3AE8 C;  2OTL P;  3H1L G;  3U1A A;  2AXT H;  3HE4 A;  2WPQ A;  1LWU A;  2FYU K;  1VQ5 P;  4XFJ A;  3WU2 H;  4PD4 H;  1EDJ A;  3WUV A;  1DEE G;  4KJM A;  2FFD C;  1H8A A;  5APT A;  2AEF A;  2JP3 A;  4EDF A;  1PL5 A;  4N6J A;  2WQY C;  1SVF A;  2B9B A;  3HE5 B;  1M1J B;  3CWB D;  2BCC J;  1NOH A;  5KJ7 D;  5M1B A;  5TIS H;  1BDD A;  2WPV B;  1CSB A;  2E75 D;  1OWA A;  5KJ7 A;  1W5C E;  4UB6 H;  2C9N Y;  1LWU C;  5AW4 B;  2BAS A;  2HPC A;  3CWB G;  1KV4 A;  3G9R A;  3IN6 A;  4IFD K;  4GOE A;  3L36 A;  4DJG A;  1LT1 A;  3AE6 C;  3TDK A;  1KTM A;  3CXH H;  1RF0 A;  4KHX A;  2YXR B;  5GTI E;  2ZYG A;  4JYB A;  2KZI A;  1RF1 B;  3JSV C;  2M5A A;  2V7Q J;  5AW9 B;  1YHQ P;  4YPC A;  2DW3 A;  1NTZ J;  2NPS D;  1JTH B;  1USE A;  2FXO A;  2KZJ A;  1LTI C;  3P8C D;  3KHU A;  5KLI B;  2NPS A;  1H89 A;  1X9V A;  2W8Z A;  2OTJ P;  3SWK A;  1KYO D;  2QM7 A;  1FJK A;  2FYN C;  2IZ1 A;  1NTK K;  1RF0 C;  2Q5U A;  1FAV A;  1N73 B;  2VRS A;  1BGY J;  1NTM E;  1DH3 A;  1MKM A;  3H1L J;  1JY3 O;  2QJY B;  2LKM A;  4IFM A;  3EFG A;  3WUU A;  5AW6 B;  1N7L A;  1LNQ A;  1MV8 A;  4WWI A;  1DIP A;  3A0H E;  2NPS C;  3USS A;  1L0N E;  1FE6 A;  2FFD B;  5CMZ A;  4WY4 B;  2OYI A;  3JC2 2;  3D71 A;  3C9I A;  4GKG A;  2XDJ A;  1IFP A;  2QM8 A;  2W27 A;  1AV1 A;  1NTM D;  3BAT A;  1MUU A;  1VDF A;  1JO5 A;  2Q6Q A;  2G8Y A;  5CJ0 A;  2P58 A;  3CWB J;  3H32 A;  4LC1 A;  3RK2 D;  1LWU B;  2NRG A;  1T8Z A;  4LLH A;  5EFW B;  2NZ2 A;  5AW1 B;  1NTM G;  2OYI C;  1PGQ A;  1L0N D;  1S72 P;  1ZV8 A;  3HTK A;  2JJL A;  4HKZ H;  1FU1 A;  2ZFC A;  2P67 A;  1JCC A;  2FBW C;  2OTK E;  1M8O B;  1L2P A;  2W6J H;  1SQV K;  2CPB A;  4B86 A;  2E76 D;  3V4Q A;  3KZI H;  3IAO A;  4RES B;  1UII A;  1WMK A;  3V6I A;  1JMB A;  3MHV A;  1L0N G;  1OIP A;  2KYV A;  1K9M Q;  1VPC A;  1QLE D;  3AE5 C;  2N1T A;  2M3E A;  1IFM A;  2E75 B;  3AE4 C;  2HPC B;  4GT1 A;  3Q5S A;  1IC2 A;  1HGV A;  1HBW A;  3AE3 C;  3VTP C;  3RK2 C;  2JDI H;  2PAJ A;  2Q3E A;  1GL2 D;  3QWO C;  1K04 A;  5APQ A;  4R4L A;  2IBZ E;  2M0B A;  1NVO A;  1P84 I;  3V4W A;  2FYN B;  1AVO A;  4QMA A;  2L5G B;  1L0L E;  4PV1 C;  1RHZ B;  2M5A B;  1SQX E;  1U7M A;  2I1K A;  5AVR B;  5GTI H;  1VQO P;  1WRG A;  3H1J E;  5H2F E;  1M90 Q;  2KNC A;  4JF7 A;  4L74 A;  2WIT A;  3G4S P;  1JCD A;  4HH2 A;  2D2C C;  3AEB C;  2NPS B;  3BVH A;  5L8R J;  3CCJ P;  2A45 I;  1HTL C;  1JMM A;  1GL2 C;  2IBZ D;  1VF5 D;  3WU2 E;  1LGH B;  4PD4 E;  3CME P;  3M0D C;  2IX7 C;  1L0L D;  1ZR4 A;  3VN0 A;  1S1C X;  4H13 D;  1BDC A;  2E5Y A;  1KC8 Q;  2E74 D;  2GUV A;  1GK4 A;  1K05 A;  5TIS E;  2P10 A;  2IBZ G;  1NTZ K;  1URQ D;  2QSI A;  1NTM J;  1SLQ A;  3PRJ A;  1L0L G;  4GDO A;  3HD7 C;  3JCU E;  1IFI A;  2R5B A;  3A5T A;  2I1J A;  2KOG A;  2OYI B;  2YNY A;  2RKL A;  1URQ A;  4RJT A;  3AE2 C;  1H88 A;  3H1J G;  5AW2 B;  2YMY A;  3T97 A;  1KQG B;  2Z5I A;  4PD4 D;  2O1J A;  2Y0C A;  1JY2 P;  2ZVN B;  1YJ9 P;  1VF5 C;  3LW5 J;  1L0N J;  3AED C;  3BAS A;  3CXH E;  2H88 C;  1J1E C;  5DJT B;  3H32 B;  1OW6 A;  2MJZ A;  3ITK A;  3HRN A;  4H13 C;  1YI2 P;  5CBO A;  2HLO A;  2E74 C;  1LTB C;  1X22 A;  3TGU E;  2O01 J;  3RK2 B;  3HTK B;  3H1H E;  4KT0 J;  2KIK A;  3HUS A;  4ZKP A;  1OMI A;  1LTJ A;  1NU1 D;  3I55 P;  2K9Y A;  2K1A A;  1YIT P;  3PJS K;  2QEX P;  3F5H A;  2E76 B;  3RBX A;  3CXH D;  5APU A;  1GMJ A;  3FX0 A;  3CCQ P;  3CLQ A;  2Z5H A;  3VMY A;  3FXE A;  3H25 A;  2XNX A;  2YIU C;  3TGU D;  3AEC C;  1YQ3 C;  1G2C A;  1EZV I;  3L73 E;  4YXD C;  3H1H D;  2IPP A;  2R3S A;  1LTJ C;  1GL2 B;  1GDT A;  5B5E E;  3B5N D;  2J58 A;  3L74 E;  5APV A;  3H1I E;  1Q86 Q;  1G1I A;  3R2P A;  3TGU G;  1VQL P;  3B5N A;  2KNC B;  3SFE C;  3GG2 A;  3H1H G;  1QL2 A;  2IYP A;  1N86 A;  1LP1 B;  2KP8 A;  1L0L J;  3OW2 O;  3F89 A;  1VQ6 P;  3FWN A;  1PZQ A;  5GTH H;  1CI6 B;  3GLM A;  5CCH D;  3C8V A;  2PP6 A;  3L73 D;  1M7L A;  4L76 A;  2W6B A;  4EOT A;  2C0X A;  2L91 A;  1JNM A;  1NYH A;  1FZF A;  5AW8 B;  2ZT9 D;  2K37 A;  1VF5 B;  2JKV A;  3B5N C;  4HJG H;  3H1I D;  5KAF H;  3L70 E;  2R5D A;  5CBN A;  1HVV A;  1S4X A;  1QVF O;  4N78 E;  4H44 D;  4U3F D;  1YJW P;  1S5L H;  3L73 G;  3KZI E;  3SWY A;  2XND H;  3KPE A;  4H13 B;  1BE3 D;  1UIX A;  3MGN A;  4OH8 B;  2HOD A;  1ZME C;  2E74 B;  5AVZ B;  1X0T A;  2AEJ A;  4TT3 H;  1AQT A;  1S9K E;  3JCU H;  1URQ B;  1KB9 I;  3H1I G;  4IL6 X;  4W7Y A;  1S5L X;  5KKZ C;  3T97 B;  4U3F G;  5CCH C;  2IFM A;  2YKP A;  1BE3 G;  1SQP E;  1W2E A;  1WT6 A;  4ZNC A;  1M1K Q;  1P84 E;  3PH0 A;  2W6A A;  2ZT9 C;  2JO1 A;  1NKN A;  3M06 A;  3AE9 C;  3L37 A;  2OYH C;  5KLV E;  1NU1 J;  2C0W A;  1OFC X;  3OA7 A;  4H44 C;  1GD2 E;  1PGJ A;  1DX7 A;  3VMX A;  1EDK A;  2HG5 D;  4Y99 C;  3WMM 0;  2YIU B;  2OGU A;  3ZDM A;  2Q9I A;  4PJ0 H;  1NTM K;  1S9K D;  1KIL E;  3B71 A;  3HUS B;  3L70 G;  5TJH A;  3OJA B;  2E42 A;  2UWJ E;  1LTJ B;  3TGU J;  3L4F A;  3KDP B;  1LTT C;  4W7Z A;  1LJ2 A;  2M3B A;  1BSN A;  1SQP D;  3A3Y B;  4W80 A;  3H1H J;  2HFE D;  2WSE H;  3EQ2 A;  2RMZ A;  1VQN P;  1Q90 D;  1U57 A;  5AVT B;  5KLV D;  2WVR A;  1JM0 A;  1R5S A;  1VQ7 P;  1G2C B;  5E79 H;  2YMK A;  1J1D C;  3M9B A;  4ZMD A;  1SQP G;  4OVN F;  1KIL D;  2Q1K A;  1QEX A;  3B8E B;  3CX5 E;  1FZC C;  2Z4E A;  3CL3 D;  2H89 C;  5KLV G;  5B5E H;  1KIL A;  5AW7 B;  3L73 J;  3B5N B;  1OW7 A;  1PGO A;  2CPS A;  1LT9 A;  1ZP0 C;  3CPW O;  4AUW A;  1BSH A;  2FXP A;  3K5B A;  4XA4 A;  1MZ9 A;  2P7J A;  2PGD A;  3GMA A;  1NTK E;  3H1I J;  5AVS B;  3VYI A;  2QJK C;  2M8R A;  3IF4 A;  4U3F J;  3I5C A;  4CPG A;  4A7P A;  1N8R Q;  1BE3 J;  5KKZ B;  1OVU A;  2MKV A;  1OVR A;  1IK9 A;  1KIL C;  4NPF X;  2BEQ D;  3CCR P;  5B66 E;  1JY3 P;  1GU5 A;  2QE7 H;  4JPZ B;  1LT9 C;  4AYC A;  1QL1 A;  4PV1 D;  2QJP C;  1FBM A;  2ZT9 B;  4L73 A;  3EWK A;  2A06 E;  1RE3 C;  2OYH B;  3CCL P;  1OW8 A;  1BCC E;  2KB7 P;  1SQB E;  2HOD B;  3H1K E;  4H44 B;  1JUN A;  4Y99 B;  2C9L Y;  1L0L K;  4O9B A;  2D2C D;  1YIJ P;  1IO4 A;  1HH0 A;  5AW0 B;  1SFC D;  3N7N A;  5AVU B;  1RQV A;  1VL2 A;  3TK1 A;  1A02 J;  1RY3 A;  2WMM A;  2GUS A;  1P84 H;  1SFC A;  4WB4 A;  3GW6 A;  4EIJ A;  4WVZ A;  1HF9 A;  2WSF H;  3NFQ A;  4DOJ A;  1GL2 A;  2A06 D;  1JB0 J;  4K3A A;  3M0D A;  1RE4 A;  1BCC D;  2KSE A;  5APY A;  1SQB D;  1SQP J;  3H1K D;  2POH A;  1SQV E;  1QVG O;  3CCS P;  1J1D B;  1FOS E;  5AVY B;  2YKO A;  1KYO I;  1FDI A;  3U1C A;  5KLV J;  3HD7 D;  1LP1 A;  1FZC B;  3AEF C;  3GF7 A;  2A06 G;  5GTH E;  3L72 E;  1M56 D;  1N7S D;  1BCC G;  5APW A;  2IZ0 A;  2A45 H;  2OYO A;  1SQB G;  1CI6 A;  1SFC C;  3H1K G;  1VQK P;  2I8D A;  3HD7 A;  2XV5 A;  2O01 N;  4UB8 H;  2V4H A;  3GHG A;  2GA1 A;  1N7S A;  1CW5 A;  1Q7Y Q;  5AVX B;  1RE4 C;  1OVV A;  2ZVO B;  5KAF E;  1SQX D;  3L75 E;  2OAR A;  1EXJ A;  1NU1 K;  1ZOY C;  4IL6 E;  5BU8 B;  3H1J D;  2QJK B;  1S5L E;  2JWA A;  1KN7 A;  2B87 A;  3AE1 C;  3P8M C;  3CCE P;  4HB1 A;  2IDB A;  2ZXE B;  3CX5 H;  2YKQ A;  3A7O A;  1KB9 E;  1KFN A;  2KS1 A;  2SPZ A;  3V2N A;  1KIL B;  1KQS O;  4BXL A;  1AVY A;  1SQX G;  1YTZ T;  3GHG C;  3CC4 P;  3CC2 P;  1FC2 C;  1N7S C;  1LT9 B;  2AEM A;  3RBZ A;  5C39 A;  2JWD A;  2QJP B;  1VQP P;  1R8E A;  2HR3 A;  2FYZ A;  3VMZ A;  1JY2 N;  1GTW A;  2WSC J;  3Q5R A;  3A0B H;  1S3J A;  2GM4 A;  4D6T E;  3L72 G;  1NGM B;  5APS A;  3L75 D;  1NAY A;  2KSJ A;  2O1K A;  1NKZ B;  1PIX A;  3G71 P;  5DJU B;  2QRX A;  2CK3 H;  1ZR2 A;  1KFM A;  4I1L A;  4PJ0 E;  2B88 A;  3NMD A;  3CCV P;  5B66 H;  3L75 G;  3QH9 A;  2QG4 A;  4I6M C;  3IFM A;  1EDL A;  5CHX A;  2WPR A;  1ZXG A;  4IOI H;  3M91 A;  4PV1 B;  1YQ4 C;  2KI7 B;  2ITA A;  1DEB A;  3BCC E;  3V2R A;  4YTP C;  4I7Z C;  4D6T D;  1KMI Z;  3G6E P;  1PP9 E;  3OAK A;  3AE7 C;  3M9Q A;  1VQM P;  1BGY E;  2WWW A;  1BCC J;  3RK3 E;  1SQB J;  2D2C B;  3H1K J;  3KXD A;  5E79 E;  1AJY A;  1GU4 A;  3TNU B;  2WSS H;  1SFC B;  4D6T G;  1W2B O;  1XTC C;  3AEG C;  3SFD C;  1IFN A;  1RF1 C;  1EQ7 A;  1G1J A;  4BRY B;  3G3Z A;  3Q1M A;  2E43 A;  3CCM P;  2ZYD A;  3BCC D;  1FOS F;  2QIW A;  2FKW B;  4U7J A;  1PP9 D;  2IBZ I;  2B89 A;  1X79 B;  1T3U A;  3RK3 D;  1SQX J;  2LR2 A;  4JYC A;  3P32 A;  3H1J J;  3LIE A;  3HD7 B;  3BCC G;  1SQQ E;  3GHG B;  3Q3D A;  2KLU A;  3V2P A;  3ABV C;  1N7S B;  1LTA C;  2ZXX A;  3RL0 D;  2IYO A;  2QA4 P;  3CMA P;  1PP9 G;  5CCH A;  1AQ5 A;  3N4X A;  2H43 A;  2O3J A;  1Y9B A;  3L74 D;  3I56 P;  5K5G B;  2B87 B;  1OXZ A;  2PFX A;  4IL6 H;  3PP5 A;  1LTG C;  1SQP K;  2AXC A;  1J1E B;  3L35 A;  4GIF A;  1NAF A;  1FZG A;  4EI2 A;  2OYH A;  2KK7 A;  4PD4 I;  1TU3 F;  4WY4 C;  1T6A A;  2K9J A;  2KS1 B;  1Y47 A;  3L75 J;  5KLV K;  1KB9 H;  1FDO A;  3L74 G;  3RK3 C;  3PTZ A;  3PLN A;  1SQQ D;  3FXD A;  5BVZ A;  4GOF A;  2YO3 A;  2FXM A;  1CZQ A;  3RL0 C;  2FYU E;  3L71 E;  2KUB A;  5AVW B;  4BWN A;  4I7Z B;  3L70 D;  2H7H A;  4N78 D;  3P8C E;  1FJP A;  1SQQ G;  3AEA C;  2W90 A;  5KAI H;  2RN0 A;  2V7Q H;  4D6T J;  1M57 D;  1KYO E;  1GZL A;  4Y28 J;  3CXH I;  4N3Y B;  2LXB A;  3WUT A;  3IR9 A;  3D70 A;  2XKM A;  3E1R A;  1FZC A;  5KJ7 C;  1E5W A;  5AVQ B;  5AVV B;  4UB8 E;  2FYU D;  1P84 D;  3L71 D;  3TSI A;  2E75 C;  3FGA D;  1YJN P;  1L0N K;  2LXC B;  1H0T B;  3PHL A;  2KLV A;  2PRR A;  2JEE A;  1OX3 A;  3BCC J;  2IFN A;  1YYC A;  2WSE J;  3S1K A;  5AW5 B;  2FYU G;  3L71 G;  1PP9 J;  2JR8 A;  1USD A;  1DD4 A;  1VQ9 P;  5APX A;  4C7R A;  2WT7 A;  4XE5 B;  4AQR D;  4TLF A;  4K35 A;  2WZ7 A;  3VOP A;  1PGP A;  4ASV A;  1E79 H;  3H6P A;  2KXP B;  1QGK B;  3U59 A;  2BEZ F;  1U7J A;  3A0B E;  1RE3 A;  3MZW B;  3L74 J;  1N2D C;  1NO4 A;  1T3J A;  4I2L C;  2A45 G;  2N9Y B;  1GW3 A;  4OGQ D;  1SQB K;  4IFF A;  3RK3 B;  1RH5 B;  1K8A Q;  2WTY A;  3TF5 A;  3CX5 D;  4JBZ A;  1IFD A;  1SP4 A;  1JY3 N;  1QX8 A;  1PFI A;  3RL0 B;  3CC7 P;  1SQQ J;  1VQ8 P;  1J2J B;  3MTU E;  3HE4 B;  5BU5 A;  3EFF K;  2N9B A;  3LID A;  3O8Z A;  2K9J B;  1A02 F;  4EYY Q;  1NTK D;  3L70 J;  3VP8 A;  4NPE A;  1AA0 A;  1SQX K;  4C7N A;  1FDM A;  3S4R A;  1AFO A;  2P1J A;  4H0L D;  4OGQ C;  1KD1 Q;  2YO2 A;  4DCK A;  3SWF A;  2K88 A;  3O6Q A;  2N1T D; 
#chains in the Genus database with same CATH homology
 1H89 A;  1X9V A;  2GM4 A;  1CI6 B;  1KZU B;  3M9H A;  5APS A;  3CI9 A;  5CCH D;  3TNU A;  2PP6 A;  2QM7 A;  1FJK A;  4HYT B;  2KSJ A;  2XU6 A;  1NTK K;  1RF0 C;  1L4A D;  2Q5U A;  2O1K A;  1NKZ B;  1JOC A;  1M7L A;  3V5B A;  2W6B A;  2XZR A;  3BRT B;  1FAV A;  4C46 A;  4EOT A;  2C0X A;  1N73 B;  1JNM A;  2VRS A;  1FZF A;  1DH3 A;  5AW8 B;  1FZA A;  1L4A A;  1JY3 O;  1ZR2 A;  1KFM A;  4I1L A;  2LKM A;  1X8Y A;  4IFM A;  3B5N C;  3MIW A;  3EFG A;  5AW6 B;  1N7L A;  2R5D A;  1HVV A;  3NMD A;  4N78 E;  1MV8 A;  4DZO A;  2WPS A;  5CJ4 A;  3SWY A;  2NPS C;  4I6M C;  3IFM A;  3KPE A;  5CHX A;  2WPR A;  1HUC A;  3MGN A;  4OH8 B;  3M91 A;  2HOD A;  3MUD A;  1DEB A;  2FFD B;  5CMZ A;  5AVZ B;  3V2R A;  2H8P D;  4WY4 B;  2OYI A;  1S9K E;  1URQ B;  2N1T C;  3TYY A;  3A2A A;  3C9I A;  4W7Y A;  4GKG A;  2XDJ A;  3OAK A;  3M9Q A;  5CCH C;  1JY2 O;  2IFM A;  2QM8 A;  2W27 A;  2WWW A;  1L4A C;  2YKP A;  1IJD B;  3KQG A;  3BAT A;  1MUU A;  1VDF A;  1W2E A;  1WT6 A;  1JO5 A;  1GU4 A;  3TNU B;  5CJ0 A;  2W6A A;  1SFC B;  3BRV B;  3MD0 A;  1NKN A;  1ZN5 A;  3H32 A;  4LC1 A;  3M06 A;  5KTB A;  3L37 A;  1XTC C;  3RK2 D;  2OYH C;  1IFN A;  1HJB A;  1RF1 C;  1LWU B;  1EQ7 A;  1T8Z A;  2WT7 B;  1G1J A;  3G3Z A;  4LLH A;  2E43 A;  2C0W A;  3OA7 A;  1DX7 A;  1GD2 E;  3VMX A;  2HG5 D;  4Y99 C;  5AW1 B;  2OYI C;  3WMM 0;  2Q9I A;  1ZV8 A;  3HTK A;  2JJL A;  1FU1 A;  1NTM K;  2ZFC A;  1FOS F;  1S9K D;  3HE5 A;  2P67 A;  3HUS B;  1M1J A;  1JCC A;  3E1I A;  4ZKU A;  3OJA B;  2E42 A;  2FKW B;  2HYN A;  1SQV K;  1FZB A;  2CPB A;  4B86 A;  1LTJ B;  3V4Q A;  1X79 B;  1T3U A;  2J59 M;  4RES B;  3RK3 D;  3L4F A;  3KDP B;  2R32 A;  1LTT C;  4W7Z A;  2M3B A;  2WSC H;  1FZE A;  3P32 A;  4JYC A;  3LW5 H;  3A3Y B;  3LIE A;  4W80 A;  3HD7 B;  2KYV A;  2HFE D;  1VPC A;  2WSE H;  3EQ2 A;  3KYQ A;  3GHG B;  2N1T A;  3V2P A;  1N7S B;  5AVT B;  5CCG D;  1IFM A;  1IFJ A;  2HPC B;  1LTA C;  3RL0 D;  4GT1 A;  5CCH A;  1AQ5 A;  3N4X A;  1IC2 A;  1HGV A;  1T2K D;  2H43 A;  1HBW A;  3VTP C;  3RK2 C;  2PAJ A;  3V2Q A;  1GL2 D;  1G2C B;  5APQ A;  1HGZ A;  5CCG A;  2O01 H;  1J1D C;  1Z56 A;  3M9B A;  3NTN A;  1M1J C;  1OXZ A;  3V4W A;  1KIL D;  1NH4 A;  3PP5 A;  1LTG C;  1SQP K;  1J1E B;  3L35 A;  3B8E B;  4GIF A;  1NAF A;  2L5G B;  1FZC C;  1HWT C;  1FZG A;  2Z4E A;  2OYH A;  3CL3 D;  1RF1 A;  3NXS A;  3UIA A;  2I1K A;  4WY4 C;  5AVR B;  1WRG A;  1KIL A;  1URQ C;  5KLV K;  5AW7 B;  1MFZ A;  1JTH A;  3B5N B;  3RK3 C;  2CPS A;  1LT9 A;  4JF7 A;  4C7N B;  3M0A A;  2WIT A;  1JCD A;  4HH2 A;  5BVZ A;  4AUW A;  5AW3 B;  4XA4 A;  1MZ9 A;  2P7J A;  2NPS B;  3BVH A;  2YO3 A;  2FXM A;  5CCG C;  5AVS B;  1CZQ A;  3VYI A;  3RL0 C;  2P2U A;  2A45 I;  1GK6 A;  2M8R A;  1T2K C;  5AVW B;  1KQL A;  3I5C A;  1HTL C;  2N1T B;  1JMM A;  2H7H A;  1GL2 C;  4N78 D;  3P8C E;  1FJP A;  1LGH B;  3M0D C;  1N73 A;  2IX7 C;  1ZR4 A;  3VN0 A;  1IK9 A;  1SQQ K;  1KIL C;  1L4A B;  1GW4 A;  1JY3 P;  1GU5 A;  1GZL A;  1ZLL A;  3HUS C;  1LT9 C;  4AYC A;  1QL1 A;  1YTZ I;  1FBM A;  2GUV A;  4N3Y B;  1GK4 A;  4WY4 D;  1RE3 C;  3IR9 A;  1NTZ K;  2OYH B;  4WBA A;  1URQ D;  4LGD E;  1NWQ A;  2KB7 P;  1SLQ A;  2XKM A;  1FZC A;  2HOD B;  2FFD A;  3HD7 C;  1IFI A;  2R5B A;  1E5W A;  5KJ7 C;  1JUN A;  3A5T A;  2I1J A;  2KOG A;  4Y99 B;  4WY4 A;  5AVQ B;  5AVV B;  3VP9 A;  1L0L K;  2C9L Y;  2OYI B;  4O9B A;  2YNY A;  1URQ A;  2R3C A;  1NHL A;  1H88 A;  3TSI A;  1IO4 A;  2Q3I A;  5AW2 B;  2YMY A;  4M3L A;  1L0N K;  1N73 C;  1LTS C;  3P7K A;  2Q7C A;  3T97 A;  3II6 A;  1HH0 A;  5AW0 B;  2Z5I A;  2O1J A;  1SFC D;  1JY2 P;  2KLV A;  3N7N A;  2JEE A;  5AVU B;  3TK1 A;  1XTG B;  2IFN A;  1A02 J;  1RY3 A;  2GUS A;  3BAS A;  1YYC A;  1SFC A;  1J1E C;  4WB4 A;  5AW5 B;  3U1A A;  3H32 B;  4EIJ A;  2MJZ A;  3HRN A;  3HE4 A;  2WSF H;  2WPQ A;  1LWU A;  2FYU K;  3NFQ A;  4DOJ A;  1GL2 A;  2HLO A;  5APX A;  4C7R A;  2WT7 A;  3M0D A;  2FFD C;  1RE4 A;  1LTB C;  5APY A;  4XE5 B;  1H8A A;  4AQR D;  2POH A;  5APT A;  3RK2 B;  3HTK B;  4N6J A;  1J1D B;  2WZ7 A;  1FOS E;  1SVF A;  5AVY B;  2YKO A;  3VOP A;  3HE5 B;  3HUS A;  1M1J B;  4ZKP A;  3U1C A;  3H6P A;  1NOH A;  3HD7 D;  3U59 A;  5KJ7 D;  1LTJ A;  1FZC B;  1RE3 A;  1N2D C;  1NO4 A;  1T3J A;  1N7S D;  4I2L C;  5APW A;  1CSB A;  2A45 H;  1CI6 A;  1SFC C;  2A45 G;  3HD7 A;  1GW3 A;  1OWA A;  5KJ7 A;  2XV5 A;  5APU A;  1SQB K;  4IFF A;  3GHG A;  2C9N Y;  3RK3 B;  1LWU C;  2WTY A;  1N7S A;  5AW4 B;  1CW5 A;  5AVX B;  3CLQ A;  2Z5H A;  2BAS A;  2HPC A;  1RE4 C;  4IFD K;  3VMY A;  2XNX A;  3L36 A;  1IFD A;  1SP4 A;  2OAR A;  1G2C A;  1JY3 N;  1NU1 K;  1PFI A;  5BU8 B;  3RL0 B;  1J2J B;  2IPP A;  3MTU E;  3P8M C;  3HE4 B;  5BU5 A;  1LTJ C;  1RF0 A;  1GL2 B;  4KHX A;  1GDT A;  2N9B A;  3B5N D;  2ZXE B;  4JYB A;  2J58 A;  1RF1 B;  5AW9 B;  2YKQ A;  3A7O A;  5APV A;  3LID A;  3O8Z A;  1KFN A;  3V2N A;  1KIL B;  1A02 F;  1G1I A;  3R2P A;  1YTZ T;  2NPS D;  3GHG C;  1JTH B;  3B5N A;  3VP8 A;  1N7S C;  1LT9 B;  1SQX K;  4C7N A;  1FDM A;  1AFO A;  1QL2 A;  2P1J A;  1N86 A;  2KP8 A;  1LTI C;  3P8C D;  3SWF A;  2YO2 A;  2FYZ A;  2NPS A;  3VMZ A;  1JY2 N;  1GTW A;  2N1T D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...