3TNUA

Heterocomplex of coil 2b domains of human intermediate filament proteins, keratin 5 (krt5) and keratin 14 (krt14)
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
90
structure length
90
Chain Sequence
SELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cytosolic protein
molecule keywords Keratin, type I cytoskeletal 14
publication title Structural basis for heteromeric assembly and perinuclear organization of keratin filaments.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2011-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3tnuA00
3MD0A 2R32A 3V5BA 1GZLA 2ZFCA 3KQGA 4GT1A 2WWWA 1FOSE 5AVVB 5AW4B 2YO2A 5AVUB 1CI6A 4HYTB 3A3YB 2E42A 1H8AA 3HTKA 3OAKA 3VYIA 3LIEA 1MUUA 2Z5HA 5AW0B 2WTYA 2Q3IA 3B8EB 1JNMA 1HWTC 4C46A 1H89A 4AUWA 3P32A 2XZRA 5APYA 5AVYB 4RESB 1MFZA 5AVRB 5AW5B 1YYCA 2P7JA 1NAFA 1OXZA 5AVTB 5CMZA 1IO4A 5AW8B 2YO3A 3M9BA 3VMXA 1CZQA 5AVQB 5AVSB 5AW1B 3M06A 2W27A 1OWAA 2XU6A 3HE5B 5AVWB 2JJLA 2ZXEB 1GD2E 2WPRA 2WT7B 1MV8A 1SLQA 3HE5A 3HE4B 3M9HA 1S9KD 5AW9B 1CSBA 1GU5A 5APUA 2R5BA 5AW3B 2WT7A 3T97A 1DH3A 2C9NY 2QM7A 1HBWA 1X8YA 3TNUB 1GTWA 2IPPA 1HUCA 4B86A 2H7HA 5AW2B 3L36A 2WPQA 5APXA 5APVA 2N9BA 1KQLA 1T2KD 3VN0A 5AVXB 1A02J 3VMZA 3TYYA 3M0DA 2Z5IA 2P67A 3V4QA 3MGNA 2QM8A 3NMDA 4DZOA 3M91A 4AYCA 3VMYA 3V4WA 3A2AA 3A5TA 3VTPC 4I2LC 4LC1A 3O8ZA 1FAVA 2E43A 1HJBA 5APWA 3L37A 4M3LA 2BASA 3HE4A 5APTA 1NWQA 5AW7B 2R3CA 1H88A 5APSA 2C9LY 2Q5UA 3NTNA 1CI6B 4XE5B 5AVZB 4C7NB 1FOSF 4AQRD 1GK4A 3TNUA 5APQA 3SWFA 3KDPB 3P7KA 1JUNA 1GU4A 2YNYA 4JYCA 4C7NA 1G2CB 1A02F 1SP4A 2VRSA 3L35A 3P8MC 4EOTA 2KP8A 2R5DA 2W6AA 3NXSA 3TK1A 4KHXA 3A7OA 2XV5A 2Q7CA 2WPSA 4GKGA 3LIDA 1S9KE 3I5CA 1J2JB 5AW6B 4JYBA 4I6MC 2P2UA 3UIAA 1T2KC 3M0AA 3IR9A 3NFQA 1GK6A
chains in the Genus database with same CATH superfamily
1AVOA 3HTKB 5AVUB 2Q1KA 2WZ7A 1LTBC 2HLOA 1U57A 2ZT9B 3I56P 1YJWP 1N7SA 2IDBA 3E1IA 1URQD 3CC4P 2N1TB 1BDDA 1L4AD 1SQXD 1YHQP 2KS1A 5CBOA 2CK3H 4MN4C 1ZR2A 1S9KD 5AW9B 3HUSB 3RL0C 2WSEJ 4WY4C 2YIUB 3CMEP 4YXDC 1NU1D 3CWBE 1NTMD 1KD1Q 2P67A 1M8OB 3L70D 3CCEP 1DD4A 1RE3C 3VP8A 5KLVE 1D7MA 2NPSC 1FZCA 1SQPG 3CI9A 3L74E 4LC1A 1ZR4A 1PP9D 4PJ0H 4ZKUA 2B88A 2R3SA 5AW7B 1PIXA 2SPZA 3AE5C 4BXLA 2C9LY 2Z4EA 2QEXP 2O1JA 3CLQA 4Y99B 1KQSO 1GDTA 3VP9A 1J1DB 3TK1A 1LTJB 3CWBJ 4PV1C 1SFCA 3WU2E 1NGMB 1SQQK 1Q86Q 1BE3G 1YQ3C 4OVNF 2KUBA 1EZVD 1CW5A 4ZKPA 3S1KA 3VOPA 3AECC 1L0NK 3WUUA 1FE6A 3A3YB 3VYIA 3GHGB 5GTHH 2RH0A 2IFNA 1N7SC 1JY3N 2N9YB 3GF7A 3H1HG 1WRGA 1VDFA 1ZOYC 2KOGA 2G8YA 1SQPE 1LNQA 2O1KA 4EI2A 4TT3H 1X22A 1NTKE 1AA0A 1H0TB 5C39A 2FXMA 3H1ID 2E75C 3TGUE 3RK3D 4GODA 5APVA 3AEAC 5KAIE 2E74C 2QG4A 1XTCC 1FZFA 3SWKA 1BE3E 1IFMA 3FWLA 3FWNA 2D2CD 1FZCC 3Q5RA 3KPEA 1SQPJ 2QRXA 1N73A 3L73D 1KFMA 3GG2A 1H88A 1T3UA 1GK4A 3AE9C 3CCLP 1VQ6P 1BGYG 2FKWB 4U7JA 2A06E 1SFCC 3H1KG 5E79E 4QMAA 1SQVD 2UWJE 1BE3J 2E76C 5APXA 3AEFC 4GT1A 1JY2N 5AVVB 5H2FH 1S2EA 2ITAA 3HTKA 2DW3A 4ASVA 2AEJA 2OYIA 2FYUK 1H89A 5B5EE 1J1EC 4OWFA 1SQQG 2E5YA 3H1HJ 5CJ0A 5AW8B 1L0NG 3IN6A 1FU1A 2N1TA 2JWAA 3CCJP 2O3JA 1L0LD 5KJ7A 1Q81Q 5APUA 4L73A 1BGYE 2FXOA 2B9BA 2QJKB 3AE1C 4KJMA 3H1KE 3BCCD 3H1JG 3VMYA 4XFJA 1AVYA 2BCCD 3EWKA 3OJAB 1FZBA 3JSVC 3QWOC 4ASWA 4IFDK 1W5CE 5CCGA 1AQTA 2NZ2A 2Q5UA 4C7NB 1ZXGA 4HH2A 2WMMA 3BRVB 3MP7B 1GW3A 1GU4A 1KILD 4OGQB 1SP4A 1VF5D 4N3YB 3ZDMA 3B5NC 1SQQE 3K5BA 4IFMA 5GTIH 5KLIC 2AXTE 2K1AA 4I6MC 3H1KJ 1L0NE 3KZIE 4O9BA 3IR9A 3SFDC 4ZNCA 1MKMA 3A0BH 2M5AB 2YO2A 1JCCA 1PZQA 1KZUB 2YKQA 3GHGA 4BWNA 2JO1A 2ZT9C 3G4SP 3H1JE 1SQQJ 3OW2O 1CZQA 2W27A 1FS0E 3MTUE 2XU6A 2N1TC 3HE5B 4U3FG 1S5LX 1OMIA 1HH0A 4DJGA 1L0NJ 1MV8A 5KJ7C 2H8PD 2C0XA 2FYUG 2FFDB 4EYYQ 3HUSC 1GTWA 1H0TA 1NHLA 3CX5I 1T2KD 1NOHA 2Z5IA 2OGUA 5CHXA 3CXHI 2GUVA 3L75D 1U7MA 1S72P 3H1LE 4I1LA 2E43A 3L37A 5CCGC 4WBAA 2AEFA 1NWQA 5B66H 1CI6B 4AQRD 3H25A 3RBZA 1LWUA 3SWFA 1GL2D 2O01J 2YKPA 1JY3O 3EFGA 5KLVD 2OYHA 1G2CB 4Y99C 1YQ4C 3WMM0 1J1DC 2XV5A 1LTJC 1FJPA 1OIPA 1BCCG 1BDCA 2A45G 3V2QA 1K73Q 5AW4B 2E42A 2FYUE 2ZYAA 5B5EH 3GHGC 2R44A 1NAFA 3MUDA 3VMXA 5AVWB 1VQOP 1LTGC 2WPRA 1EDKA 4U3FJ 3TSIA 3Q2YA 1DH3A 2FYUJ 1SQBK 1JEKA 3G6EP 1NTKD 1W2EA 2LR2A 1Q82Q 2W90A 2NRGA 2J5UA 1JY2O 1URQB 2BASA 1L4AB 1ZRTE 3G71P 3P8CD 5AVZB 3AEDC 4GIFA 4C7NA 5KAFH 1JTHB 1K9MQ 3HD7D 4UB6H 1IFJA 1QGKB 2NPSA 2JWDA 2WPSA 1P84E 1RE4A 3BRTB 1VQ5P 1P84I 2HFED 1PPJE 1JY3P 5EFWB 1JM0A 2KIKA 1BCCJ 2OTKE 4N78D 1FJKA 1FOSE 4HYTB 1KB9E 3L71D 1VQ7P 1HWTC 1ZMEC 2M5AA 1SFCD 1KB9I 1EXJA 3F5HA 4ZMDA 1LTAC 3MIWA 3MUDC 3M9QA 2WQYC 5CMZA 3Q1MA 4H13D 2JEEA 3CX5H 3V2NA 1Q2NA 1SVFA 3HE4B 3HE5A 1YITP 2QJPB 3CXHH 2H7HA 1LP1B 2LXBA 1KQLA 2FFDA 1VQKP 1JOCA 2OARA 2WSCJ 3C9IA 1DEBA 2WITA 2BEZF 3CPWO 3FGAD 5TISH 1YJ9P 1OW6A 3G3ZA 1PV3A 3U59A 2M8RA 1SQBG 1OZHA 3ABVC 1JY2P 4OGQC 2IBZG 1RE4C 3RK3B 2W6JH 1J2JB 4JYBA 4JQ0D 4UB8E 2YKOA 2K9JB 4HJGH 3PTZA 1S5LE 4TLFA 3V5BA 1KYOE 1NU1K 2HPCB 1NTMK 1KYOI 3AE6C 1FDIA 1G1IA 4NPEA 1OXZA 1HGVA 4WB4A 4H0LD 2Y0CA 2HYNA 1RQVA 3D71A 4IL6H 2B89A 4L74A 2WT7B 3E7KA 3B4SA 2W83C 1MZ9A 3V6IA 3L72D 2FYNB 4BRYB 1SQBE 2FFDC 2QJYB 2XKMA 3TYYA 2IBZE 2N1TD 3CX5D 1RY3A 1LTSC 3FXDA 2KK7A 4RJTA 1IC2A 3CXHD 4GOFA 5APSA 1URQA 3LW5H 1Y47A 3PLNA 1L4AA 3BASA 1AV1A 1W2BO 1E79H 3H1LD 1TU3F 1P84H 1SQBJ 2GUSA 1JTHA 4GKGA 1YI2P 1NTZD 2ZVOB 1X9VA 2AXCA 1GK6A 4CPGA 2IYPA 1RQUA 1KB9H 1WT6A 1HTLC 1QVGO 3A0HE 1KTMA 2Q3IA 3H1HE 3B5NA 1SQXG 3P32A 4IL6X 2QVAA 3CCQP 2K3RA 1MFZA 1HGZA 3RK2D 5AVRB 3EFFK 1USEA 1YTZI 4HKZH 1KILB 1T6AA 1KMIZ 1VQ8P 4D6TD 1VF5B 5BU8B 1OWAA 5CJ4A 2JJLA 2WSFJ 1NU1G 1NTMG 2YXQB 1DX7A 2H43A 2R5BA 3L70G 1JMBA 2OQQA 3TNUB 3U1CA 1FBMA 1SQVK 3VMZA 1PP9G 5DJUB 1M56D 4L76A 3A2AA 2JP3A 3PRJA 2H89C 1VQ9P 1VQNP 1EDJA 4M3LA 1IFDA 4JPZB 3HUSA 1K04A 1URQC 1L4AC 3KDPB 1JUNA 1PGJA 1KV4A 2KSEA 1N86A 1NH4A 1EZVG 4YPCA 3IAOA 2W6AA 4A7PA 1S9KE 1ZRTD 3AEBC 5AW6B 4H44D 3E1RA 3UIAA 1L0LK 1RHZB 3NFQA 1KYOH 3IFMA 2K9JA 3AEGC 1NTME 2PRRA 3OAKA 1P84D 3L70E 2P58A 3WU2H 1VQ4P 2K9YA 2ZYGA 4PD4E 1SQXJ 1YYCA 1LTJA 1GL2B 1PGQA 3F89A 4PD4I 1IO4A 3M9BA 1R5LA 2KZIA 1KB9D 3H1IG 2FY8A 3PP5A 1ZP0C 1CSBA 3JCUE 1NU1J 1DIPA 2WT7A 2C9NY 1NTMJ 1Z56A 1LGHB 4YXWH 2QJPC 2I1JA 1Q90D 3L70J 4IOIH 2IZ1A 2ZVNB 3AE2C 2J58A 1FDMA 1HF9A 4DZOA 2FYZA 1USDA 3SSUA 4LGDE 3L73G 1LT9B 1PP9J 3V4WA 4JF7A 5CCHA 4Y28J 1MFTA 5KAIH 1OFCX 2B87B 1FOSF 2YIUC 3AEEC 3IF4A 1S3JA 1SQVG 2IX7C 1PGPA 4W7ZA 2L5GB 1G1JA 1OW8A 3RL0D 4I7ZB 3CWBD 4WY4D 3RK3C 3L4FA 1X0TA 3RK3E 2ZFCA 3H32B 3A0HH 3S9OA 3O6QB 3L74D 1H8AA 4NPDA 1MUUA 2Z5HA 1JNMA 2NPSD 5E79H 2ZXXA 4OH8B 2XZRA 2Q9IA 2P7JA 1KYOD 3CL3D 1NKZB 4U3FE 3L73E 1L0LG 2ZYDA 3HD7B 2KLUA 3Q5PA 1RF1B 1ZN5A 3USSA 3H1IJ 4PV1D 3CCVP 3BCCG 1SQVE 3GLMA 2FYNC 2BCCG 3VN0A 5AVXB 1OW7A 2QJYC 3M91A 1SFCB 4L75A 1IFIA 1NTZJ 5CCHC 2HODB 1AJYA 4I2LC 3L73J 3I55P 1N7SD 2G3AA 4K35A 3WUTA 4H13B 4DOJA 2CPSA 1ZV8A 3R4YA 1SQPD 4XE5B 2PP6A 3RBXA 1EXIA 1SQVJ 4W80A 5GTHE 2RMZA 3A7OA 1PFIA 2E5TA 2KZJA 3R2PA 1BCCE 3TGUD 1L0LE 4N6JA 4D6TJ 2E75D 2KSJA 2QSIA 3BATA 2A45I 3HRNA 2E74D 3KQGA 2OTLP 1BE3D 3CCSP 3RL0g 3BCCE 2AXTH 5KKZB 1NTKK 4YTPC 4PD4H 5APYA 1AFOA 1WMKA 2KNCB 3KZIH 3C1LA 5L8RJ 2PGDA 1Y8AA 3D70A 5AVSB 1EC5A 1KILC 5DJTB 2A06D 2FXPA 1L0LJ 1UIXA 5BVZA 1VF5C 3H1HD 1GD2E 1KILE 2ZAEB 1N73B 3M9HA 1GU5A 2QM7A 1X8YA 1S4XA 3L75G 2N9BA 2JR8A 4DT0A 2E76D 1A02J 3BCCJ 2BCCJ 2Y0EA 3JC22 3V4QA 1FZGA 1SS1A 1XTGB 1M7LA 1ZLLA 3CCRP 4WVZA 2O01H 2HG5D 1FAVA 1LT9A 5KLVG 2O01N 4H0LB 1YBKA 2KLVA 3NTNA 3V2RA 3GMAA 2B87A 2OYIB 5H2FE 3L35A 2KP8A 2QJKC 2R5DA 3V2PA 4KHXA 1BSNA 1KQGB 3I5CA 1BGYD 2Y9ZA 1NKNA 1T2KC 1RH5B 2GA1A 2V7QH 3H1KD 1CI6A 2FBWC 3Q3DA 1SQXK 3H32A 3L75E 1FZAA 4C46A 4AUWA 1G2CA 3O6QA 2POHA 3U1AA 2KXPB 1M1KQ 2YXRB 2WVRA 1GL2C 3H6PA 2D2CB 1M1JB 1SQQD 4JBZA 3HD7A 3B5ND 1PGOA 4PD4D 1RF1A 3EQ2A 3WUVA 1NTKG 1L0ND 4B86A 2WPQA 1NJIQ 1KN7A 4IFFA 3L75J 1JO5A 3TGUG 3B71A 2MJZA 3NMDA 2I8DA 4WWIA 1RF0C 1T3JA 3RK2B 5BU5A 1LT9C 1T8ZA 3AE4C 5GTIE 1HJBA 1FC2C 2HODA 1OX3A 3H1JD 2ZT9D 5KLVJ 3L74J 2LXCB 3AE3C 3SFEC 1AQ5A 1JB0J 1L2PA 1QL1A 3A0BE 2YNYA 1JCDA 2KYVA 2IBZI 5KJ7D 2A45H 3SWYA 2A06G 3FXEA 3L71G 1IJDB 1GW4A 4I7ZC 1DD3A 3CC2P 2WWWA 4EDFA 2L91A 4LLHA 3B8EB 5AVYB 1FDOA 1LT1A 5CCGD 2P1JA 3CCMP 3FX0A 2KNCA 3P8CE 5AW1B 1IFNA 5K5GB 1M90Q 1NVOA 4GOEA 3HD7C 3GW6A 4H44B 1RF1C 4W7YA 1N7LA 2WSCH 2Q6QA 4U3FD 1HUCA 1LWUB 5AW2B 1YIJP 1NTKJ 1EDLA 2OYHB 3KXDA 3MZWB 3D6ZA 2WSEH 1NTZK 5B66E 2FYUD 3MGNA 2QM8A 1EDIA 1N2DC 4N78E 3TGUJ 2J59M 3TF5A 4K3AA 3A5TA 3L71E 2YMKA 5APWA 4HB1A 3HE4A 4Z1MH 1UIIA 1LP1A 4H13C 2CPBA 2K37A 2VRSA 5CCHD 2C0WA 4KT0J 2Q7CA 5CBNA 3CC7P 3LIDA 1LTTC 1VQMP 4DCKA 1QL2A 2R32A 3L71J 1GZLA 1SQXE 1YJNP 1QX8A 2W8ZA 2XNDH 1BCCD 1LJ2A 3LIEA 4GDOA 4UB8H 5KKZC 5AW5B 1IFPA 1S5LH 3PJSK 4EIJA 1JMMA 3M06A 1NU1E 3L72G 4XA4A 2M3BA 3D6YA 1VQPP 3RL0B 1OVUA 3T97B 2Y0DA 1M1JA 2KB7P 4WY4B 2HPCA 1N73C 1PPJD 1PP9E 1ZW0A 2NPSB 4AYCA 2Q3EA 1BGYJ 5KAFE 2K88A 1VL2A 3O8ZA 4UB6E 1QVFO 2BEQD 3ITKA 2JDIH 2WPVB 3H1LG 3N7NA 1EZVE 4BRYA 4H0LC 3Q5SA 4NPFX 3TDKA 2I1KA 4JYCA 1NTZG 1EZVI 1LTIC 1A02F 4PV1B 3P8MC 2QA4P 2OYIC 1K05A 1NAYA 1KFNA 1Q7YQ 3S4RA 1U7JA 2AEMA 3PH0A 2IFMA 2WSSH 3L72E 1VQLP 3MD0A 1FZEA 1E5WA 3CD6P 1N7SB 3GF3A 5AW0B 3CX5E 4D6TG 2RN0A 3W68A 4RESB 2WSFH 2MKVA 2KS1B 3H1IE 3CXHE 1R8EA 2XNXA 5AVQB 3OA7A 2KI7B 2ZXEB 2D2CC 3L72J 2GM4A 1M1JC 1SLQA 3H1JJ 2E75B 4OGQD 1YTZT 1S1CX 3BVHA 1IK7A 1M57D 4R4MA 2IPPA 2E74B 3L36A 1NYHA 1NTZE 4RO0A 1QEXA 5TISE 3M0DA 3KYQA 1FZCB 1OVVA 1KILA 2M3EA 4R4LA 1BSHA 2P10A 3N4XA 5KLVK 3RK2C 5APTA 4PJ0E 2IZ0A 4RKUJ 2R3CA 3II6A 3TNUA 3H1LJ 3P7KA 2RKLA 2ZJSE 4D6TE 2XDJA 1DEEG 3VMAA 2QE7H 3AE8C 2PFXA 2QIWA 2V7QJ 2E76B 1SQBD 3RGUA 4C7RA 3M0AA 1R5SA 3C8VA 1KORA 1KC8Q 2IBZD 1PPJG 2HR3A 1J1EB 4IL6E 2WTYA 3QH9A 5TJHA 5AVTB 1HJ0A 2OYOA 2YO3A 1KQFB 1PL5A 1SQPK 2V4HA 2M0BA 2LKMA 2BCCE 4H44C 2JKVA 5AW3B 3T97A 1HBWA 4WY4A 1IZNB 1LWUC 2OTJP 3M0DC 2OYHC 1GL2A 2IYOA 5M1BA 3MHVA 1QLED 3PHLA 1RE3A 3VTPC 3JCUH 1IK9A 1N8RQ 3G9RA 3AE7C 1GMJA 2PAJA 5APQA 3W67A 3B5NB 2YMYA 1EQ7A 3CWBG 5KLIB 4EOTA 2H88C 3NXSA 1K8AQ 1RF0A 1X79B 1Y9BA 2Y9YA 3LW5J 3KHUA 2W6BA 3CMAP 1OVRA 1NO4A 3L74G 2P2UA 1HVVA 1VPCA 3CCUP 5KTBA
chains in the Genus database with same CATH topology
2A45G 3IFMA 3V2QA 3HTKB 2WWWA 5AW4B 5AVUB 2E42A 3OAKA 4LLHA 2WZ7A 3B8EB 1LTBC 2HLOA 3GHGC 5AVYB 1N7SA 5CCGD 1YYCA 2P1JA 1LTJA 1NAFA 1GL2B 3MUDA 3E1IA 1URQD 1IO4A 2N1TB 3VMXA 1L4AD 3M9BA 3P8CE 5AW1B 1IFNA 5AVWB 3PP5A 3HD7C 1ZR2A 1LTGC 2WPRA 1S9KD 1RF1C 4W7YA 5AW9B 1CSBA 3TSIA 3HUSB 1N7LA 2WSCH 3RL0C 2WT7A 1DH3A 2C9NY 1Z56A 4WY4C 1LGHB 1HUCA 1LWUB 5AW2B 2I1JA 2OYHB 2WSEH 1NTZK 1SQBK 2P67A 2J58A 1FDMA 3MGNA 2QM8A 4DZOA 1N2DC 1W2EA 2FYZA 4N78E 1RE3C 4LGDE 1LT9B 2J59M 3V4WA 3VP8A 3A5TA 2NPSC 4JF7A 5CCHA 3CI9A 1FZCA 4LC1A 1ZR4A 5APWA 1JY2O 1URQB 2BASA 4ZKUA 3HE4A 1L4AB 5AW7B 3P8CD 2C9LY 5AVZB 1FOSF 2Z4EA 4GIFA 2O1JA 3CLQA 4Y99B 4C7NA 2IX7C 1JTHB 2CPBA 1GDTA 3VP9A 1J1DB 2VRSA 3HD7D 5CCHD 3TK1A 2C0WA 1IFJA 1LTJB 4W7ZA 2NPSA 1SFCA 2L5GB 2WPSA 2Q7CA 1G1JA 1SQQK 3LIDA 3RL0D 1RE4A 1LTTC 3BRTB 4WY4D 1CW5A 3RK3C 4ZKPA 2HFED 3L4FA 1JY3P 3VOPA 1QL2A 1L0NK 2R32A 1GZLA 2ZFCA 4N78D 1FJKA 1FOSE 3H32B 4HYTB 3A3YB 1H8AA 3VYIA 3GHGB 3LIEA 1MUUA 2Z5HA 1JNMA 1HWTC 2IFNA 2NPSD 1SFCD 4OH8B 1N7SC 2XZRA 1JY3N 2Q9IA 1LTAC 3MIWA 2P7JA 5AW5B 3CL3D 1NKZB 1WRGA 3M9QA 5CMZA 1VDFA 4EIJA 1JMMA 2KOGA 3HD7B 3M06A 2O1KA 4XA4A 2M3BA 1RF1B 1ZN5A 3RL0B 2JEEA 3V2NA 1SVFA 3HE4B 3HE5A 1M1JA 2KB7P 4WY4B 2HPCA 2FXMA 1N73C 2H7HA 3RK3D 5APVA 1KQLA 2FFDA 3VN0A 5AVXB 1XTCC 1JOCA 2OARA 1FZFA 2NPSB 1SFCB 3M91A 4AYCA 1IFMA 1IFIA 3C9IA 1FZCC 5CCHC 2HODB 1DEBA 2WITA 4I2LC 3O8ZA 3KPEA 1N7SD 1N73A 1KFMA 3N7NA 1H88A 4DOJA 2CPSA 1T3UA 1ZV8A 4XE5B 3G3ZA 1GK4A 2I1KA 2FKWB 3U59A 2M8RA 4JYCA 2PP6A 1LTIC 1A02F 3P8MC 2OYIC 4W80A 1JY2P 1SFCC 3A7OA 1PFIA 1KFNA 3R2PA 1RE4C 3RK3B 1J2JB 4N6JA 2KSJA 4JYBA 2IFMA 2YKOA 5APXA 3BATA 2A45I 3MD0A 1FZEA 3HRNA 3V5BA 1E5WA 3KQGA 4GT1A 1JY2N 5AVVB 1NU1K 2HPCB 1NTMK 3HTKA 1N7SB 5AW0B 2OYIA 1NTKK 2FYUK 1H89A 1G1IA 1J1EC 5APYA 4RESB 1AFOA 2WSFH 1OXZA 1HGVA 2XNXA 4WB4A 5CJ0A 5AW8B 5AVQB 5AVSB 3OA7A 1KILC 2HYNA 1FU1A 5BVZA 2N1TA 2ZXEB 1GD2E 2WT7B 1N73B 2GM4A 1M1JC 1SLQA 3M9HA 5KJ7A 1GU5A 1YTZT 5APUA 1MZ9A 3BVHA 2QM7A 1X8YA 2IPPA 3L36A 2FFDC 2N9BA 1A02J 2XKMA 3TYYA 3M0DA 3V4QA 3KYQA 1FZGA 1FZCB 2N1TD 1KILA 3VMYA 1XTGB 1M7LA 1ZLLA 2O01H 3OJAB 1FZBA 3N4XA 2HG5D 1RY3A 1FAVA 1LTSC 1LT9A 5KLVK 3RK2C 1IC2A 4IFDK 5CCGA 5APTA 2KLVA 2R3CA 5APSA 1URQA 2Q5UA 3NTNA 3II6A 4C7NB 3LW5H 1L4AA 4HH2A 3TNUA 3V2RA 3BRVB 3P7KA 3BASA 1GW3A 1GU4A 2OYIB 1KILD 2XDJA 1SP4A 3L35A 2KP8A 4N3YB 2R5DA 3V2PA 3B5NC 4KHXA 2GUSA 4IFMA 1JTHA 4GKGA 3I5CA 4I6MC 1NKNA 4C7RA 4O9BA 1X9VA 3M0AA 3IR9A 1T2KC 1GK6A 2YO2A 1CI6A 1WT6A 1JCCA 1HTLC 1J1EB 1SQXK 3H32A 2WTYA 2Q3IA 1FZAA 4C46A 1KZUB 4AUWA 2YKQA 1G2CA 3B5NA 3P32A 3GHGA 2POHA 1MFZA 3U1AA 1HGZA 3RK2D 5AVRB 1YTZI 5AVTB 1KILB 1GL2C 2YO3A 1CZQA 5BU8B 3H6PA 2W27A 1OWAA 3MTUE 2XU6A 2N1TC 3HE5B 5CJ4A 1M1JB 2JJLA 1SQPK 1HH0A 3HD7A 1MV8A 5KJ7C 2H8PD 3B5ND 2LKMA 1RF1A 3EQ2A 1DX7A 2C0XA 2H43A 2R5BA 5AW3B 3T97A 2FFDB 1HBWA 3HUSC 3TNUB 1GTWA 3U1CA 4WY4A 4B86A 1NHLA 2WPQA 1T2KD 4IFFA 1LWUC 1FBMA 1SQVK 3M0DC 1NOHA 3VMZA 1JO5A 2Z5IA 2OYHC 1GL2A 5CHXA 2MJZA 3NMDA 2GUVA 1RE3A 1RF0C 3A2AA 1T3JA 3RK2B 3VTPC 5BU5A 1IK9A 1LT9C 2E43A 4I1LA 1T8ZA 1HJBA 3L37A 1IFDA 4M3LA 2HODA 5CCGC 4WBAA 3HUSA 1NWQA 1URQC 1CI6B 2PAJA 1L4AC 4AQRD 5APQA 1AQ5A 1LWUA 3KDPB 3SWFA 1GL2D 2YKPA 1QL1A 1JUNA 1JY3O 3EFGA 2YNYA 2OYHA 3B5NB 1N86A 1G2CB 1NH4A 2YMYA 1EQ7A 4Y99C 4EOTA 2W6AA 1JCDA 2KYVA 3NXSA 3WMM0 1RF0A 1X79B 1J1DC 5KJ7D 2A45H 2XV5A 3SWYA 1S9KE 5AW6B 1LTJC 2W6BA 1FJPA 1NO4A 2P2UA 3UIAA 1L0LK 1HVVA 1IJDB 1GW4A 3NFQA 1VPCA 5KTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MD0 A;  2R32 A;  3V5B A;  1GZL A;  2ZFC A;  3KQG A;  4GT1 A;  2WWW A;  1FOS E;  5AVV B;  5AW4 B;  2YO2 A;  5AVU B;  1CI6 A;  4HYT B;  3A3Y B;  2E42 A;  1H8A A;  3HTK A;  3OAK A;  3VYI A;  3LIE A;  1MUU A;  2Z5H A;  5AW0 B;  2WTY A;  2Q3I A;  3B8E B;  1JNM A;  1HWT C;  4C46 A;  1H89 A;  4AUW A;  3P32 A;  2XZR A;  5APY A;  5AVY B;  4RES B;  1MFZ A;  5AVR B;  5AW5 B;  1YYC A;  2P7J A;  1NAF A;  1OXZ A;  5AVT B;  5CMZ A;  1IO4 A;  5AW8 B;  2YO3 A;  3M9B A;  3VMX A;  1CZQ A;  5AVQ B;  5AVS B;  5AW1 B;  3M06 A;  2W27 A;  1OWA A;  2XU6 A;  3HE5 B;  5AVW B;  2JJL A;  2ZXE B;  1GD2 E;  2WPR A;  2WT7 B;  1MV8 A;  1SLQ A;  3HE5 A;  3HE4 B;  3M9H A;  1S9K D;  5AW9 B;  1CSB A;  1GU5 A;  5APU A;  2R5B A;  5AW3 B;  2WT7 A;  3T97 A;  1DH3 A;  2C9N Y;  2QM7 A;  1HBW A;  1X8Y A;  3TNU B;  1GTW A;  2IPP A;  1HUC A;  4B86 A;  2H7H A;  5AW2 B;  3L36 A;  2WPQ A;  5APX A;  5APV A;  2N9B A;  1KQL A;  1T2K D;  3VN0 A;  5AVX B;  1A02 J;  3VMZ A;  3TYY A;  3M0D A;  2Z5I A;  2P67 A;  3V4Q A;  3MGN A;  2QM8 A;  3NMD A;  4DZO A;  3M91 A;  4AYC A;  3VMY A;  3V4W A;  3A2A A;  3A5T A;  3VTP C;  4I2L C;  4LC1 A;  3O8Z A;  1FAV A;  2E43 A;  1HJB A;  5APW A;  3L37 A;  4M3L A;  2BAS A;  3HE4 A;  5APT A;  1NWQ A;  5AW7 B;  2R3C A;  1H88 A;  5APS A;  2C9L Y;  2Q5U A;  3NTN A;  1CI6 B;  4XE5 B;  5AVZ B;  4C7N B;  1FOS F;  4AQR D;  1GK4 A;  3TNU A;  5APQ A;  3SWF A;  3KDP B;  3P7K A;  1JUN A;  1GU4 A;  2YNY A;  4JYC A;  4C7N A;  1G2C B;  1A02 F;  1SP4 A;  2VRS A;  3L35 A;  3P8M C;  4EOT A;  2KP8 A;  2R5D A;  2W6A A;  3NXS A;  3TK1 A;  4KHX A;  3A7O A;  2XV5 A;  2Q7C A;  2WPS A;  4GKG A;  3LID A;  1S9K E;  3I5C A;  1J2J B;  5AW6 B;  4JYB A;  4I6M C;  2P2U A;  3UIA A;  1T2K C;  3M0A A;  3IR9 A;  3NFQ A;  1GK6 A; 
#chains in the Genus database with same CATH topology
 1AVO A;  3HTK B;  5AVU B;  2Q1K A;  2WZ7 A;  1LTB C;  2HLO A;  1U57 A;  2ZT9 B;  3I56 P;  1YJW P;  1N7S A;  2IDB A;  3E1I A;  1URQ D;  3CC4 P;  2N1T B;  1BDD A;  1L4A D;  1SQX D;  1YHQ P;  2KS1 A;  5CBO A;  2CK3 H;  4MN4 C;  1ZR2 A;  1S9K D;  5AW9 B;  3HUS B;  3RL0 C;  2WSE J;  4WY4 C;  2YIU B;  3CME P;  4YXD C;  1NU1 D;  3CWB E;  1NTM D;  1KD1 Q;  2P67 A;  1M8O B;  3L70 D;  3CCE P;  1DD4 A;  1RE3 C;  3VP8 A;  5KLV E;  1D7M A;  2NPS C;  1FZC A;  1SQP G;  3CI9 A;  3L74 E;  4LC1 A;  1ZR4 A;  1PP9 D;  4PJ0 H;  4ZKU A;  2B88 A;  2R3S A;  5AW7 B;  1PIX A;  2SPZ A;  3AE5 C;  4BXL A;  2C9L Y;  2Z4E A;  2QEX P;  2O1J A;  3CLQ A;  4Y99 B;  1KQS O;  1GDT A;  3VP9 A;  1J1D B;  3TK1 A;  1LTJ B;  3CWB J;  4PV1 C;  1SFC A;  3WU2 E;  1NGM B;  1SQQ K;  1Q86 Q;  1BE3 G;  1YQ3 C;  4OVN F;  2KUB A;  1EZV D;  1CW5 A;  4ZKP A;  3S1K A;  3VOP A;  3AEC C;  1L0N K;  3WUU A;  1FE6 A;  3A3Y B;  3VYI A;  3GHG B;  5GTH H;  2RH0 A;  2IFN A;  1N7S C;  1JY3 N;  2N9Y B;  3GF7 A;  3H1H G;  1WRG A;  1VDF A;  1ZOY C;  2KOG A;  2G8Y A;  1SQP E;  1LNQ A;  2O1K A;  4EI2 A;  4TT3 H;  1X22 A;  1NTK E;  1AA0 A;  1H0T B;  5C39 A;  2FXM A;  3H1I D;  2E75 C;  3TGU E;  3RK3 D;  4GOD A;  5APV A;  3AEA C;  5KAI E;  2E74 C;  2QG4 A;  1XTC C;  1FZF A;  3SWK A;  1BE3 E;  1IFM A;  3FWL A;  3FWN A;  2D2C D;  1FZC C;  3Q5R A;  3KPE A;  1SQP J;  2QRX A;  1N73 A;  3L73 D;  1KFM A;  3GG2 A;  1H88 A;  1T3U A;  1GK4 A;  3AE9 C;  3CCL P;  1VQ6 P;  1BGY G;  2FKW B;  4U7J A;  2A06 E;  1SFC C;  3H1K G;  5E79 E;  4QMA A;  1SQV D;  2UWJ E;  1BE3 J;  2E76 C;  5APX A;  3AEF C;  4GT1 A;  1JY2 N;  5AVV B;  5H2F H;  1S2E A;  2ITA A;  3HTK A;  2DW3 A;  4ASV A;  2AEJ A;  2OYI A;  2FYU K;  1H89 A;  5B5E E;  1J1E C;  4OWF A;  1SQQ G;  2E5Y A;  3H1H J;  5CJ0 A;  5AW8 B;  1L0N G;  3IN6 A;  1FU1 A;  2N1T A;  2JWA A;  3CCJ P;  2O3J A;  1L0L D;  5KJ7 A;  1Q81 Q;  5APU A;  4L73 A;  1BGY E;  2FXO A;  2B9B A;  2QJK B;  3AE1 C;  4KJM A;  3H1K E;  3BCC D;  3H1J G;  3VMY A;  4XFJ A;  1AVY A;  2BCC D;  3EWK A;  3OJA B;  1FZB A;  3JSV C;  3QWO C;  4ASW A;  4IFD K;  1W5C E;  5CCG A;  1AQT A;  2NZ2 A;  2Q5U A;  4C7N B;  1ZXG A;  4HH2 A;  2WMM A;  3BRV B;  3MP7 B;  1GW3 A;  1GU4 A;  1KIL D;  4OGQ B;  1SP4 A;  1VF5 D;  4N3Y B;  3ZDM A;  3B5N C;  1SQQ E;  3K5B A;  4IFM A;  5GTI H;  5KLI C;  2AXT E;  2K1A A;  4I6M C;  3H1K J;  1L0N E;  3KZI E;  4O9B A;  3IR9 A;  3SFD C;  4ZNC A;  1MKM A;  3A0B H;  2M5A B;  2YO2 A;  1JCC A;  1PZQ A;  1KZU B;  2YKQ A;  3GHG A;  4BWN A;  2JO1 A;  2ZT9 C;  3G4S P;  3H1J E;  1SQQ J;  3OW2 O;  1CZQ A;  2W27 A;  1FS0 E;  3MTU E;  2XU6 A;  2N1T C;  3HE5 B;  4U3F G;  1S5L X;  1OMI A;  1HH0 A;  4DJG A;  1L0N J;  1MV8 A;  5KJ7 C;  2H8P D;  2C0X A;  2FYU G;  2FFD B;  4EYY Q;  3HUS C;  1GTW A;  1H0T A;  1NHL A;  3CX5 I;  1T2K D;  1NOH A;  2Z5I A;  2OGU A;  5CHX A;  3CXH I;  2GUV A;  3L75 D;  1U7M A;  1S72 P;  3H1L E;  4I1L A;  2E43 A;  3L37 A;  5CCG C;  4WBA A;  2AEF A;  1NWQ A;  5B66 H;  1CI6 B;  4AQR D;  3H25 A;  3RBZ A;  1LWU A;  3SWF A;  1GL2 D;  2O01 J;  2YKP A;  1JY3 O;  3EFG A;  5KLV D;  2OYH A;  1G2C B;  4Y99 C;  1YQ4 C;  3WMM 0;  1J1D C;  2XV5 A;  1LTJ C;  1FJP A;  1OIP A;  1BCC G;  1BDC A;  2A45 G;  3V2Q A;  1K73 Q;  5AW4 B;  2E42 A;  2FYU E;  2ZYA A;  5B5E H;  3GHG C;  2R44 A;  1NAF A;  3MUD A;  3VMX A;  5AVW B;  1VQO P;  1LTG C;  2WPR A;  1EDK A;  4U3F J;  3TSI A;  3Q2Y A;  1DH3 A;  2FYU J;  1SQB K;  1JEK A;  3G6E P;  1NTK D;  1W2E A;  2LR2 A;  1Q82 Q;  2W90 A;  2NRG A;  2J5U A;  1JY2 O;  1URQ B;  2BAS A;  1L4A B;  1ZRT E;  3G71 P;  3P8C D;  5AVZ B;  3AED C;  4GIF A;  4C7N A;  5KAF H;  1JTH B;  1K9M Q;  3HD7 D;  4UB6 H;  1IFJ A;  1QGK B;  2NPS A;  2JWD A;  2WPS A;  1P84 E;  1RE4 A;  3BRT B;  1VQ5 P;  1P84 I;  2HFE D;  1PPJ E;  1JY3 P;  5EFW B;  1JM0 A;  2KIK A;  1BCC J;  2OTK E;  4N78 D;  1FJK A;  1FOS E;  4HYT B;  1KB9 E;  3L71 D;  1VQ7 P;  1HWT C;  1ZME C;  2M5A A;  1SFC D;  1KB9 I;  1EXJ A;  3F5H A;  4ZMD A;  1LTA C;  3MIW A;  3MUD C;  3M9Q A;  2WQY C;  5CMZ A;  3Q1M A;  4H13 D;  2JEE A;  3CX5 H;  3V2N A;  1Q2N A;  1SVF A;  3HE4 B;  3HE5 A;  1YIT P;  2QJP B;  3CXH H;  2H7H A;  1LP1 B;  2LXB A;  1KQL A;  2FFD A;  1VQK P;  1JOC A;  2OAR A;  2WSC J;  3C9I A;  1DEB A;  2WIT A;  2BEZ F;  3CPW O;  3FGA D;  5TIS H;  1YJ9 P;  1OW6 A;  3G3Z A;  1PV3 A;  3U59 A;  2M8R A;  1SQB G;  1OZH A;  3ABV C;  1JY2 P;  4OGQ C;  2IBZ G;  1RE4 C;  3RK3 B;  2W6J H;  1J2J B;  4JYB A;  4JQ0 D;  4UB8 E;  2YKO A;  2K9J B;  4HJG H;  3PTZ A;  1S5L E;  4TLF A;  3V5B A;  1KYO E;  1NU1 K;  2HPC B;  1NTM K;  1KYO I;  3AE6 C;  1FDI A;  1G1I A;  4NPE A;  1OXZ A;  1HGV A;  4WB4 A;  4H0L D;  2Y0C A;  2HYN A;  1RQV A;  3D71 A;  4IL6 H;  2B89 A;  4L74 A;  2WT7 B;  3E7K A;  3B4S A;  2W83 C;  1MZ9 A;  3V6I A;  3L72 D;  2FYN B;  4BRY B;  1SQB E;  2FFD C;  2QJY B;  2XKM A;  3TYY A;  2IBZ E;  2N1T D;  3CX5 D;  1RY3 A;  1LTS C;  3FXD A;  2KK7 A;  4RJT A;  1IC2 A;  3CXH D;  4GOF A;  5APS A;  1URQ A;  3LW5 H;  1Y47 A;  3PLN A;  1L4A A;  3BAS A;  1AV1 A;  1W2B O;  1E79 H;  3H1L D;  1TU3 F;  1P84 H;  1SQB J;  2GUS A;  1JTH A;  4GKG A;  1YI2 P;  1NTZ D;  2ZVO B;  1X9V A;  2AXC A;  1GK6 A;  4CPG A;  2IYP A;  1RQU A;  1KB9 H;  1WT6 A;  1HTL C;  1QVG O;  3A0H E;  1KTM A;  2Q3I A;  3H1H E;  3B5N A;  1SQX G;  3P32 A;  4IL6 X;  2QVA A;  3CCQ P;  2K3R A;  1MFZ A;  1HGZ A;  3RK2 D;  5AVR B;  3EFF K;  1USE A;  1YTZ I;  4HKZ H;  1KIL B;  1T6A A;  1KMI Z;  1VQ8 P;  4D6T D;  1VF5 B;  5BU8 B;  1OWA A;  5CJ4 A;  2JJL A;  2WSF J;  1NU1 G;  1NTM G;  2YXQ B;  1DX7 A;  2H43 A;  2R5B A;  3L70 G;  1JMB A;  2OQQ A;  3TNU B;  3U1C A;  1FBM A;  1SQV K;  3VMZ A;  1PP9 G;  5DJU B;  1M56 D;  4L76 A;  3A2A A;  2JP3 A;  3PRJ A;  2H89 C;  1VQ9 P;  1VQN P;  1EDJ A;  4M3L A;  1IFD A;  4JPZ B;  3HUS A;  1K04 A;  1URQ C;  1L4A C;  3KDP B;  1JUN A;  1PGJ A;  1KV4 A;  2KSE A;  1N86 A;  1NH4 A;  1EZV G;  4YPC A;  3IAO A;  2W6A A;  4A7P A;  1S9K E;  1ZRT D;  3AEB C;  5AW6 B;  4H44 D;  3E1R A;  3UIA A;  1L0L K;  1RHZ B;  3NFQ A;  1KYO H;  3IFM A;  2K9J A;  3AEG C;  1NTM E;  2PRR A;  3OAK A;  1P84 D;  3L70 E;  2P58 A;  3WU2 H;  1VQ4 P;  2K9Y A;  2ZYG A;  4PD4 E;  1SQX J;  1YYC A;  1LTJ A;  1GL2 B;  1PGQ A;  3F89 A;  4PD4 I;  1IO4 A;  3M9B A;  1R5L A;  2KZI A;  1KB9 D;  3H1I G;  2FY8 A;  3PP5 A;  1ZP0 C;  1CSB A;  3JCU E;  1NU1 J;  1DIP A;  2WT7 A;  2C9N Y;  1NTM J;  1Z56 A;  1LGH B;  4YXW H;  2QJP C;  2I1J A;  1Q90 D;  3L70 J;  4IOI H;  2IZ1 A;  2ZVN B;  3AE2 C;  2J58 A;  1FDM A;  1HF9 A;  4DZO A;  2FYZ A;  1USD A;  3SSU A;  4LGD E;  3L73 G;  1LT9 B;  1PP9 J;  3V4W A;  4JF7 A;  5CCH A;  4Y28 J;  1MFT A;  5KAI H;  1OFC X;  2B87 B;  1FOS F;  2YIU C;  3AEE C;  3IF4 A;  1S3J A;  1SQV G;  2IX7 C;  1PGP A;  4W7Z A;  2L5G B;  1G1J A;  1OW8 A;  3RL0 D;  4I7Z B;  3CWB D;  4WY4 D;  3RK3 C;  3L4F A;  1X0T A;  3RK3 E;  2ZFC A;  3H32 B;  3A0H H;  3S9O A;  3O6Q B;  3L74 D;  1H8A A;  4NPD A;  1MUU A;  2Z5H A;  1JNM A;  2NPS D;  5E79 H;  2ZXX A;  4OH8 B;  2XZR A;  2Q9I A;  2P7J A;  1KYO D;  3CL3 D;  1NKZ B;  4U3F E;  3L73 E;  1L0L G;  2ZYD A;  3HD7 B;  2KLU A;  3Q5P A;  1RF1 B;  1ZN5 A;  3USS A;  3H1I J;  4PV1 D;  3CCV P;  3BCC G;  1SQV E;  3GLM A;  2FYN C;  2BCC G;  3VN0 A;  5AVX B;  1OW7 A;  2QJY C;  3M91 A;  1SFC B;  4L75 A;  1IFI A;  1NTZ J;  5CCH C;  2HOD B;  1AJY A;  4I2L C;  3L73 J;  3I55 P;  1N7S D;  2G3A A;  4K35 A;  3WUT A;  4H13 B;  4DOJ A;  2CPS A;  1ZV8 A;  3R4Y A;  1SQP D;  4XE5 B;  2PP6 A;  3RBX A;  1EXI A;  1SQV J;  4W80 A;  5GTH E;  2RMZ A;  3A7O A;  1PFI A;  2E5T A;  2KZJ A;  3R2P A;  1BCC E;  3TGU D;  1L0L E;  4N6J A;  4D6T J;  2E75 D;  2KSJ A;  2QSI A;  3BAT A;  2A45 I;  3HRN A;  2E74 D;  3KQG A;  2OTL P;  1BE3 D;  3CCS P;  3RL0 g;  3BCC E;  2AXT H;  5KKZ B;  1NTK K;  4YTP C;  4PD4 H;  5APY A;  1AFO A;  1WMK A;  2KNC B;  3KZI H;  3C1L A;  5L8R J;  2PGD A;  1Y8A A;  3D70 A;  5AVS B;  1EC5 A;  1KIL C;  5DJT B;  2A06 D;  2FXP A;  1L0L J;  1UIX A;  5BVZ A;  1VF5 C;  3H1H D;  1GD2 E;  1KIL E;  2ZAE B;  1N73 B;  3M9H A;  1GU5 A;  2QM7 A;  1X8Y A;  1S4X A;  3L75 G;  2N9B A;  2JR8 A;  4DT0 A;  2E76 D;  1A02 J;  3BCC J;  2BCC J;  2Y0E A;  3JC2 2;  3V4Q A;  1FZG A;  1SS1 A;  1XTG B;  1M7L A;  1ZLL A;  3CCR P;  4WVZ A;  2O01 H;  2HG5 D;  1FAV A;  1LT9 A;  5KLV G;  2O01 N;  4H0L B;  1YBK A;  2KLV A;  3NTN A;  3V2R A;  3GMA A;  2B87 A;  2OYI B;  5H2F E;  3L35 A;  2KP8 A;  2QJK C;  2R5D A;  3V2P A;  4KHX A;  1BSN A;  1KQG B;  3I5C A;  1BGY D;  2Y9Z A;  1NKN A;  1T2K C;  1RH5 B;  2GA1 A;  2V7Q H;  3H1K D;  1CI6 A;  2FBW C;  3Q3D A;  1SQX K;  3H32 A;  3L75 E;  1FZA A;  4C46 A;  4AUW A;  1G2C A;  3O6Q A;  2POH A;  3U1A A;  2KXP B;  1M1K Q;  2YXR B;  2WVR A;  1GL2 C;  3H6P A;  2D2C B;  1M1J B;  1SQQ D;  4JBZ A;  3HD7 A;  3B5N D;  1PGO A;  4PD4 D;  1RF1 A;  3EQ2 A;  3WUV A;  1NTK G;  1L0N D;  4B86 A;  2WPQ A;  1NJI Q;  1KN7 A;  4IFF A;  3L75 J;  1JO5 A;  3TGU G;  3B71 A;  2MJZ A;  3NMD A;  2I8D A;  4WWI A;  1RF0 C;  1T3J A;  3RK2 B;  5BU5 A;  1LT9 C;  1T8Z A;  3AE4 C;  5GTI E;  1HJB A;  1FC2 C;  2HOD A;  1OX3 A;  3H1J D;  2ZT9 D;  5KLV J;  3L74 J;  2LXC B;  3AE3 C;  3SFE C;  1AQ5 A;  1JB0 J;  1L2P A;  1QL1 A;  3A0B E;  2YNY A;  1JCD A;  2KYV A;  2IBZ I;  5KJ7 D;  2A45 H;  3SWY A;  2A06 G;  3FXE A;  3L71 G;  1IJD B;  1GW4 A;  4I7Z C;  1DD3 A;  3CC2 P;  2WWW A;  4EDF A;  2L91 A;  4LLH A;  3B8E B;  5AVY B;  1FDO A;  1LT1 A;  5CCG D;  2P1J A;  3CCM P;  3FX0 A;  2KNC A;  3P8C E;  5AW1 B;  1IFN A;  5K5G B;  1M90 Q;  1NVO A;  4GOE A;  3HD7 C;  3GW6 A;  4H44 B;  1RF1 C;  4W7Y A;  1N7L A;  2WSC H;  2Q6Q A;  4U3F D;  1HUC A;  1LWU B;  5AW2 B;  1YIJ P;  1NTK J;  1EDL A;  2OYH B;  3KXD A;  3MZW B;  3D6Z A;  2WSE H;  1NTZ K;  5B66 E;  2FYU D;  3MGN A;  2QM8 A;  1EDI A;  1N2D C;  4N78 E;  3TGU J;  2J59 M;  3TF5 A;  4K3A A;  3A5T A;  3L71 E;  2YMK A;  5APW A;  4HB1 A;  3HE4 A;  4Z1M H;  1UII A;  1LP1 A;  4H13 C;  2CPB A;  2K37 A;  2VRS A;  5CCH D;  2C0W A;  4KT0 J;  2Q7C A;  5CBN A;  3CC7 P;  3LID A;  1LTT C;  1VQM P;  4DCK A;  1QL2 A;  2R32 A;  3L71 J;  1GZL A;  1SQX E;  1YJN P;  1QX8 A;  2W8Z A;  2XND H;  1BCC D;  1LJ2 A;  3LIE A;  4GDO A;  4UB8 H;  5KKZ C;  5AW5 B;  1IFP A;  1S5L H;  3PJS K;  4EIJ A;  1JMM A;  3M06 A;  1NU1 E;  3L72 G;  4XA4 A;  2M3B A;  3D6Y A;  1VQP P;  3RL0 B;  1OVU A;  3T97 B;  2Y0D A;  1M1J A;  2KB7 P;  4WY4 B;  2HPC A;  1N73 C;  1PPJ D;  1PP9 E;  1ZW0 A;  2NPS B;  4AYC A;  2Q3E A;  1BGY J;  5KAF E;  2K88 A;  1VL2 A;  3O8Z A;  4UB6 E;  1QVF O;  2BEQ D;  3ITK A;  2JDI H;  2WPV B;  3H1L G;  3N7N A;  1EZV E;  4BRY A;  4H0L C;  3Q5S A;  4NPF X;  3TDK A;  2I1K A;  4JYC A;  1NTZ G;  1EZV I;  1LTI C;  1A02 F;  4PV1 B;  3P8M C;  2QA4 P;  2OYI C;  1K05 A;  1NAY A;  1KFN A;  1Q7Y Q;  3S4R A;  1U7J A;  2AEM A;  3PH0 A;  2IFM A;  2WSS H;  3L72 E;  1VQL P;  3MD0 A;  1FZE A;  1E5W A;  3CD6 P;  1N7S B;  3GF3 A;  5AW0 B;  3CX5 E;  4D6T G;  2RN0 A;  3W68 A;  4RES B;  2WSF H;  2MKV A;  2KS1 B;  3H1I E;  3CXH E;  1R8E A;  2XNX A;  5AVQ B;  3OA7 A;  2KI7 B;  2ZXE B;  2D2C C;  3L72 J;  2GM4 A;  1M1J C;  1SLQ A;  3H1J J;  2E75 B;  4OGQ D;  1YTZ T;  1S1C X;  3BVH A;  1IK7 A;  1M57 D;  4R4M A;  2IPP A;  2E74 B;  3L36 A;  1NYH A;  1NTZ E;  4RO0 A;  1QEX A;  5TIS E;  3M0D A;  3KYQ A;  1FZC B;  1OVV A;  1KIL A;  2M3E A;  4R4L A;  1BSH A;  2P10 A;  3N4X A;  5KLV K;  3RK2 C;  5APT A;  4PJ0 E;  2IZ0 A;  4RKU J;  2R3C A;  3II6 A;  3TNU A;  3H1L J;  3P7K A;  2RKL A;  2ZJS E;  4D6T E;  2XDJ A;  1DEE G;  3VMA A;  2QE7 H;  3AE8 C;  2PFX A;  2QIW A;  2V7Q J;  2E76 B;  1SQB D;  3RGU A;  4C7R A;  3M0A A;  1R5S A;  3C8V A;  1KOR A;  1KC8 Q;  2IBZ D;  1PPJ G;  2HR3 A;  1J1E B;  4IL6 E;  2WTY A;  3QH9 A;  5TJH A;  5AVT B;  1HJ0 A;  2OYO A;  2YO3 A;  1KQF B;  1PL5 A;  1SQP K;  2V4H A;  2M0B A;  2LKM A;  2BCC E;  4H44 C;  2JKV A;  5AW3 B;  3T97 A;  1HBW A;  4WY4 A;  1IZN B;  1LWU C;  2OTJ P;  3M0D C;  2OYH C;  1GL2 A;  2IYO A;  5M1B A;  3MHV A;  1QLE D;  3PHL A;  1RE3 A;  3VTP C;  3JCU H;  1IK9 A;  1N8R Q;  3G9R A;  3AE7 C;  1GMJ A;  2PAJ A;  5APQ A;  3W67 A;  3B5N B;  2YMY A;  1EQ7 A;  3CWB G;  5KLI B;  4EOT A;  2H88 C;  3NXS A;  1K8A Q;  1RF0 A;  1X79 B;  1Y9B A;  2Y9Y A;  3LW5 J;  3KHU A;  2W6B A;  3CMA P;  1OVR A;  1NO4 A;  3L74 G;  2P2U A;  1HVV A;  1VPC A;  3CCU P;  5KTB A; 
#chains in the Genus database with same CATH homology
 2A45 G;  3IFM A;  3V2Q A;  3HTK B;  2WWW A;  5AW4 B;  5AVU B;  2E42 A;  3OAK A;  4LLH A;  2WZ7 A;  3B8E B;  1LTB C;  2HLO A;  3GHG C;  5AVY B;  1N7S A;  5CCG D;  1YYC A;  2P1J A;  1LTJ A;  1NAF A;  1GL2 B;  3MUD A;  3E1I A;  1URQ D;  1IO4 A;  2N1T B;  3VMX A;  1L4A D;  3M9B A;  3P8C E;  5AW1 B;  1IFN A;  5AVW B;  3PP5 A;  3HD7 C;  1ZR2 A;  1LTG C;  2WPR A;  1S9K D;  1RF1 C;  4W7Y A;  5AW9 B;  1CSB A;  3TSI A;  3HUS B;  1N7L A;  2WSC H;  3RL0 C;  2WT7 A;  1DH3 A;  2C9N Y;  1Z56 A;  4WY4 C;  1LGH B;  1HUC A;  1LWU B;  5AW2 B;  2I1J A;  2OYH B;  2WSE H;  1NTZ K;  1SQB K;  2P67 A;  2J58 A;  1FDM A;  3MGN A;  2QM8 A;  4DZO A;  1N2D C;  1W2E A;  2FYZ A;  4N78 E;  1RE3 C;  4LGD E;  1LT9 B;  2J59 M;  3V4W A;  3VP8 A;  3A5T A;  2NPS C;  4JF7 A;  5CCH A;  3CI9 A;  1FZC A;  4LC1 A;  1ZR4 A;  5APW A;  1JY2 O;  1URQ B;  2BAS A;  4ZKU A;  3HE4 A;  1L4A B;  5AW7 B;  3P8C D;  2C9L Y;  5AVZ B;  1FOS F;  2Z4E A;  4GIF A;  2O1J A;  3CLQ A;  4Y99 B;  4C7N A;  2IX7 C;  1JTH B;  2CPB A;  1GDT A;  3VP9 A;  1J1D B;  2VRS A;  3HD7 D;  5CCH D;  3TK1 A;  2C0W A;  1IFJ A;  1LTJ B;  4W7Z A;  2NPS A;  1SFC A;  2L5G B;  2WPS A;  2Q7C A;  1G1J A;  1SQQ K;  3LID A;  3RL0 D;  1RE4 A;  1LTT C;  3BRT B;  4WY4 D;  1CW5 A;  3RK3 C;  4ZKP A;  2HFE D;  3L4F A;  1JY3 P;  3VOP A;  1QL2 A;  1L0N K;  2R32 A;  1GZL A;  2ZFC A;  4N78 D;  1FJK A;  1FOS E;  3H32 B;  4HYT B;  3A3Y B;  1H8A A;  3VYI A;  3GHG B;  3LIE A;  1MUU A;  2Z5H A;  1JNM A;  1HWT C;  2IFN A;  2NPS D;  1SFC D;  4OH8 B;  1N7S C;  2XZR A;  1JY3 N;  2Q9I A;  1LTA C;  3MIW A;  2P7J A;  5AW5 B;  3CL3 D;  1NKZ B;  1WRG A;  3M9Q A;  5CMZ A;  1VDF A;  4EIJ A;  1JMM A;  2KOG A;  3HD7 B;  3M06 A;  2O1K A;  4XA4 A;  2M3B A;  1RF1 B;  1ZN5 A;  3RL0 B;  2JEE A;  3V2N A;  1SVF A;  3HE4 B;  3HE5 A;  1M1J A;  2KB7 P;  4WY4 B;  2HPC A;  2FXM A;  1N73 C;  2H7H A;  3RK3 D;  5APV A;  1KQL A;  2FFD A;  3VN0 A;  5AVX B;  1XTC C;  1JOC A;  2OAR A;  1FZF A;  2NPS B;  1SFC B;  3M91 A;  4AYC A;  1IFM A;  1IFI A;  3C9I A;  1FZC C;  5CCH C;  2HOD B;  1DEB A;  2WIT A;  4I2L C;  3O8Z A;  3KPE A;  1N7S D;  1N73 A;  1KFM A;  3N7N A;  1H88 A;  4DOJ A;  2CPS A;  1T3U A;  1ZV8 A;  4XE5 B;  3G3Z A;  1GK4 A;  2I1K A;  2FKW B;  3U59 A;  2M8R A;  4JYC A;  2PP6 A;  1LTI C;  1A02 F;  3P8M C;  2OYI C;  4W80 A;  1JY2 P;  1SFC C;  3A7O A;  1PFI A;  1KFN A;  3R2P A;  1RE4 C;  3RK3 B;  1J2J B;  4N6J A;  2KSJ A;  4JYB A;  2IFM A;  2YKO A;  5APX A;  3BAT A;  2A45 I;  3MD0 A;  1FZE A;  3HRN A;  3V5B A;  1E5W A;  3KQG A;  4GT1 A;  1JY2 N;  5AVV B;  1NU1 K;  2HPC B;  1NTM K;  3HTK A;  1N7S B;  5AW0 B;  2OYI A;  1NTK K;  2FYU K;  1H89 A;  1G1I A;  1J1E C;  5APY A;  4RES B;  1AFO A;  2WSF H;  1OXZ A;  1HGV A;  2XNX A;  4WB4 A;  5CJ0 A;  5AW8 B;  5AVQ B;  5AVS B;  3OA7 A;  1KIL C;  2HYN A;  1FU1 A;  5BVZ A;  2N1T A;  2ZXE B;  1GD2 E;  2WT7 B;  1N73 B;  2GM4 A;  1M1J C;  1SLQ A;  3M9H A;  5KJ7 A;  1GU5 A;  1YTZ T;  5APU A;  1MZ9 A;  3BVH A;  2QM7 A;  1X8Y A;  2IPP A;  3L36 A;  2FFD C;  2N9B A;  1A02 J;  2XKM A;  3TYY A;  3M0D A;  3V4Q A;  3KYQ A;  1FZG A;  1FZC B;  2N1T D;  1KIL A;  3VMY A;  1XTG B;  1M7L A;  1ZLL A;  2O01 H;  3OJA B;  1FZB A;  3N4X A;  2HG5 D;  1RY3 A;  1FAV A;  1LTS C;  1LT9 A;  5KLV K;  3RK2 C;  1IC2 A;  4IFD K;  5CCG A;  5APT A;  2KLV A;  2R3C A;  5APS A;  1URQ A;  2Q5U A;  3NTN A;  3II6 A;  4C7N B;  3LW5 H;  1L4A A;  4HH2 A;  3TNU A;  3V2R A;  3BRV B;  3P7K A;  3BAS A;  1GW3 A;  1GU4 A;  2OYI B;  1KIL D;  2XDJ A;  1SP4 A;  3L35 A;  2KP8 A;  4N3Y B;  2R5D A;  3V2P A;  3B5N C;  4KHX A;  2GUS A;  4IFM A;  1JTH A;  4GKG A;  3I5C A;  4I6M C;  1NKN A;  4C7R A;  4O9B A;  1X9V A;  3M0A A;  3IR9 A;  1T2K C;  1GK6 A;  2YO2 A;  1CI6 A;  1WT6 A;  1JCC A;  1HTL C;  1J1E B;  1SQX K;  3H32 A;  2WTY A;  2Q3I A;  1FZA A;  4C46 A;  1KZU B;  4AUW A;  2YKQ A;  1G2C A;  3B5N A;  3P32 A;  3GHG A;  2POH A;  1MFZ A;  3U1A A;  1HGZ A;  3RK2 D;  5AVR B;  1YTZ I;  5AVT B;  1KIL B;  1GL2 C;  2YO3 A;  1CZQ A;  5BU8 B;  3H6P A;  2W27 A;  1OWA A;  3MTU E;  2XU6 A;  2N1T C;  3HE5 B;  5CJ4 A;  1M1J B;  2JJL A;  1SQP K;  1HH0 A;  3HD7 A;  1MV8 A;  5KJ7 C;  2H8P D;  3B5N D;  2LKM A;  1RF1 A;  3EQ2 A;  1DX7 A;  2C0X A;  2H43 A;  2R5B A;  5AW3 B;  3T97 A;  2FFD B;  1HBW A;  3HUS C;  3TNU B;  1GTW A;  3U1C A;  4WY4 A;  4B86 A;  1NHL A;  2WPQ A;  1T2K D;  4IFF A;  1LWU C;  1FBM A;  1SQV K;  3M0D C;  1NOH A;  3VMZ A;  1JO5 A;  2Z5I A;  2OYH C;  1GL2 A;  5CHX A;  2MJZ A;  3NMD A;  2GUV A;  1RE3 A;  1RF0 C;  3A2A A;  1T3J A;  3RK2 B;  3VTP C;  5BU5 A;  1IK9 A;  1LT9 C;  2E43 A;  4I1L A;  1T8Z A;  1HJB A;  3L37 A;  1IFD A;  4M3L A;  2HOD A;  5CCG C;  4WBA A;  3HUS A;  1NWQ A;  1URQ C;  1CI6 B;  2PAJ A;  1L4A C;  4AQR D;  5APQ A;  1AQ5 A;  1LWU A;  3KDP B;  3SWF A;  1GL2 D;  2YKP A;  1QL1 A;  1JUN A;  1JY3 O;  3EFG A;  2YNY A;  2OYH A;  3B5N B;  1N86 A;  1G2C B;  1NH4 A;  2YMY A;  1EQ7 A;  4Y99 C;  4EOT A;  2W6A A;  1JCD A;  2KYV A;  3NXS A;  3WMM 0;  1RF0 A;  1X79 B;  1J1D C;  5KJ7 D;  2A45 H;  2XV5 A;  3SWY A;  1S9K E;  5AW6 B;  1LTJ C;  2W6B A;  1FJP A;  1NO4 A;  2P2U A;  3UIA A;  1L0L K;  1HVV A;  1IJD B;  1GW4 A;  3NFQ A;  1VPC A;  5KTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...