1GU5A

Crystal structure of c/ebpbeta bzip homodimer bound to a dna fragment from the mim-1 promoter
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
65
structure length
65
Chain Sequence
DKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Flexible Base Recognition by C/Ebpbeta
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords CAAT/ENHANCER BINDING PROTEIN BETA
total genus 29
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gu5A00
1S9KD 1NAFA 2BASA 2WPRA 3A2AA 2ZFCA 4LC1A 2WWWA 5AW7B 2Q3IA 2P2UA 5AW0B 5AVZB 1H89A 4GKGA 3MGNA 5AVUB 1DH3A 1KQLA 2WT7A 3NTNA 2YO3A 3VTPC 4C7NB 4HYTB 3HE5B 2YNYA 2R32A 2R5DA 1CSBA 1MV8A 3A3YB 5AVXB 4B86A 1J2JB 2N9BA 2ZXEB 4M3LA 2H7HA 5AW6B 1A02F 5AVTB 4EOTA 1H8AA 3M9HA 2C9NY 2R5BA 3VMXA 3LIEA 1GU4A 4I2LC 3M06A 3KDPB 3TNUB 3A5TA 3VMZA 3V4WA 4DZOA 1X8YA 1OWAA 2Z5HA 5APSA 5AW1B 2P67A 5APXA 4AYCA 3HE5A 3P8MC 1MUUA 2XV5A 2W27A 4I6MC 5AVWB 3A7OA 2XZRA 4KHXA 4C46A 3HTKA 2JJLA 2E42A 3SWFA 5APTA 2WPSA 2KP8A 2Q7CA 1IO4A 5AVRB 1FOSE 3OAKA 3TYYA 2IPPA 3L35A 1NWQA 1FOSF 5AW2B 5CMZA 5AVVB 4JYBA 1T2KD 2XU6A 3TNUA 3UIAA 2W6AA 3NFQA 5AW4B 3I5CA 1T2KC 1GU5A 4AQRD 1JNMA 5AVSB 2Q5UA 3V4QA 1GD2E 5AW5B 4XE5B 2WTYA 2R3CA 3HE4B 3VN0A 5AW3B 3B8EB 2YO2A 3MD0A 1H88A 1JUNA 1CI6B 2P7JA 5AVQB 1GK6A 1MFZA 1SLQA 3P32A 5AVYB 2Z5IA 2QM7A 3IR9A 1GK4A 3NMDA 1OXZA 2WPQA 1GTWA 1YYCA 1HUCA 3KQGA 2VRSA 3VYIA 3LIDA 3TK1A 1HBWA 3T97A 1HWTC 2E43A 2QM8A 3O8ZA 4JYCA 1GZLA 5APUA 2WT7B 3M0DA 5APWA 4C7NA 3V5BA 3HE4A 3NXSA 1SP4A 3M9BA 3P7KA 5AW9B 1A02J 1FAVA 4RESB 3M0AA 4GT1A 3L36A 5AW8B 1S9KE 2C9LY 4AUWA 1CZQA 1CI6A 5APYA 3L37A 5APVA 5APQA 3M91A 3VMYA 1HJBA 1G2CB
chains in the Genus database with same CATH superfamily
1NAFA 1DD3A 1LTJB 3QWOC 3CCSP 1NTME 1LWUB 2C0WA 3L70J 3KHUA 1U57A 3A2AA 2ZFCA 4OGQC 2HPCA 3ITKA 5KLIC 1Q86Q 5BU8B 2OYIC 1LP1A 2P2UA 4PJ0H 5AW0B 3N4XA 1KQSO 4AUWA 2JP3A 3MGNA 1RH5B 4IOIH 1R5LA 3RK2D 1NKZB 1KQLA 5CCGC 1PZQA 2WT7A 1SQVJ 3ZDMA 1LNQA 1OW6A 2WSCH 2KSJA 1LTIC 3CCEP 4HYTB 4HKZH 3AE8C 1BE3E 1JCCA 1QL2A 4PV1B 1ZN5A 4UB6E 4IL6H 4GOFA 4IFFA 4Y99B 4C7NB 4PJ0E 1QX8A 2WVRA 1FE6A 4DOJA 1CSBA 1ZRTE 1SQBD 3A3YB 3L73J 5AVXB 2N1TD 2ZXEB 1BDCA 4BXLA 1HGVA 3B4SA 1S5LX 1KD1Q 2H89C 2RH0A 3L70D 2OYIB 1PPJE 4U7JA 2KS1A 2IZ1A 2E74C 3P8CD 1EXJA 1JO5A 1N7SD 1KORA 2WSEH 3AEFC 1SQBK 3EFGA 3L72E 1EQ7A 1LT9B 1LWUA 1L4AB 2QSIA 5GTIH 3N7NA 1NKNA 3AE7C 5CCGA 1KB9E 3AE2C 3KDPB 3L70G 3TDKA 3A5TA 1X9VA 5E79E 1L0LK 4Z1MH 4U3FJ 4OGQB 3Q1MA 3D71A 1J1EB 2O01N 4WY4A 1NH4A 1NU1K 3P8MC 4H44B 3BRVB 5KAIE 1SQPE 1E5WA 2M3BA 3CPWO 1G1IA 4YXWH 2YKQA 4I6MC 2ZYGA 1M57D 3HTKA 2E42A 5DJTB 1S4XA 2POHA 2IDBA 3V2QA 1Q7YQ 3L71G 2KP8A 2L91A 3PP5A 1SQPK 1KYOD 3G71P 5KJ7D 2Y0EA 2P58A 3CC2P 3IN6A 1NTMG 3TGUJ 4ASVA 3S1KA 2IPPA 2ZYDA 5KLIB 2A06G 3RGUA 2KLVA 1FBMA 2QJPC 1J1DB 1L4AA 1S2EA 2AXTE 3KPEA 3KYQA 2B87A 1LTSC 5CMZA 1NTZE 2V7QH 2KSEA 4L74A 1SQQK 2WQYC 2YKOA 3TGUD 1JB0J 1NTKE 4WY4C 3HD7D 2E74D 2FXPA 1DD4A 4PV1D 5AW4B 3HE5B 2Y9ZA 4DT0A 3CC7P 3CLQA 1JNMA 1IFPA 1RE4A 4PV1C 3GF3A 3V4QA 1T3JA 1VQ8P 1U7MA 4K35A 2PAJA 4I1LA 2R3CA 2W8ZA 3BCCG 1Q90D 1BGYD 1FJPA 1WMKA 4NPEA 2KNCB 4GIFA 3EFFK 2RKLA 3HTKB 1SQQD 5AW3B 2YO2A 3H32B 1P84E 1ZP0C 2FXOA 3KZIH 1KFMA 2FYZA 3TF5A 1FZAA 1PP9G 1SQVE 2A45G 2O3JA 2P7JA 1MFZA 3CWBG 5AVQB 1SFCB 1SQPD 2QM7A 2Z5IA 3NMDA 1AV1A 2KYVA 3Q2YA 3Q3DA 2WITA 4OGQD 3L73G 1GTWA 1HUCA 1ZOYC 2JWAA 3CXHI 1SQVK 2KXPB 3KQGA 2Y9YA 4D6TJ 1URQA 2YKPA 3I56P 3SWKA 2IYPA 1RE4C 3O6QA 3H1KG 3T97A 1HBWA 2QJPB 4JF7A 5H2FE 3H1HJ 2QM8A 5H2FH 4RO0A 5B5EE 2PFXA 4ZKPA 3H1IE 3H1LD 2ZT9C 4C7NA 2HR3A 2YMYA 2HFED 3JC22 2YIUC 1AQTA 3V2RA 1KN7A 1R8EA 1G1JA 3HD7A 1L0LG 4TT3H 2IBZG 2P1JA 3PLNA 1OW8A 2IFMA 1L2PA 1OVUA 4RJTA 3AEGC 1PGPA 3BASA 3C1LA 3RK3B 1KYOH 2MKVA 1EDIA 3BCCJ 1N7LA 3FGAD 3L71E 3L36A 4GT1A 4RESB 5CJ0A 5AW8B 2IZ0A 5BU5A 1IFDA 1S9KE 1CI6A 3GF7A 3L37A 4PD4I 2KZJA 1A02J 1U7JA 4R4LA 3OW2O 1S9KD 5KLVD 2ZVOB 3L75G 2QA4P 1RF0A 2DW3A 1AQ5A 1FZBA 1YITP 1VF5D 1L0NG 4LC1A 1S3JA 3MZWB 1XTGB 3O6QB 1ZR2A 2FYNB 2YXRB 3A0HE 2QJKC 3GLMA 4W7ZA 5AVZB 1H89A 2OTLP 2MJZA 4CPGA 4Y28J 1FZCC 1N86A 1NTMJ 5KLVG 1YJNP 1USDA 2YO3A 2O1JA 2BEQD 3L72D 1NTZD 3IAOA 3BCCD 3VTPC 1RQUA 1FS0E 1HTLC 2E75B 2KK7A 1JM0A 2LXCB 2YNYA 3E1IA 3H1JD 4LLHA 5CCHD 1M1KQ 1HH0A 2WSFJ 3AEDC 1QL1A 2K1AA 1RQVA 2W6JH 3G6EP 1XTCC 4GOEA 4B86A 1NOHA 1VDFA 1J2JB 2N9BA 1JY3P 3B5ND 1KQGB 1JTHB 1FDOA 3S4RA 3H1JG 3PRJA 2JKVA 3RL0B 1NTZK 2ZAEB 1KILC 1OMIA 2FYUK 1SQQE 4U3FG 3WUVA 4EOTA 3CX5H 3M9HA 1KC8Q 1NTKK 3H1HE 4D6TD 5KAFE 5CHXA 1VQKP 1GU4A 3MTUE 4I2LC 3AE4C 4EIJA 1QVGO 3G4SP 2K9JA 3FWNA 3VMZA 2BCCJ 2PP6A 1PGJA 1L0ND 2V4HA 1X8YA 4H13C 1SQPJ 3L75J 1BCCG 3F5HA 4HB1A 1X0TA 4GODA 1HJ0A 2OYHB 2P67A 1EXIA 2Y0CA 3RK3D 3G3ZA 1M90Q 3CWBD 1M56D 3HE5A 1FZFA 1MUUA 2XV5A 4U3FE 3AE3C 1BGYJ 2RMZA 3HUSA 3B5NC 2QIWA 1KZUB 1M1JA 4H0LB 4C46A 3H1KE 2J5UA 1ZRTD 3C9IA 1EZVE 3RK2B 1N73C 2NPSB 5EFWB 3U1AA 3IF4A 3SWFA 5B5EH 3M0DC 5KTBA 1NU1E 2Q7CA 1PPJD 2ZJSE 3H1KD 2Q3EA 5AVRB 3VMAA 5TISH 3BVHA 1RE3A 2QE7H 1Q2NA 4ASWA 1FOSE 2OYHC 2M5AA 2Q1KA 3OA7A 3AE5C 3L35A 1BE3G 1NWQA 1RF1B 1EDJA 4YXDC 1K8AQ 1ZLLA 3A0BE 4O9BA 3RL0C 3I55P 1BDDA 4JYBA 1VL2A 2XU6A 2K9JB 2QVAA 2OGUA 4L75A 2W6AA 3UIAA 1VQ5P 1DEBA 2KIKA 2OTKE 4I7ZC 4KJMA 1N7SB 3L71D 1T2KC 3GW6A 3MIWA 4PD4H 4OH8B 1M8OB 4ZMDA 2FFDA 2H8PD 3B5NA 1NHLA 3IFMA 1GD2E 2QJYC 4XE5B 5M1BA 1PP9J 3PJSK 4NPDA 5CBNA 2WTYA 1S72P 3VN0A 1LGHB 2BCCG 3HE4B 1W2BO 1NYHA 1Y8AA 2WPVB 1Y9BA 2IFNA 1BSNA 1M1JB 4UB6H 4JBZA 1IK7A 1OW7A 2NZ2A 1DX7A 3MD0A 3L70E 3VOPA 2GA1A 2XNXA 2E76B 3KZIE 5AVYB 1SLQA 3G9RA 4U3FD 1JMMA 3IR9A 5C39A 1ZR4A 1N73B 2QEXP 1VQ7P 1LJ2A 1PPJG 1KILD 1SQXK 4EI2A 3L74E 1YHQP 1OXZA 1YBKA 3L72G 1JMBA 1YYCA 3CX5E 3F89A 3H1KJ 3LW5J 4JPZB 5GTIE 3CMAP 1PGQA 2VRSA 3H1LE 2G8YA 1GL2A 3H1ID 2J59M 1DIPA 3AEBC 4N78E 1JY3O 1N7SA 4JYCA 5KJ7C 1LTJC 1AFOA 5APUA 2GUVA 2LR2A 3EWKA 3JCUH 1QVFO 3M0DA 2HODB 1T8ZA 1MKMA 1SQBJ 4N78D 4YTPC 5KLVE 3FXDA 1K9MQ 1N2DC 1RE3C 1S5LH 1J1EC 3NXSA 2N9YB 1H0TB 5KAIH 1EZVG 1K05A 3M9BA 4JQ0D 3P7KA 3CCUP 3CI9A 1PFIA 5E79H 2FKWB 3RBZA 1QLED 5KLVK 1KYOE 2C9LY 2FYUE 1SQVD 2B89A 1LTTC 2OYIA 3M91A 4L73A 1G2CB 3V6IA 2QJKB 2QRXA 1BE3D 1Q81Q 2GUSA 4K3AA 3H1JE 1EZVD 1GL2C 2N1TA 4GDOA 1SQQG 1PV3A 2FFDB 1GW4A 1NTKD 1OVVA 1Y47A 2FY8A 2WWWA 3HD7C 5AW7B 4EYYQ 1ZW0A 1SFCD 1YIJP 3H1IG 1JY3N 3KXDA 1DH3A 4H44C 1NTMK 2O1KA 3TGUG 4EDFA 2BEZF 1VQ9P 3CC4P 3U59A 3CX5D 1GL2D 4WY4B 1K04A 1OX3A 2IBZE 2ZT9D 4N3YB 4IL6E 1KYOI 2ITAA 2R32A 1H0TA 3BATA 4N6JA 3M9QA 1RY3A 4DCKA 1VPCA 1P84D 1NAYA 4ZKUA 5L8RJ 1ZV8A 2FXMA 1P84H 2WMMA 3AEAC 1G2CA 5AVTB 1W2EA 1YTZI 1YTZT 3CWBE 1LTJA 4XA4A 4PD4D 1BCCJ 3USSA 1SQPG 1JOCA 2ZVNB 2C9NY 2GM4A 2R5BA 2HPCB 3FXEA 4Y99C 1LP1B 2O01J 3V4WA 4WB4A 3LW5H 4WWIA 4DZOA 2A45H 5CCHA 2H43A 1OWAA 2Z5HA 2HLOA 1VQMP 3WUTA 1RF0C 4BWNA 5TISE 4ZNCA 1FJKA 4AYCA 1JEKA 1JY2O 5KJ7A 3Q5SA 2O01H 1CW5A 2W27A 5AW9B 2R3SA 2WSSH 3H1LJ 1N8RQ 3K5BA 3GG2A 2WZ7A 5AVWB 2KB7P 2A06D 2YMKA 4H13B 4KHXA 3VP9A 1SFCC 2JJLA 2FFDC 3EQ2A 2WPSA 3L4FA 1YQ4C 1S1CX 2WSEJ 4W7YA 1YI2P 1SQBG 1AVOA 1LTGC 2JO1A 2D2CB 4I7ZB 4BRYA 5KKZB 2Z4EA 4IFDK 1LTAC 3OAKA 2IX7C 3TYYA 1LT9A 2AXTH 1TU3F 4L76A 4UB8H 1DEEG 3RK2C 2E5TA 2NPSC 4LGDE 4YPCA 1VQOP 2H88C 1URQB 2I1JA 2B9BA 2K3RA 1T2KD 3SSUA 1L0NE 1GMJA 2ZT9B 2JWDA 1PP9E 3I5CA 3NFQA 2CK3H 1USEA 2L5GB 3A0HH 3OJAB 3RL0D 3S9OA 4AQRD 5AVSB 1RF1C 3D6YA 1VQ6P 1PP9D 2XNDH 1FDMA 1FU1A 1JY2P 3AECC 1IJDB 3R4YA 1IK9A 1L0LJ 1YJWP 1URQC 1MFTA 1CI6B 2QJYB 2W6BA 4H44D 5TJHA 3CXHD 3VP8A 4BRYB 1GK4A 4H0LD 2LKMA 1M1JC 3WU2E 2OARA 2G3AA 2B87B 1PL5A 3VYIA 1UIIA 3AEEC 2K88A 3LIDA 3PTZA 3TK1A 1HWTC 2E43A 3CCJP 1FDIA 1KB9D 1MZ9A 1SQXG 2C0XA 1GZLA 1NU1G 1X79B 2E75C 2W83C 3QH9A 3RK3E 3SFDC 3CCRP 1PIXA 1BCCE 2PGDA 5APWA 2I1KA 2Q6QA 2FYUJ 3CWBJ 3JCUE 3V5BA 2BCCE 2ZXXA 1E79H 3CCVP 3MHVA 4R4MA 2AXCA 5CCGD 3H25A 2A45I 2FYNC 5DJUB 3L75D 2M3EA 2D2CD 1OZHA 1L0NJ 1QGKB 2KNCA 3AE9C 3GMAA 4NPFX 4QMAA 1FAVA 1NU1D 1BGYG 1L4AD 2WSFH 2Y0DA 3H32A 3M0AA 1SQBE 2AEFA 2KZIA 3GHGA 2P10A 1OFCX 3RL0g 5APYA 5APVA 1FC2C 3VMYA 1JTHA 5B66H 1SFCA 1VQ4P 1IFNA 3HRNA 4C7RA 2BASA 1WT6A 2A06E 2IBZD 2OTJP 1W5CE 2WPRA 1NO4A 1NTKJ 3PH0A 2PRRA 1NTZG 1L0LE 2XKMA 1IFMA 2SPZA 1FZCB 1KFNA 1EDKA 2E76D 3A0BH 3L73D 2Q3IA 3CX5I 4IL6X 3T97B 5K5GB 1LTBC 1BE3J 2CPSA 4GKGA 3CCMP 3ABVC 5AVUB 2IBZI 2XDJA 1ZXGA 2CPBA 1T6AA 2J58A 1SVFA 2KOGA 3H1JJ 3NTNA 1EDLA 4PD4E 1NU1J 1IFJA 1KTMA 4UB8E 4IFMA 3HD7B 2E74B 2JDIH 4OWFA 1NTMD 2OQQA 2R5DA 1HGZA 1KILA 3FX0A 2LXBA 3HUSB 1BSHA 1QEXA 3WUUA 1FZCA 1MV8A 2FYUD 3CXHH 3GHGB 1FZGA 1FZEA 4M3LA 3Q5PA 5AW6B 2H7HA 1AJYA 1A02F 1T3UA 1D7MA 5KLVJ 2E76C 2FBWC 2JEEA 2M5AB 3C8VA 3H1IJ 2E5YA 3BCCE 3L71J 1VQPP 1H8AA 3BRTB 2NRGA 1IC2A 3LIEA 3VMXA 2R44A 1YQ3C 1SS1A 1HVVA 1NGMB 2IYOA 3E7KA 3HUSC 3M06A 1OVRA 2ZYAA 3H1LG 3TNUB 1VQLP 3MP7B 3MUDC 3L74J 4HH2A 5APSA 5AW1B 5APXA 1UIXA 1L0LD 2JR8A 3GHGC 1L4AC 2M0BA 2W90A 3L73E 3R2PA 2D2CC 2HG5D 3CL3D 5KKZC 4DJGA 1KILB 4RKUJ 3SFEC 3A7OA 3H1HD 2XZRA 2YXQB 4XFJA 4D6TE 1VQNP 1J1DC 1RHZB 2KI7B 4TLFA 5B66E 1SQXE 5BVZA 1IZNB 5APTA 3CMEP 1KV4A 1IO4A 4A7PA 2FYUG 2QG4A 5CJ4A 1N73A 3CD6P 1SQVG 1SQXD 1L0NK 2B88A 3B71A 1OIPA 1GDTA 1PGOA 1FOSF 5AW2B 1JY2N 1HF9A 5AVVB 1GL2B 1GW3A 2V7QJ 3FWLA 4WY4D 3TNUA 4D6TG 1SQQJ 1EC5A 1LT1A 3V2NA 2K37A 2KUBA 2UWJE 3Q5RA 1IFIA 1KMIZ 1GU5A 2OYOA 3AE1C 2Q9IA 2OYHA 2Q5UA 1VF5B 1Z56A 2HODA 3E1RA 4WBAA 3TGUE 3L74G 5AW5B 4WVZA 3JSVC 5CBOA 1K73Q 3RBXA 3P8CE 4MN4C 3WU2H 5CCHC 1NVOA 3CXHE 3AE6C 3B8EB 2NPSA 3U1CA 3CCQP 1KQFB 1H88A 1JUNA 1BGYE 1GK6A 3W67A 3P32A 1LWUC 2HYNA 3W68A 2BCCD 3MUDA 3D6ZA 1SQXJ 5GTHE 2I8DA 5KAFH 2N1TB 1VF5C 1RF1A 1P84I 2WPQA 1X22A 3L75E 2NPSD 1KB9I 1EZVI 2YIUB 4HJGH 2E75D 1YJ9P 1NJIQ 1KB9H 1R5SA 1LT9C 1BCCD 1JCDA 2K9YA 2AEJA 3II6A 2KLUA 3RK3C 3O8ZA 3PHLA 3TSIA 3CCLP 3D70A 2WT7B 4H13D 3B5NB 1WRGA 4H0LC 5GTHH 1N7SC 1AVYA 3H1HG 1KILE 1M7LA 3HE4A 4W80A 1S5LE 3L74D 1SP4A 3H6PA 2N1TC 3SWYA 1NTZJ 3L72J 1ZMEC 1NTKG 2RN0A 4OVNF 1CZQA 4KT0J 3V2PA 3WMM0 2M8RA 5APQA 1AA0A 1Q82Q 1HJBA 2KS1B 1URQD 2AEMA 2WSCJ
chains in the Genus database with same CATH topology
1NAFA 1LTJB 1LWUB 2C0WA 3A2AA 2HPCA 2ZFCA 2OYIC 2P2UA 5AW0B 3N4XA 3MGNA 3RK2D 1NKZB 1KQLA 5CCGC 2WT7A 2WSCH 2KSJA 1LTIC 4HYTB 1JCCA 1QL2A 1ZN5A 4Y99B 4IFFA 4DOJA 1CSBA 3A3YB 5AVXB 2N1TD 2ZXEB 1HGVA 2OYIB 3P8CD 1JO5A 1N7SD 2WSEH 3EFGA 1SQBK 1EQ7A 1LT9B 1LWUA 1L4AB 3N7NA 1NKNA 5CCGA 3KDPB 3A5TA 1X9VA 1L0LK 1J1EB 4WY4A 1NH4A 1NU1K 3P8MC 3BRVB 1E5WA 2M3BA 1G1IA 2YKQA 4I6MC 3HTKA 2E42A 2POHA 3V2QA 2KP8A 3PP5A 1SQPK 5KJ7D 2IPPA 2KLVA 1FBMA 3KPEA 1J1DB 1L4AA 3KYQA 5CMZA 1LTSC 1SQQK 2YKOA 4WY4C 3HD7D 5AW4B 3CLQA 1JNMA 1RE4A 3V4QA 1T3JA 2PAJA 4I1LA 2R3CA 1FJPA 4GIFA 5AW3B 3HTKB 2YO2A 3H32B 1KFMA 2FYZA 1H88A 1FZAA 2A45G 2P7JA 5AVQB 1MFZA 1SFCB 2Z5IA 2QM7A 3NMDA 2KYVA 2WITA 1GTWA 1HUCA 1SQVK 3KQGA 1URQA 2YKPA 1RE4C 1HBWA 3T97A 4JF7A 2QM8A 4ZKPA 4C7NA 2YMYA 2HFED 3V2RA 1G1JA 3HD7A 2P1JA 2IFMA 3BASA 3RK3B 1A02J 4RESB 1N7LA 4GT1A 5CJ0A 3L36A 5AW8B 5BU5A 1S9KE 1IFDA 1CI6A 3L37A 1S9KD 1RF0A 1AQ5A 1FZBA 4LC1A 1XTGB 1ZR2A 4W7ZA 5AVZB 1H89A 2MJZA 1FZCC 1N86A 2YO3A 2O1JA 3VTPC 4C7NB 3E1IA 3HE5B 1HTLC 2YNYA 5CCHD 4LLHA 1HH0A 1QL1A 1XTCC 4B86A 1NOHA 1VDFA 1J2JB 2N9BA 1JY3P 3B5ND 1JTHB 3RL0B 1NTZK 1KILC 2FYUK 4EOTA 3M9HA 1NTKK 5CHXA 1GU4A 3MTUE 4I2LC 4EIJA 3VMZA 2PP6A 1X8YA 2OYHB 2P67A 3RK3D 3G3ZA 3HE5A 1FZFA 1MUUA 2XV5A 3HUSA 3B5NC 5BU8B 1KZUB 1M1JA 4C46A 1N73C 3C9IA 3RK2B 2NPSB 3U1AA 3SWFA 5KTBA 3M0DC 2Q7CA 3BVHA 5AVRB 1FOSE 1RE3A 2OYHC 3OA7A 3L35A 1RF1B 1NWQA 1ZLLA 3RL0C 4JYBA 2XU6A 3UIAA 2W6AA 1T2KC 1DEBA 1N7SB 3MIWA 4OH8B 2H8PD 3B5NA 1NHLA 3IFMA 1GD2E 4XE5B 2WTYA 3VN0A 1LGHB 3HE4B 2IFNA 1M1JB 1DX7A 3MD0A 3VOPA 2XNXA 5AVYB 1SLQA 1ZR4A 1N73B 1JMMA 3IR9A 1KILD 1SQXK 1OXZA 1YYCA 2FFDA 2VRSA 1GL2A 2J59M 4N78E 1JY3O 1N7SA 4JYCA 5KJ7C 1LTJC 1AFOA 5APUA 2GUVA 3M0DA 2HODB 1T8ZA 4N78D 1N2DC 1RE3C 1J1EC 3NXSA 3M9BA 3P7KA 1PFIA 3CI9A 2FKWB 5KLVK 2C9LY 1LTTC 2OYIA 3M91A 1G2CB 2GUSA 1GL2C 2N1TA 2FFDB 1GW4A 2WWWA 3HD7C 5AW7B 1SFCD 1JY3N 1DH3A 1NTMK 2O1KA 3U59A 1GL2D 4WY4B 4N3YB 2R32A 3BATA 4N6JA 3M9QA 1RY3A 1VPCA 4ZKUA 1ZV8A 2FXMA 1G2CA 5AVTB 1W2EA 1YTZI 1YTZT 1LTJA 4XA4A 1JOCA 2C9NY 2GM4A 2R5BA 2HPCB 4Y99C 3V4WA 4DZOA 4WB4A 3LW5H 5CCHA 2H43A 2A45H 1OWAA 2Z5HA 2HLOA 1RF0C 1FJKA 4AYCA 1JY2O 5KJ7A 2O01H 1CW5A 2W27A 2WZ7A 5AVWB 2KB7P 4KHXA 3VP9A 1SFCC 2JJLA 3EQ2A 2WPSA 3L4FA 4W7YA 1LTGC 4IFDK 2Z4EA 1LTAC 3OAKA 2IX7C 3TYYA 1LT9A 3RK2C 2NPSC 4LGDE 2I1JA 1URQB 1T2KD 3NFQA 3I5CA 2L5GB 3RL0D 3OJAB 4AQRD 5AVSB 1RF1C 1FDMA 1FU1A 1JY2P 1IJDB 1IK9A 1URQC 1CI6B 2W6BA 3VP8A 1GK4A 2LKMA 1M1JC 2OARA 3VYIA 3LIDA 3TK1A 1HWTC 2E43A 1MZ9A 4O9BA 2C0XA 1GZLA 1X79B 5APWA 2I1KA 3V5BA 5CCGD 2A45I 5AW9B 1FZCB 1FAVA 2WSFH 1L4AD 3M0AA 3H32A 2FFDC 3GHGA 5APYA 5APVA 3VMYA 1JTHA 1SFCA 1IFNA 3HRNA 4C7RA 2BASA 1WT6A 2WPRA 1NO4A 2XKMA 1IFMA 1KFNA 2Q3IA 1LTBC 2CPSA 4GKGA 5AVUB 2XDJA 2CPBA 2J58A 1SVFA 2KOGA 3NTNA 1IFJA 4IFMA 3HD7B 2R5DA 3HUSB 1HGZA 1KILA 1FZCA 1MV8A 3GHGB 1FZGA 1FZEA 4M3LA 2H7HA 5AW6B 1A02F 1T3UA 2JEEA 1H8AA 3BRTB 3VMXA 1IC2A 3LIEA 1HVVA 3M06A 3HUSC 3TNUB 4HH2A 5APSA 5AW1B 5APXA 3GHGC 1L4AC 3R2PA 2HG5D 3CL3D 1KILB 3A7OA 2XZRA 1J1DC 5BVZA 5APTA 1IO4A 5CJ4A 1N73A 1L0NK 1GDTA 1FOSF 5AW2B 1JY2N 5AVVB 1GL2B 1GW3A 4WY4D 3TNUA 3V2NA 1IFIA 1GU5A 2OYHA 2Q9IA 2Q5UA 1Z56A 2HODA 4WBAA 5AW5B 3P8CE 5CCHC 3B8EB 2NPSA 3U1CA 1JUNA 1GK6A 3P32A 1LWUC 2HYNA 3MUDA 1RF1A 2N1TB 2WPQA 2NPSD 1LT9C 1JCDA 3II6A 3RK3C 3O8ZA 3TSIA 2WT7B 3B5NB 1WRGA 1N7SC 1M7LA 3HE4A 4W80A 1SP4A 3H6PA 2N1TC 3SWYA 4AUWA 3V2PA 1CZQA 3WMM0 1HJBA 2M8RA 5APQA 1URQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S9K D;  1NAF A;  2BAS A;  2WPR A;  3A2A A;  2ZFC A;  4LC1 A;  2WWW A;  5AW7 B;  2Q3I A;  2P2U A;  5AW0 B;  5AVZ B;  1H89 A;  4GKG A;  3MGN A;  5AVU B;  1DH3 A;  1KQL A;  2WT7 A;  3NTN A;  2YO3 A;  3VTP C;  4C7N B;  4HYT B;  3HE5 B;  2YNY A;  2R32 A;  2R5D A;  1CSB A;  1MV8 A;  3A3Y B;  5AVX B;  4B86 A;  1J2J B;  2N9B A;  2ZXE B;  4M3L A;  2H7H A;  5AW6 B;  1A02 F;  5AVT B;  4EOT A;  1H8A A;  3M9H A;  2C9N Y;  2R5B A;  3VMX A;  3LIE A;  1GU4 A;  4I2L C;  3M06 A;  3KDP B;  3TNU B;  3A5T A;  3VMZ A;  3V4W A;  4DZO A;  1X8Y A;  1OWA A;  2Z5H A;  5APS A;  5AW1 B;  2P67 A;  5APX A;  4AYC A;  3HE5 A;  3P8M C;  1MUU A;  2XV5 A;  2W27 A;  4I6M C;  5AVW B;  3A7O A;  2XZR A;  4KHX A;  4C46 A;  3HTK A;  2JJL A;  2E42 A;  3SWF A;  5APT A;  2WPS A;  2KP8 A;  2Q7C A;  1IO4 A;  5AVR B;  1FOS E;  3OAK A;  3TYY A;  2IPP A;  3L35 A;  1NWQ A;  1FOS F;  5AW2 B;  5CMZ A;  5AVV B;  4JYB A;  1T2K D;  2XU6 A;  3TNU A;  3UIA A;  2W6A A;  3NFQ A;  5AW4 B;  3I5C A;  1T2K C;  1GU5 A;  4AQR D;  1JNM A;  5AVS B;  2Q5U A;  3V4Q A;  1GD2 E;  5AW5 B;  4XE5 B;  2WTY A;  2R3C A;  3HE4 B;  3VN0 A;  5AW3 B;  3B8E B;  2YO2 A;  3MD0 A;  1H88 A;  1JUN A;  1CI6 B;  2P7J A;  5AVQ B;  1GK6 A;  1MFZ A;  1SLQ A;  3P32 A;  5AVY B;  2Z5I A;  2QM7 A;  3IR9 A;  1GK4 A;  3NMD A;  1OXZ A;  2WPQ A;  1GTW A;  1YYC A;  1HUC A;  3KQG A;  2VRS A;  3VYI A;  3LID A;  3TK1 A;  1HBW A;  3T97 A;  1HWT C;  2E43 A;  2QM8 A;  3O8Z A;  4JYC A;  1GZL A;  5APU A;  2WT7 B;  3M0D A;  5APW A;  4C7N A;  3V5B A;  3HE4 A;  3NXS A;  1SP4 A;  3M9B A;  3P7K A;  5AW9 B;  1A02 J;  1FAV A;  4RES B;  3M0A A;  4GT1 A;  3L36 A;  5AW8 B;  1S9K E;  2C9L Y;  4AUW A;  1CZQ A;  1CI6 A;  5APY A;  3L37 A;  5APV A;  5APQ A;  3M91 A;  3VMY A;  1HJB A;  1G2C B; 
#chains in the Genus database with same CATH topology
 1NAF A;  1DD3 A;  1LTJ B;  3QWO C;  3CCS P;  1NTM E;  1LWU B;  2C0W A;  3L70 J;  3KHU A;  1U57 A;  3A2A A;  2ZFC A;  4OGQ C;  2HPC A;  3ITK A;  5KLI C;  1Q86 Q;  5BU8 B;  2OYI C;  1LP1 A;  2P2U A;  4PJ0 H;  5AW0 B;  3N4X A;  1KQS O;  4AUW A;  2JP3 A;  3MGN A;  1RH5 B;  4IOI H;  1R5L A;  3RK2 D;  1NKZ B;  1KQL A;  5CCG C;  1PZQ A;  2WT7 A;  1SQV J;  3ZDM A;  1LNQ A;  1OW6 A;  2WSC H;  2KSJ A;  1LTI C;  3CCE P;  4HYT B;  4HKZ H;  3AE8 C;  1BE3 E;  1JCC A;  1QL2 A;  4PV1 B;  1ZN5 A;  4UB6 E;  4IL6 H;  4GOF A;  4IFF A;  4Y99 B;  4C7N B;  4PJ0 E;  1QX8 A;  2WVR A;  1FE6 A;  4DOJ A;  1CSB A;  1ZRT E;  1SQB D;  3A3Y B;  3L73 J;  5AVX B;  2N1T D;  2ZXE B;  1BDC A;  4BXL A;  1HGV A;  3B4S A;  1S5L X;  1KD1 Q;  2H89 C;  2RH0 A;  3L70 D;  2OYI B;  1PPJ E;  4U7J A;  2KS1 A;  2IZ1 A;  2E74 C;  3P8C D;  1EXJ A;  1JO5 A;  1N7S D;  1KOR A;  2WSE H;  3AEF C;  1SQB K;  3EFG A;  3L72 E;  1EQ7 A;  1LT9 B;  1LWU A;  1L4A B;  2QSI A;  5GTI H;  3N7N A;  1NKN A;  3AE7 C;  5CCG A;  1KB9 E;  3AE2 C;  3KDP B;  3L70 G;  3TDK A;  3A5T A;  1X9V A;  5E79 E;  1L0L K;  4Z1M H;  4U3F J;  4OGQ B;  3Q1M A;  3D71 A;  1J1E B;  2O01 N;  4WY4 A;  1NH4 A;  1NU1 K;  3P8M C;  4H44 B;  3BRV B;  5KAI E;  1SQP E;  1E5W A;  2M3B A;  3CPW O;  1G1I A;  4YXW H;  2YKQ A;  4I6M C;  2ZYG A;  1M57 D;  3HTK A;  2E42 A;  5DJT B;  1S4X A;  2POH A;  2IDB A;  3V2Q A;  1Q7Y Q;  3L71 G;  2KP8 A;  2L91 A;  3PP5 A;  1SQP K;  1KYO D;  3G71 P;  5KJ7 D;  2Y0E A;  2P58 A;  3CC2 P;  3IN6 A;  1NTM G;  3TGU J;  4ASV A;  3S1K A;  2IPP A;  2ZYD A;  5KLI B;  2A06 G;  3RGU A;  2KLV A;  1FBM A;  2QJP C;  1J1D B;  1L4A A;  1S2E A;  2AXT E;  3KPE A;  3KYQ A;  2B87 A;  1LTS C;  5CMZ A;  1NTZ E;  2V7Q H;  2KSE A;  4L74 A;  1SQQ K;  2WQY C;  2YKO A;  3TGU D;  1JB0 J;  1NTK E;  4WY4 C;  3HD7 D;  2E74 D;  2FXP A;  1DD4 A;  4PV1 D;  5AW4 B;  3HE5 B;  2Y9Z A;  4DT0 A;  3CC7 P;  3CLQ A;  1JNM A;  1IFP A;  1RE4 A;  4PV1 C;  3GF3 A;  3V4Q A;  1T3J A;  1VQ8 P;  1U7M A;  4K35 A;  2PAJ A;  4I1L A;  2R3C A;  2W8Z A;  3BCC G;  1Q90 D;  1BGY D;  1FJP A;  1WMK A;  4NPE A;  2KNC B;  4GIF A;  3EFF K;  2RKL A;  3HTK B;  1SQQ D;  5AW3 B;  2YO2 A;  3H32 B;  1P84 E;  1ZP0 C;  2FXO A;  3KZI H;  1KFM A;  2FYZ A;  3TF5 A;  1FZA A;  1PP9 G;  1SQV E;  2A45 G;  2O3J A;  2P7J A;  1MFZ A;  3CWB G;  5AVQ B;  1SFC B;  1SQP D;  2QM7 A;  2Z5I A;  3NMD A;  1AV1 A;  2KYV A;  3Q2Y A;  3Q3D A;  2WIT A;  4OGQ D;  3L73 G;  1GTW A;  1HUC A;  1ZOY C;  2JWA A;  3CXH I;  1SQV K;  2KXP B;  3KQG A;  2Y9Y A;  4D6T J;  1URQ A;  2YKP A;  3I56 P;  3SWK A;  2IYP A;  1RE4 C;  3O6Q A;  3H1K G;  3T97 A;  1HBW A;  2QJP B;  4JF7 A;  5H2F E;  3H1H J;  2QM8 A;  5H2F H;  4RO0 A;  5B5E E;  2PFX A;  4ZKP A;  3H1I E;  3H1L D;  2ZT9 C;  4C7N A;  2HR3 A;  2YMY A;  2HFE D;  3JC2 2;  2YIU C;  1AQT A;  3V2R A;  1KN7 A;  1R8E A;  1G1J A;  3HD7 A;  1L0L G;  4TT3 H;  2IBZ G;  2P1J A;  3PLN A;  1OW8 A;  2IFM A;  1L2P A;  1OVU A;  4RJT A;  3AEG C;  1PGP A;  3BAS A;  3C1L A;  3RK3 B;  1KYO H;  2MKV A;  1EDI A;  3BCC J;  1N7L A;  3FGA D;  3L71 E;  3L36 A;  4GT1 A;  4RES B;  5CJ0 A;  5AW8 B;  2IZ0 A;  5BU5 A;  1IFD A;  1S9K E;  1CI6 A;  3GF7 A;  3L37 A;  4PD4 I;  2KZJ A;  1A02 J;  1U7J A;  4R4L A;  3OW2 O;  1S9K D;  5KLV D;  2ZVO B;  3L75 G;  2QA4 P;  1RF0 A;  2DW3 A;  1AQ5 A;  1FZB A;  1YIT P;  1VF5 D;  1L0N G;  4LC1 A;  1S3J A;  3MZW B;  1XTG B;  3O6Q B;  1ZR2 A;  2FYN B;  2YXR B;  3A0H E;  2QJK C;  3GLM A;  4W7Z A;  5AVZ B;  1H89 A;  2OTL P;  2MJZ A;  4CPG A;  4Y28 J;  1FZC C;  1N86 A;  1NTM J;  5KLV G;  1YJN P;  1USD A;  2YO3 A;  2O1J A;  2BEQ D;  3L72 D;  1NTZ D;  3IAO A;  3BCC D;  3VTP C;  1RQU A;  1FS0 E;  1HTL C;  2E75 B;  2KK7 A;  1JM0 A;  2LXC B;  2YNY A;  3E1I A;  3H1J D;  4LLH A;  5CCH D;  1M1K Q;  1HH0 A;  2WSF J;  3AED C;  1QL1 A;  2K1A A;  1RQV A;  2W6J H;  3G6E P;  1XTC C;  4GOE A;  4B86 A;  1NOH A;  1VDF A;  1J2J B;  2N9B A;  1JY3 P;  3B5N D;  1KQG B;  1JTH B;  1FDO A;  3S4R A;  3H1J G;  3PRJ A;  2JKV A;  3RL0 B;  1NTZ K;  2ZAE B;  1KIL C;  1OMI A;  2FYU K;  1SQQ E;  4U3F G;  3WUV A;  4EOT A;  3CX5 H;  3M9H A;  1KC8 Q;  1NTK K;  3H1H E;  4D6T D;  5KAF E;  5CHX A;  1VQK P;  1GU4 A;  3MTU E;  4I2L C;  3AE4 C;  4EIJ A;  1QVG O;  3G4S P;  2K9J A;  3FWN A;  3VMZ A;  2BCC J;  2PP6 A;  1PGJ A;  1L0N D;  2V4H A;  1X8Y A;  4H13 C;  1SQP J;  3L75 J;  1BCC G;  3F5H A;  4HB1 A;  1X0T A;  4GOD A;  1HJ0 A;  2OYH B;  2P67 A;  1EXI A;  2Y0C A;  3RK3 D;  3G3Z A;  1M90 Q;  3CWB D;  1M56 D;  3HE5 A;  1FZF A;  1MUU A;  2XV5 A;  4U3F E;  3AE3 C;  1BGY J;  2RMZ A;  3HUS A;  3B5N C;  2QIW A;  1KZU B;  1M1J A;  4H0L B;  4C46 A;  3H1K E;  2J5U A;  1ZRT D;  3C9I A;  1EZV E;  3RK2 B;  1N73 C;  2NPS B;  5EFW B;  3U1A A;  3IF4 A;  3SWF A;  5B5E H;  3M0D C;  5KTB A;  1NU1 E;  2Q7C A;  1PPJ D;  2ZJS E;  3H1K D;  2Q3E A;  5AVR B;  3VMA A;  5TIS H;  3BVH A;  1RE3 A;  2QE7 H;  1Q2N A;  4ASW A;  1FOS E;  2OYH C;  2M5A A;  2Q1K A;  3OA7 A;  3AE5 C;  3L35 A;  1BE3 G;  1NWQ A;  1RF1 B;  1EDJ A;  4YXD C;  1K8A Q;  1ZLL A;  3A0B E;  4O9B A;  3RL0 C;  3I55 P;  1BDD A;  4JYB A;  1VL2 A;  2XU6 A;  2K9J B;  2QVA A;  2OGU A;  4L75 A;  2W6A A;  3UIA A;  1VQ5 P;  1DEB A;  2KIK A;  2OTK E;  4I7Z C;  4KJM A;  1N7S B;  3L71 D;  1T2K C;  3GW6 A;  3MIW A;  4PD4 H;  4OH8 B;  1M8O B;  4ZMD A;  2FFD A;  2H8P D;  3B5N A;  1NHL A;  3IFM A;  1GD2 E;  2QJY C;  4XE5 B;  5M1B A;  1PP9 J;  3PJS K;  4NPD A;  5CBN A;  2WTY A;  1S72 P;  3VN0 A;  1LGH B;  2BCC G;  3HE4 B;  1W2B O;  1NYH A;  1Y8A A;  2WPV B;  1Y9B A;  2IFN A;  1BSN A;  1M1J B;  4UB6 H;  4JBZ A;  1IK7 A;  1OW7 A;  2NZ2 A;  1DX7 A;  3MD0 A;  3L70 E;  3VOP A;  2GA1 A;  2XNX A;  2E76 B;  3KZI E;  5AVY B;  1SLQ A;  3G9R A;  4U3F D;  1JMM A;  3IR9 A;  5C39 A;  1ZR4 A;  1N73 B;  2QEX P;  1VQ7 P;  1LJ2 A;  1PPJ G;  1KIL D;  1SQX K;  4EI2 A;  3L74 E;  1YHQ P;  1OXZ A;  1YBK A;  3L72 G;  1JMB A;  1YYC A;  3CX5 E;  3F89 A;  3H1K J;  3LW5 J;  4JPZ B;  5GTI E;  3CMA P;  1PGQ A;  2VRS A;  3H1L E;  2G8Y A;  1GL2 A;  3H1I D;  2J59 M;  1DIP A;  3AEB C;  4N78 E;  1JY3 O;  1N7S A;  4JYC A;  5KJ7 C;  1LTJ C;  1AFO A;  5APU A;  2GUV A;  2LR2 A;  3EWK A;  3JCU H;  1QVF O;  3M0D A;  2HOD B;  1T8Z A;  1MKM A;  1SQB J;  4N78 D;  4YTP C;  5KLV E;  3FXD A;  1K9M Q;  1N2D C;  1RE3 C;  1S5L H;  1J1E C;  3NXS A;  2N9Y B;  1H0T B;  5KAI H;  1EZV G;  1K05 A;  3M9B A;  4JQ0 D;  3P7K A;  3CCU P;  3CI9 A;  1PFI A;  5E79 H;  2FKW B;  3RBZ A;  1QLE D;  5KLV K;  1KYO E;  2C9L Y;  2FYU E;  1SQV D;  2B89 A;  1LTT C;  2OYI A;  3M91 A;  4L73 A;  1G2C B;  3V6I A;  2QJK B;  2QRX A;  1BE3 D;  1Q81 Q;  2GUS A;  4K3A A;  3H1J E;  1EZV D;  1GL2 C;  2N1T A;  4GDO A;  1SQQ G;  1PV3 A;  2FFD B;  1GW4 A;  1NTK D;  1OVV A;  1Y47 A;  2FY8 A;  2WWW A;  3HD7 C;  5AW7 B;  4EYY Q;  1ZW0 A;  1SFC D;  1YIJ P;  3H1I G;  1JY3 N;  3KXD A;  1DH3 A;  4H44 C;  1NTM K;  2O1K A;  3TGU G;  4EDF A;  2BEZ F;  1VQ9 P;  3CC4 P;  3U59 A;  3CX5 D;  1GL2 D;  4WY4 B;  1K04 A;  1OX3 A;  2IBZ E;  2ZT9 D;  4N3Y B;  4IL6 E;  1KYO I;  2ITA A;  2R32 A;  1H0T A;  3BAT A;  4N6J A;  3M9Q A;  1RY3 A;  4DCK A;  1VPC A;  1P84 D;  1NAY A;  4ZKU A;  5L8R J;  1ZV8 A;  2FXM A;  1P84 H;  2WMM A;  3AEA C;  1G2C A;  5AVT B;  1W2E A;  1YTZ I;  1YTZ T;  3CWB E;  1LTJ A;  4XA4 A;  4PD4 D;  1BCC J;  3USS A;  1SQP G;  1JOC A;  2ZVN B;  2C9N Y;  2GM4 A;  2R5B A;  2HPC B;  3FXE A;  4Y99 C;  1LP1 B;  2O01 J;  3V4W A;  4WB4 A;  3LW5 H;  4WWI A;  4DZO A;  2A45 H;  5CCH A;  2H43 A;  1OWA A;  2Z5H A;  2HLO A;  1VQM P;  3WUT A;  1RF0 C;  4BWN A;  5TIS E;  4ZNC A;  1FJK A;  4AYC A;  1JEK A;  1JY2 O;  5KJ7 A;  3Q5S A;  2O01 H;  1CW5 A;  2W27 A;  5AW9 B;  2R3S A;  2WSS H;  3H1L J;  1N8R Q;  3K5B A;  3GG2 A;  2WZ7 A;  5AVW B;  2KB7 P;  2A06 D;  2YMK A;  4H13 B;  4KHX A;  3VP9 A;  1SFC C;  2JJL A;  2FFD C;  3EQ2 A;  2WPS A;  3L4F A;  1YQ4 C;  1S1C X;  2WSE J;  4W7Y A;  1YI2 P;  1SQB G;  1AVO A;  1LTG C;  2JO1 A;  2D2C B;  4I7Z B;  4BRY A;  5KKZ B;  2Z4E A;  4IFD K;  1LTA C;  3OAK A;  2IX7 C;  3TYY A;  1LT9 A;  2AXT H;  1TU3 F;  4L76 A;  4UB8 H;  1DEE G;  3RK2 C;  2E5T A;  2NPS C;  4LGD E;  4YPC A;  1VQO P;  2H88 C;  1URQ B;  2I1J A;  2B9B A;  2K3R A;  1T2K D;  3SSU A;  1L0N E;  1GMJ A;  2ZT9 B;  2JWD A;  1PP9 E;  3I5C A;  3NFQ A;  2CK3 H;  1USE A;  2L5G B;  3A0H H;  3OJA B;  3RL0 D;  3S9O A;  4AQR D;  5AVS B;  1RF1 C;  3D6Y A;  1VQ6 P;  1PP9 D;  2XND H;  1FDM A;  1FU1 A;  1JY2 P;  3AEC C;  1IJD B;  3R4Y A;  1IK9 A;  1L0L J;  1YJW P;  1URQ C;  1MFT A;  1CI6 B;  2QJY B;  2W6B A;  4H44 D;  5TJH A;  3CXH D;  3VP8 A;  4BRY B;  1GK4 A;  4H0L D;  2LKM A;  1M1J C;  3WU2 E;  2OAR A;  2G3A A;  2B87 B;  1PL5 A;  3VYI A;  1UII A;  3AEE C;  2K88 A;  3LID A;  3PTZ A;  3TK1 A;  1HWT C;  2E43 A;  3CCJ P;  1FDI A;  1KB9 D;  1MZ9 A;  1SQX G;  2C0X A;  1GZL A;  1NU1 G;  1X79 B;  2E75 C;  2W83 C;  3QH9 A;  3RK3 E;  3SFD C;  3CCR P;  1PIX A;  1BCC E;  2PGD A;  5APW A;  2I1K A;  2Q6Q A;  2FYU J;  3CWB J;  3JCU E;  3V5B A;  2BCC E;  2ZXX A;  1E79 H;  3CCV P;  3MHV A;  4R4M A;  2AXC A;  5CCG D;  3H25 A;  2A45 I;  2FYN C;  5DJU B;  3L75 D;  2M3E A;  2D2C D;  1OZH A;  1L0N J;  1QGK B;  2KNC A;  3AE9 C;  3GMA A;  4NPF X;  4QMA A;  1FAV A;  1NU1 D;  1BGY G;  1L4A D;  2WSF H;  2Y0D A;  3H32 A;  3M0A A;  1SQB E;  2AEF A;  2KZI A;  3GHG A;  2P10 A;  1OFC X;  3RL0 g;  5APY A;  5APV A;  1FC2 C;  3VMY A;  1JTH A;  5B66 H;  1SFC A;  1VQ4 P;  1IFN A;  3HRN A;  4C7R A;  2BAS A;  1WT6 A;  2A06 E;  2IBZ D;  2OTJ P;  1W5C E;  2WPR A;  1NO4 A;  1NTK J;  3PH0 A;  2PRR A;  1NTZ G;  1L0L E;  2XKM A;  1IFM A;  2SPZ A;  1FZC B;  1KFN A;  1EDK A;  2E76 D;  3A0B H;  3L73 D;  2Q3I A;  3CX5 I;  4IL6 X;  3T97 B;  5K5G B;  1LTB C;  1BE3 J;  2CPS A;  4GKG A;  3CCM P;  3ABV C;  5AVU B;  2IBZ I;  2XDJ A;  1ZXG A;  2CPB A;  1T6A A;  2J58 A;  1SVF A;  2KOG A;  3H1J J;  3NTN A;  1EDL A;  4PD4 E;  1NU1 J;  1IFJ A;  1KTM A;  4UB8 E;  4IFM A;  3HD7 B;  2E74 B;  2JDI H;  4OWF A;  1NTM D;  2OQQ A;  2R5D A;  1HGZ A;  1KIL A;  3FX0 A;  2LXB A;  3HUS B;  1BSH A;  1QEX A;  3WUU A;  1FZC A;  1MV8 A;  2FYU D;  3CXH H;  3GHG B;  1FZG A;  1FZE A;  4M3L A;  3Q5P A;  5AW6 B;  2H7H A;  1AJY A;  1A02 F;  1T3U A;  1D7M A;  5KLV J;  2E76 C;  2FBW C;  2JEE A;  2M5A B;  3C8V A;  3H1I J;  2E5Y A;  3BCC E;  3L71 J;  1VQP P;  1H8A A;  3BRT B;  2NRG A;  1IC2 A;  3LIE A;  3VMX A;  2R44 A;  1YQ3 C;  1SS1 A;  1HVV A;  1NGM B;  2IYO A;  3E7K A;  3HUS C;  3M06 A;  1OVR A;  2ZYA A;  3H1L G;  3TNU B;  1VQL P;  3MP7 B;  3MUD C;  3L74 J;  4HH2 A;  5APS A;  5AW1 B;  5APX A;  1UIX A;  1L0L D;  2JR8 A;  3GHG C;  1L4A C;  2M0B A;  2W90 A;  3L73 E;  3R2P A;  2D2C C;  2HG5 D;  3CL3 D;  5KKZ C;  4DJG A;  1KIL B;  4RKU J;  3SFE C;  3A7O A;  3H1H D;  2XZR A;  2YXQ B;  4XFJ A;  4D6T E;  1VQN P;  1J1D C;  1RHZ B;  2KI7 B;  4TLF A;  5B66 E;  1SQX E;  5BVZ A;  1IZN B;  5APT A;  3CME P;  1KV4 A;  1IO4 A;  4A7P A;  2FYU G;  2QG4 A;  5CJ4 A;  1N73 A;  3CD6 P;  1SQV G;  1SQX D;  1L0N K;  2B88 A;  3B71 A;  1OIP A;  1GDT A;  1PGO A;  1FOS F;  5AW2 B;  1JY2 N;  1HF9 A;  5AVV B;  1GL2 B;  1GW3 A;  2V7Q J;  3FWL A;  4WY4 D;  3TNU A;  4D6T G;  1SQQ J;  1EC5 A;  1LT1 A;  3V2N A;  2K37 A;  2KUB A;  2UWJ E;  3Q5R A;  1IFI A;  1KMI Z;  1GU5 A;  2OYO A;  3AE1 C;  2Q9I A;  2OYH A;  2Q5U A;  1VF5 B;  1Z56 A;  2HOD A;  3E1R A;  4WBA A;  3TGU E;  3L74 G;  5AW5 B;  4WVZ A;  3JSV C;  5CBO A;  1K73 Q;  3RBX A;  3P8C E;  4MN4 C;  3WU2 H;  5CCH C;  1NVO A;  3CXH E;  3AE6 C;  3B8E B;  2NPS A;  3U1C A;  3CCQ P;  1KQF B;  1H88 A;  1JUN A;  1BGY E;  1GK6 A;  3W67 A;  3P32 A;  1LWU C;  2HYN A;  3W68 A;  2BCC D;  3MUD A;  3D6Z A;  1SQX J;  5GTH E;  2I8D A;  5KAF H;  2N1T B;  1VF5 C;  1RF1 A;  1P84 I;  2WPQ A;  1X22 A;  3L75 E;  2NPS D;  1KB9 I;  1EZV I;  2YIU B;  4HJG H;  2E75 D;  1YJ9 P;  1NJI Q;  1KB9 H;  1R5S A;  1LT9 C;  1BCC D;  1JCD A;  2K9Y A;  2AEJ A;  3II6 A;  2KLU A;  3RK3 C;  3O8Z A;  3PHL A;  3TSI A;  3CCL P;  3D70 A;  2WT7 B;  4H13 D;  3B5N B;  1WRG A;  4H0L C;  5GTH H;  1N7S C;  1AVY A;  3H1H G;  1KIL E;  1M7L A;  3HE4 A;  4W80 A;  1S5L E;  3L74 D;  1SP4 A;  3H6P A;  2N1T C;  3SWY A;  1NTZ J;  3L72 J;  1ZME C;  1NTK G;  2RN0 A;  4OVN F;  1CZQ A;  4KT0 J;  3V2P A;  3WMM 0;  2M8R A;  5APQ A;  1AA0 A;  1Q82 Q;  1HJB A;  2KS1 B;  1URQ D;  2AEM A;  2WSC J; 
#chains in the Genus database with same CATH homology
 1NAF A;  1LTJ B;  1LWU B;  2C0W A;  3A2A A;  2HPC A;  2ZFC A;  2OYI C;  2P2U A;  5AW0 B;  3N4X A;  3MGN A;  3RK2 D;  1NKZ B;  1KQL A;  5CCG C;  2WT7 A;  2WSC H;  2KSJ A;  1LTI C;  4HYT B;  1JCC A;  1QL2 A;  1ZN5 A;  4Y99 B;  4IFF A;  4DOJ A;  1CSB A;  3A3Y B;  5AVX B;  2N1T D;  2ZXE B;  1HGV A;  2OYI B;  3P8C D;  1JO5 A;  1N7S D;  2WSE H;  3EFG A;  1SQB K;  1EQ7 A;  1LT9 B;  1LWU A;  1L4A B;  3N7N A;  1NKN A;  5CCG A;  3KDP B;  3A5T A;  1X9V A;  1L0L K;  1J1E B;  4WY4 A;  1NH4 A;  1NU1 K;  3P8M C;  3BRV B;  1E5W A;  2M3B A;  1G1I A;  2YKQ A;  4I6M C;  3HTK A;  2E42 A;  2POH A;  3V2Q A;  2KP8 A;  3PP5 A;  1SQP K;  5KJ7 D;  2IPP A;  2KLV A;  1FBM A;  3KPE A;  1J1D B;  1L4A A;  3KYQ A;  5CMZ A;  1LTS C;  1SQQ K;  2YKO A;  4WY4 C;  3HD7 D;  5AW4 B;  3CLQ A;  1JNM A;  1RE4 A;  3V4Q A;  1T3J A;  2PAJ A;  4I1L A;  2R3C A;  1FJP A;  4GIF A;  5AW3 B;  3HTK B;  2YO2 A;  3H32 B;  1KFM A;  2FYZ A;  1H88 A;  1FZA A;  2A45 G;  2P7J A;  5AVQ B;  1MFZ A;  1SFC B;  2Z5I A;  2QM7 A;  3NMD A;  2KYV A;  2WIT A;  1GTW A;  1HUC A;  1SQV K;  3KQG A;  1URQ A;  2YKP A;  1RE4 C;  1HBW A;  3T97 A;  4JF7 A;  2QM8 A;  4ZKP A;  4C7N A;  2YMY A;  2HFE D;  3V2R A;  1G1J A;  3HD7 A;  2P1J A;  2IFM A;  3BAS A;  3RK3 B;  1A02 J;  4RES B;  1N7L A;  4GT1 A;  5CJ0 A;  3L36 A;  5AW8 B;  5BU5 A;  1S9K E;  1IFD A;  1CI6 A;  3L37 A;  1S9K D;  1RF0 A;  1AQ5 A;  1FZB A;  4LC1 A;  1XTG B;  1ZR2 A;  4W7Z A;  5AVZ B;  1H89 A;  2MJZ A;  1FZC C;  1N86 A;  2YO3 A;  2O1J A;  3VTP C;  4C7N B;  3E1I A;  3HE5 B;  1HTL C;  2YNY A;  5CCH D;  4LLH A;  1HH0 A;  1QL1 A;  1XTC C;  4B86 A;  1NOH A;  1VDF A;  1J2J B;  2N9B A;  1JY3 P;  3B5N D;  1JTH B;  3RL0 B;  1NTZ K;  1KIL C;  2FYU K;  4EOT A;  3M9H A;  1NTK K;  5CHX A;  1GU4 A;  3MTU E;  4I2L C;  4EIJ A;  3VMZ A;  2PP6 A;  1X8Y A;  2OYH B;  2P67 A;  3RK3 D;  3G3Z A;  3HE5 A;  1FZF A;  1MUU A;  2XV5 A;  3HUS A;  3B5N C;  5BU8 B;  1KZU B;  1M1J A;  4C46 A;  1N73 C;  3C9I A;  3RK2 B;  2NPS B;  3U1A A;  3SWF A;  5KTB A;  3M0D C;  2Q7C A;  3BVH A;  5AVR B;  1FOS E;  1RE3 A;  2OYH C;  3OA7 A;  3L35 A;  1RF1 B;  1NWQ A;  1ZLL A;  3RL0 C;  4JYB A;  2XU6 A;  3UIA A;  2W6A A;  1T2K C;  1DEB A;  1N7S B;  3MIW A;  4OH8 B;  2H8P D;  3B5N A;  1NHL A;  3IFM A;  1GD2 E;  4XE5 B;  2WTY A;  3VN0 A;  1LGH B;  3HE4 B;  2IFN A;  1M1J B;  1DX7 A;  3MD0 A;  3VOP A;  2XNX A;  5AVY B;  1SLQ A;  1ZR4 A;  1N73 B;  1JMM A;  3IR9 A;  1KIL D;  1SQX K;  1OXZ A;  1YYC A;  2FFD A;  2VRS A;  1GL2 A;  2J59 M;  4N78 E;  1JY3 O;  1N7S A;  4JYC A;  5KJ7 C;  1LTJ C;  1AFO A;  5APU A;  2GUV A;  3M0D A;  2HOD B;  1T8Z A;  4N78 D;  1N2D C;  1RE3 C;  1J1E C;  3NXS A;  3M9B A;  3P7K A;  1PFI A;  3CI9 A;  2FKW B;  5KLV K;  2C9L Y;  1LTT C;  2OYI A;  3M91 A;  1G2C B;  2GUS A;  1GL2 C;  2N1T A;  2FFD B;  1GW4 A;  2WWW A;  3HD7 C;  5AW7 B;  1SFC D;  1JY3 N;  1DH3 A;  1NTM K;  2O1K A;  3U59 A;  1GL2 D;  4WY4 B;  4N3Y B;  2R32 A;  3BAT A;  4N6J A;  3M9Q A;  1RY3 A;  1VPC A;  4ZKU A;  1ZV8 A;  2FXM A;  1G2C A;  5AVT B;  1W2E A;  1YTZ I;  1YTZ T;  1LTJ A;  4XA4 A;  1JOC A;  2C9N Y;  2GM4 A;  2R5B A;  2HPC B;  4Y99 C;  3V4W A;  4DZO A;  4WB4 A;  3LW5 H;  5CCH A;  2H43 A;  2A45 H;  1OWA A;  2Z5H A;  2HLO A;  1RF0 C;  1FJK A;  4AYC A;  1JY2 O;  5KJ7 A;  2O01 H;  1CW5 A;  2W27 A;  2WZ7 A;  5AVW B;  2KB7 P;  4KHX A;  3VP9 A;  1SFC C;  2JJL A;  3EQ2 A;  2WPS A;  3L4F A;  4W7Y A;  1LTG C;  4IFD K;  2Z4E A;  1LTA C;  3OAK A;  2IX7 C;  3TYY A;  1LT9 A;  3RK2 C;  2NPS C;  4LGD E;  2I1J A;  1URQ B;  1T2K D;  3NFQ A;  3I5C A;  2L5G B;  3RL0 D;  3OJA B;  4AQR D;  5AVS B;  1RF1 C;  1FDM A;  1FU1 A;  1JY2 P;  1IJD B;  1IK9 A;  1URQ C;  1CI6 B;  2W6B A;  3VP8 A;  1GK4 A;  2LKM A;  1M1J C;  2OAR A;  3VYI A;  3LID A;  3TK1 A;  1HWT C;  2E43 A;  1MZ9 A;  4O9B A;  2C0X A;  1GZL A;  1X79 B;  5APW A;  2I1K A;  3V5B A;  5CCG D;  2A45 I;  5AW9 B;  1FZC B;  1FAV A;  2WSF H;  1L4A D;  3M0A A;  3H32 A;  2FFD C;  3GHG A;  5APY A;  5APV A;  3VMY A;  1JTH A;  1SFC A;  1IFN A;  3HRN A;  4C7R A;  2BAS A;  1WT6 A;  2WPR A;  1NO4 A;  2XKM A;  1IFM A;  1KFN A;  2Q3I A;  1LTB C;  2CPS A;  4GKG A;  5AVU B;  2XDJ A;  2CPB A;  2J58 A;  1SVF A;  2KOG A;  3NTN A;  1IFJ A;  4IFM A;  3HD7 B;  2R5D A;  3HUS B;  1HGZ A;  1KIL A;  1FZC A;  1MV8 A;  3GHG B;  1FZG A;  1FZE A;  4M3L A;  2H7H A;  5AW6 B;  1A02 F;  1T3U A;  2JEE A;  1H8A A;  3BRT B;  3VMX A;  1IC2 A;  3LIE A;  1HVV A;  3M06 A;  3HUS C;  3TNU B;  4HH2 A;  5APS A;  5AW1 B;  5APX A;  3GHG C;  1L4A C;  3R2P A;  2HG5 D;  3CL3 D;  1KIL B;  3A7O A;  2XZR A;  1J1D C;  5BVZ A;  5APT A;  1IO4 A;  5CJ4 A;  1N73 A;  1L0N K;  1GDT A;  1FOS F;  5AW2 B;  1JY2 N;  5AVV B;  1GL2 B;  1GW3 A;  4WY4 D;  3TNU A;  3V2N A;  1IFI A;  1GU5 A;  2OYH A;  2Q9I A;  2Q5U A;  1Z56 A;  2HOD A;  4WBA A;  5AW5 B;  3P8C E;  5CCH C;  3B8E B;  2NPS A;  3U1C A;  1JUN A;  1GK6 A;  3P32 A;  1LWU C;  2HYN A;  3MUD A;  1RF1 A;  2N1T B;  2WPQ A;  2NPS D;  1LT9 C;  1JCD A;  3II6 A;  3RK3 C;  3O8Z A;  3TSI A;  2WT7 B;  3B5N B;  1WRG A;  1N7S C;  1M7L A;  3HE4 A;  4W80 A;  1SP4 A;  3H6P A;  2N1T C;  3SWY A;  4AUW A;  3V2P A;  1CZQ A;  3WMM 0;  1HJB A;  2M8R A;  5APQ A;  1URQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...