1GU5A

Crystal structure of c/ebpbeta bzip homodimer bound to a dna fragment from the mim-1 promoter
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
65
structure length
65
Chain Sequence
DKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords CAAT/ENHANCER BINDING PROTEIN BETA
publication title Structural Basis for Flexible Base Recognition by C/Ebpbeta
rcsb
source organism Homo sapiens
total genus 29
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gu5A00
1CI6B 2YNYA 1CSBA 3MGNA 1T2KD 3HE5B 5AW6B 1S9KE 3VMYA 2WPQA 5AVZB 4EOTA 1H8AA 3P32A 3VTPC 4C46A 3L37A 1GD2E 1HJBA 3A5TA 5AVVB 3L35A 2C9LY 5AW5B 3M9HA 5APXA 2ZFCA 1NWQA 1DH3A 1FAVA 2XV5A 2ZXEB 4M3LA 1GK6A 5APVA 4GKGA 2KP8A 3LIEA 2P67A 2JJLA 3VYIA 1H88A 2WWWA 1FOSE 2QM7A 1GZLA 2WT7A 2E43A 4DZOA 5APTA 5APQA 4I2LC 5AVWB 1YYCA 3NFQA 3TYYA 1FOSF 1T2KC 1JNMA 5APWA 2WT7B 5AVUB 3T97A 3VMZA 2YO3A 5AVYB 3M9BA 1SP4A 4AYCA 4B86A 2IPPA 5CMZA 3M0AA 5AW7B 5AW9B 4AUWA 2XU6A 4HYTB 2VRSA 3I5CA 1A02F 2W27A 2R5DA 1HWTC 3HE4A 2N9BA 2H7HA 1X8YA 1J2JB 4XE5B 3IR9A 1GK4A 3NTNA 3HE4B 2R32A 3HTKA 4C7NA 2XZRA 3M91A 2R5BA 1MUUA 3B8EB 5AW1B 5AW2B 1MFZA 2W6AA 1OWAA 1NAFA 3OAKA 2C9NY 4C7NB 1GTWA 1JUNA 4RESB 3A3YB 3VMXA 2Q3IA 1S9KD 1MV8A 5AVXB 2Q5UA 5AW0B 4AQRD 3TNUA 3V4WA 2P7JA 1G2CB 5AVSB 3KQGA 5AW8B 2WTYA 3P7KA 2WPRA 3VN0A 2QM8A 1GU5A 4GT1A 5APSA 1CZQA 5AW4B 5AVTB 3V5BA 1A02J 2WPSA 2Z5IA 1GU4A 3M0DA 2YO2A 2R3CA 4I6MC 3NXSA 4JYCA 5AVQB 1HUCA 2Z5HA 2P2UA 3SWFA 3A2AA 3UIAA 3M06A 5AVRB 4JYBA 4KHXA 3TK1A 3NMDA 1KQLA 4LC1A 3MD0A 3P8MC 1HBWA 3LIDA 3L36A 1CI6A 5APYA 5APUA 3V4QA 1H89A 3A7OA 3KDPB 3TNUB 1OXZA 3HE5A 2E42A 2BASA 1SLQA 1IO4A 3O8ZA 2Q7CA 5AW3B
chains in the Genus database with same CATH superfamily
3HUSB 4JBZA 3QH9A 4IL6H 3SSUA 1L0NG 2BCCJ 4H0LD 3RL0D 2N1TB 3VMYA 5AVZB 2FKWB 4C46A 3M9QA 1DH3A 3PH0A 2WZ7A 3RL0B 2WITA 2YXRB 1Q81Q 1YITP 4N78D 1HH0A 2K1AA 2C0XA 5KLVG 1JO5A 1JNMA 4R4LA 3VMZA 1CW5A 4AYCA 5E79E 1MKMA 3PRJA 1N86A 4PV1D 2G3AA 5CCGC 2HPCB 1RH5B 2Y0EA 3LW5J 3RK3D 4PV1B 4C7NA 3H1JJ 5AW1B 3H1HJ 3RK3B 3L73G 1BCCE 3GHGC 1Q86Q 3GF3A 2WTYA 2J5UA 1HGZA 4IFDK 1EDIA 2FFDB 2HLOA 2Y0DA 1T8ZA 1SFCA 1L4AC 5B66E 4DJGA 3NXSA 1K05A 1PGOA 4JYBA 1RQUA 1L0NK 1BCCD 3HD7A 1ZOYC 5APUA 4WVZA 5L8RJ 1IO4A 2Q7CA 2KSEA 2H43A 2ZYDA 5KLVK 3AE2C 1NGMB 2IBZE 3C9IA 1N73A 1PGQA 2ZVNB 2BEZF 1SQBG 5BU5A 3Q3DA 2AEMA 2FYUE 1JY2N 1FJPA 3AE7C 2AXTE 3R4YA 1SQVE 2K9YA 1JY2O 1TU3F 1HWTC 2IBZD 1T3UA 4WY4D 2DW3A 1MUUA 4N3YB 3OAKA 4WY4B 1S9KD 1OW6A 5CBOA 2KS1B 3CC7P 3B71A 1U7JA 3RBZA 1SQVD 1Y47A 1VQNP 3A0BE 3D71A 1L0LK 1LWUA 2IZ1A 1GU4A 1M1JC 4QMAA 3PJSK 4Y28J 1JY3O 4IOIH 3WUVA 2HFED 1K73Q 5BVZA 1CI6A 5GTIH 4K35A 3FXEA 1S72P 3H32B 3CMEP 3HE5B 2E5YA 2ZYAA 1SQBK 1PIXA 2WPQA 5E79H 3AEDC 3AE6C 3ZDMA 3KZIE 4YXWH 2ZXEB 3L75E 4EI2A 1JTHB 1ZN5A 4EIJA 1AJYA 2B9BA 3CXHE 2YKQA 2WT7A 4DT0A 1EZVE 2IFNA 3M9BA 1SQQE 3EFFK 3JCUE 1BGYJ 1M7LA 1ZRTE 2N9BA 2FYNC 3L75D 1EXJA 3V2QA 3HE4B 5B66H 3CXHD 1J1DC 1AQ5A 1K8AQ 3AEFC 1EZVD 4Y99C 2O1KA 1RF1B 3GG2A 2WVRA 2OYIB 2OQQA 3D6YA 1SQQD 1FZCC 3KPEA 1M56D 1LTJC 2QM8A 5H2FE 2HYNA 2AEFA 2D2CD 1BCCJ 4HB1A 1A02J 3RL0g 2HODB 1BE3D 3M0DA 2RMZA 1BSNA 2BEQD 1PP9D 2D2CB 5K5GB 3UIAA 4KHXA 4IFFA 2YIUB 1IFPA 1LP1B 3CCJP 2XDJA 5CCHC 4D6TG 1IFIA 2H88C 1HJ0A 3H1LG 1DX7A 2V7QH 2WSFJ 2AXTH 1VQ6P 1HJBA 1VQ9P 1K9MQ 3M9HA 4KJMA 1N7SA 1LT9C 1FAVA 2GUVA 3B5ND 1PPJG 2YKOA 1HTLC 3LIEA 1FS0E 3B5NB 1KQFB 1NTME 2G8YA 5AVUB 1QL1A 2P10A 2MKVA 1RE3A 3T97B 1XTCC 2IDBA 1JMBA 1KQSO 3L70G 4Z1MH 3MUDA 3A0BH 1VQ7P 2JEEA 1T3JA 2R5DA 3AEGC 2V7QJ 1GK4A 1EQ7A 1LTJB 2M8RA 2ZYGA 1SQVJ 4U3FJ 2W90A 5GTHH 3L74G 3A3YB 2NPSC 1L0NE 4PJ0E 2ZAEB 1KFNA 3CXHI 1S1CX 2GM4A 1EZVI 2A45I 1WT6A 1IJDB 2QVAA 2Z4EA 3CCSP 2Z5HA 2E74C 3KZIH 5KLVE 1W2EA 2FYUK 3TK1A 1PGJA 2PGDA 3MD0A 1M8OB 1L0ND 3CXHH 1LT9B 4ZKPA 1ZLLA 3O8ZA 3ABVC 1Z56A 4U7JA 3TGUG 2I1JA 2IZ0A 4GDOA 3JCUH 1NTZG 2OGUA 3CI9A 1KILA 3GW6A 5KLVD 1GK6A 2QJYC 2YMKA 1OFCX 4GKGA 3L73E 2KNCB 2QE7H 1H0TA 2P67A 5C39A 2FY8A 3KXDA 4BWNA 3L75J 1SQPG 1KV4A 5BU8B 4L74A 2PP6A 5AVYB 4JPZB 2XU6A 2V4HA 1GL2D 2J58A 3Q5PA 4ZNCA 5H2FH 3HUSC 2XNXA 4BRYA 3G4SP 2KUBA 1FZFA 3IR9A 1GL2B 2ZXXA 1SQQJ 3AE9C 3HTKA 1KMIZ 2W6AA 1VF5C 4H0LC 1BE3J 3V4WA 3H1IG 1IZNB 1QEXA 1PP9J 1WRGA 5TISE 3KQGA 1VQKP 1RE4A 2N1TA 3V5BA 2YO2A 1L0LD 1SQBE 1YI2P 2YXQB 5AVRB 3AE1C 3N7NA 4LLHA 2KIKA 3Q5SA 1FDMA 4PV1C 2QJYB 3IF4A 1EDKA 1SQXJ 2OTLP 2W8ZA 3RK3C 2I1KA 2YMYA 1SQBD 3O6QA 2LR2A 4OWFA 4NPFX 2FFDC 1NH4A 2LKMA 2JJLA 3VYIA 3V2PA 3AE4C 4DZOA 3TYYA 3FX0A 1VF5D 4YPCA 1KTMA 2JWAA 1VF5B 4H0LB 3BCCG 3VMAA 2MJZA 2M5AB 5KJ7D 2HG5D 3VP9A 1MFZA 2M3EA 2H8PD 4RESB 3H1HG 2OTJP 2KZJA 4PD4E 1KYOE 3P7KA 1LGHB 1NKZB 1OMIA 1URQD 2JWDA 1AFOA 1L0NJ 2JP3A 1BDDA 3L72J 4W80A 1EC5A 1NTMK 1URQB 3GLMA 3HRNA 3BRVB 1GDTA 2HR3A 3M06A 2M0BA 4PD4D 5CCGA 1NHLA 3Q2YA 1YIJP 3JSVC 5B5EE 2FXMA 1LTSC 2OYHB 4OVNF 1DEEG 4WY4C 3L71J 3JC22 2J59M 1S5LX 3P32A 3WUUA 3GHGA 3L35A 1NWQA 1RF0C 5APVA 1KC8Q 1GZLA 1P84E 3KHUA 1U7MA 1FDOA 4I2LC 1L4AA 3G71P 1FOSF 1SP4A 1JMMA 3M0AA 5TISH 2GUSA 2K9JA 3I5CA 1FZAA 1J2JB 3CC4P 1FJKA 2QJPC 5AW2B 4UB6E 1Q2NA 1L2PA 4C7NB 4D6TE 3VMXA 2POHA 1L0LJ 1S4XA 3V2NA 3H1LE 2W6BA 3SWYA 2B87A 5APSA 1DD3A 1PPJE 3H1KJ 2WPSA 1W2BO 3WMM0 4L75A 4ZMDA 3TF5A 2OYOA 4WWIA 3S9OA 1IFDA 4IFMA 4H44D 3CX5E 3HD7D 1KB9E 4D6TD 1QGKB 3MTUE 2FYUD 1HBWA 3H1LD 3A7OA 4H44B 1IFJA 1PZQA 2AXCA 3HD7B 2IYOA 3VN0A 3L70E 1MFTA 3CWBJ 3ITKA 1RF1C 1PPJD 1OW7A 2OYIC 4PD4I 2CPSA 2FYZA 1Y9BA 1FDIA 3F89A 1KYOI 1YBKA 2M3BA 3CX5D 3L74E 3RBXA 2WWWA 5AVWB 1M1JA 2D2CC 1EDLA 5APWA 4OGQD 4PD4H 1DD4A 2QJPB 1KYOH 1FZEA 2YIUC 4OGQB 1BGYG 1NU1G 1LTTC 3GMAA 1X79B 3L74D 1ZR2A 1LTBC 2N9YB 1OWAA 3TGUE 2Q5UA 5M1BA 3IFMA 1KFMA 3B5NC 1UIIA 1NTZE 1P84I 1S2EA 3P8CE 2LXCB 2KI7B 3S1KA 3H25A 1LWUB 1FU1A 3CLQA 2RH0A 1KQLA 2QEXP 1S5LE 1ZV8A 4O9BA 1OXZA 2B88A 1ZRTD 1CI6B 1FE6A 2AEJA 3KYQA 3P8CD 1G1JA 1SVFA 3EFGA 4JQ0D 1YJ9P 5APXA 2WSSH 1NJIQ 1W5CE 2YKPA 1FZCA 1PGPA 4KT0J 1LTJA 1IFMA 1FOSE 3H1IE 3PP5A 3A0HE 2ZVOB 1K04A 4UB8E 4UB6H 1NU1K 2JR8A 2WT7B 4K3AA 1JCCA 2IPPA 3CX5I 5AW9B 1NTKG 1KB9I 1AVOA 3CCVP 2H7HA 3WU2E 5CCHA 1ZMEC 3H1ID 1SQVG 4U3FG 1NAFA 3CX5H 2Q3IA 5AVXB 1LT9A 1OIPA 2KYVA 1Q82Q 3SWKA 5AVSB 4ASVA 1IK9A 4BXLA 1PL5A 2RKLA 3FGAD 1GU5A 1M57D 4TT3H 2R3SA 2FYUJ 5DJUB 3U1AA 3MZWB 2Z5IA 3CCMP 3H1LJ 2LXBA 3D6ZA 4H13D 3SWFA 1OVUA 1NTMD 2KNCA 1IC2A 4H13B 1GL2C 3L36A 4W7ZA 3TNUB 1SLQA 2YNYA 1PV3A 1CSBA 3BCCE 1D7MA 1LTAC 2SPZA 1JB0J 3I56P 4WBAA 2NPSA 5AVVB 1M90Q 5KTBA 4GOEA 1EDJA 3K5BA 3H1HE 1NTKK 3TDKA 3G9RA 3PHLA 2A45H 5APQA 3BCCD 1NVOA 3L74J 1QVGO 2O01N 2OARA 4DCKA 1HGVA 4HYTB 2VRSA 1A02F 4XE5B 1JEKA 3SFDC 2W83C 2P58A 2L91A 1S3JA 1G2CA 2K3RA 1BE3G 1USEA 3GF7A 3L4FA 4L73A 1PP9G 3TSIA 4HKZH 3PTZA 2CK3H 3Q1MA 3L73D 2E76C 1KORA 2WMMA 5KAFE 1QX8A 2JKVA 1KILE 2P2UA 3AE8C 3RK2D 3S4RA 4TLFA 2O01H 3LIDA 1YQ3C 2KOGA 3HUSA 2KK7A 3RK2B 1X9VA 2ITAA 1VQ4P 4UB8H 1SQXG 5KJ7C 1HF9A 3OA7A 2K37A 1KILD 1OX3A 2QG4A 5AW5B 1BSHA 2QJKB 1AVYA 5KAIE 1KILB 1H88A 3E7KA 1NTZK 2E43A 1YYCA 1URQC 1H0TB 3OW2O 2O01J 2Q6QA 3BASA 2Y9YA 5DJTB 2BCCG 4RO0A 3H1IJ 2HPCA 2L5GB 1SQPK 2W27A 2A06G 1G1IA 2OYHC 2E76D 2QRXA 2PRRA 2R32A 2XZRA 4EDFA 1MZ9A 2RN0A 3HTKB 2E76B 2WPVB 1JY3P 1VQ5P 2K88A 2ZT9D 4PJ0H 2FFDA 3BRTB 2O3JA 1NTMJ 1VQMP 2N1TD 1CZQA 2ZT9B 1BDCA 1OVVA 1U57A 2H89C 3H1JG 3L72G 3LW5H 3CMAP 2Q9IA 3MP7B 5AVQB 2CPBA 3G6EP 3AECC 3CCRP 1SQXK 3EWKA 1QL2A 1USDA 3RK3E 3V4QA 1H89A 3E1RA 3AEEC 5GTIE 1OVRA 1BGYE 1GMJA 1NU1E 2QIWA 3L71G 4ASWA 3VTPC 3V2RA 3A5TA 1FZBA 2JDIH 3BCCJ 1XTGB 3C8VA 2NRGA 3O6QB 3VOPA 1IK7A 1KYOD 5KLVJ 3CL3D 2KZIA 1SFCC 1BGYD 2YO3A 1VL2A 1NU1D 1QVFO 1FC2C 5AW7B 2Y9ZA 2Y0CA 5EFWB 2WSCH 4H44C 3HD7C 1YTZI 5CHXA 4GODA 1T6AA 3D70A 5KAFH 1SS1A 1GW3A 2PFXA 1RY3A 4WY4A 2KS1A 3L73J 5AW0B 2P7JA 1L0LG 1RF0A 2IFMA 1YTZT 1PFIA 2WPRA 3RGUA 4HH2A 1N73C 1Q90D 3WUTA 1E79H 3H1KG 1NAYA 3U59A 1P84D 2WSCJ 2FXPA 1HUCA 1E5WA 3MIWA 4OGQC 4OH8B 5CCGD 3CCQP 5KAIH 1NTKE 3H32A 4RJTA 3HE5A 3CPWO 2WSEH 1SFCD 1YJWP 3CWBG 3CC2P 1S9KE 4EOTA 1SFCB 1JTHA 2ZFCA 3USSA 4U3FE 3G3ZA 3OJAB 3GHGB 1SQBJ 1N2DC 3CCUP 2QM7A 2Q1KA 1LT1A 1L4AD 1NTKD 1LWUC 5TJHA 3PLNA 4RKUJ 1L4AB 1N7LA 4B86A 3FWLA 1LNQA 3B4SA 2WSEJ 4NPEA 3HE4A 1X8YA 4U3FD 1KB9D 2K9JB 3FWNA 2XKMA 1KD1Q 4IL6X 1JY3N 1N73B 1RF1A 3W68A 3L70D 1RQVA 5CJ4A 2OYIA 1JUNA 5GTHE 1NOHA 1ZXGA 1VQLP 2HODA 2I8DA 1DIPA 3VP8A 2B87B 5KLIC 1OW8A 4A7PA 1KQGB 1LP1A 1IFNA 2E42A 3I55P 5AW3B 5B5EH 3FXDA 2QA4P 1BCCG 3E1IA 5CJ0A 3U1CA 3IN6A 1N8RQ 3L37A 1GD2E 4YTPC 3II6A 4ZKUA 1NU1J 1SQPE 3TGUD 3B5NA 1BE3E 2KP8A 1P84H 2PAJA 4I1LA 1PP9E 1NTZD 3M0DC 1VQ8P 4GIFA 3T97A 1M1JB 4H13C 1WMKA 2IBZI 3H6PA 2WSFH 4MN4C 5KKZC 1SQPD 3N4XA 2C0WA 3SFEC 2IBZG 2C9NY 2QSIA 3BVHA 4I7ZC 5KLIB 1MV8A 1SQXE 3TNUA 1NKNA 1N7SC 1LTIC 4EYYQ 1JM0A 4GT1A 2FYUG 1FZGA 1YQ4C 4XFJA 4C7RA 4JYCA 3A2AA 3AE5C 1RE3C 1KB9H 1FBMA 4LC1A 1SQXD 2BCCE 3MUDC 3CD6P 1NYHA 2BASA 4D6TJ 2FYNB 3MGNA 2B89A 2A06E 1JOCA 4YXDC 1NTKJ 1H8AA 1J1DB 4Y99B 2C9LY 3AE3C 2XV5A 2E5TA 4M3LA 1AA0A 2KB7P 1LTGC 2BCCD 1FZCB 3QWOC 5APTA 5KKZB 3NFQA 1T2KC 1J1EC 2A06D 4W7YA 4IL6E 5CMZA 1N7SD 3L70J 3H1JE 3L72E 3RK2C 1GL2A 3CCEP 4I7ZB 1R8EA 3CCLP 1N7SB 1YJNP 5CCHD 4N6JA 3M91A 3AEAC 2O1JA 2Q3EA 3L75G 1GTWA 3MHVA 2KLUA 2QJKC 2E75C 1UIXA 1KILC 1SQVK 3L71E 5AW8B 1EZVG 2A45G 3H1JD 3L72D 1GW4A 1VDFA 4DOJA 3H1HD 5AW4B 5AVTB 2OTKE 1VPCA 1SQQG 1M1KQ 2R3CA 4I6MC 2P1JA 1KN7A 3AEBC 1S5LH 2FBWC 3P8MC 5APYA 3KDPB 3F5HA 3L71D 2XNDH 1LJ2A 1YHQP 3TGUJ 2KSJA 4JF7A 1T2KD 1VQOP 5AW6B 2NPSD 4R4MA 1NTZJ 1J1EB 2W6JH 3R2PA 4HJGH 1VQPP 2NPSB 2ZT9C 3IAOA 1Y8AA 5CBNA 2NZ2A 1L0LE 1AQTA 1RE4C 2N1TC 3A0HH 3EQ2A 2GA1A 1HVVA 1DEBA 1SQPJ 2E74D 1R5SA 4LGDE 3RL0C 4GOFA 2E75D 1AV1A 2R44A 3H1KE 4AUWA 4WB4A 3C1LA 3Q5RA 4CPGA 2E74B 1ZP0C 2M5AA 1QLED 2E75B 1OZHA 1JY2P 4NPDA 3WU2H 3NTNA 2KLVA 3W67A 2JO1A 2R5BA 3B8EB 5KJ7A 1ZW0A 2IYPA 1RHZB 4AQRD 3CWBE 1JCDA 1SQQK 3V6IA 3H1KD 1G2CB 1X0TA 4L76A 2IX7C 1NO4A 1NTMG 1URQA 1R5LA 4BRYB 2WQYC 1EXIA 1ZR4A 2UWJE 1X22A 3NMDA 2ZJSE 2KXPB 3CWBD 4N78E 3BATA 1Q7YQ 2OYHA 1KZUB 2FXOA 4XA4A
chains in the Genus database with same CATH topology
2WSEH 1SFCD 1CI6B 3HUSB 1Z56A 3KYQA 1S9KE 3P8CD 1G1JA 2I1JA 2N1TB 3RL0D 3VMYA 1SVFA 5AVZB 4EOTA 2FKWB 3EFGA 1SFCB 4C46A 1JTHA 3M9QA 5APXA 3CI9A 2ZFCA 1DH3A 2WZ7A 1KILA 2YKPA 3RL0B 1GK6A 1FZCA 2WITA 3G3ZA 3OJAB 3GHGB 1LTJA 4GKGA 2P67A 1N2DC 1IFMA 4N78D 3PP5A 2QM7A 1FOSE 1HH0A 1L4AD 2C0XA 1LWUC 1JO5A 1JNMA 1NU1K 2WT7B 5BU8B 3VMZA 1JCCA 1CW5A 2PP6A 5AVYB 1L4AB 1N7LA 4AYCA 4B86A 2IPPA 5AW9B 2XU6A 1N86A 1GL2D 2J58A 5CCGC 2HPCB 3HE4A 2H7HA 3HUSC 1X8YA 2XNXA 1FZFA 2XKMA 3IR9A 1GL2B 3RK3D 5CCHA 3HTKA 1JY3N 4C7NA 1N73B 1RF1A 5AW1B 2W6AA 5CJ4A 2OYIA 1NAFA 1JUNA 3RK3B 2Q3IA 5AVXB 1NOHA 1LT9A 3GHGC 3V4WA 2KYVA 1WRGA 5AVSB 3KQGA 2WTYA 1IK9A 2HODA 1HGZA 4IFDK 1GU5A 2FFDB 1RE4A 2N1TA 2HLOA 3U1AA 3V5BA 2Z5IA 1T8ZA 3VP8A 1SFCA 1L4AC 2YO2A 3NXSA 3SWFA 5AVRB 4JYBA 1L0NK 3N7NA 1IC2A 4LLHA 3HD7A 1GL2C 1IFNA 3L36A 1FDMA 5APUA 4W7ZA 3TNUB 2E42A 1IO4A 1SLQA 2Q7CA 5AW3B 2YNYA 1CSBA 3E1IA 2H43A 3RK3C 5CJ0A 2I1KA 3U1CA 1LTAC 2YMYA 3L37A 1GD2E 4WBAA 2NPSA 5AVVB 5KLVK 3II6A 5KTBA 4ZKUA 3C9IA 2FFDC 1NH4A 3B5NA 1N73A 2KP8A 1NTKK 2LKMA 2JJLA 3VYIA 3V2PA 2PAJA 4DZOA 2A45H 4I1LA 5APQA 3TYYA 3M0DC 4GIFA 3T97A 5BU5A 1M1JB 2OARA 1JY2N 1FJPA 3H6PA 1HGVA 4HYTB 2VRSA 2WSFH 1A02F 1JY2O 1HWTC 2MJZA 4XE5B 3N4XA 1T3UA 4WY4D 2C0WA 5KJ7D 2HG5D 1MUUA 4N3YB 3VP9A 1MFZA 3OAKA 2H8PD 2C9NY 4WY4B 4RESB 1G2CA 3BVHA 1S9KD 1MV8A 3TNUA 1NKNA 1N7SC 1LTIC 3L4FA 3P7KA 1LGHB 1NKZB 3TSIA 4GT1A 1URQD 1L0LK 1LWUA 1GU4A 1AFOA 1FZGA 4W80A 1M1JC 1NTMK 1URQB 4JYCA 4C7RA 3HRNA 3BRVB 2P2UA 1GDTA 3A2AA 1JY3O 3RK2D 2HFED 1RE3C 3M06A 5BVZA 2O01H 1FBMA 4LC1A 3LIDA 5CCGA 2KOGA 1NHLA 3HUSA 1CI6A 3RK2B 2BASA 1X9VA 3MGNA 3H32B 2FXMA 1LTSC 2OYHB 3HE5B 1JOCA 4WY4C 5KJ7C 1SQBK 2J59M 2WPQA 1H8AA 3OA7A 3P32A 1J1DB 4Y99B 1KILD 3GHGA 3L35A 5AW5B 2C9LY 1NWQA 2XV5A 2ZXEB 1RF0C 4M3LA 1JTHB 5APVA 1ZN5A 2KB7P 1KILB 1H88A 4EIJA 1LTGC 1FZCB 1GZLA 1NTZK 2YKQA 2WT7A 2E43A 5APTA 4I2LC 1YYCA 1URQC 1L4AA 2IFNA 3NFQA 1FOSF 1T2KC 1J1EC 3BASA 4W7YA 3M9BA 1SP4A 1JMMA 5CMZA 3M0AA 1N7SD 2HPCA 2L5GB 2GUSA 1M7LA 3RK2C 1SQPK 1GL2A 3I5CA 2W27A 2N9BA 1FZAA 1G1IA 1J2JB 1N7SB 5CCHD 2OYHC 3V2QA 1FJKA 3HE4B 4N6JA 2R32A 2XZRA 3M91A 2O1JA 1J1DC 5AW2B 1MZ9A 1AQ5A 4Y99C 3HTKB 4C7NB 1GTWA 2O1KA 1RF1B 3VMXA 2POHA 1JY3P 2OYIB 3V2NA 2FFDA 1KILC 1SQVK 2W6BA 3BRTB 1FZCC 5AW8B 3SWYA 3KPEA 2A45G 1LTJC 1GW4A 2N1TD 2QM8A 1VDFA 4DOJA 5APSA 2HYNA 1CZQA 5AW4B 5AVTB 1A02J 2HODB 2WPSA 3WMM0 3M0DA 1VPCA 2R3CA 4I6MC 3LW5H 2P1JA 2Q9IA 5AVQB 2CPBA 1IFDA 4IFMA 3UIAA 4KHXA 1SQXK 3HD7D 4IFFA 1QL2A 3MTUE 3P8MC 1HBWA 5APYA 3V4QA 1H89A 3A7OA 3KDPB 1IFJA 3HD7B 3VN0A 2KSJA 4JF7A 1T2KD 2XDJA 5CCHC 1IFIA 1RF1C 5AW6B 1DX7A 2OYIC 2NPSD 3VTPC 1J1EB 3V2RA 2CPSA 3A5TA 1FZBA 1HJBA 2FYZA 3M9HA 1N7SA 1LT9C 1FAVA 1XTGB 2GUVA 3B5ND 3R2PA 2YKOA 2M3BA 2NPSB 1HTLC 3VOPA 3LIEA 2WWWA 1RE4C 2N1TC 3B5NB 3EQ2A 1HVVA 3CL3D 1DEBA 5AVWB 1M1JA 1SFCC 5APWA 5AVUB 4LGDE 2YO3A 3RL0C 1QL1A 5AW7B 4AUWA 1RE3A 4WB4A 1XTCC 1FZEA 2WSCH 3MUDA 3HD7C 2JEEA 1T3JA 2R5DA 1YTZI 5CHXA 1JY2P 1LTTC 1X79B 1GK4A 3NTNA 1ZR2A 1EQ7A 1GW3A 1LTBC 1LTJB 1RY3A 2KLVA 2M8RA 4WY4A 2R5BA 3B8EB 5KJ7A 1OWAA 3A3YB 2Q5UA 5AW0B 4AQRD 2NPSC 1JCDA 1SQQK 2P7JA 1RF0A 2IFMA 1G2CB 1YTZT 1PFIA 3IFMA 1KFNA 1KFMA 2IX7C 3B5NC 2WPRA 1NO4A 4HH2A 1N73C 2GM4A 2A45I 1WT6A 3P8CE 1URQA 3U59A 1IJDB 1ZR4A 1LWUB 2Z4EA 1HUCA 1E5WA 2Z5HA 3MIWA 1W2EA 4OH8B 1FU1A 3CLQA 2FYUK 3TK1A 5CCGD 3NMDA 1KQLA 3MD0A 4N78E 3BATA 3H32A 1LT9B 1ZV8A 4O9BA 1ZLLA 4ZKPA 1OXZA 3HE5A 2OYHA 1KZUB 3O8ZA 4XA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CI6 B;  2YNY A;  1CSB A;  3MGN A;  1T2K D;  3HE5 B;  5AW6 B;  1S9K E;  3VMY A;  2WPQ A;  5AVZ B;  4EOT A;  1H8A A;  3P32 A;  3VTP C;  4C46 A;  3L37 A;  1GD2 E;  1HJB A;  3A5T A;  5AVV B;  3L35 A;  2C9L Y;  5AW5 B;  3M9H A;  5APX A;  2ZFC A;  1NWQ A;  1DH3 A;  1FAV A;  2XV5 A;  2ZXE B;  4M3L A;  1GK6 A;  5APV A;  4GKG A;  2KP8 A;  3LIE A;  2P67 A;  2JJL A;  3VYI A;  1H88 A;  2WWW A;  1FOS E;  2QM7 A;  1GZL A;  2WT7 A;  2E43 A;  4DZO A;  5APT A;  5APQ A;  4I2L C;  5AVW B;  1YYC A;  3NFQ A;  3TYY A;  1FOS F;  1T2K C;  1JNM A;  5APW A;  2WT7 B;  5AVU B;  3T97 A;  3VMZ A;  2YO3 A;  5AVY B;  3M9B A;  1SP4 A;  4AYC A;  4B86 A;  2IPP A;  5CMZ A;  3M0A A;  5AW7 B;  5AW9 B;  4AUW A;  2XU6 A;  4HYT B;  2VRS A;  3I5C A;  1A02 F;  2W27 A;  2R5D A;  1HWT C;  3HE4 A;  2N9B A;  2H7H A;  1X8Y A;  1J2J B;  4XE5 B;  3IR9 A;  1GK4 A;  3NTN A;  3HE4 B;  2R32 A;  3HTK A;  4C7N A;  2XZR A;  3M91 A;  2R5B A;  1MUU A;  3B8E B;  5AW1 B;  5AW2 B;  1MFZ A;  2W6A A;  1OWA A;  1NAF A;  3OAK A;  2C9N Y;  4C7N B;  1GTW A;  1JUN A;  4RES B;  3A3Y B;  3VMX A;  2Q3I A;  1S9K D;  1MV8 A;  5AVX B;  2Q5U A;  5AW0 B;  4AQR D;  3TNU A;  3V4W A;  2P7J A;  1G2C B;  5AVS B;  3KQG A;  5AW8 B;  2WTY A;  3P7K A;  2WPR A;  3VN0 A;  2QM8 A;  1GU5 A;  4GT1 A;  5APS A;  1CZQ A;  5AW4 B;  5AVT B;  3V5B A;  1A02 J;  2WPS A;  2Z5I A;  1GU4 A;  3M0D A;  2YO2 A;  2R3C A;  4I6M C;  3NXS A;  4JYC A;  5AVQ B;  1HUC A;  2Z5H A;  2P2U A;  3SWF A;  3A2A A;  3UIA A;  3M06 A;  5AVR B;  4JYB A;  4KHX A;  3TK1 A;  3NMD A;  1KQL A;  4LC1 A;  3MD0 A;  3P8M C;  1HBW A;  3LID A;  3L36 A;  1CI6 A;  5APY A;  5APU A;  3V4Q A;  1H89 A;  3A7O A;  3KDP B;  3TNU B;  1OXZ A;  3HE5 A;  2E42 A;  2BAS A;  1SLQ A;  1IO4 A;  3O8Z A;  2Q7C A;  5AW3 B; 
#chains in the Genus database with same CATH topology
 3HUS B;  4JBZ A;  3QH9 A;  4IL6 H;  3SSU A;  1L0N G;  2BCC J;  4H0L D;  3RL0 D;  2N1T B;  3VMY A;  5AVZ B;  2FKW B;  4C46 A;  3M9Q A;  1DH3 A;  3PH0 A;  2WZ7 A;  3RL0 B;  2WIT A;  2YXR B;  1Q81 Q;  1YIT P;  4N78 D;  1HH0 A;  2K1A A;  2C0X A;  5KLV G;  1JO5 A;  1JNM A;  4R4L A;  3VMZ A;  1CW5 A;  4AYC A;  5E79 E;  1MKM A;  3PRJ A;  1N86 A;  4PV1 D;  2G3A A;  5CCG C;  2HPC B;  1RH5 B;  2Y0E A;  3LW5 J;  3RK3 D;  4PV1 B;  4C7N A;  3H1J J;  5AW1 B;  3H1H J;  3RK3 B;  3L73 G;  1BCC E;  3GHG C;  1Q86 Q;  3GF3 A;  2WTY A;  2J5U A;  1HGZ A;  4IFD K;  1EDI A;  2FFD B;  2HLO A;  2Y0D A;  1T8Z A;  1SFC A;  1L4A C;  5B66 E;  4DJG A;  3NXS A;  1K05 A;  1PGO A;  4JYB A;  1RQU A;  1L0N K;  1BCC D;  3HD7 A;  1ZOY C;  5APU A;  4WVZ A;  5L8R J;  1IO4 A;  2Q7C A;  2KSE A;  2H43 A;  2ZYD A;  5KLV K;  3AE2 C;  1NGM B;  2IBZ E;  3C9I A;  1N73 A;  1PGQ A;  2ZVN B;  2BEZ F;  1SQB G;  5BU5 A;  3Q3D A;  2AEM A;  2FYU E;  1JY2 N;  1FJP A;  3AE7 C;  2AXT E;  3R4Y A;  1SQV E;  2K9Y A;  1JY2 O;  1TU3 F;  1HWT C;  2IBZ D;  1T3U A;  4WY4 D;  2DW3 A;  1MUU A;  4N3Y B;  3OAK A;  4WY4 B;  1S9K D;  1OW6 A;  5CBO A;  2KS1 B;  3CC7 P;  3B71 A;  1U7J A;  3RBZ A;  1SQV D;  1Y47 A;  1VQN P;  3A0B E;  3D71 A;  1L0L K;  1LWU A;  2IZ1 A;  1GU4 A;  1M1J C;  4QMA A;  3PJS K;  4Y28 J;  1JY3 O;  4IOI H;  3WUV A;  2HFE D;  1K73 Q;  5BVZ A;  1CI6 A;  5GTI H;  4K35 A;  3FXE A;  1S72 P;  3H32 B;  3CME P;  3HE5 B;  2E5Y A;  2ZYA A;  1SQB K;  1PIX A;  2WPQ A;  5E79 H;  3AED C;  3AE6 C;  3ZDM A;  3KZI E;  4YXW H;  2ZXE B;  3L75 E;  4EI2 A;  1JTH B;  1ZN5 A;  4EIJ A;  1AJY A;  2B9B A;  3CXH E;  2YKQ A;  2WT7 A;  4DT0 A;  1EZV E;  2IFN A;  3M9B A;  1SQQ E;  3EFF K;  3JCU E;  1BGY J;  1M7L A;  1ZRT E;  2N9B A;  2FYN C;  3L75 D;  1EXJ A;  3V2Q A;  3HE4 B;  5B66 H;  3CXH D;  1J1D C;  1AQ5 A;  1K8A Q;  3AEF C;  1EZV D;  4Y99 C;  2O1K A;  1RF1 B;  3GG2 A;  2WVR A;  2OYI B;  2OQQ A;  3D6Y A;  1SQQ D;  1FZC C;  3KPE A;  1M56 D;  1LTJ C;  2QM8 A;  5H2F E;  2HYN A;  2AEF A;  2D2C D;  1BCC J;  4HB1 A;  1A02 J;  3RL0 g;  2HOD B;  1BE3 D;  3M0D A;  2RMZ A;  1BSN A;  2BEQ D;  1PP9 D;  2D2C B;  5K5G B;  3UIA A;  4KHX A;  4IFF A;  2YIU B;  1IFP A;  1LP1 B;  3CCJ P;  2XDJ A;  5CCH C;  4D6T G;  1IFI A;  2H88 C;  1HJ0 A;  3H1L G;  1DX7 A;  2V7Q H;  2WSF J;  2AXT H;  1VQ6 P;  1HJB A;  1VQ9 P;  1K9M Q;  3M9H A;  4KJM A;  1N7S A;  1LT9 C;  1FAV A;  2GUV A;  3B5N D;  1PPJ G;  2YKO A;  1HTL C;  3LIE A;  1FS0 E;  3B5N B;  1KQF B;  1NTM E;  2G8Y A;  5AVU B;  1QL1 A;  2P10 A;  2MKV A;  1RE3 A;  3T97 B;  1XTC C;  2IDB A;  1JMB A;  1KQS O;  3L70 G;  4Z1M H;  3MUD A;  3A0B H;  1VQ7 P;  2JEE A;  1T3J A;  2R5D A;  3AEG C;  2V7Q J;  1GK4 A;  1EQ7 A;  1LTJ B;  2M8R A;  2ZYG A;  1SQV J;  4U3F J;  2W90 A;  5GTH H;  3L74 G;  3A3Y B;  2NPS C;  1L0N E;  4PJ0 E;  2ZAE B;  1KFN A;  3CXH I;  1S1C X;  2GM4 A;  1EZV I;  2A45 I;  1WT6 A;  1IJD B;  2QVA A;  2Z4E A;  3CCS P;  2Z5H A;  2E74 C;  3KZI H;  5KLV E;  1W2E A;  2FYU K;  3TK1 A;  1PGJ A;  2PGD A;  3MD0 A;  1M8O B;  1L0N D;  3CXH H;  1LT9 B;  4ZKP A;  1ZLL A;  3O8Z A;  3ABV C;  1Z56 A;  4U7J A;  3TGU G;  2I1J A;  2IZ0 A;  4GDO A;  3JCU H;  1NTZ G;  2OGU A;  3CI9 A;  1KIL A;  3GW6 A;  5KLV D;  1GK6 A;  2QJY C;  2YMK A;  1OFC X;  4GKG A;  3L73 E;  2KNC B;  2QE7 H;  1H0T A;  2P67 A;  5C39 A;  2FY8 A;  3KXD A;  4BWN A;  3L75 J;  1SQP G;  1KV4 A;  5BU8 B;  4L74 A;  2PP6 A;  5AVY B;  4JPZ B;  2XU6 A;  2V4H A;  1GL2 D;  2J58 A;  3Q5P A;  4ZNC A;  5H2F H;  3HUS C;  2XNX A;  4BRY A;  3G4S P;  2KUB A;  1FZF A;  3IR9 A;  1GL2 B;  2ZXX A;  1SQQ J;  3AE9 C;  3HTK A;  1KMI Z;  2W6A A;  1VF5 C;  4H0L C;  1BE3 J;  3V4W A;  3H1I G;  1IZN B;  1QEX A;  1PP9 J;  1WRG A;  5TIS E;  3KQG A;  1VQK P;  1RE4 A;  2N1T A;  3V5B A;  2YO2 A;  1L0L D;  1SQB E;  1YI2 P;  2YXQ B;  5AVR B;  3AE1 C;  3N7N A;  4LLH A;  2KIK A;  3Q5S A;  1FDM A;  4PV1 C;  2QJY B;  3IF4 A;  1EDK A;  1SQX J;  2OTL P;  2W8Z A;  3RK3 C;  2I1K A;  2YMY A;  1SQB D;  3O6Q A;  2LR2 A;  4OWF A;  4NPF X;  2FFD C;  1NH4 A;  2LKM A;  2JJL A;  3VYI A;  3V2P A;  3AE4 C;  4DZO A;  3TYY A;  3FX0 A;  1VF5 D;  4YPC A;  1KTM A;  2JWA A;  1VF5 B;  4H0L B;  3BCC G;  3VMA A;  2MJZ A;  2M5A B;  5KJ7 D;  2HG5 D;  3VP9 A;  1MFZ A;  2M3E A;  2H8P D;  4RES B;  3H1H G;  2OTJ P;  2KZJ A;  4PD4 E;  1KYO E;  3P7K A;  1LGH B;  1NKZ B;  1OMI A;  1URQ D;  2JWD A;  1AFO A;  1L0N J;  2JP3 A;  1BDD A;  3L72 J;  4W80 A;  1EC5 A;  1NTM K;  1URQ B;  3GLM A;  3HRN A;  3BRV B;  1GDT A;  2HR3 A;  3M06 A;  2M0B A;  4PD4 D;  5CCG A;  1NHL A;  3Q2Y A;  1YIJ P;  3JSV C;  5B5E E;  2FXM A;  1LTS C;  2OYH B;  4OVN F;  1DEE G;  4WY4 C;  3L71 J;  3JC2 2;  2J59 M;  1S5L X;  3P32 A;  3WUU A;  3GHG A;  3L35 A;  1NWQ A;  1RF0 C;  5APV A;  1KC8 Q;  1GZL A;  1P84 E;  3KHU A;  1U7M A;  1FDO A;  4I2L C;  1L4A A;  3G71 P;  1FOS F;  1SP4 A;  1JMM A;  3M0A A;  5TIS H;  2GUS A;  2K9J A;  3I5C A;  1FZA A;  1J2J B;  3CC4 P;  1FJK A;  2QJP C;  5AW2 B;  4UB6 E;  1Q2N A;  1L2P A;  4C7N B;  4D6T E;  3VMX A;  2POH A;  1L0L J;  1S4X A;  3V2N A;  3H1L E;  2W6B A;  3SWY A;  2B87 A;  5APS A;  1DD3 A;  1PPJ E;  3H1K J;  2WPS A;  1W2B O;  3WMM 0;  4L75 A;  4ZMD A;  3TF5 A;  2OYO A;  4WWI A;  3S9O A;  1IFD A;  4IFM A;  4H44 D;  3CX5 E;  3HD7 D;  1KB9 E;  4D6T D;  1QGK B;  3MTU E;  2FYU D;  1HBW A;  3H1L D;  3A7O A;  4H44 B;  1IFJ A;  1PZQ A;  2AXC A;  3HD7 B;  2IYO A;  3VN0 A;  3L70 E;  1MFT A;  3CWB J;  3ITK A;  1RF1 C;  1PPJ D;  1OW7 A;  2OYI C;  4PD4 I;  2CPS A;  2FYZ A;  1Y9B A;  1FDI A;  3F89 A;  1KYO I;  1YBK A;  2M3B A;  3CX5 D;  3L74 E;  3RBX A;  2WWW A;  5AVW B;  1M1J A;  2D2C C;  1EDL A;  5APW A;  4OGQ D;  4PD4 H;  1DD4 A;  2QJP B;  1KYO H;  1FZE A;  2YIU C;  4OGQ B;  1BGY G;  1NU1 G;  1LTT C;  3GMA A;  1X79 B;  3L74 D;  1ZR2 A;  1LTB C;  2N9Y B;  1OWA A;  3TGU E;  2Q5U A;  5M1B A;  3IFM A;  1KFM A;  3B5N C;  1UII A;  1NTZ E;  1P84 I;  1S2E A;  3P8C E;  2LXC B;  2KI7 B;  3S1K A;  3H25 A;  1LWU B;  1FU1 A;  3CLQ A;  2RH0 A;  1KQL A;  2QEX P;  1S5L E;  1ZV8 A;  4O9B A;  1OXZ A;  2B88 A;  1ZRT D;  1CI6 B;  1FE6 A;  2AEJ A;  3KYQ A;  3P8C D;  1G1J A;  1SVF A;  3EFG A;  4JQ0 D;  1YJ9 P;  5APX A;  2WSS H;  1NJI Q;  1W5C E;  2YKP A;  1FZC A;  1PGP A;  4KT0 J;  1LTJ A;  1IFM A;  1FOS E;  3H1I E;  3PP5 A;  3A0H E;  2ZVO B;  1K04 A;  4UB8 E;  4UB6 H;  1NU1 K;  2JR8 A;  2WT7 B;  4K3A A;  1JCC A;  2IPP A;  3CX5 I;  5AW9 B;  1NTK G;  1KB9 I;  1AVO A;  3CCV P;  2H7H A;  3WU2 E;  5CCH A;  1ZME C;  3H1I D;  1SQV G;  4U3F G;  1NAF A;  3CX5 H;  2Q3I A;  5AVX B;  1LT9 A;  1OIP A;  2KYV A;  1Q82 Q;  3SWK A;  5AVS B;  4ASV A;  1IK9 A;  4BXL A;  1PL5 A;  2RKL A;  3FGA D;  1GU5 A;  1M57 D;  4TT3 H;  2R3S A;  2FYU J;  5DJU B;  3U1A A;  3MZW B;  2Z5I A;  3CCM P;  3H1L J;  2LXB A;  3D6Z A;  4H13 D;  3SWF A;  1OVU A;  1NTM D;  2KNC A;  1IC2 A;  4H13 B;  1GL2 C;  3L36 A;  4W7Z A;  3TNU B;  1SLQ A;  2YNY A;  1PV3 A;  1CSB A;  3BCC E;  1D7M A;  1LTA C;  2SPZ A;  1JB0 J;  3I56 P;  4WBA A;  2NPS A;  5AVV B;  1M90 Q;  5KTB A;  4GOE A;  1EDJ A;  3K5B A;  3H1H E;  1NTK K;  3TDK A;  3G9R A;  3PHL A;  2A45 H;  5APQ A;  3BCC D;  1NVO A;  3L74 J;  1QVG O;  2O01 N;  2OAR A;  4DCK A;  1HGV A;  4HYT B;  2VRS A;  1A02 F;  4XE5 B;  1JEK A;  3SFD C;  2W83 C;  2P58 A;  2L91 A;  1S3J A;  1G2C A;  2K3R A;  1BE3 G;  1USE A;  3GF7 A;  3L4F A;  4L73 A;  1PP9 G;  3TSI A;  4HKZ H;  3PTZ A;  2CK3 H;  3Q1M A;  3L73 D;  2E76 C;  1KOR A;  2WMM A;  5KAF E;  1QX8 A;  2JKV A;  1KIL E;  2P2U A;  3AE8 C;  3RK2 D;  3S4R A;  4TLF A;  2O01 H;  3LID A;  1YQ3 C;  2KOG A;  3HUS A;  2KK7 A;  3RK2 B;  1X9V A;  2ITA A;  1VQ4 P;  4UB8 H;  1SQX G;  5KJ7 C;  1HF9 A;  3OA7 A;  2K37 A;  1KIL D;  1OX3 A;  2QG4 A;  5AW5 B;  1BSH A;  2QJK B;  1AVY A;  5KAI E;  1KIL B;  1H88 A;  3E7K A;  1NTZ K;  2E43 A;  1YYC A;  1URQ C;  1H0T B;  3OW2 O;  2O01 J;  2Q6Q A;  3BAS A;  2Y9Y A;  5DJT B;  2BCC G;  4RO0 A;  3H1I J;  2HPC A;  2L5G B;  1SQP K;  2W27 A;  2A06 G;  1G1I A;  2OYH C;  2E76 D;  2QRX A;  2PRR A;  2R32 A;  2XZR A;  4EDF A;  1MZ9 A;  2RN0 A;  3HTK B;  2E76 B;  2WPV B;  1JY3 P;  1VQ5 P;  2K88 A;  2ZT9 D;  4PJ0 H;  2FFD A;  3BRT B;  2O3J A;  1NTM J;  1VQM P;  2N1T D;  1CZQ A;  2ZT9 B;  1BDC A;  1OVV A;  1U57 A;  2H89 C;  3H1J G;  3L72 G;  3LW5 H;  3CMA P;  2Q9I A;  3MP7 B;  5AVQ B;  2CPB A;  3G6E P;  3AEC C;  3CCR P;  1SQX K;  3EWK A;  1QL2 A;  1USD A;  3RK3 E;  3V4Q A;  1H89 A;  3E1R A;  3AEE C;  5GTI E;  1OVR A;  1BGY E;  1GMJ A;  1NU1 E;  2QIW A;  3L71 G;  4ASW A;  3VTP C;  3V2R A;  3A5T A;  1FZB A;  2JDI H;  3BCC J;  1XTG B;  3C8V A;  2NRG A;  3O6Q B;  3VOP A;  1IK7 A;  1KYO D;  5KLV J;  3CL3 D;  2KZI A;  1SFC C;  1BGY D;  2YO3 A;  1VL2 A;  1NU1 D;  1QVF O;  1FC2 C;  5AW7 B;  2Y9Z A;  2Y0C A;  5EFW B;  2WSC H;  4H44 C;  3HD7 C;  1YTZ I;  5CHX A;  4GOD A;  1T6A A;  3D70 A;  5KAF H;  1SS1 A;  1GW3 A;  2PFX A;  1RY3 A;  4WY4 A;  2KS1 A;  3L73 J;  5AW0 B;  2P7J A;  1L0L G;  1RF0 A;  2IFM A;  1YTZ T;  1PFI A;  2WPR A;  3RGU A;  4HH2 A;  1N73 C;  1Q90 D;  3WUT A;  1E79 H;  3H1K G;  1NAY A;  3U59 A;  1P84 D;  2WSC J;  2FXP A;  1HUC A;  1E5W A;  3MIW A;  4OGQ C;  4OH8 B;  5CCG D;  3CCQ P;  5KAI H;  1NTK E;  3H32 A;  4RJT A;  3HE5 A;  3CPW O;  2WSE H;  1SFC D;  1YJW P;  3CWB G;  3CC2 P;  1S9K E;  4EOT A;  1SFC B;  1JTH A;  2ZFC A;  3USS A;  4U3F E;  3G3Z A;  3OJA B;  3GHG B;  1SQB J;  1N2D C;  3CCU P;  2QM7 A;  2Q1K A;  1LT1 A;  1L4A D;  1NTK D;  1LWU C;  5TJH A;  3PLN A;  4RKU J;  1L4A B;  1N7L A;  4B86 A;  3FWL A;  1LNQ A;  3B4S A;  2WSE J;  4NPE A;  3HE4 A;  1X8Y A;  4U3F D;  1KB9 D;  2K9J B;  3FWN A;  2XKM A;  1KD1 Q;  4IL6 X;  1JY3 N;  1N73 B;  1RF1 A;  3W68 A;  3L70 D;  1RQV A;  5CJ4 A;  2OYI A;  1JUN A;  5GTH E;  1NOH A;  1ZXG A;  1VQL P;  2HOD A;  2I8D A;  1DIP A;  3VP8 A;  2B87 B;  5KLI C;  1OW8 A;  4A7P A;  1KQG B;  1LP1 A;  1IFN A;  2E42 A;  3I55 P;  5AW3 B;  5B5E H;  3FXD A;  2QA4 P;  1BCC G;  3E1I A;  5CJ0 A;  3U1C A;  3IN6 A;  1N8R Q;  3L37 A;  1GD2 E;  4YTP C;  3II6 A;  4ZKU A;  1NU1 J;  1SQP E;  3TGU D;  3B5N A;  1BE3 E;  2KP8 A;  1P84 H;  2PAJ A;  4I1L A;  1PP9 E;  1NTZ D;  3M0D C;  1VQ8 P;  4GIF A;  3T97 A;  1M1J B;  4H13 C;  1WMK A;  2IBZ I;  3H6P A;  2WSF H;  4MN4 C;  5KKZ C;  1SQP D;  3N4X A;  2C0W A;  3SFE C;  2IBZ G;  2C9N Y;  2QSI A;  3BVH A;  4I7Z C;  5KLI B;  1MV8 A;  1SQX E;  3TNU A;  1NKN A;  1N7S C;  1LTI C;  4EYY Q;  1JM0 A;  4GT1 A;  2FYU G;  1FZG A;  1YQ4 C;  4XFJ A;  4C7R A;  4JYC A;  3A2A A;  3AE5 C;  1RE3 C;  1KB9 H;  1FBM A;  4LC1 A;  1SQX D;  2BCC E;  3MUD C;  3CD6 P;  1NYH A;  2BAS A;  4D6T J;  2FYN B;  3MGN A;  2B89 A;  2A06 E;  1JOC A;  4YXD C;  1NTK J;  1H8A A;  1J1D B;  4Y99 B;  2C9L Y;  3AE3 C;  2XV5 A;  2E5T A;  4M3L A;  1AA0 A;  2KB7 P;  1LTG C;  2BCC D;  1FZC B;  3QWO C;  5APT A;  5KKZ B;  3NFQ A;  1T2K C;  1J1E C;  2A06 D;  4W7Y A;  4IL6 E;  5CMZ A;  1N7S D;  3L70 J;  3H1J E;  3L72 E;  3RK2 C;  1GL2 A;  3CCE P;  4I7Z B;  1R8E A;  3CCL P;  1N7S B;  1YJN P;  5CCH D;  4N6J A;  3M91 A;  3AEA C;  2O1J A;  2Q3E A;  3L75 G;  1GTW A;  3MHV A;  2KLU A;  2QJK C;  2E75 C;  1UIX A;  1KIL C;  1SQV K;  3L71 E;  5AW8 B;  1EZV G;  2A45 G;  3H1J D;  3L72 D;  1GW4 A;  1VDF A;  4DOJ A;  3H1H D;  5AW4 B;  5AVT B;  2OTK E;  1VPC A;  1SQQ G;  1M1K Q;  2R3C A;  4I6M C;  2P1J A;  1KN7 A;  3AEB C;  1S5L H;  2FBW C;  3P8M C;  5APY A;  3KDP B;  3F5H A;  3L71 D;  2XND H;  1LJ2 A;  1YHQ P;  3TGU J;  2KSJ A;  4JF7 A;  1T2K D;  1VQO P;  5AW6 B;  2NPS D;  4R4M A;  1NTZ J;  1J1E B;  2W6J H;  3R2P A;  4HJG H;  1VQP P;  2NPS B;  2ZT9 C;  3IAO A;  1Y8A A;  5CBN A;  2NZ2 A;  1L0L E;  1AQT A;  1RE4 C;  2N1T C;  3A0H H;  3EQ2 A;  2GA1 A;  1HVV A;  1DEB A;  1SQP J;  2E74 D;  1R5S A;  4LGD E;  3RL0 C;  4GOF A;  2E75 D;  1AV1 A;  2R44 A;  3H1K E;  4AUW A;  4WB4 A;  3C1L A;  3Q5R A;  4CPG A;  2E74 B;  1ZP0 C;  2M5A A;  1QLE D;  2E75 B;  1OZH A;  1JY2 P;  4NPD A;  3WU2 H;  3NTN A;  2KLV A;  3W67 A;  2JO1 A;  2R5B A;  3B8E B;  5KJ7 A;  1ZW0 A;  2IYP A;  1RHZ B;  4AQR D;  3CWB E;  1JCD A;  1SQQ K;  3V6I A;  3H1K D;  1G2C B;  1X0T A;  4L76 A;  2IX7 C;  1NO4 A;  1NTM G;  1URQ A;  1R5L A;  4BRY B;  2WQY C;  1EXI A;  1ZR4 A;  2UWJ E;  1X22 A;  3NMD A;  2ZJS E;  2KXP B;  3CWB D;  4N78 E;  3BAT A;  1Q7Y Q;  2OYH A;  1KZU B;  2FXO A;  4XA4 A; 
#chains in the Genus database with same CATH homology
 2WSE H;  1SFC D;  1CI6 B;  3HUS B;  1Z56 A;  3KYQ A;  1S9K E;  3P8C D;  1G1J A;  2I1J A;  2N1T B;  3RL0 D;  3VMY A;  1SVF A;  5AVZ B;  4EOT A;  2FKW B;  3EFG A;  1SFC B;  4C46 A;  1JTH A;  3M9Q A;  5APX A;  3CI9 A;  2ZFC A;  1DH3 A;  2WZ7 A;  1KIL A;  2YKP A;  3RL0 B;  1GK6 A;  1FZC A;  2WIT A;  3G3Z A;  3OJA B;  3GHG B;  1LTJ A;  4GKG A;  2P67 A;  1N2D C;  1IFM A;  4N78 D;  3PP5 A;  2QM7 A;  1FOS E;  1HH0 A;  1L4A D;  2C0X A;  1LWU C;  1JO5 A;  1JNM A;  1NU1 K;  2WT7 B;  5BU8 B;  3VMZ A;  1JCC A;  1CW5 A;  2PP6 A;  5AVY B;  1L4A B;  1N7L A;  4AYC A;  4B86 A;  2IPP A;  5AW9 B;  2XU6 A;  1N86 A;  1GL2 D;  2J58 A;  5CCG C;  2HPC B;  3HE4 A;  2H7H A;  3HUS C;  1X8Y A;  2XNX A;  1FZF A;  2XKM A;  3IR9 A;  1GL2 B;  3RK3 D;  5CCH A;  3HTK A;  1JY3 N;  4C7N A;  1N73 B;  1RF1 A;  5AW1 B;  2W6A A;  5CJ4 A;  2OYI A;  1NAF A;  1JUN A;  3RK3 B;  2Q3I A;  5AVX B;  1NOH A;  1LT9 A;  3GHG C;  3V4W A;  2KYV A;  1WRG A;  5AVS B;  3KQG A;  2WTY A;  1IK9 A;  2HOD A;  1HGZ A;  4IFD K;  1GU5 A;  2FFD B;  1RE4 A;  2N1T A;  2HLO A;  3U1A A;  3V5B A;  2Z5I A;  1T8Z A;  3VP8 A;  1SFC A;  1L4A C;  2YO2 A;  3NXS A;  3SWF A;  5AVR B;  4JYB A;  1L0N K;  3N7N A;  1IC2 A;  4LLH A;  3HD7 A;  1GL2 C;  1IFN A;  3L36 A;  1FDM A;  5APU A;  4W7Z A;  3TNU B;  2E42 A;  1IO4 A;  1SLQ A;  2Q7C A;  5AW3 B;  2YNY A;  1CSB A;  3E1I A;  2H43 A;  3RK3 C;  5CJ0 A;  2I1K A;  3U1C A;  1LTA C;  2YMY A;  3L37 A;  1GD2 E;  4WBA A;  2NPS A;  5AVV B;  5KLV K;  3II6 A;  5KTB A;  4ZKU A;  3C9I A;  2FFD C;  1NH4 A;  3B5N A;  1N73 A;  2KP8 A;  1NTK K;  2LKM A;  2JJL A;  3VYI A;  3V2P A;  2PAJ A;  4DZO A;  2A45 H;  4I1L A;  5APQ A;  3TYY A;  3M0D C;  4GIF A;  3T97 A;  5BU5 A;  1M1J B;  2OAR A;  1JY2 N;  1FJP A;  3H6P A;  1HGV A;  4HYT B;  2VRS A;  2WSF H;  1A02 F;  1JY2 O;  1HWT C;  2MJZ A;  4XE5 B;  3N4X A;  1T3U A;  4WY4 D;  2C0W A;  5KJ7 D;  2HG5 D;  1MUU A;  4N3Y B;  3VP9 A;  1MFZ A;  3OAK A;  2H8P D;  2C9N Y;  4WY4 B;  4RES B;  1G2C A;  3BVH A;  1S9K D;  1MV8 A;  3TNU A;  1NKN A;  1N7S C;  1LTI C;  3L4F A;  3P7K A;  1LGH B;  1NKZ B;  3TSI A;  4GT1 A;  1URQ D;  1L0L K;  1LWU A;  1GU4 A;  1AFO A;  1FZG A;  4W80 A;  1M1J C;  1NTM K;  1URQ B;  4JYC A;  4C7R A;  3HRN A;  3BRV B;  2P2U A;  1GDT A;  3A2A A;  1JY3 O;  3RK2 D;  2HFE D;  1RE3 C;  3M06 A;  5BVZ A;  2O01 H;  1FBM A;  4LC1 A;  3LID A;  5CCG A;  2KOG A;  1NHL A;  3HUS A;  1CI6 A;  3RK2 B;  2BAS A;  1X9V A;  3MGN A;  3H32 B;  2FXM A;  1LTS C;  2OYH B;  3HE5 B;  1JOC A;  4WY4 C;  5KJ7 C;  1SQB K;  2J59 M;  2WPQ A;  1H8A A;  3OA7 A;  3P32 A;  1J1D B;  4Y99 B;  1KIL D;  3GHG A;  3L35 A;  5AW5 B;  2C9L Y;  1NWQ A;  2XV5 A;  2ZXE B;  1RF0 C;  4M3L A;  1JTH B;  5APV A;  1ZN5 A;  2KB7 P;  1KIL B;  1H88 A;  4EIJ A;  1LTG C;  1FZC B;  1GZL A;  1NTZ K;  2YKQ A;  2WT7 A;  2E43 A;  5APT A;  4I2L C;  1YYC A;  1URQ C;  1L4A A;  2IFN A;  3NFQ A;  1FOS F;  1T2K C;  1J1E C;  3BAS A;  4W7Y A;  3M9B A;  1SP4 A;  1JMM A;  5CMZ A;  3M0A A;  1N7S D;  2HPC A;  2L5G B;  2GUS A;  1M7L A;  3RK2 C;  1SQP K;  1GL2 A;  3I5C A;  2W27 A;  2N9B A;  1FZA A;  1G1I A;  1J2J B;  1N7S B;  5CCH D;  2OYH C;  3V2Q A;  1FJK A;  3HE4 B;  4N6J A;  2R32 A;  2XZR A;  3M91 A;  2O1J A;  1J1D C;  5AW2 B;  1MZ9 A;  1AQ5 A;  4Y99 C;  3HTK B;  4C7N B;  1GTW A;  2O1K A;  1RF1 B;  3VMX A;  2POH A;  1JY3 P;  2OYI B;  3V2N A;  2FFD A;  1KIL C;  1SQV K;  2W6B A;  3BRT B;  1FZC C;  5AW8 B;  3SWY A;  3KPE A;  2A45 G;  1LTJ C;  1GW4 A;  2N1T D;  2QM8 A;  1VDF A;  4DOJ A;  5APS A;  2HYN A;  1CZQ A;  5AW4 B;  5AVT B;  1A02 J;  2HOD B;  2WPS A;  3WMM 0;  3M0D A;  1VPC A;  2R3C A;  4I6M C;  3LW5 H;  2P1J A;  2Q9I A;  5AVQ B;  2CPB A;  1IFD A;  4IFM A;  3UIA A;  4KHX A;  1SQX K;  3HD7 D;  4IFF A;  1QL2 A;  3MTU E;  3P8M C;  1HBW A;  5APY A;  3V4Q A;  1H89 A;  3A7O A;  3KDP B;  1IFJ A;  3HD7 B;  3VN0 A;  2KSJ A;  4JF7 A;  1T2K D;  2XDJ A;  5CCH C;  1IFI A;  1RF1 C;  5AW6 B;  1DX7 A;  2OYI C;  2NPS D;  3VTP C;  1J1E B;  3V2R A;  2CPS A;  3A5T A;  1FZB A;  1HJB A;  2FYZ A;  3M9H A;  1N7S A;  1LT9 C;  1FAV A;  1XTG B;  2GUV A;  3B5N D;  3R2P A;  2YKO A;  2M3B A;  2NPS B;  1HTL C;  3VOP A;  3LIE A;  2WWW A;  1RE4 C;  2N1T C;  3B5N B;  3EQ2 A;  1HVV A;  3CL3 D;  1DEB A;  5AVW B;  1M1J A;  1SFC C;  5APW A;  5AVU B;  4LGD E;  2YO3 A;  3RL0 C;  1QL1 A;  5AW7 B;  4AUW A;  1RE3 A;  4WB4 A;  1XTC C;  1FZE A;  2WSC H;  3MUD A;  3HD7 C;  2JEE A;  1T3J A;  2R5D A;  1YTZ I;  5CHX A;  1JY2 P;  1LTT C;  1X79 B;  1GK4 A;  3NTN A;  1ZR2 A;  1EQ7 A;  1GW3 A;  1LTB C;  1LTJ B;  1RY3 A;  2KLV A;  2M8R A;  4WY4 A;  2R5B A;  3B8E B;  5KJ7 A;  1OWA A;  3A3Y B;  2Q5U A;  5AW0 B;  4AQR D;  2NPS C;  1JCD A;  1SQQ K;  2P7J A;  1RF0 A;  2IFM A;  1G2C B;  1YTZ T;  1PFI A;  3IFM A;  1KFN A;  1KFM A;  2IX7 C;  3B5N C;  2WPR A;  1NO4 A;  4HH2 A;  1N73 C;  2GM4 A;  2A45 I;  1WT6 A;  3P8C E;  1URQ A;  3U59 A;  1IJD B;  1ZR4 A;  1LWU B;  2Z4E A;  1HUC A;  1E5W A;  2Z5H A;  3MIW A;  1W2E A;  4OH8 B;  1FU1 A;  3CLQ A;  2FYU K;  3TK1 A;  5CCG D;  3NMD A;  1KQL A;  3MD0 A;  4N78 E;  3BAT A;  3H32 A;  1LT9 B;  1ZV8 A;  4O9B A;  1ZLL A;  4ZKP A;  1OXZ A;  3HE5 A;  2OYH A;  1KZU B;  3O8Z A;  4XA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...