1GU5A

Crystal structure of c/ebpbeta bzip homodimer bound to a dna fragment from the mim-1 promoter
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
65
structure length
65
Chain Sequence
DKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CAAT/ENHANCER BINDING PROTEIN BETA
publication title Structural Basis for Flexible Base Recognition by C/Ebpbeta
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 29
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gu5A00
1J2JB 2N9BA 2WTYA 2QM8A 3A2AA 2P67A 2Z5IA 3A7OA 3L37A 3M9HA 5APSA 1GK4A 3IR9A 1SLQA 3I5CA 4B86A 1GU5A 2WPQA 3SWFA 1FOSF 4I6MC 5AW4B 1FOSE 2P2UA 1JUNA 2WWWA 2W27A 5CMZA 2ZFCA 3LIDA 1OXZA 2Q5UA 2YO3A 5APQA 5APUA 4AQRD 4KHXA 1S9KE 4M3LA 2Q7CA 2E42A 1KQLA 5AVRB 3MD0A 1DH3A 4C46A 4EOTA 2R32A 1H89A 3M0AA 2YNYA 3V4WA 1A02J 1GTWA 1S9KD 2WT7A 3B8EB 1HBWA 2H7HA 3KQGA 3NMDA 3M9BA 5AW6B 4AYCA 3M0DA 5APYA 2ZXEB 3NFQA 1X8YA 3T97A 2WT7B 3VMXA 2WPSA 4HYTB 3HTKA 1SP4A 4DZOA 3M06A 5AVZB 5AW5B 4C7NA 1IO4A 1NAFA 2XV5A 2P7JA 4GT1A 1CI6A 1A02F 1GD2E 3TYYA 1GK6A 3HE4A 5AVTB 3VMZA 2E43A 2XU6A 5AW0B 5AW3B 3O8ZA 2IPPA 4C7NB 2Q3IA 3VTPC 3A3YB 3HE5A 2R3CA 3HE4B 1MUUA 3V5BA 1HUCA 3V4QA 1MFZA 3KDPB 1CZQA 3TNUA 1H88A 4LC1A 5APTA 1YYCA 3P8MC 2R5BA 3HE5B 5APXA 2YO2A 3VMYA 3L36A 1H8AA 2KP8A 5AVQB 2BASA 5AW1B 2JJLA 1HJBA 3VYIA 3NXSA 3TNUB 1T2KD 4XE5B 5AVUB 3A5TA 3P32A 5AW8B 2Z5HA 1GZLA 5AW2B 1JNMA 1CSBA 5AVVB 5AW9B 5AW7B 3NTNA 1NWQA 2QM7A 2C9NY 2C9LY 1CI6B 3L35A 3MGNA 5APVA 1HWTC 3UIAA 4AUWA 5AVXB 1T2KC 4GKGA 3M91A 5AVWB 4RESB 3OAKA 2W6AA 2XZRA 4I2LC 4JYBA 3TK1A 5AVSB 1G2CB 4JYCA 5AVYB 2WPRA 5APWA 2R5DA 3VN0A 3LIEA 3P7KA 2VRSA 1GU4A 1OWAA 1MV8A 1FAVA
chains in the Genus database with same CATH superfamily
1FZEA 2IFNA 3JC22 1LT9B 3V2NA 1SVFA 1KC8Q 3B5ND 1NOHA 1M57D 1QVFO 1PGPA 3H1IG 2KOGA 5APUA 3U59A 3L70J 3MUDC 5H2FE 1RE4C 1PPJE 2K1AA 1FZAA 2WSCH 1M90Q 3L75G 3LW5H 3GW6A 3HD7B 5APYA 4N6JA 1PIXA 1UIXA 5AVZB 2PGDA 1IFNA 1SS1A 5KAFH 2XV5A 4D6TJ 4WY4B 2JEEA 5AW0B 1L4AD 2E5TA 4U3FE 1DD3A 4HH2A 4C7RA 3HRNA 4XA4A 1KTMA 2FYUK 3AE4C 1OVRA 3N4XA 5E79E 3A5TA 3L75D 1N8RQ 2W83C 3FGAD 5KLVE 2V7QH 3H1LE 1NVOA 3V2QA 2JWAA 4AUWA 2QJYC 1T2KC 1LTIC 4JYBA 3D6ZA 1KQGB 1LTBC 3PRJA 3ABVC 1S2EA 5GTHH 1VDFA 1GL2A 2O01H 1GK4A 3AEAC 5BU8B 5C39A 5KLIC 3MD0A 2FYNB 1VF5B 2R32A 4ASVA 3V4WA 3CCSP 3MUDA 3L71G 2KXPB 3NMDA 2E74D 4I7ZB 5AW6B 3B71A 4A7PA 3FWNA 5M1BA 2E76D 2QIWA 3G71P 3T97A 2Z4EA 3E1RA 1NHLA 4UB6E 1KB9H 1CI6A 2FKWB 3PP5A 1SQPJ 2QJKC 3AE1C 3KDPB 1H88A 4LC1A 2I1KA 5APTA 2IDBA 2KP8A 1FZCC 1OMIA 4JPZB 1L4AC 3RK3E 4H13C 1HGZA 2UWJE 5KTBA 4R4LA 1ZR2A 4Y99C 3M91A 2JKVA 1NH4A 1SQXE 2IZ1A 3BRTB 3RBXA 2C0WA 2KB7P 3Q3DA 1NKNA 1E79H 5APSA 2QG4A 1ZR4A 1S5LE 4IFFA 1TU3F 3L74E 2P10A 2P2UA 1GL2B 3IAOA 1QVGO 2P58A 2FYUJ 2Q7CA 3PHLA 1XTGB 1JTHA 1GTWA 4L74A 2ZYGA 1YQ3C 3KYQA 3B5NA 2ZXEB 3NFQA 1QLED 4PV1D 3HTKA 3L72G 1FC2C 2CPBA 2O01J 3CCMP 1FJKA 2FY8A 3M06A 1NAYA 2P7JA 3GHGC 2V4HA 3OA7A 3T97B 1KQSO 4U3FG 2E74C 5KLVK 3RL0C 4RO0A 3O8ZA 2E76C 1SQBK 2H88C 2OTLP 2M0BA 1PPJD 2W90A 2H89C 1D7MA 3N7NA 3QWOC 2YO2A 1NJIQ 3NXSA 3R2PA 1BDCA 3H1HE 5AW8B 3WU2H 1FZCA 1IFJA 1K8AQ 1K04A 1L4AA 3L72D 2YKQA 1PL5A 1BE3E 2K37A 1LTJC 4YPCA 4I2LC 4U3FD 3JCUH 4HKZH 2KZJA 1JB0J 2XNXA 1GW4A 1YHQP 2QE7H 2N9BA 2QJPC 2J58A 3L37A 1VPCA 2K9JA 2HR3A 4B86A 2O01N 5AW4B 3RK2D 1KB9I 4LLHA 5TJHA 4ZKPA 3H1LD 5EFWB 2W6BA 1NTZG 2N1TD 3MP7B 1NYHA 2SPZA 1VQOP 1OVUA 5KLIB 1JTHB 1NTME 3D6YA 3Q2YA 1VQLP 3H1IE 3HTKB 5AVTB 3CC2P 4KJMA 2FBWC 1OZHA 3GHGA 4PV1C 4PD4H 2Q1KA 2L91A 1W5CE 5APXA 1SQXK 1USEA 4WWIA 1S3JA 2K9YA 2B88A 2OYIC 1KQFB 2QJKB 3P32A 1SQQE 2QA4P 2M5AA 1FZCB 2POHA 3TDKA 5CJ0A 4GKGA 1NU1G 1L4AB 1ZV8A 4RESB 4DOJA 2XZRA 3TGUJ 1VQ5P 3U1AA 1EDJA 1GU4A 2IZ0A 1FAVA 1BCCG 2KI7B 1JMMA 4Y99B 1SQBJ 2WPQA 4ZMDA 1IC2A 3RK3D 2W27A 2LR2A 2HLOA 2K9JB 1QGKB 2K88A 2I8DA 3D71A 4H0LD 1EXIA 3RK2C 2FYNC 1SQXD 1VF5C 5KAIH 3CI9A 3IF4A 1SQVJ 2N1TC 1NTKG 1BCCD 3L74D 1WMKA 4DJGA 3L73E 1VQ9P 1ZXGA 1MFTA 1T6AA 3GF7A 1DD4A 2BCCJ 1J1DC 5GTHE 4D6TG 3L71E 3GHGB 2KS1A 2IFMA 3KHUA 2E74B 1U7JA 1PZQA 2E76B 4H44D 1HTLC 1JY3O 1JMBA 1IFIA 2Z5HA 5AW9B 2OYIA 2C9NY 1NTKD 1L0NE 2W8ZA 5APVA 1JY3N 2AXTH 2M5AB 2NPSD 1G1JA 3BCCJ 2HG5D 3OAKA 2OTJP 1OW7A 4JYCA 2YXRB 3P7KA 1OWAA 1L0LJ 2WTYA 2B87A 4IOIH 3A2AA 2KUBA 2P67A 1KB9E 1S72P 2LKMA 3H1HD 1HVVA 1KMIZ 4PJ0H 2XNDH 3VMAA 3A0BH 1RF0A 1IZNB 4M3LA 2QJPB 4NPEA 1AVYA 4C46A 1BE3D 4PD4I 1A02J 3I56P 3FWLA 4I1LA 3RK3C 1NTMG 1HBWA 5K5GB 3Q1MA 1KILE 3CCVP 4UB8H 4DCKA 4XFJA 3VMXA 2WPSA 3AEEC 1AQ5A 1Q86Q 4H0LC 1IO4A 4ASWA 2N1TA 3KZIH 2JO1A 3H32B 4OGQD 1EDLA 1CW5A 5AW3B 1QX8A 2J59M 2MJZA 2OYHA 3EFGA 1CZQA 3VMYA 1ZW0A 1PP9G 1Q90D 1SQQG 5BVZA 1NTMD 3AECC 3L72E 4EYYQ 4PV1B 1IK7A 2G3AA 1KZUB 3H1ID 1HWTC 5AVWB 4H44C 2OYIB 1AJYA 5AVYB 5GTIH 3GLMA 2IBZI 4W80A 3CWBE 1NO4A 4OVNF 3PLNA 2O1JA 2OARA 3I5CA 3SWFA 1PP9D 3WMM0 1SQQD 1VQPP 2B87B 4LGDE 1JY3P 1VQKP 2PP6A 1OFCX 1DIPA 3ZDMA 2E5YA 3CX5H 2YNYA 2FFDA 3B8EB 2H7HA 4IFMA 4TLFA 3I55P 2KLVA 3L73G 1EXJA 3RK2B 4TT3H 3HE4A 1WRGA 3B5NC 1NTZE 3U1CA 1EQ7A 3H25A 2N1TB 3TF5A 1JY2O 4MN4C 1KFMA 4OGQC 1Q7YQ 1IK9A 3HUSC 1KFNA 1PGQA 3BATA 3Q5PA 1Q2NA 1L0NG 1GZLA 5KKZB 4WVZA 1J1DB 1H0TA 5AW7B 1BGYE 5BU5A 2QRXA 3L35A 1G2CA 5B66H 3L73D 5AVXB 3L75J 1ZMEC 2JR8A 2YXQB 1HF9A 4L76A 3CMAP 3AEFC 5APWA 2R5DA 2VRSA 1JCDA 3S9OA 2WVRA 3L71D 3MTUE 3CXHE 2PRRA 3F5HA 2Z5IA 4BXLA 1GU5A 4I6MC 3SFDC 1OVVA 3A0HE 4BRYA 5CCHD 2NPSA 5CJ4A 4Y28J 5APQA 3L4FA 3B4SA 1L0ND 4PD4E 4RJTA 1NU1E 2YKPA 4EOTA 1RQVA 3G4SP 1EZVG 5H2FH 4AYCA 1BCCE 1FDOA 2FFDB 1R5LA 1KB9D 2ZVOB 4C7NA 1P84H 4GT1A 1GMJA 4N78E 3RK3B 1A02F 1KN7A 2WPVB 5CBOA 2YMKA 3HE4B 3MHVA 1EDKA 4H0LB 3TNUA 3E1IA 3FX0A 1YYCA 3P8MC 1N2DC 1KILD 1NTKE 3W67A 4NPDA 1N7SD 3HUSA 1NWQA 2QM7A 3H1KJ 5E79H 1CI6B 3D70A 2KIKA 1H0TB 3CX5I 4IL6X 1RF1A 3CWBG 3KXDA 1G2CB 5CCGD 5KAIE 1JOCA 2R44A 4D6TE 1YJ9P 4L75A 5AVUB 2H8PD 1J2JB 3CCQP 2QSIA 1N73A 3A7OA 4H44B 3H1JG 1JUNA 2WWWA 2MKVA 1VQ4P 3V2RA 4AQRD 4BRYB 2A06G 4WB4A 2NPSB 2L5GB 3M0AA 1NTZK 4GDOA 2RMZA 5CCHC 1J1EC 3E7KA 1FZGA 3CWBD 2Y0CA 2WSEH 2ITAA 3Q5SA 2WITA 1W2BO 2AXTE 4R4MA 2Y0DA 4C7NB 1SQVG 3A3YB 3AE3C 3H1JD 1RQUA 5B5EH 1JO5A 1X9VA 1VQMP 5AVQB 1DEBA 1HJBA 1EZVI 3B5NB 3TNUB 4PJ0E 1LNQA 1BGYG 2BCCG 2GA1A 3A0BE 1YITP 3MZWB 1W2EA 4N3YB 5TISH 2M3BA 4OGQB 3UIAA 1T3JA 3HUSB 1HJ0A 2C0XA 3VP8A 1KILC 1NTZD 3TK1A 4ZNCA 1NU1K 1N7SC 3VOPA 1T3UA 2NZ2A 1SQPE 1ZRTE 1PP9E 1MV8A 2HFED 3L72J 1RF1B 3C8VA 3II6A 4JBZA 3BCCG 3SWKA 4U3FJ 1KYOH 3KZIE 5CCGC 1P84I 3Q5RA 1Q82Q 1N73B 2WMMA 3SSUA 1L0LG 2ZFCA 1OXZA 3AE9C 2PAJA 1BGYD 2BCCD 4NPFX 2YMYA 1S5LH 1BSNA 2GUSA 2KZIA 1FDMA 2KNCA 4Z1MH 4BWNA 3S4RA 3GF3A 5KLVJ 3O6QA 3H1LJ 5KAFE 3KQGA 3CCRP 3M9BA 5CBNA 2KSJA 1RF0C 3CXHD 5CCHA 1QL1A 3SFEC 1LTSC 2BEQD 5AW5B 1NTKK 1JCCA 1IJDB 3WUUA 1Y8AA 2Q3IA 5GTIE 4PD4D 1L0LD 1NU1D 3S1KA 3CCEP 3L70G 2NRGA 1YJWP 1LTAC 2FYUE 3F89A 2A45H 3G6EP 1WT6A 2OYHC 2WSEJ 1CSBA 2IBZG 4N78D 3CX5E 2J5UA 5KKZC 2RN0A 2P1JA 1FE6A 1KILA 1M1JA 1AA0A 2JP3A 1N7SA 3L70D 2HYNA 1Z56A 3M9HA 1OW8A 1S4XA 3C9IA 2YO3A 2KK7A 3USSA 5CCGA 1SFCD 5AVRB 3V6IA 1E5WA 1YTZI 2RH0A 4KT0J 2IBZD 2O1KA 4JF7A 2I1JA 4D6TD 2KNCB 2PFXA 1NTMK 1X8YA 2FXMA 2KLUA 1NGMB 2IYOA 1SQXJ 3G3ZA 2FFDC 3AE7C 1J1EB 4OH8B 3CCUP 3L74J 3P8CE 1EZVE 1X79B 2Q6QA 1OW6A 2ZYDA 1AV1A 1T8ZA 1SQQK 1S1CX 1KYOI 2K3RA 1NKZB 3AEDC 4HJGH 3CL3D 3AE8C 1SQPG 3EWKA 2O3JA 2WPRA 1YBKA 2IX7C 1NTKJ 2ZT9D 2DW3A 2KS1B 3BVHA 1R8EA 1RHZB 3AE6C 3OW2O 1Q81Q 1P84E 3V2PA 1U57A 1KILB 1M1JB 3AEBC 4IL6H 1PGOA 1N7SB 1N7LA 3LIDA 1RY3A 2WSSH 2ZXXA 1VL2A 1DH3A 3H1HJ 1S5LX 2WT7A 2NPSC 2GM4A 1DEEG 1K73Q 4H13D 1SQPD 3M0DA 1ZRTD 1SFCC 2A45I 3CCLP 1BE3J 1LTGC 3TGUE 4W7ZA 3H1JE 2OQQA 3W68A 1GD2E 3IN6A 1GK6A 1R5SA 1QEXA 1ZP0C 2A06E 2RKLA 4GODA 2R3CA 1SQBE 1MUUA 3V4QA 2FYUG 1YTZT 3WU2E 4L73A 2R5BA 3CMEP 1URQD 3CLQA 1L2PA 3K5BA 3H6PA 5AVVB 3JCUE 5L8RJ 1L0NK 3C1LA 3MGNA 1JM0A 1SQVE 1NTMJ 1PV3A 1JEKA 2FXOA 2QVAA 2OYHB 1G1IA 3H1KG 3H1IJ 4YXDC 2WZ7A 1JY2N 2FYUD 3CC7P 1RE4A 1LT1A 1SLQA 3GMAA 1RF1C 3RL0D 2BCCE 2D2CD 2B9BA 5CMZA 2ZT9C 1VQ8P 1KQLA 3WUVA 5B5EE 3CX5D 1N73C 1PP9J 3AE5C 1SQQJ 1QL2A 1S9KD 2QEXP 3PJSK 1M7LA 2B89A 1KV4A 2Y9ZA 3BCCE 2WT7B 2WSCJ 3H1KD 2KYVA 2YKOA 3ITKA 1SP4A 3LW5J 3IFMA 4DZOA 5TISE 3M9QA 1SFCA 1L0LE 1LTTC 1MFZA 3CD6P 2E75D 2R3SA 3L36A 1AQTA 1KYOE 2N9YB 2ZVNB 3PH0A 1YIJP 1URQC 1AFOA 2CPSA 5CHXA 1PPJG 2W6AA 2V7QJ 5AVSB 3L70E 1PFIA 4RKUJ 1FS0E 3HD7D 3L73J 3P8CD 1EZVD 2XDJA 2QM8A 3BASA 4YXWH 3IR9A 1FOSF 4WY4D 1FOSE 4GOFA 2YIUC 1KORA 3KPEA 3L71J 3GG2A 2IBZE 4JQ0D 1IFMA 4KHXA 2E42A 2AEMA 4EDFA 2FYZA 1FZFA 4HB1A 4OWFA 3PTZA 4WBAA 3EFFK 3AE2C 1JY2P 1ZN5A 2D2CC 1L0NJ 3TGUG 1FDIA 2HODA 1LJ2A 1LP1A 4EIJA 2Q9IA 1P84D 1M8OB 2Y9YA 5KLVG 3H1LG 2M3EA 1LWUC 1SQBG 2E43A 3VMZA 3R4YA 3VTPC 4ZKUA 1SFCB 3G9RA 2AEJA 2KSEA 3V5BA 1HUCA 1SQVK 2LXCB 1VQNP 2ZAEB 1N86A 1K9MQ 5KJ7D 2CK3H 4XE5B 1RE3C 2OGUA 1MKMA 3TGUD 2QJYB 2E75C 3NTNA 2C9LY 3AEGC 4UB6H 1LT9C 4YTPC 1X0TA 2ZJSE 4EI2A 1VF5D 5KLVD 2A06D 1SQBD 1URQA 3WUTA 3LIEA 2IYPA 4DT0A 2OTKE 2G8YA 1GW3A 1GDTA 4GOEA 3MIWA 2AXCA 2WSFH 4U7JA 3CXHH 1IFPA 2Q5UA 2WQYC 1M1JC 3HD7C 3CC4P 1M1KQ 2JDIH 1L0LK 1BDDA 1SQVD 1DX7A 3A0HH 4UB8E 1H89A 2FXPA 4WY4C 2XKMA 1HGVA 2ZT9B 1AVOA 3BRVB 3L75E 4HYTB 4GIFA 1BSHA 1VQ6P 2HODB 1LP1B 1HH0A 3CWBJ 2GUVA 3FXEA 1EC5A 2AEFA 3HE5A 1Y47A 1USDA 1LWUA 2ZYAA 3QH9A 1LGHB 1SQXG 4K35A 4QMAA 4W7YA 2BASA 3H1JJ 2HPCA 4IL6E 3VYIA 4H13B 2OYOA 1FJPA 4O9BA 1LTJA 3BCCD 1FBMA 1FZBA 5AW2B 1GL2D 3L74G 1ZOYC 1JNMA 2M8RA 1RE3A 3CCJP 1IFDA 5KJ7C 1K05A 2W6JH 1ZLLA 1LT9A 1X22A 3EQ2A 4CPGA 3VN0A 3TSIA 2JWDA 1URQB 1KYOD 1NTZJ 3RL0g 1FU1A 3H32A 3RBZA 4I7ZC 2Y0EA 1S9KE 2A45G 3HD7A 4K3AA 2BEZF 3CPWO 1KD1Q 3H1KE 2YIUB 1BGYJ 1EDIA 1PGJA 4WY4A 1YQ4C 3SWYA 3H1HG 3RL0B 4IFDK 1NAFA 1UIIA 3TYYA 1U7MA 2D2CB 2WSFJ 3VP9A 2XU6A 3M0DC 2IPPA 5DJUB 1BE3G 1OIPA 1RH5B 3HE5B 3O6QB 1YJNP 1H8AA 1LWUB 5AW1B 1M56D 2JJLA 1T2KD 5B66E 1NU1J 3OJAB 1YI2P 2LXBA 2HPCB 3CXHI 5DJTB 1LTJB 2H43A 1Y9BA 1BCCJ 1XTCC 2Q3EA 1OX3A 3RGUA 5KJ7A 1GL2C 3FXDA 1MZ9A 2E75B 1SQPK 1VQ7P 3JSVC
chains in the Genus database with same CATH topology
1J2JB 1FZEA 2IFNA 1JY2N 1JMMA 1LT9B 3V2NA 1RE4A 1N73A 3A7OA 4Y99B 1SVFA 1SLQA 1RF1C 3RL0D 3B5ND 2WPQA 1NOHA 1IC2A 3RK3D 1JUNA 2WWWA 2W27A 5CMZA 2HLOA 3V2RA 2KOGA 5APUA 4AQRD 3U59A 1KQLA 1RE4C 4WB4A 2NPSB 1N73C 2L5GB 1QL2A 3M0AA 3RK2C 1NTZK 1FZAA 1S9KD 2WSCH 5CCHC 1J1EC 3LW5H 1FZGA 3HD7B 1M7LA 3CI9A 5APYA 4N6JA 2N1TC 2WT7B 2WSEH 2KYVA 2YKOA 1SP4A 4DZOA 3IFMA 5AVZB 2WITA 1IFNA 3M9QA 1SFCA 2XV5A 4WY4B 2JEEA 5AW0B 4C7NB 3A3YB 1L4AD 1LTTC 1MFZA 4HH2A 4C7RA 1J1DC 3HRNA 4XA4A 1JO5A 1X9VA 2FYUK 3GHGB 2IFMA 3L36A 5AVQB 1DEBA 3N4XA 1HJBA 3B5NB 3TNUB 1HTLC 1JY3O 3A5TA 1IFIA 2Z5HA 5AW9B 2OYIA 2C9NY 1W2EA 4N3YB 2M3BA 1URQC 3V2QA 5APVA 1JY3N 1AFOA 2NPSD 1G1JA 1T3JA 2CPSA 1LTIC 3HUSB 3UIAA 2C0XA 5CHXA 1T2KC 4AUWA 3VP8A 2HG5D 1KILC 3OAKA 2W6AA 3TK1A 4JYBA 5AVSB 4JYCA 1NU1K 1N7SC 1PFIA 3VOPA 1T3UA 1LTBC 3P7KA 1OWAA 2HFED 3HD7D 1MV8A 1RF1B 3P8CD 3II6A 2XDJA 1VDFA 2WTYA 1GL2A 2QM8A 3A2AA 2P67A 2O01H 3BASA 1GK4A 3IR9A 2LKMA 1FOSF 5BU8B 5CCGC 1HVVA 4WY4D 1FOSE 1N73B 3KPEA 2ZFCA 1OXZA 2PAJA 1IFMA 4KHXA 1RF0A 4M3LA 2E42A 2YMYA 2FYZA 2GUSA 3MD0A 1FZFA 1FDMA 4C46A 4WBAA 2R32A 3V4WA 1A02J 4I1LA 1JY2P 3MUDA 3RK3C 1ZN5A 1HBWA 3KQGA 3NMDA 3M9BA 5AW6B 2KSJA 1RF0C 2HODA 5CCHA 3T97A 3VMXA 1QL1A 2WPSA 4EIJA 2Z4EA 2Q9IA 1LTSC 1AQ5A 5AW5B 1IO4A 1NHLA 1NTKK 1JCCA 1CI6A 2FKWB 2N1TA 1IJDB 3PP5A 1LWUC 3H32B 3VMZA 2E43A 1CW5A 5AW3B 2Q3IA 3VTPC 4ZKUA 1SFCB 2J59M 3V5BA 1HUCA 1SQVK 2MJZA 2OYHA 3EFGA 3KDPB 1CZQA 1H88A 4LC1A 2I1KA 5APTA 3VMYA 1LTAC 1N86A 2KP8A 1FZCC 5KJ7D 4XE5B 2A45H 1L4AC 1RE3C 5BVZA 1WT6A 2OYHC 1CSBA 1HGZA 3NTNA 2C9LY 4N78D 1KZUB 5KTBA 1LT9C 1ZR2A 1HWTC 4Y99C 3M91A 5AVWB 2OYIB 1NH4A 2P1JA 1URQA 5AVYB 3BRTB 4W80A 2C0WA 3LIEA 2KB7P 1KILA 1M1JA 1NO4A 1NKNA 1GW3A 1GDTA 2O1JA 1N7SA 2HYNA 5APSA 1Z56A 3M9HA 1ZR4A 4IFFA 2OARA 3I5CA 3MIWA 3SWFA 1FAVA 3WMM0 2WSFH 2P2UA 4LGDE 1JY3P 1GL2B 3C9IA 2PP6A 2Q5UA 1M1JC 2YO3A 3HD7C 2Q7CA 5CCGA 1SFCD 1L0LK 5AVRB 1DX7A 1E5WA 1XTGB 1YTZI 1H89A 2YNYA 1JTHA 2O1KA 1GTWA 4WY4C 2FFDA 4JF7A 2I1JA 3B8EB 2XKMA 2H7HA 1HGVA 3KYQA 3B5NA 3BRVB 1NTMK 2ZXEB 3NFQA 4IFMA 1X8YA 2FXMA 4HYTB 3HTKA 4GIFA 2KLVA 2CPBA 1FJKA 3M06A 3RK2B 3G3ZA 2P7JA 3GHGC 2FFDC 2HODB 1J1EB 1HH0A 3HE4A 3OA7A 1WRGA 5KLVK 3RL0C 3B5NC 3O8ZA 2GUVA 4OH8B 1SQBK 3HE5A 3U1CA 1EQ7A 2N1TB 1LWUA 1LGHB 1JY2O 3N7NA 3P8CE 2YO2A 1X79B 1KFMA 4W7YA 2BASA 1IK9A 2HPCA 3HUSC 3VYIA 3NXSA 3R2PA 1FJPA 4O9BA 1KFNA 1LTJA 1T8ZA 3BATA 1SQQK 5AW8B 1FZCA 1FBMA 1NKZB 1GZLA 1FZBA 5AW2B 1GL2D 1JNMA 2M8RA 1J1DB 1IFJA 5AW7B 1L4AA 1RE3A 5BU5A 3L35A 1G2CA 1IFDA 3CL3D 5KJ7C 2YKQA 5AVXB 1LTJC 4I2LC 1ZLLA 1LT9A 2WPRA 5APWA 3EQ2A 2IX7C 2R5DA 3VN0A 2XNXA 2VRSA 1GW4A 3TSIA 1JCDA 3MTUE 2N9BA 3BVHA 1URQB 2J58A 2Z5IA 3L37A 1VPCA 3V2PA 1KILB 1M1JB 4B86A 1GU5A 4I6MC 5AW4B 3RK2D 4LLHA 5CCHD 1N7SB 2NPSA 1N7LA 1FU1A 3H32A 3LIDA 5CJ4A 1RY3A 5APQA 4ZKPA 1S9KE 3L4FA 2W6BA 2N1TD 2YKPA 1DH3A 4EOTA 2A45G 3HD7A 2WT7A 2NPSC 2GM4A 4AYCA 3M0DA 1JTHB 1SFCC 2A45I 4WY4A 2FFDB 3SWYA 1LTGC 4W7ZA 3RL0B 4C7NA 4IFDK 1NAFA 4GT1A 3RK3B 4N78E 1A02F 1GD2E 3TYYA 1GK6A 3VP9A 3HTKB 5AVTB 2XU6A 3M0DC 2IPPA 3GHGA 2R3CA 3HE4B 1MUUA 3V4QA 1YTZT 3TNUA 3E1IA 1YYCA 3P8MC 1N2DC 2R5BA 3HE5B 5APXA 1H8AA 1SQXK 1URQD 1LWUB 5AW1B 2JJLA 1T2KD 3CLQA 2OYIC 1KILD 3P32A 3OJAB 2HPCB 1N7SD 3HUSA 3H6PA 5AVVB 1NWQA 2QM7A 1L0NK 1LTJB 1CI6B 2H43A 3MGNA 1FZCB 2POHA 5CJ0A 4GKGA 1XTCC 1L4AB 1ZV8A 4RESB 4DOJA 1RF1A 2XZRA 1G2CB 5CCGD 5KJ7A 2OYHB 1GL2C 3U1AA 1JOCA 1MZ9A 1G1IA 1SQPK 1GU4A 5AVUB 2H8PD 2WZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J2J B;  2N9B A;  2WTY A;  2QM8 A;  3A2A A;  2P67 A;  2Z5I A;  3A7O A;  3L37 A;  3M9H A;  5APS A;  1GK4 A;  3IR9 A;  1SLQ A;  3I5C A;  4B86 A;  1GU5 A;  2WPQ A;  3SWF A;  1FOS F;  4I6M C;  5AW4 B;  1FOS E;  2P2U A;  1JUN A;  2WWW A;  2W27 A;  5CMZ A;  2ZFC A;  3LID A;  1OXZ A;  2Q5U A;  2YO3 A;  5APQ A;  5APU A;  4AQR D;  4KHX A;  1S9K E;  4M3L A;  2Q7C A;  2E42 A;  1KQL A;  5AVR B;  3MD0 A;  1DH3 A;  4C46 A;  4EOT A;  2R32 A;  1H89 A;  3M0A A;  2YNY A;  3V4W A;  1A02 J;  1GTW A;  1S9K D;  2WT7 A;  3B8E B;  1HBW A;  2H7H A;  3KQG A;  3NMD A;  3M9B A;  5AW6 B;  4AYC A;  3M0D A;  5APY A;  2ZXE B;  3NFQ A;  1X8Y A;  3T97 A;  2WT7 B;  3VMX A;  2WPS A;  4HYT B;  3HTK A;  1SP4 A;  4DZO A;  3M06 A;  5AVZ B;  5AW5 B;  4C7N A;  1IO4 A;  1NAF A;  2XV5 A;  2P7J A;  4GT1 A;  1CI6 A;  1A02 F;  1GD2 E;  3TYY A;  1GK6 A;  3HE4 A;  5AVT B;  3VMZ A;  2E43 A;  2XU6 A;  5AW0 B;  5AW3 B;  3O8Z A;  2IPP A;  4C7N B;  2Q3I A;  3VTP C;  3A3Y B;  3HE5 A;  2R3C A;  3HE4 B;  1MUU A;  3V5B A;  1HUC A;  3V4Q A;  1MFZ A;  3KDP B;  1CZQ A;  3TNU A;  1H88 A;  4LC1 A;  5APT A;  1YYC A;  3P8M C;  2R5B A;  3HE5 B;  5APX A;  2YO2 A;  3VMY A;  3L36 A;  1H8A A;  2KP8 A;  5AVQ B;  2BAS A;  5AW1 B;  2JJL A;  1HJB A;  3VYI A;  3NXS A;  3TNU B;  1T2K D;  4XE5 B;  5AVU B;  3A5T A;  3P32 A;  5AW8 B;  2Z5H A;  1GZL A;  5AW2 B;  1JNM A;  1CSB A;  5AVV B;  5AW9 B;  5AW7 B;  3NTN A;  1NWQ A;  2QM7 A;  2C9N Y;  2C9L Y;  1CI6 B;  3L35 A;  3MGN A;  5APV A;  1HWT C;  3UIA A;  4AUW A;  5AVX B;  1T2K C;  4GKG A;  3M91 A;  5AVW B;  4RES B;  3OAK A;  2W6A A;  2XZR A;  4I2L C;  4JYB A;  3TK1 A;  5AVS B;  1G2C B;  4JYC A;  5AVY B;  2WPR A;  5APW A;  2R5D A;  3VN0 A;  3LIE A;  3P7K A;  2VRS A;  1GU4 A;  1OWA A;  1MV8 A;  1FAV A; 
#chains in the Genus database with same CATH topology
 1FZE A;  2IFN A;  3JC2 2;  1LT9 B;  3V2N A;  1SVF A;  1KC8 Q;  3B5N D;  1NOH A;  1M57 D;  1QVF O;  1PGP A;  3H1I G;  2KOG A;  5APU A;  3U59 A;  3L70 J;  3MUD C;  5H2F E;  1RE4 C;  1PPJ E;  2K1A A;  1FZA A;  2WSC H;  1M90 Q;  3L75 G;  3LW5 H;  3GW6 A;  3HD7 B;  5APY A;  4N6J A;  1PIX A;  1UIX A;  5AVZ B;  2PGD A;  1IFN A;  1SS1 A;  5KAF H;  2XV5 A;  4D6T J;  4WY4 B;  2JEE A;  5AW0 B;  1L4A D;  2E5T A;  4U3F E;  1DD3 A;  4HH2 A;  4C7R A;  3HRN A;  4XA4 A;  1KTM A;  2FYU K;  3AE4 C;  1OVR A;  3N4X A;  5E79 E;  3A5T A;  3L75 D;  1N8R Q;  2W83 C;  3FGA D;  5KLV E;  2V7Q H;  3H1L E;  1NVO A;  3V2Q A;  2JWA A;  4AUW A;  2QJY C;  1T2K C;  1LTI C;  4JYB A;  3D6Z A;  1KQG B;  1LTB C;  3PRJ A;  3ABV C;  1S2E A;  5GTH H;  1VDF A;  1GL2 A;  2O01 H;  1GK4 A;  3AEA C;  5BU8 B;  5C39 A;  5KLI C;  3MD0 A;  2FYN B;  1VF5 B;  2R32 A;  4ASV A;  3V4W A;  3CCS P;  3MUD A;  3L71 G;  2KXP B;  3NMD A;  2E74 D;  4I7Z B;  5AW6 B;  3B71 A;  4A7P A;  3FWN A;  5M1B A;  2E76 D;  2QIW A;  3G71 P;  3T97 A;  2Z4E A;  3E1R A;  1NHL A;  4UB6 E;  1KB9 H;  1CI6 A;  2FKW B;  3PP5 A;  1SQP J;  2QJK C;  3AE1 C;  3KDP B;  1H88 A;  4LC1 A;  2I1K A;  5APT A;  2IDB A;  2KP8 A;  1FZC C;  1OMI A;  4JPZ B;  1L4A C;  3RK3 E;  4H13 C;  1HGZ A;  2UWJ E;  5KTB A;  4R4L A;  1ZR2 A;  4Y99 C;  3M91 A;  2JKV A;  1NH4 A;  1SQX E;  2IZ1 A;  3BRT B;  3RBX A;  2C0W A;  2KB7 P;  3Q3D A;  1NKN A;  1E79 H;  5APS A;  2QG4 A;  1ZR4 A;  1S5L E;  4IFF A;  1TU3 F;  3L74 E;  2P10 A;  2P2U A;  1GL2 B;  3IAO A;  1QVG O;  2P58 A;  2FYU J;  2Q7C A;  3PHL A;  1XTG B;  1JTH A;  1GTW A;  4L74 A;  2ZYG A;  1YQ3 C;  3KYQ A;  3B5N A;  2ZXE B;  3NFQ A;  1QLE D;  4PV1 D;  3HTK A;  3L72 G;  1FC2 C;  2CPB A;  2O01 J;  3CCM P;  1FJK A;  2FY8 A;  3M06 A;  1NAY A;  2P7J A;  3GHG C;  2V4H A;  3OA7 A;  3T97 B;  1KQS O;  4U3F G;  2E74 C;  5KLV K;  3RL0 C;  4RO0 A;  3O8Z A;  2E76 C;  1SQB K;  2H88 C;  2OTL P;  2M0B A;  1PPJ D;  2W90 A;  2H89 C;  1D7M A;  3N7N A;  3QWO C;  2YO2 A;  1NJI Q;  3NXS A;  3R2P A;  1BDC A;  3H1H E;  5AW8 B;  3WU2 H;  1FZC A;  1IFJ A;  1K8A Q;  1K04 A;  1L4A A;  3L72 D;  2YKQ A;  1PL5 A;  1BE3 E;  2K37 A;  1LTJ C;  4YPC A;  4I2L C;  4U3F D;  3JCU H;  4HKZ H;  2KZJ A;  1JB0 J;  2XNX A;  1GW4 A;  1YHQ P;  2QE7 H;  2N9B A;  2QJP C;  2J58 A;  3L37 A;  1VPC A;  2K9J A;  2HR3 A;  4B86 A;  2O01 N;  5AW4 B;  3RK2 D;  1KB9 I;  4LLH A;  5TJH A;  4ZKP A;  3H1L D;  5EFW B;  2W6B A;  1NTZ G;  2N1T D;  3MP7 B;  1NYH A;  2SPZ A;  1VQO P;  1OVU A;  5KLI B;  1JTH B;  1NTM E;  3D6Y A;  3Q2Y A;  1VQL P;  3H1I E;  3HTK B;  5AVT B;  3CC2 P;  4KJM A;  2FBW C;  1OZH A;  3GHG A;  4PV1 C;  4PD4 H;  2Q1K A;  2L91 A;  1W5C E;  5APX A;  1SQX K;  1USE A;  4WWI A;  1S3J A;  2K9Y A;  2B88 A;  2OYI C;  1KQF B;  2QJK B;  3P32 A;  1SQQ E;  2QA4 P;  2M5A A;  1FZC B;  2POH A;  3TDK A;  5CJ0 A;  4GKG A;  1NU1 G;  1L4A B;  1ZV8 A;  4RES B;  4DOJ A;  2XZR A;  3TGU J;  1VQ5 P;  3U1A A;  1EDJ A;  1GU4 A;  2IZ0 A;  1FAV A;  1BCC G;  2KI7 B;  1JMM A;  4Y99 B;  1SQB J;  2WPQ A;  4ZMD A;  1IC2 A;  3RK3 D;  2W27 A;  2LR2 A;  2HLO A;  2K9J B;  1QGK B;  2K88 A;  2I8D A;  3D71 A;  4H0L D;  1EXI A;  3RK2 C;  2FYN C;  1SQX D;  1VF5 C;  5KAI H;  3CI9 A;  3IF4 A;  1SQV J;  2N1T C;  1NTK G;  1BCC D;  3L74 D;  1WMK A;  4DJG A;  3L73 E;  1VQ9 P;  1ZXG A;  1MFT A;  1T6A A;  3GF7 A;  1DD4 A;  2BCC J;  1J1D C;  5GTH E;  4D6T G;  3L71 E;  3GHG B;  2KS1 A;  2IFM A;  3KHU A;  2E74 B;  1U7J A;  1PZQ A;  2E76 B;  4H44 D;  1HTL C;  1JY3 O;  1JMB A;  1IFI A;  2Z5H A;  5AW9 B;  2OYI A;  2C9N Y;  1NTK D;  1L0N E;  2W8Z A;  5APV A;  1JY3 N;  2AXT H;  2M5A B;  2NPS D;  1G1J A;  3BCC J;  2HG5 D;  3OAK A;  2OTJ P;  1OW7 A;  4JYC A;  2YXR B;  3P7K A;  1OWA A;  1L0L J;  2WTY A;  2B87 A;  4IOI H;  3A2A A;  2KUB A;  2P67 A;  1KB9 E;  1S72 P;  2LKM A;  3H1H D;  1HVV A;  1KMI Z;  4PJ0 H;  2XND H;  3VMA A;  3A0B H;  1RF0 A;  1IZN B;  4M3L A;  2QJP B;  4NPE A;  1AVY A;  4C46 A;  1BE3 D;  4PD4 I;  1A02 J;  3I56 P;  3FWL A;  4I1L A;  3RK3 C;  1NTM G;  1HBW A;  5K5G B;  3Q1M A;  1KIL E;  3CCV P;  4UB8 H;  4DCK A;  4XFJ A;  3VMX A;  2WPS A;  3AEE C;  1AQ5 A;  1Q86 Q;  4H0L C;  1IO4 A;  4ASW A;  2N1T A;  3KZI H;  2JO1 A;  3H32 B;  4OGQ D;  1EDL A;  1CW5 A;  5AW3 B;  1QX8 A;  2J59 M;  2MJZ A;  2OYH A;  3EFG A;  1CZQ A;  3VMY A;  1ZW0 A;  1PP9 G;  1Q90 D;  1SQQ G;  5BVZ A;  1NTM D;  3AEC C;  3L72 E;  4EYY Q;  4PV1 B;  1IK7 A;  2G3A A;  1KZU B;  3H1I D;  1HWT C;  5AVW B;  4H44 C;  2OYI B;  1AJY A;  5AVY B;  5GTI H;  3GLM A;  2IBZ I;  4W80 A;  3CWB E;  1NO4 A;  4OVN F;  3PLN A;  2O1J A;  2OAR A;  3I5C A;  3SWF A;  1PP9 D;  3WMM 0;  1SQQ D;  1VQP P;  2B87 B;  4LGD E;  1JY3 P;  1VQK P;  2PP6 A;  1OFC X;  1DIP A;  3ZDM A;  2E5Y A;  3CX5 H;  2YNY A;  2FFD A;  3B8E B;  2H7H A;  4IFM A;  4TLF A;  3I55 P;  2KLV A;  3L73 G;  1EXJ A;  3RK2 B;  4TT3 H;  3HE4 A;  1WRG A;  3B5N C;  1NTZ E;  3U1C A;  1EQ7 A;  3H25 A;  2N1T B;  3TF5 A;  1JY2 O;  4MN4 C;  1KFM A;  4OGQ C;  1Q7Y Q;  1IK9 A;  3HUS C;  1KFN A;  1PGQ A;  3BAT A;  3Q5P A;  1Q2N A;  1L0N G;  1GZL A;  5KKZ B;  4WVZ A;  1J1D B;  1H0T A;  5AW7 B;  1BGY E;  5BU5 A;  2QRX A;  3L35 A;  1G2C A;  5B66 H;  3L73 D;  5AVX B;  3L75 J;  1ZME C;  2JR8 A;  2YXQ B;  1HF9 A;  4L76 A;  3CMA P;  3AEF C;  5APW A;  2R5D A;  2VRS A;  1JCD A;  3S9O A;  2WVR A;  3L71 D;  3MTU E;  3CXH E;  2PRR A;  3F5H A;  2Z5I A;  4BXL A;  1GU5 A;  4I6M C;  3SFD C;  1OVV A;  3A0H E;  4BRY A;  5CCH D;  2NPS A;  5CJ4 A;  4Y28 J;  5APQ A;  3L4F A;  3B4S A;  1L0N D;  4PD4 E;  4RJT A;  1NU1 E;  2YKP A;  4EOT A;  1RQV A;  3G4S P;  1EZV G;  5H2F H;  4AYC A;  1BCC E;  1FDO A;  2FFD B;  1R5L A;  1KB9 D;  2ZVO B;  4C7N A;  1P84 H;  4GT1 A;  1GMJ A;  4N78 E;  3RK3 B;  1A02 F;  1KN7 A;  2WPV B;  5CBO A;  2YMK A;  3HE4 B;  3MHV A;  1EDK A;  4H0L B;  3TNU A;  3E1I A;  3FX0 A;  1YYC A;  3P8M C;  1N2D C;  1KIL D;  1NTK E;  3W67 A;  4NPD A;  1N7S D;  3HUS A;  1NWQ A;  2QM7 A;  3H1K J;  5E79 H;  1CI6 B;  3D70 A;  2KIK A;  1H0T B;  3CX5 I;  4IL6 X;  1RF1 A;  3CWB G;  3KXD A;  1G2C B;  5CCG D;  5KAI E;  1JOC A;  2R44 A;  4D6T E;  1YJ9 P;  4L75 A;  5AVU B;  2H8P D;  1J2J B;  3CCQ P;  2QSI A;  1N73 A;  3A7O A;  4H44 B;  3H1J G;  1JUN A;  2WWW A;  2MKV A;  1VQ4 P;  3V2R A;  4AQR D;  4BRY B;  2A06 G;  4WB4 A;  2NPS B;  2L5G B;  3M0A A;  1NTZ K;  4GDO A;  2RMZ A;  5CCH C;  1J1E C;  3E7K A;  1FZG A;  3CWB D;  2Y0C A;  2WSE H;  2ITA A;  3Q5S A;  2WIT A;  1W2B O;  2AXT E;  4R4M A;  2Y0D A;  4C7N B;  1SQV G;  3A3Y B;  3AE3 C;  3H1J D;  1RQU A;  5B5E H;  1JO5 A;  1X9V A;  1VQM P;  5AVQ B;  1DEB A;  1HJB A;  1EZV I;  3B5N B;  3TNU B;  4PJ0 E;  1LNQ A;  1BGY G;  2BCC G;  2GA1 A;  3A0B E;  1YIT P;  3MZW B;  1W2E A;  4N3Y B;  5TIS H;  2M3B A;  4OGQ B;  3UIA A;  1T3J A;  3HUS B;  1HJ0 A;  2C0X A;  3VP8 A;  1KIL C;  1NTZ D;  3TK1 A;  4ZNC A;  1NU1 K;  1N7S C;  3VOP A;  1T3U A;  2NZ2 A;  1SQP E;  1ZRT E;  1PP9 E;  1MV8 A;  2HFE D;  3L72 J;  1RF1 B;  3C8V A;  3II6 A;  4JBZ A;  3BCC G;  3SWK A;  4U3F J;  1KYO H;  3KZI E;  5CCG C;  1P84 I;  3Q5R A;  1Q82 Q;  1N73 B;  2WMM A;  3SSU A;  1L0L G;  2ZFC A;  1OXZ A;  3AE9 C;  2PAJ A;  1BGY D;  2BCC D;  4NPF X;  2YMY A;  1S5L H;  1BSN A;  2GUS A;  2KZI A;  1FDM A;  2KNC A;  4Z1M H;  4BWN A;  3S4R A;  3GF3 A;  5KLV J;  3O6Q A;  3H1L J;  5KAF E;  3KQG A;  3CCR P;  3M9B A;  5CBN A;  2KSJ A;  1RF0 C;  3CXH D;  5CCH A;  1QL1 A;  3SFE C;  1LTS C;  2BEQ D;  5AW5 B;  1NTK K;  1JCC A;  1IJD B;  3WUU A;  1Y8A A;  2Q3I A;  5GTI E;  4PD4 D;  1L0L D;  1NU1 D;  3S1K A;  3CCE P;  3L70 G;  2NRG A;  1YJW P;  1LTA C;  2FYU E;  3F89 A;  2A45 H;  3G6E P;  1WT6 A;  2OYH C;  2WSE J;  1CSB A;  2IBZ G;  4N78 D;  3CX5 E;  2J5U A;  5KKZ C;  2RN0 A;  2P1J A;  1FE6 A;  1KIL A;  1M1J A;  1AA0 A;  2JP3 A;  1N7S A;  3L70 D;  2HYN A;  1Z56 A;  3M9H A;  1OW8 A;  1S4X A;  3C9I A;  2YO3 A;  2KK7 A;  3USS A;  5CCG A;  1SFC D;  5AVR B;  3V6I A;  1E5W A;  1YTZ I;  2RH0 A;  4KT0 J;  2IBZ D;  2O1K A;  4JF7 A;  2I1J A;  4D6T D;  2KNC B;  2PFX A;  1NTM K;  1X8Y A;  2FXM A;  2KLU A;  1NGM B;  2IYO A;  1SQX J;  3G3Z A;  2FFD C;  3AE7 C;  1J1E B;  4OH8 B;  3CCU P;  3L74 J;  3P8C E;  1EZV E;  1X79 B;  2Q6Q A;  1OW6 A;  2ZYD A;  1AV1 A;  1T8Z A;  1SQQ K;  1S1C X;  1KYO I;  2K3R A;  1NKZ B;  3AED C;  4HJG H;  3CL3 D;  3AE8 C;  1SQP G;  3EWK A;  2O3J A;  2WPR A;  1YBK A;  2IX7 C;  1NTK J;  2ZT9 D;  2DW3 A;  2KS1 B;  3BVH A;  1R8E A;  1RHZ B;  3AE6 C;  3OW2 O;  1Q81 Q;  1P84 E;  3V2P A;  1U57 A;  1KIL B;  1M1J B;  3AEB C;  4IL6 H;  1PGO A;  1N7S B;  1N7L A;  3LID A;  1RY3 A;  2WSS H;  2ZXX A;  1VL2 A;  1DH3 A;  3H1H J;  1S5L X;  2WT7 A;  2NPS C;  2GM4 A;  1DEE G;  1K73 Q;  4H13 D;  1SQP D;  3M0D A;  1ZRT D;  1SFC C;  2A45 I;  3CCL P;  1BE3 J;  1LTG C;  3TGU E;  4W7Z A;  3H1J E;  2OQQ A;  3W68 A;  1GD2 E;  3IN6 A;  1GK6 A;  1R5S A;  1QEX A;  1ZP0 C;  2A06 E;  2RKL A;  4GOD A;  2R3C A;  1SQB E;  1MUU A;  3V4Q A;  2FYU G;  1YTZ T;  3WU2 E;  4L73 A;  2R5B A;  3CME P;  1URQ D;  3CLQ A;  1L2P A;  3K5B A;  3H6P A;  5AVV B;  3JCU E;  5L8R J;  1L0N K;  3C1L A;  3MGN A;  1JM0 A;  1SQV E;  1NTM J;  1PV3 A;  1JEK A;  2FXO A;  2QVA A;  2OYH B;  1G1I A;  3H1K G;  3H1I J;  4YXD C;  2WZ7 A;  1JY2 N;  2FYU D;  3CC7 P;  1RE4 A;  1LT1 A;  1SLQ A;  3GMA A;  1RF1 C;  3RL0 D;  2BCC E;  2D2C D;  2B9B A;  5CMZ A;  2ZT9 C;  1VQ8 P;  1KQL A;  3WUV A;  5B5E E;  3CX5 D;  1N73 C;  1PP9 J;  3AE5 C;  1SQQ J;  1QL2 A;  1S9K D;  2QEX P;  3PJS K;  1M7L A;  2B89 A;  1KV4 A;  2Y9Z A;  3BCC E;  2WT7 B;  2WSC J;  3H1K D;  2KYV A;  2YKO A;  3ITK A;  1SP4 A;  3LW5 J;  3IFM A;  4DZO A;  5TIS E;  3M9Q A;  1SFC A;  1L0L E;  1LTT C;  1MFZ A;  3CD6 P;  2E75 D;  2R3S A;  3L36 A;  1AQT A;  1KYO E;  2N9Y B;  2ZVN B;  3PH0 A;  1YIJ P;  1URQ C;  1AFO A;  2CPS A;  5CHX A;  1PPJ G;  2W6A A;  2V7Q J;  5AVS B;  3L70 E;  1PFI A;  4RKU J;  1FS0 E;  3HD7 D;  3L73 J;  3P8C D;  1EZV D;  2XDJ A;  2QM8 A;  3BAS A;  4YXW H;  3IR9 A;  1FOS F;  4WY4 D;  1FOS E;  4GOF A;  2YIU C;  1KOR A;  3KPE A;  3L71 J;  3GG2 A;  2IBZ E;  4JQ0 D;  1IFM A;  4KHX A;  2E42 A;  2AEM A;  4EDF A;  2FYZ A;  1FZF A;  4HB1 A;  4OWF A;  3PTZ A;  4WBA A;  3EFF K;  3AE2 C;  1JY2 P;  1ZN5 A;  2D2C C;  1L0N J;  3TGU G;  1FDI A;  2HOD A;  1LJ2 A;  1LP1 A;  4EIJ A;  2Q9I A;  1P84 D;  1M8O B;  2Y9Y A;  5KLV G;  3H1L G;  2M3E A;  1LWU C;  1SQB G;  2E43 A;  3VMZ A;  3R4Y A;  3VTP C;  4ZKU A;  1SFC B;  3G9R A;  2AEJ A;  2KSE A;  3V5B A;  1HUC A;  1SQV K;  2LXC B;  1VQN P;  2ZAE B;  1N86 A;  1K9M Q;  5KJ7 D;  2CK3 H;  4XE5 B;  1RE3 C;  2OGU A;  1MKM A;  3TGU D;  2QJY B;  2E75 C;  3NTN A;  2C9L Y;  3AEG C;  4UB6 H;  1LT9 C;  4YTP C;  1X0T A;  2ZJS E;  4EI2 A;  1VF5 D;  5KLV D;  2A06 D;  1SQB D;  1URQ A;  3WUT A;  3LIE A;  2IYP A;  4DT0 A;  2OTK E;  2G8Y A;  1GW3 A;  1GDT A;  4GOE A;  3MIW A;  2AXC A;  2WSF H;  4U7J A;  3CXH H;  1IFP A;  2Q5U A;  2WQY C;  1M1J C;  3HD7 C;  3CC4 P;  1M1K Q;  2JDI H;  1L0L K;  1BDD A;  1SQV D;  1DX7 A;  3A0H H;  4UB8 E;  1H89 A;  2FXP A;  4WY4 C;  2XKM A;  1HGV A;  2ZT9 B;  1AVO A;  3BRV B;  3L75 E;  4HYT B;  4GIF A;  1BSH A;  1VQ6 P;  2HOD B;  1LP1 B;  1HH0 A;  3CWB J;  2GUV A;  3FXE A;  1EC5 A;  2AEF A;  3HE5 A;  1Y47 A;  1USD A;  1LWU A;  2ZYA A;  3QH9 A;  1LGH B;  1SQX G;  4K35 A;  4QMA A;  4W7Y A;  2BAS A;  3H1J J;  2HPC A;  4IL6 E;  3VYI A;  4H13 B;  2OYO A;  1FJP A;  4O9B A;  1LTJ A;  3BCC D;  1FBM A;  1FZB A;  5AW2 B;  1GL2 D;  3L74 G;  1ZOY C;  1JNM A;  2M8R A;  1RE3 A;  3CCJ P;  1IFD A;  5KJ7 C;  1K05 A;  2W6J H;  1ZLL A;  1LT9 A;  1X22 A;  3EQ2 A;  4CPG A;  3VN0 A;  3TSI A;  2JWD A;  1URQ B;  1KYO D;  1NTZ J;  3RL0 g;  1FU1 A;  3H32 A;  3RBZ A;  4I7Z C;  2Y0E A;  1S9K E;  2A45 G;  3HD7 A;  4K3A A;  2BEZ F;  3CPW O;  1KD1 Q;  3H1K E;  2YIU B;  1BGY J;  1EDI A;  1PGJ A;  4WY4 A;  1YQ4 C;  3SWY A;  3H1H G;  3RL0 B;  4IFD K;  1NAF A;  1UII A;  3TYY A;  1U7M A;  2D2C B;  2WSF J;  3VP9 A;  2XU6 A;  3M0D C;  2IPP A;  5DJU B;  1BE3 G;  1OIP A;  1RH5 B;  3HE5 B;  3O6Q B;  1YJN P;  1H8A A;  1LWU B;  5AW1 B;  1M56 D;  2JJL A;  1T2K D;  5B66 E;  1NU1 J;  3OJA B;  1YI2 P;  2LXB A;  2HPC B;  3CXH I;  5DJT B;  1LTJ B;  2H43 A;  1Y9B A;  1BCC J;  1XTC C;  2Q3E A;  1OX3 A;  3RGU A;  5KJ7 A;  1GL2 C;  3FXD A;  1MZ9 A;  2E75 B;  1SQP K;  1VQ7 P;  3JSV C; 
#chains in the Genus database with same CATH homology
 1J2J B;  1FZE A;  2IFN A;  1JY2 N;  1JMM A;  1LT9 B;  3V2N A;  1RE4 A;  1N73 A;  3A7O A;  4Y99 B;  1SVF A;  1SLQ A;  1RF1 C;  3RL0 D;  3B5N D;  2WPQ A;  1NOH A;  1IC2 A;  3RK3 D;  1JUN A;  2WWW A;  2W27 A;  5CMZ A;  2HLO A;  3V2R A;  2KOG A;  5APU A;  4AQR D;  3U59 A;  1KQL A;  1RE4 C;  4WB4 A;  2NPS B;  1N73 C;  2L5G B;  1QL2 A;  3M0A A;  3RK2 C;  1NTZ K;  1FZA A;  1S9K D;  2WSC H;  5CCH C;  1J1E C;  3LW5 H;  1FZG A;  3HD7 B;  1M7L A;  3CI9 A;  5APY A;  4N6J A;  2N1T C;  2WT7 B;  2WSE H;  2KYV A;  2YKO A;  1SP4 A;  4DZO A;  3IFM A;  5AVZ B;  2WIT A;  1IFN A;  3M9Q A;  1SFC A;  2XV5 A;  4WY4 B;  2JEE A;  5AW0 B;  4C7N B;  3A3Y B;  1L4A D;  1LTT C;  1MFZ A;  4HH2 A;  4C7R A;  1J1D C;  3HRN A;  4XA4 A;  1JO5 A;  1X9V A;  2FYU K;  3GHG B;  2IFM A;  3L36 A;  5AVQ B;  1DEB A;  3N4X A;  1HJB A;  3B5N B;  3TNU B;  1HTL C;  1JY3 O;  3A5T A;  1IFI A;  2Z5H A;  5AW9 B;  2OYI A;  2C9N Y;  1W2E A;  4N3Y B;  2M3B A;  1URQ C;  3V2Q A;  5APV A;  1JY3 N;  1AFO A;  2NPS D;  1G1J A;  1T3J A;  2CPS A;  1LTI C;  3HUS B;  3UIA A;  2C0X A;  5CHX A;  1T2K C;  4AUW A;  3VP8 A;  2HG5 D;  1KIL C;  3OAK A;  2W6A A;  3TK1 A;  4JYB A;  5AVS B;  4JYC A;  1NU1 K;  1N7S C;  1PFI A;  3VOP A;  1T3U A;  1LTB C;  3P7K A;  1OWA A;  2HFE D;  3HD7 D;  1MV8 A;  1RF1 B;  3P8C D;  3II6 A;  2XDJ A;  1VDF A;  2WTY A;  1GL2 A;  2QM8 A;  3A2A A;  2P67 A;  2O01 H;  3BAS A;  1GK4 A;  3IR9 A;  2LKM A;  1FOS F;  5BU8 B;  5CCG C;  1HVV A;  4WY4 D;  1FOS E;  1N73 B;  3KPE A;  2ZFC A;  1OXZ A;  2PAJ A;  1IFM A;  4KHX A;  1RF0 A;  4M3L A;  2E42 A;  2YMY A;  2FYZ A;  2GUS A;  3MD0 A;  1FZF A;  1FDM A;  4C46 A;  4WBA A;  2R32 A;  3V4W A;  1A02 J;  4I1L A;  1JY2 P;  3MUD A;  3RK3 C;  1ZN5 A;  1HBW A;  3KQG A;  3NMD A;  3M9B A;  5AW6 B;  2KSJ A;  1RF0 C;  2HOD A;  5CCH A;  3T97 A;  3VMX A;  1QL1 A;  2WPS A;  4EIJ A;  2Z4E A;  2Q9I A;  1LTS C;  1AQ5 A;  5AW5 B;  1IO4 A;  1NHL A;  1NTK K;  1JCC A;  1CI6 A;  2FKW B;  2N1T A;  1IJD B;  3PP5 A;  1LWU C;  3H32 B;  3VMZ A;  2E43 A;  1CW5 A;  5AW3 B;  2Q3I A;  3VTP C;  4ZKU A;  1SFC B;  2J59 M;  3V5B A;  1HUC A;  1SQV K;  2MJZ A;  2OYH A;  3EFG A;  3KDP B;  1CZQ A;  1H88 A;  4LC1 A;  2I1K A;  5APT A;  3VMY A;  1LTA C;  1N86 A;  2KP8 A;  1FZC C;  5KJ7 D;  4XE5 B;  2A45 H;  1L4A C;  1RE3 C;  5BVZ A;  1WT6 A;  2OYH C;  1CSB A;  1HGZ A;  3NTN A;  2C9L Y;  4N78 D;  1KZU B;  5KTB A;  1LT9 C;  1ZR2 A;  1HWT C;  4Y99 C;  3M91 A;  5AVW B;  2OYI B;  1NH4 A;  2P1J A;  1URQ A;  5AVY B;  3BRT B;  4W80 A;  2C0W A;  3LIE A;  2KB7 P;  1KIL A;  1M1J A;  1NO4 A;  1NKN A;  1GW3 A;  1GDT A;  2O1J A;  1N7S A;  2HYN A;  5APS A;  1Z56 A;  3M9H A;  1ZR4 A;  4IFF A;  2OAR A;  3I5C A;  3MIW A;  3SWF A;  1FAV A;  3WMM 0;  2WSF H;  2P2U A;  4LGD E;  1JY3 P;  1GL2 B;  3C9I A;  2PP6 A;  2Q5U A;  1M1J C;  2YO3 A;  3HD7 C;  2Q7C A;  5CCG A;  1SFC D;  1L0L K;  5AVR B;  1DX7 A;  1E5W A;  1XTG B;  1YTZ I;  1H89 A;  2YNY A;  1JTH A;  2O1K A;  1GTW A;  4WY4 C;  2FFD A;  4JF7 A;  2I1J A;  3B8E B;  2XKM A;  2H7H A;  1HGV A;  3KYQ A;  3B5N A;  3BRV B;  1NTM K;  2ZXE B;  3NFQ A;  4IFM A;  1X8Y A;  2FXM A;  4HYT B;  3HTK A;  4GIF A;  2KLV A;  2CPB A;  1FJK A;  3M06 A;  3RK2 B;  3G3Z A;  2P7J A;  3GHG C;  2FFD C;  2HOD B;  1J1E B;  1HH0 A;  3HE4 A;  3OA7 A;  1WRG A;  5KLV K;  3RL0 C;  3B5N C;  3O8Z A;  2GUV A;  4OH8 B;  1SQB K;  3HE5 A;  3U1C A;  1EQ7 A;  2N1T B;  1LWU A;  1LGH B;  1JY2 O;  3N7N A;  3P8C E;  2YO2 A;  1X79 B;  1KFM A;  4W7Y A;  2BAS A;  1IK9 A;  2HPC A;  3HUS C;  3VYI A;  3NXS A;  3R2P A;  1FJP A;  4O9B A;  1KFN A;  1LTJ A;  1T8Z A;  3BAT A;  1SQQ K;  5AW8 B;  1FZC A;  1FBM A;  1NKZ B;  1GZL A;  1FZB A;  5AW2 B;  1GL2 D;  1JNM A;  2M8R A;  1J1D B;  1IFJ A;  5AW7 B;  1L4A A;  1RE3 A;  5BU5 A;  3L35 A;  1G2C A;  1IFD A;  3CL3 D;  5KJ7 C;  2YKQ A;  5AVX B;  1LTJ C;  4I2L C;  1ZLL A;  1LT9 A;  2WPR A;  5APW A;  3EQ2 A;  2IX7 C;  2R5D A;  3VN0 A;  2XNX A;  2VRS A;  1GW4 A;  3TSI A;  1JCD A;  3MTU E;  2N9B A;  3BVH A;  1URQ B;  2J58 A;  2Z5I A;  3L37 A;  1VPC A;  3V2P A;  1KIL B;  1M1J B;  4B86 A;  1GU5 A;  4I6M C;  5AW4 B;  3RK2 D;  4LLH A;  5CCH D;  1N7S B;  2NPS A;  1N7L A;  1FU1 A;  3H32 A;  3LID A;  5CJ4 A;  1RY3 A;  5APQ A;  4ZKP A;  1S9K E;  3L4F A;  2W6B A;  2N1T D;  2YKP A;  1DH3 A;  4EOT A;  2A45 G;  3HD7 A;  2WT7 A;  2NPS C;  2GM4 A;  4AYC A;  3M0D A;  1JTH B;  1SFC C;  2A45 I;  4WY4 A;  2FFD B;  3SWY A;  1LTG C;  4W7Z A;  3RL0 B;  4C7N A;  4IFD K;  1NAF A;  4GT1 A;  3RK3 B;  4N78 E;  1A02 F;  1GD2 E;  3TYY A;  1GK6 A;  3VP9 A;  3HTK B;  5AVT B;  2XU6 A;  3M0D C;  2IPP A;  3GHG A;  2R3C A;  3HE4 B;  1MUU A;  3V4Q A;  1YTZ T;  3TNU A;  3E1I A;  1YYC A;  3P8M C;  1N2D C;  2R5B A;  3HE5 B;  5APX A;  1H8A A;  1SQX K;  1URQ D;  1LWU B;  5AW1 B;  2JJL A;  1T2K D;  3CLQ A;  2OYI C;  1KIL D;  3P32 A;  3OJA B;  2HPC B;  1N7S D;  3HUS A;  3H6P A;  5AVV B;  1NWQ A;  2QM7 A;  1L0N K;  1LTJ B;  1CI6 B;  2H43 A;  3MGN A;  1FZC B;  2POH A;  5CJ0 A;  4GKG A;  1XTC C;  1L4A B;  1ZV8 A;  4RES B;  4DOJ A;  1RF1 A;  2XZR A;  1G2C B;  5CCG D;  5KJ7 A;  2OYH B;  1GL2 C;  3U1A A;  1JOC A;  1MZ9 A;  1G1I A;  1SQP K;  1GU4 A;  5AVU B;  2H8P D;  2WZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...