1GU5A

Crystal structure of c/ebpbeta bzip homodimer bound to a dna fragment from the mim-1 promoter
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
65
structure length
65
Chain Sequence
DKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Flexible Base Recognition by C/Ebpbeta
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords CAAT/ENHANCER BINDING PROTEIN BETA
total genus 29
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1gu5A00
3M9BA 3P8MC 3TYYA 3IR9A 1SP4A 2R32A 5AW2B 2WTYA 5APQA 2KP8A 4M3LA 4GKGA 2VRSA 3VTPC 3NFQA 5APXA 1H89A 1GD2E 1CI6A 4DZOA 1GK6A 3B8EB 2WT7B 5AVXB 5AW6B 2YO2A 1YYCA 3L35A 5APWA 1HWTC 5AVZB 2P67A 3LIDA 3UIAA 3A7OA 4C7NB 1S9KD 2BASA 3VYIA 3HE5A 5APYA 3SWFA 1A02J 1IO4A 5AVQB 3V5BA 1JNMA 2W6AA 3P7KA 3M0DA 5AW1B 2E43A 3KQGA 1S9KE 4JYBA 2Q5UA 1CZQA 2QM7A 1GK4A 3TK1A 3V4WA 3NXSA 2H7HA 5AW5B 1OXZA 5AVWB 5AVYB 3A5TA 1HJBA 1GU4A 3HTKA 5AW0B 1HBWA 3HE5B 4C46A 3M06A 3T97A 4HYTB 5APSA 5AW4B 2XV5A 3VMZA 3V4QA 2R5DA 2C9LY 2E42A 2YNYA 5AVUB 1GTWA 3A2AA 1CSBA 4C7NA 5APVA 1FOSF 2WPRA 3MD0A 5AW9B 4EOTA 1NAFA 3L36A 2Q7CA 5CMZA 1KQLA 2P7JA 1J2JB 1SLQA 2QM8A 3P32A 2WPQA 4XE5B 2N9BA 3TNUB 4I2LC 1JUNA 4B86A 1T2KD 3L37A 5AVSB 4GT1A 4AUWA 5AW8B 3KDPB 1X8YA 1MFZA 2XZRA 2XU6A 1OWAA 2YO3A 5AVTB 3VMYA 3OAKA 3NMDA 2R3CA 3I5CA 3LIEA 2WWWA 2Z5HA 3HE4A 2JJLA 3VMXA 2WT7A 5APUA 4LC1A 3NTNA 2IPPA 1T2KC 4AYCA 1H88A 2ZXEB 1A02F 3A3YB 3M0AA 3M91A 1G2CB 2Q3IA 5APTA 5AW3B 4RESB 5AVVB 1MV8A 2W27A 2R5BA 3TNUA 1GU5A 1DH3A 3O8ZA 4KHXA 4AQRD 1HUCA 5AW7B 2Z5IA 1MUUA 2ZFCA 4I6MC 2C9NY 4JYCA 3VN0A 5AVRB 1H8AA 1CI6B 2P2UA 3HE4B 1FAVA 1GZLA 1FOSE 3MGNA 3M9HA 2WPSA 1NWQA
chains in the Genus database with same CATH superfamily
2H8PD 1LWUA 4Y99B 1SVFA 1AV1A 1JY3P 3V6IA 4EYYQ 1IK7A 1NHLA 1AJYA 1FDIA 2E5TA 2QVAA 1ZP0C 1ZRTE 3IR9A 4HJGH 2R3SA 5H2FH 1RF1B 1VQPP 3TGUJ 4XA4A 5AW2B 1JEKA 3L72G 1YITP 1EZVD 4ZKPA 2VRSA 1SQPG 3I56P 3MIWA 3NFQA 1N73A 1GD2E 3V2QA 1E5WA 4IFFA 5GTHE 1FDMA 1S4XA 1LT9B 3VOPA 4DZOA 1H0TA 2HPCB 1JMMA 2FYUJ 2QRXA 1DEEG 1KZUB 1NAYA 2WZ7A 1Q81Q 1NTKD 3HUSB 3AE8C 3L70E 2YO2A 1YYCA 4HB1A 3RBZA 2PGDA 3H32A 4OGQC 5APWA 1L0LJ 1S5LH 1NTZE 1OMIA 2HR3A 1VPCA 1ZN5A 2QIWA 3HD7C 1X79B 4WY4A 5AVZB 2IZ0A 2JKVA 2P67A 3UIAA 3MZWB 1R8EA 1N73B 1FZCB 1NTME 1S9KD 3HD7D 1K8AQ 2OYIC 2BEQD 1JY3O 3VYIA 2O01J 3HE5A 1HF9A 3SWFA 3SWYA 3OW2O 2IBZI 3GHGB 1S5LE 1GDTA 2E76B 1JNMA 3P7KA 4A7PA 5KJ7A 2M3BA 2W83C 3AEEC 4YXDC 4Z1MH 2NRGA 1J1EC 4UB8E 4OWFA 3H1JG 1L4AA 2PAJA 1LT9C 3EQ2A 3S1KA 3EFGA 1EZVG 1USEA 1NTZG 2HODB 5AW5B 3V4WA 5AVWB 1KV4A 5KKZB 3CX5H 2A06E 2CPBA 2D2CB 3FGAD 2KB7P 3CCSP 1NTZD 2PRRA 2XNXA 1LTJB 1VF5B 1SQXK 2AEFA 4EI2A 2OYHB 1FZFA 3LW5H 3HD7B 5APSA 1NTKG 5AW4B 1L0LK 1OFCX 5M1BA 3KZIH 1PV3A 2PFXA 2JWAA 1GTWA 2KSJA 1K73Q 1KC8Q 1X22A 1NKZB 1SQBE 3TSIA 3A0BH 2B88A 2KLVA 2HFED 2WMMA 1KYOD 3GHGC 4PD4E 1NVOA 1USDA 3MD0A 2G8YA 3AE5C 5APVA 2ZYAA 5KAFE 3ABVC 2Q9IA 3L36A 1VQ6P 5CMZA 1QVFO 2FXOA 1NTMG 5DJTB 1SLQA 1PZQA 1E79H 1YJNP 2FFDA 2ZYGA 1SQVD 1YBKA 2WPQA 3B5NC 4XE5B 3WU2H 3Q5PA 3H1KG 3PP5A 4UB6H 1NTKE 4CPGA 2K1AA 2GUVA 2WSFH 1HH0A 3H1IG 3L75D 2XKMA 1T6AA 3L74E 3HD7A 1L0NJ 1FC2C 4D6TJ 5AVSB 1T2KD 2BCCG 3AE3C 1EDJA 4AUWA 1LTJA 3RK2C 5KJ7C 2OYHA 2OGUA 3OJAB 3H1HG 1X8YA 1EZVE 1MFZA 1JM0A 1SQVJ 4L76A 4Y99C 2BCCJ 3G3ZA 3CWBG 3S4RA 4C7RA 1S3JA 2NPSD 1T8ZA 2DW3A 1YIJP 3OAKA 3AECC 3H1IJ 1FE6A 2Z5HA 2JJLA 1L0NK 1RE3A 3BCCG 3L70J 2FYNC 5APUA 2YIUB 1OIPA 1VL2A 1LT9A 3M9QA 1SFCD 2JEEA 4YPCA 5B66H 1Y9BA 1H0TB 3FXDA 3HRNA 2IBZG 1D7MA 1JMBA 1N7SC 1DEBA 1SQVK 3B5NB 4AYCA 4TT3H 1RE3C 5BU5A 1NJIQ 1KORA 3RL0C 3H1HE 4OGQB 5H2FE 3V2NA 4WWIA 1GW3A 4U3FE 1SQXE 2H89C 1MUUA 4K3AA 2OYIB 1GW4A 4OH8B 4XFJA 1BCCD 2KZIA 2K9YA 4N78D 4BRYB 3Q5RA 1BDDA 3H25A 1BSNA 2QJPB 2GUSA 2IBZE 1K04A 4WY4D 1PP9J 2N1TC 2OYOA 3ZDMA 1NWQA 2FYUK 1ZW0A 3P8MC 3WUTA 1NU1D 1M90Q 3WMM0 1HGZA 4R4LA 4U7JA 4HKZH 3FWLA 1KYOE 2IFMA 4UB6E 1FU1A 1IZNB 2R32A 2K9JA 2D2CC 2WTYA 4GKGA 1OVVA 5KAIH 5APXA 3U1CA 1PGQA 2E75B 1VQMP 1PIXA 5B66E 2QJKB 1FZBA 2ZAEB 3B8EB 2E75D 2LR2A 2WT7B 5AVXB 1S5LX 5AW6B 3H1LG 3CXHE 1URQA 1DD4A 2M0BA 3O6QB 5C39A 1EXJA 2QJPC 1KMIZ 1IFDA 3GG2A 3LIDA 2H43A 4C7NB 3BCCD 2BASA 1R5SA 1L0LE 3AEFC 5APYA 1AVYA 2CK3H 4WY4C 4IOIH 3QH9A 2A45G 2JWDA 4PJ0E 3V5BA 4ASWA 2OTJP 1LP1A 3M0DA 3CL3D 2E43A 3KQGA 2J59M 2Q5UA 3KHUA 4BWNA 4PD4I 4UB8H 2QM7A 3P8CE 3CMAP 1U7MA 2IBZD 3H32B 3VP9A 2K3RA 5BU8B 3CCRP 1GK4A 3Q2YA 5AVYB 1YTZI 1KN7A 4N78E 2OTKE 3CC7P 4IL6E 4L73A 2HPCA 2P1JA 1M7LA 3HE5B 1SQVG 5CBNA 1IK9A 1P84I 3VMZA 1LWUC 1J1DB 3V4QA 2C9LY 2QG4A 1OW8A 2YKQA 3H1HD 1KB9E 4D6TG 3Q5SA 2FYUD 2RN0A 1CSBA 3A2AA 2FKWB 3FX0A 1GMJA 2Y9ZA 1G2CA 1FZAA 1KQGB 2ZYDA 4NPEA 4WB4A 1FOSF 4ZKUA 4EOTA 1LNQA 2IFNA 3QWOC 1N73C 3SFEC 1LTIC 2IDBA 4BRYA 3CWBJ 4JF7A 2I1KA 1AVOA 1P84D 4R4MA 2P58A 1LJ2A 4H44D 3FWNA 1LP1B 3E7KA 3L70G 1NTMD 2YMKA 2W8ZA 1QX8A 1PGPA 1KYOH 1M1KQ 4RO0A 5KAIE 1MFTA 5CCHA 2SPZA 1JUNA 4B86A 3L37A 4GT1A 1AA0A 4I7ZB 2E74D 4DJGA 1RH5B 1P84H 3JSVC 1KFMA 2QE7H 3N7NA 5KLIC 2N9YB 1BE3G 4W7ZA 1KILD 3Q3DA 1NTMJ 4RKUJ 4Y28J 2YO3A 4U3FD 1LTJC 1VF5C 2BCCE 2HG5D 2IZ1A 1JCCA 2R3CA 2ZVNB 3AE4C 2WSCH 1HJ0A 2WPVB 2WWWA 3L71D 2KNCA 1NU1E 1SQPK 4GOEA 1FS0E 1ZRTD 3MUDA 3B71A 2QEXP 2OYHC 4ZNCA 4N3YB 1AFOA 1H88A 1FJKA 2BCCD 1Q86Q 1JTHB 1NTKJ 3A3YB 3IAOA 1URQD 2Q3IA 3M91A 5B5EE 1JCDA 3MUDC 2RH0A 2W27A 1L0LD 3H1ID 1K05A 4H0LB 3TNUA 2YMYA 4L74A 5KLVD 3TGUE 1SFCB 1KYOI 1SQXD 1BSHA 3KPEA 1ZLLA 2XNDH 3L72E 1W2BO 1KD1Q 2ZFCA 1T3JA 2C0XA 1SQPE 3L72D 3V2PA 2MKVA 2AXCA 3IF4A 4ZMDA 1ZMEC 1VQKP 4WY4B 3VN0A 1RF1A 4EDFA 3CCJP 3PHLA 1CI6B 1HGVA 1KFNA 2Y0EA 5CCHD 1M57D 3CX5D 1JY2P 2P10A 1OX3A 4IFDK 1RHZB 4NPDA 3G71P 1FZCC 4LC1A 1HUCA 3AEAC 3R2PA 4H13B 1IJDB 1FOSE 3M9BA 1SQPJ 2J58A 2KXPB 2WSCJ 3L72J 2FXMA 4OGQD 1LTTC 1FZCA 2L5GB 1JB0J 1NYHA 2E76C 2B9BA 1M8OB 3C8VA 1RF0C 1U57A 2D2CD 1J1EB 2KNCB 4M3LA 3VTPC 3H1LJ 4DCKA 2RMZA 1GL2A 3BATA 1ZR2A 1PP9G 5CCGA 1EDKA 1LWUB 3SFDC 3WU2E 1MKMA 1EQ7A 1GK6A 2LKMA 5KLVG 1RF0A 1SQBG 1DD3A 3PTZA 3W67A 1NGMB 2IYOA 1DX7A 3A0BE 2Q6QA 3L35A 1LTBC 4PJ0H 2YXQB 2FYZA 2M5AA 3N4XA 1NTMK 1UIIA 3B4SA 2N1TD 4H13C 3EWKA 3S9OA 3G9RA 1IO4A 2FBWC 1NKNA 5TISE 5AVQB 3FXEA 3OA7A 1R5LA 3ITKA 5CHXA 1SQBD 5GTIH 5AW1B 2FXPA 3L74G 1BE3J 2KLUA 1NTKK 4BXLA 4IL6H 1CZQA 1G1JA 1PP9D 3BCCJ 2W6JH 1PPJD 3RK3D 4KJMA 3TK1A 5CBOA 3NXSA 2QSIA 1M1JC 2KI7B 1IC2A 2ZT9B 3CXHD 1CW5A 1N7LA 1VQ8P 2KS1B 2BEZF 3C9IA 2AEMA 1N7SD 3PH0A 1PL5A 3TGUD 4C46A 1K9MQ 3H1KE 3II6A 1PPJE 1ZV8A 3L70D 3RK3E 3T97A 4HYTB 2HLOA 2XV5A 4H44C 1OW6A 2NPSC 4PV1B 2E42A 2YNYA 3L74D 5AVUB 1WT6A 3CLQA 5E79H 1IFPA 1BGYG 1NTZK 4C7NA 3G6EP 2OTLP 1X9VA 3D71A 2NPSA 2WPRA 1VQOP 2YKPA 3H1KJ 1NAFA 3AEBC 3O6QA 2Q7CA 1X0TA 2IYPA 2NZ2A 4H0LC 1KQLA 3PRJA 4IL6X 4W7YA 5GTHH 5CCGC 1KB9I 2P7JA 2ZT9D 1J2JB 1NU1K 2QM8A 3BRTB 3E1RA 3H1JD 3P32A 3RBXA 1LTSC 3H1HJ 3CCEP 2KIKA 1SFCA 1TU3F 1IFMA 2IX7C 1YTZT 2O1KA 2WSEH 3BCCE 3RL0D 3TNUB 1VQLP 1URQC 2A45H 1KILE 1BE3E 2CPSA 1NH4A 4IFMA 3H1KD 3WUVA 2ZJSE 3SWKA 5B5EH 1UIXA 2WSSH 1VQNP 1EDIA 4QMAA 1VQ7P 3D70A 1SQQG 2A06D 3L73D 4H44B 1RY3A 3CWBD 1NU1J 1NU1G 1RE4C 4RJTA 2H88C 4L75A 1RQVA 5CCGD 4H13D 1VF5D 1HVVA 3KXDA 5KTBA 1SQXG 3VMYA 2UWJE 3AE2C 3RL0g 2I8DA 1JOCA 3LIEA 2QA4P 1YHQP 1NTZJ 2RKLA 1RE4A 3W68A 1FZGA 1BGYD 2Z4EA 1GL2D 3USSA 2E74C 3RK3B 1Q7YQ 2PP6A 5KJ7D 3RK2D 2LXCB 2JO1A 3NTNA 1L0NE 2V7QJ 1JY3N 3MHVA 5EFWB 1T2KC 3CCUP 2OYIA 4H0LD 3Q1MA 2ZXEB 1QVGO 1A02F 3AEGC 3M0AA 3A0HH 1G2CB 5APTA 3H1LE 3GF3A 2LXBA 1MV8A 5K5GB 2AXTH 1JO5A 1DH3A 3CCLP 3AEDC 3MP7B 2KZJA 2E75C 3CWBE 4KT0J 2QJKC 2WSFJ 2QJYB 1PFIA 5AW7B 2Z5IA 3JC22 3F5HA 4YTPC 4I6MC 1S1CX 1EC5A 1IFNA 4GOFA 1L4AD 4JBZA 4TLFA 2C9NY 1GL2B 1NO4A 5AVRB 3TGUG 1FBMA 1RQUA 2E76D 4N6JA 1FAVA 2V4HA 3P8CD 1T3UA 2E74B 3M9HA 4I1LA 4O9BA 1PPJG 1LTGC 2JP3A 3RK3C 2O1JA 2JR8A 1Q90D 3KZIE 3L73G 3TYYA 5KLIB 3L71E 4PV1D 1SS1A 4K35A 1S72P 2FFDB 3BASA 1KTMA 3CX5I 1SP4A 2AXTE 1M1JB 3KYQA 4PD4D 4U3FJ 4U3FG 5CCHC 1BGYE 4LGDE 1L0LG 2FY8A 2YKOA 3CX5E 1BCCG 2KP8A 3E1IA 1SQBK 2M3EA 5APQA 3T97B 1XTGB 3V2RA 1Y47A 1H89A 1KILA 2GA1A 1CI6A 1QL1A 2FYUG 1SQPD 1G1IA 1Y8AA 4JQ0D 4PV1C 4ASVA 3G4SP 2K88A 5L8RJ 3CCQP 1GL2C 2OARA 1OVRA 1YJWP 1VDFA 5DJUB 1YQ4C 1HWTC 2GM4A 1JY2N 3H1IE 4HH2A 5CJ4A 5KLVJ 2O01H 2ZVOB 1J1DC 3A7OA 3C1LA 2Q3EA 2K9JB 4DOJA 5KLVE 1AQ5A 2J5UA 2FFDC 4W80A 2O01N 1A02J 3H1JE 1OVUA 2Y0DA 4EIJA 2KS1A 1BCCJ 1EZVI 2KYVA 1L4AC 3TF5A 3L4FA 3WUUA 2WVRA 1URQB 1FZEA 1WMKA 2W6AA 3L75J 2FYUE 2B89A 4D6TE 4D6TD 3CC4P 3GW6A 5TJHA 2WITA 3GLMA 4JYBA 1WRGA 1QL2A 1S9KE 1N2DC 1MZ9A 2O3JA 3RK2B 2AEJA 2Y0CA 2K37A 1ZOYC 2H7HA 1L0NG 1OXZA 3AE6C 5TISH 2KSEA 3AE1C 1FDOA 2JDIH 3A5TA 1HJBA 1GU4A 3F89A 5CJ0A 3HTKA 5AW0B 1HBWA 3L71J 1LT1A 2G3AA 3M06A 3MTUE 1W2EA 1M1JA 4WVZA 1KB9H 3GHGA 3H1LD 4I7ZC 5E79E 1VQ4P 2FYNB 2R5DA 2W6BA 1N86A 2YIUC 1HTLC 1W5CE 1IFIA 2HODA 3HUSC 1N7SB 1RF1C 4LLHA 3PLNA 1KQSO 3VMAA 1L4AB 2Y9YA 5AW9B 3BRVB 3B5NA 3CI9A 3RGUA 1L0ND 3RL0B 3R4YA 3D6YA 2KOGA 1SQXJ 3HUSA 1KILC 1PGJA 3CCMP 1U7JA 1XTCC 2I1JA 2N1TA 2WSEJ 1VQ5P 1DIPA 1YI2P 1FJPA 1SQQK 1KB9D 2QJYC 3JCUH 2N9BA 1S2EA 3L71G 4I2LC 5GTIE 3GF7A 3I55P 1Q82Q 3EFFK 2MJZA 1VQ9P 2A45I 4GDOA 1NOHA 4DT0A 1SFCC 3L75E 1OW7A 1ZR4A 4JPZB 3BVHA 3CMEP 1BCCE 2R44A 5AW8B 4GIFA 2WQYC 2N1TB 3H1JJ 3KDPB 3U1AA 4MN4C 1QEXA 2XDJA 3HTKB 2XZRA 1SQQJ 2XU6A 2ZT9C 1JTHA 5KKZC 1OWAA 5KLVK 1LTAC 5AVTB 3CPWO 1Q2NA 3NMDA 3I5CA 2ZXXA 2ITAA 3AE7C 1SQQE 3CXHH 2W90A 1SQVE 1N7SA 1JY2O 1L2PA 2Q1KA 2HYNA 3CXHI 3HE4A 3VP8A 4NPFX 3VMXA 2NPSB 1M56D 2KUBA 2WT7A 2E5YA 1KILB 1N8RQ 2IPPA 3PJSK 2B87A 1Z56A 2M8RA 3L74J 3D6ZA 1SQQD 2A06G 1EXIA 2V7QH 1IFJA 1ZXGA 2POHA 5AW3B 3CD6P 1BDCA 4RESB 1KQFB 3CC2P 5AVVB 1QGKB 2R5BA 2YXRB 1AQTA 3B5ND 3IFMA 3M0DC 3IN6A 1GU5A 1BGYJ 5BVZA 3O8ZA 3H6PA 3JCUE 1EDLA 1QLED 3AE9C 3A0HE 1LGHB 1YQ3C 1PGOA 2OQQA 4GODA 4KHXA 4AQRD 2L91A 2B87B 3TDKA 2C0WA 3L73E 4JYCA 3U59A 1PP9E 2KK7A 2M5AB 1YJ9P 4OVNF 4WBAA 3SSUA 5KAFH 1H8AA 2P2UA 1SQBJ 3HE4B 3LW5J 3CCVP 4PD4H 1P84E 1BE3D 3K5BA 1GZLA 3L75G 3GMAA 1OZHA 4YXWH 3MGNA 2WPSA 3L73J
chains in the Genus database with same CATH topology
2H8PD 1LWUA 4Y99B 1SVFA 1JY3P 1NHLA 3IR9A 4XA4A 5AW2B 4ZKPA 2VRSA 1N73A 3MIWA 3NFQA 1GD2E 1E5WA 4IFFA 1FDMA 1LT9B 3VOPA 4DZOA 2HPCB 1JMMA 1KZUB 2WZ7A 3HUSB 1RF1B 2YO2A 1YYCA 3H32A 5APWA 4IFDK 4WY4A 1VPCA 1ZN5A 3HD7C 1X79B 5AVZB 1N73B 2P67A 3UIAA 1FZCB 1S9KD 3HD7D 2OYIC 1JY3O 3VYIA 3HE5A 3SWFA 3SWYA 3GHGB 1GDTA 1JNMA 3P7KA 2M3BA 1J1EC 1L4AA 2PAJA 1LT9C 3EQ2A 3EFGA 3V4WA 2HODB 5AW5B 5AVWB 2CPBA 2KB7P 2XNXA 1LTJB 2OYHB 1SQXK 1FZFA 3LW5H 3HD7B 5APSA 5AW4B 1L0LK 1GTWA 2KSJA 1NKZB 3TSIA 2KLVA 3V2QA 2HFED 3GHGC 1ZR2A 5APVA 3MD0A 3L36A 5CMZA 1SLQA 3B5NC 2WPQA 4XE5B 3PP5A 2WSFH 2GUVA 1HH0A 2XKMA 3HD7A 1T2KD 5AVSB 4AUWA 1LTJA 3RK2C 5KJ7C 2OYHA 3OJAB 2FFDA 1MFZA 1X8YA 4Y99C 3G3ZA 4C7RA 2NPSD 1T8ZA 3OAKA 2Z5HA 2JJLA 1L0NK 1RE3A 5APUA 1LT9A 1SFCD 2JEEA 3HRNA 3B5NB 1N7SC 1SQVK 4AYCA 1DEBA 1RE3C 5BU5A 3RL0C 3V2NA 1GW3A 1MUUA 2OYIB 1GW4A 4OH8B 4N78D 2GUSA 4WY4D 2N1TC 1NWQA 2FYUK 3P8MC 3WMM0 1HGZA 2IFMA 1FU1A 2R32A 2WTYA 4GKGA 5APXA 3U1CA 1FZBA 3B8EB 2WT7B 5AVXB 5AW6B 1URQA 1IFDA 3LIDA 2H43A 4C7NB 2BASA 5APYA 4WY4C 2A45G 3V5BA 3M0DA 3CL3D 2E43A 3KQGA 2J59M 2Q5UA 2QM7A 3P8CE 3H32B 3VP9A 1GK4A 5AVYB 1YTZI 4N78E 2HPCA 2P1JA 1M7LA 3HE5B 1IK9A 3VMZA 1LWUC 1J1DB 3V4QA 2C9LY 2YKQA 3A2AA 1CSBA 2FKWB 1G2CA 1FZAA 4WB4A 1FOSF 4ZKUA 4EOTA 2IFNA 1N73C 1LTIC 4JF7A 2I1KA 5CCHA 1JUNA 4B86A 3L37A 4GT1A 1KFMA 3N7NA 4W7ZA 1KILD 2YO3A 1LTJC 2HG5D 2R3CA 5KJ7A 2OYHC 1JCCA 2WSCH 2WWWA 1SQPK 3MUDA 1AFOA 4N3YB 1H88A 1FJKA 1JTHB 3A3YB 3M91A 1URQD 2Q3IA 1JCDA 2W27A 3TNUA 2YMYA 1SFCB 3KPEA 1ZLLA 2ZFCA 1T3JA 2C0XA 3V2PA 4WY4B 3VN0A 1CI6B 1HGVA 1KFNA 5CCHD 1JY2P 1FOSE 1FZCC 4LC1A 1HUCA 3R2PA 1IJDB 3M9BA 2J58A 2FXMA 1LTTC 1FZCA 2L5GB 1RF0C 4M3LA 3VTPC 1J1EB 1GL2A 3BATA 5CCGA 1LWUB 1EQ7A 1GK6A 2LKMA 1DX7A 1RF0A 3L35A 1LTBC 2FYZA 3N4XA 1NTMK 2N1TD 1IO4A 1NKNA 5AVQB 3OA7A 5CHXA 5AW1B 1NTKK 1CZQA 1G1JA 3RK3D 3TK1A 3NXSA 1M1JC 1IC2A 1CW5A 1N7LA 3C9IA 1N7SD 4C46A 3II6A 1ZV8A 3T97A 4HYTB 2HLOA 2XV5A 2NPSC 2E42A 2YNYA 5AVUB 1WT6A 3CLQA 4C7NA 1NTZK 1X9VA 2NPSA 2WPRA 2YKPA 1NAFA 2Q7CA 1KQLA 4W7YA 5CCGC 2P7JA 1J2JB 1NU1K 2QM8A 3BRTB 3P32A 1LTSC 1SFCA 2IX7C 1IFMA 2O1KA 1YTZT 2WSEH 3RL0D 3TNUB 1URQC 2A45H 2CPSA 4IFMA 1NH4A 1RY3A 1RE4C 5CCGD 1HVVA 5KTBA 3VMYA 3LIEA 1JOCA 1RE4A 2Z4EA 1GL2D 3RK3B 2PP6A 5KJ7D 3RK2D 3NTNA 1JY3N 1T2KC 2OYIA 2ZXEB 1A02F 3M0AA 1G2CB 5APTA 1MV8A 1JO5A 1DH3A 1PFIA 5AW7B 2Z5IA 4I6MC 2C9NY 1IFNA 1L4AD 1GL2B 1NO4A 5AVRB 1FBMA 4N6JA 1FAVA 3P8CD 1T3UA 4I1LA 3M9HA 4O9BA 3RK3C 1LTGC 1FJPA 2O1JA 3TYYA 2FFDB 3BASA 1SP4A 1M1JB 3KYQA 5CCHC 4LGDE 2YKOA 3E1IA 5APQA 2KP8A 3V2RA 1SQBK 1XTGB 1H89A 1KILA 1CI6A 1QL1A 1G1IA 1GL2C 2OARA 1VDFA 1HWTC 2GM4A 1JY2N 4HH2A 5CJ4A 2O01H 1J1DC 3A7OA 4DOJA 1AQ5A 2FFDC 4W80A 1A02J 4EIJA 2KYVA 1L4AC 3L4FA 1URQB 1FZEA 2W6AA 2WITA 1S9KE 4JYBA 1WRGA 1QL2A 1N2DC 1MZ9A 3RK2B 2H7HA 1OXZA 3A5TA 1HJBA 1GU4A 5CJ0A 3HTKA 5AW0B 1HBWA 3M06A 3MTUE 1W2EA 1M1JA 3GHGA 2R5DA 2W6BA 1N86A 1HTLC 1IFIA 2HODA 3HUSC 1N7SB 1RF1C 4LLHA 1L4AB 5AW9B 3BRVB 3B5NA 3CI9A 3RL0B 2KOGA 3HUSA 1KILC 1RF1A 1XTCC 2I1JA 2N1TA 1SQQK 2N9BA 4I2LC 2MJZA 2A45I 1NOHA 1SFCC 1ZR4A 3BVHA 5AW8B 4GIFA 3U1AA 2N1TB 3KDPB 2XDJA 3HTKB 2XZRA 2XU6A 1JTHA 5KLVK 1OWAA 1LTAC 5AVTB 3NMDA 3I5CA 1FZGA 3M9QA 1N7SA 1JY2O 3HE4A 3VP8A 2HYNA 3VMXA 5BU8B 2WT7A 2NPSB 1KILB 2IPPA 2M8RA 1Z56A 1IFJA 5AW3B 2POHA 4RESB 5AVVB 2Q9IA 2R5BA 3B5ND 3IFMA 1GU5A 3M0DC 5BVZA 3O8ZA 3H6PA 1LGHB 4KHXA 4AQRD 2C0WA 3U59A 4JYCA 1H8AA 4WBAA 2P2UA 3HE4B 1GZLA 3MGNA 2WPSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M9B A;  3P8M C;  3TYY A;  3IR9 A;  1SP4 A;  2R32 A;  5AW2 B;  2WTY A;  5APQ A;  2KP8 A;  4M3L A;  4GKG A;  2VRS A;  3VTP C;  3NFQ A;  5APX A;  1H89 A;  1GD2 E;  1CI6 A;  4DZO A;  1GK6 A;  3B8E B;  2WT7 B;  5AVX B;  5AW6 B;  2YO2 A;  1YYC A;  3L35 A;  5APW A;  1HWT C;  5AVZ B;  2P67 A;  3LID A;  3UIA A;  3A7O A;  4C7N B;  1S9K D;  2BAS A;  3VYI A;  3HE5 A;  5APY A;  3SWF A;  1A02 J;  1IO4 A;  5AVQ B;  3V5B A;  1JNM A;  2W6A A;  3P7K A;  3M0D A;  5AW1 B;  2E43 A;  3KQG A;  1S9K E;  4JYB A;  2Q5U A;  1CZQ A;  2QM7 A;  1GK4 A;  3TK1 A;  3V4W A;  3NXS A;  2H7H A;  5AW5 B;  1OXZ A;  5AVW B;  5AVY B;  3A5T A;  1HJB A;  1GU4 A;  3HTK A;  5AW0 B;  1HBW A;  3HE5 B;  4C46 A;  3M06 A;  3T97 A;  4HYT B;  5APS A;  5AW4 B;  2XV5 A;  3VMZ A;  3V4Q A;  2R5D A;  2C9L Y;  2E42 A;  2YNY A;  5AVU B;  1GTW A;  3A2A A;  1CSB A;  4C7N A;  5APV A;  1FOS F;  2WPR A;  3MD0 A;  5AW9 B;  4EOT A;  1NAF A;  3L36 A;  2Q7C A;  5CMZ A;  1KQL A;  2P7J A;  1J2J B;  1SLQ A;  2QM8 A;  3P32 A;  2WPQ A;  4XE5 B;  2N9B A;  3TNU B;  4I2L C;  1JUN A;  4B86 A;  1T2K D;  3L37 A;  5AVS B;  4GT1 A;  4AUW A;  5AW8 B;  3KDP B;  1X8Y A;  1MFZ A;  2XZR A;  2XU6 A;  1OWA A;  2YO3 A;  5AVT B;  3VMY A;  3OAK A;  3NMD A;  2R3C A;  3I5C A;  3LIE A;  2WWW A;  2Z5H A;  3HE4 A;  2JJL A;  3VMX A;  2WT7 A;  5APU A;  4LC1 A;  3NTN A;  2IPP A;  1T2K C;  4AYC A;  1H88 A;  2ZXE B;  1A02 F;  3A3Y B;  3M0A A;  3M91 A;  1G2C B;  2Q3I A;  5APT A;  5AW3 B;  4RES B;  5AVV B;  1MV8 A;  2W27 A;  2R5B A;  3TNU A;  1GU5 A;  1DH3 A;  3O8Z A;  4KHX A;  4AQR D;  1HUC A;  5AW7 B;  2Z5I A;  1MUU A;  2ZFC A;  4I6M C;  2C9N Y;  4JYC A;  3VN0 A;  5AVR B;  1H8A A;  1CI6 B;  2P2U A;  3HE4 B;  1FAV A;  1GZL A;  1FOS E;  3MGN A;  3M9H A;  2WPS A;  1NWQ A; 
#chains in the Genus database with same CATH topology
 2H8P D;  1LWU A;  4Y99 B;  1SVF A;  1AV1 A;  1JY3 P;  3V6I A;  4EYY Q;  1IK7 A;  1NHL A;  1AJY A;  1FDI A;  2E5T A;  2QVA A;  1ZP0 C;  1ZRT E;  3IR9 A;  4HJG H;  2R3S A;  5H2F H;  1RF1 B;  1VQP P;  3TGU J;  4XA4 A;  5AW2 B;  1JEK A;  3L72 G;  1YIT P;  1EZV D;  4ZKP A;  2VRS A;  1SQP G;  3I56 P;  3MIW A;  3NFQ A;  1N73 A;  1GD2 E;  3V2Q A;  1E5W A;  4IFF A;  5GTH E;  1FDM A;  1S4X A;  1LT9 B;  3VOP A;  4DZO A;  1H0T A;  2HPC B;  1JMM A;  2FYU J;  2QRX A;  1DEE G;  1KZU B;  1NAY A;  2WZ7 A;  1Q81 Q;  1NTK D;  3HUS B;  3AE8 C;  3L70 E;  2YO2 A;  1YYC A;  4HB1 A;  3RBZ A;  2PGD A;  3H32 A;  4OGQ C;  5APW A;  1L0L J;  1S5L H;  1NTZ E;  1OMI A;  2HR3 A;  1VPC A;  1ZN5 A;  2QIW A;  3HD7 C;  1X79 B;  4WY4 A;  5AVZ B;  2IZ0 A;  2JKV A;  2P67 A;  3UIA A;  3MZW B;  1R8E A;  1N73 B;  1FZC B;  1NTM E;  1S9K D;  3HD7 D;  1K8A Q;  2OYI C;  2BEQ D;  1JY3 O;  3VYI A;  2O01 J;  3HE5 A;  1HF9 A;  3SWF A;  3SWY A;  3OW2 O;  2IBZ I;  3GHG B;  1S5L E;  1GDT A;  2E76 B;  1JNM A;  3P7K A;  4A7P A;  5KJ7 A;  2M3B A;  2W83 C;  3AEE C;  4YXD C;  4Z1M H;  2NRG A;  1J1E C;  4UB8 E;  4OWF A;  3H1J G;  1L4A A;  2PAJ A;  1LT9 C;  3EQ2 A;  3S1K A;  3EFG A;  1EZV G;  1USE A;  1NTZ G;  2HOD B;  5AW5 B;  3V4W A;  5AVW B;  1KV4 A;  5KKZ B;  3CX5 H;  2A06 E;  2CPB A;  2D2C B;  3FGA D;  2KB7 P;  3CCS P;  1NTZ D;  2PRR A;  2XNX A;  1LTJ B;  1VF5 B;  1SQX K;  2AEF A;  4EI2 A;  2OYH B;  1FZF A;  3LW5 H;  3HD7 B;  5APS A;  1NTK G;  5AW4 B;  1L0L K;  1OFC X;  5M1B A;  3KZI H;  1PV3 A;  2PFX A;  2JWA A;  1GTW A;  2KSJ A;  1K73 Q;  1KC8 Q;  1X22 A;  1NKZ B;  1SQB E;  3TSI A;  3A0B H;  2B88 A;  2KLV A;  2HFE D;  2WMM A;  1KYO D;  3GHG C;  4PD4 E;  1NVO A;  1USD A;  3MD0 A;  2G8Y A;  3AE5 C;  5APV A;  2ZYA A;  5KAF E;  3ABV C;  2Q9I A;  3L36 A;  1VQ6 P;  5CMZ A;  1QVF O;  2FXO A;  1NTM G;  5DJT B;  1SLQ A;  1PZQ A;  1E79 H;  1YJN P;  2FFD A;  2ZYG A;  1SQV D;  1YBK A;  2WPQ A;  3B5N C;  4XE5 B;  3WU2 H;  3Q5P A;  3H1K G;  3PP5 A;  4UB6 H;  1NTK E;  4CPG A;  2K1A A;  2GUV A;  2WSF H;  1HH0 A;  3H1I G;  3L75 D;  2XKM A;  1T6A A;  3L74 E;  3HD7 A;  1L0N J;  1FC2 C;  4D6T J;  5AVS B;  1T2K D;  2BCC G;  3AE3 C;  1EDJ A;  4AUW A;  1LTJ A;  3RK2 C;  5KJ7 C;  2OYH A;  2OGU A;  3OJA B;  3H1H G;  1X8Y A;  1EZV E;  1MFZ A;  1JM0 A;  1SQV J;  4L76 A;  4Y99 C;  2BCC J;  3G3Z A;  3CWB G;  3S4R A;  4C7R A;  1S3J A;  2NPS D;  1T8Z A;  2DW3 A;  1YIJ P;  3OAK A;  3AEC C;  3H1I J;  1FE6 A;  2Z5H A;  2JJL A;  1L0N K;  1RE3 A;  3BCC G;  3L70 J;  2FYN C;  5APU A;  2YIU B;  1OIP A;  1VL2 A;  1LT9 A;  3M9Q A;  1SFC D;  2JEE A;  4YPC A;  5B66 H;  1Y9B A;  1H0T B;  3FXD A;  3HRN A;  2IBZ G;  1D7M A;  1JMB A;  1N7S C;  1DEB A;  1SQV K;  3B5N B;  4AYC A;  4TT3 H;  1RE3 C;  5BU5 A;  1NJI Q;  1KOR A;  3RL0 C;  3H1H E;  4OGQ B;  5H2F E;  3V2N A;  4WWI A;  1GW3 A;  4U3F E;  1SQX E;  2H89 C;  1MUU A;  4K3A A;  2OYI B;  1GW4 A;  4OH8 B;  4XFJ A;  1BCC D;  2KZI A;  2K9Y A;  4N78 D;  4BRY B;  3Q5R A;  1BDD A;  3H25 A;  1BSN A;  2QJP B;  2GUS A;  2IBZ E;  1K04 A;  4WY4 D;  1PP9 J;  2N1T C;  2OYO A;  3ZDM A;  1NWQ A;  2FYU K;  1ZW0 A;  3P8M C;  3WUT A;  1NU1 D;  1M90 Q;  3WMM 0;  1HGZ A;  4R4L A;  4U7J A;  4HKZ H;  3FWL A;  1KYO E;  2IFM A;  4UB6 E;  1FU1 A;  1IZN B;  2R32 A;  2K9J A;  2D2C C;  2WTY A;  4GKG A;  1OVV A;  5KAI H;  5APX A;  3U1C A;  1PGQ A;  2E75 B;  1VQM P;  1PIX A;  5B66 E;  2QJK B;  1FZB A;  2ZAE B;  3B8E B;  2E75 D;  2LR2 A;  2WT7 B;  5AVX B;  1S5L X;  5AW6 B;  3H1L G;  3CXH E;  1URQ A;  1DD4 A;  2M0B A;  3O6Q B;  5C39 A;  1EXJ A;  2QJP C;  1KMI Z;  1IFD A;  3GG2 A;  3LID A;  2H43 A;  4C7N B;  3BCC D;  2BAS A;  1R5S A;  1L0L E;  3AEF C;  5APY A;  1AVY A;  2CK3 H;  4WY4 C;  4IOI H;  3QH9 A;  2A45 G;  2JWD A;  4PJ0 E;  3V5B A;  4ASW A;  2OTJ P;  1LP1 A;  3M0D A;  3CL3 D;  2E43 A;  3KQG A;  2J59 M;  2Q5U A;  3KHU A;  4BWN A;  4PD4 I;  4UB8 H;  2QM7 A;  3P8C E;  3CMA P;  1U7M A;  2IBZ D;  3H32 B;  3VP9 A;  2K3R A;  5BU8 B;  3CCR P;  1GK4 A;  3Q2Y A;  5AVY B;  1YTZ I;  1KN7 A;  4N78 E;  2OTK E;  3CC7 P;  4IL6 E;  4L73 A;  2HPC A;  2P1J A;  1M7L A;  3HE5 B;  1SQV G;  5CBN A;  1IK9 A;  1P84 I;  3VMZ A;  1LWU C;  1J1D B;  3V4Q A;  2C9L Y;  2QG4 A;  1OW8 A;  2YKQ A;  3H1H D;  1KB9 E;  4D6T G;  3Q5S A;  2FYU D;  2RN0 A;  1CSB A;  3A2A A;  2FKW B;  3FX0 A;  1GMJ A;  2Y9Z A;  1G2C A;  1FZA A;  1KQG B;  2ZYD A;  4NPE A;  4WB4 A;  1FOS F;  4ZKU A;  4EOT A;  1LNQ A;  2IFN A;  3QWO C;  1N73 C;  3SFE C;  1LTI C;  2IDB A;  4BRY A;  3CWB J;  4JF7 A;  2I1K A;  1AVO A;  1P84 D;  4R4M A;  2P58 A;  1LJ2 A;  4H44 D;  3FWN A;  1LP1 B;  3E7K A;  3L70 G;  1NTM D;  2YMK A;  2W8Z A;  1QX8 A;  1PGP A;  1KYO H;  1M1K Q;  4RO0 A;  5KAI E;  1MFT A;  5CCH A;  2SPZ A;  1JUN A;  4B86 A;  3L37 A;  4GT1 A;  1AA0 A;  4I7Z B;  2E74 D;  4DJG A;  1RH5 B;  1P84 H;  3JSV C;  1KFM A;  2QE7 H;  3N7N A;  5KLI C;  2N9Y B;  1BE3 G;  4W7Z A;  1KIL D;  3Q3D A;  1NTM J;  4RKU J;  4Y28 J;  2YO3 A;  4U3F D;  1LTJ C;  1VF5 C;  2BCC E;  2HG5 D;  2IZ1 A;  1JCC A;  2R3C A;  2ZVN B;  3AE4 C;  2WSC H;  1HJ0 A;  2WPV B;  2WWW A;  3L71 D;  2KNC A;  1NU1 E;  1SQP K;  4GOE A;  1FS0 E;  1ZRT D;  3MUD A;  3B71 A;  2QEX P;  2OYH C;  4ZNC A;  4N3Y B;  1AFO A;  1H88 A;  1FJK A;  2BCC D;  1Q86 Q;  1JTH B;  1NTK J;  3A3Y B;  3IAO A;  1URQ D;  2Q3I A;  3M91 A;  5B5E E;  1JCD A;  3MUD C;  2RH0 A;  2W27 A;  1L0L D;  3H1I D;  1K05 A;  4H0L B;  3TNU A;  2YMY A;  4L74 A;  5KLV D;  3TGU E;  1SFC B;  1KYO I;  1SQX D;  1BSH A;  3KPE A;  1ZLL A;  2XND H;  3L72 E;  1W2B O;  1KD1 Q;  2ZFC A;  1T3J A;  2C0X A;  1SQP E;  3L72 D;  3V2P A;  2MKV A;  2AXC A;  3IF4 A;  4ZMD A;  1ZME C;  1VQK P;  4WY4 B;  3VN0 A;  1RF1 A;  4EDF A;  3CCJ P;  3PHL A;  1CI6 B;  1HGV A;  1KFN A;  2Y0E A;  5CCH D;  1M57 D;  3CX5 D;  1JY2 P;  2P10 A;  1OX3 A;  4IFD K;  1RHZ B;  4NPD A;  3G71 P;  1FZC C;  4LC1 A;  1HUC A;  3AEA C;  3R2P A;  4H13 B;  1IJD B;  1FOS E;  3M9B A;  1SQP J;  2J58 A;  2KXP B;  2WSC J;  3L72 J;  2FXM A;  4OGQ D;  1LTT C;  1FZC A;  2L5G B;  1JB0 J;  1NYH A;  2E76 C;  2B9B A;  1M8O B;  3C8V A;  1RF0 C;  1U57 A;  2D2C D;  1J1E B;  2KNC B;  4M3L A;  3VTP C;  3H1L J;  4DCK A;  2RMZ A;  1GL2 A;  3BAT A;  1ZR2 A;  1PP9 G;  5CCG A;  1EDK A;  1LWU B;  3SFD C;  3WU2 E;  1MKM A;  1EQ7 A;  1GK6 A;  2LKM A;  5KLV G;  1RF0 A;  1SQB G;  1DD3 A;  3PTZ A;  3W67 A;  1NGM B;  2IYO A;  1DX7 A;  3A0B E;  2Q6Q A;  3L35 A;  1LTB C;  4PJ0 H;  2YXQ B;  2FYZ A;  2M5A A;  3N4X A;  1NTM K;  1UII A;  3B4S A;  2N1T D;  4H13 C;  3EWK A;  3S9O A;  3G9R A;  1IO4 A;  2FBW C;  1NKN A;  5TIS E;  5AVQ B;  3FXE A;  3OA7 A;  1R5L A;  3ITK A;  5CHX A;  1SQB D;  5GTI H;  5AW1 B;  2FXP A;  3L74 G;  1BE3 J;  2KLU A;  1NTK K;  4BXL A;  4IL6 H;  1CZQ A;  1G1J A;  1PP9 D;  3BCC J;  2W6J H;  1PPJ D;  3RK3 D;  4KJM A;  3TK1 A;  5CBO A;  3NXS A;  2QSI A;  1M1J C;  2KI7 B;  1IC2 A;  2ZT9 B;  3CXH D;  1CW5 A;  1N7L A;  1VQ8 P;  2KS1 B;  2BEZ F;  3C9I A;  2AEM A;  1N7S D;  3PH0 A;  1PL5 A;  3TGU D;  4C46 A;  1K9M Q;  3H1K E;  3II6 A;  1PPJ E;  1ZV8 A;  3L70 D;  3RK3 E;  3T97 A;  4HYT B;  2HLO A;  2XV5 A;  4H44 C;  1OW6 A;  2NPS C;  4PV1 B;  2E42 A;  2YNY A;  3L74 D;  5AVU B;  1WT6 A;  3CLQ A;  5E79 H;  1IFP A;  1BGY G;  1NTZ K;  4C7N A;  3G6E P;  2OTL P;  1X9V A;  3D71 A;  2NPS A;  2WPR A;  1VQO P;  2YKP A;  3H1K J;  1NAF A;  3AEB C;  3O6Q A;  2Q7C A;  1X0T A;  2IYP A;  2NZ2 A;  4H0L C;  1KQL A;  3PRJ A;  4IL6 X;  4W7Y A;  5GTH H;  5CCG C;  1KB9 I;  2P7J A;  2ZT9 D;  1J2J B;  1NU1 K;  2QM8 A;  3BRT B;  3E1R A;  3H1J D;  3P32 A;  3RBX A;  1LTS C;  3H1H J;  3CCE P;  2KIK A;  1SFC A;  1TU3 F;  1IFM A;  2IX7 C;  1YTZ T;  2O1K A;  2WSE H;  3BCC E;  3RL0 D;  3TNU B;  1VQL P;  1URQ C;  2A45 H;  1KIL E;  1BE3 E;  2CPS A;  1NH4 A;  4IFM A;  3H1K D;  3WUV A;  2ZJS E;  3SWK A;  5B5E H;  1UIX A;  2WSS H;  1VQN P;  1EDI A;  4QMA A;  1VQ7 P;  3D70 A;  1SQQ G;  2A06 D;  3L73 D;  4H44 B;  1RY3 A;  3CWB D;  1NU1 J;  1NU1 G;  1RE4 C;  4RJT A;  2H88 C;  4L75 A;  1RQV A;  5CCG D;  4H13 D;  1VF5 D;  1HVV A;  3KXD A;  5KTB A;  1SQX G;  3VMY A;  2UWJ E;  3AE2 C;  3RL0 g;  2I8D A;  1JOC A;  3LIE A;  2QA4 P;  1YHQ P;  1NTZ J;  2RKL A;  1RE4 A;  3W68 A;  1FZG A;  1BGY D;  2Z4E A;  1GL2 D;  3USS A;  2E74 C;  3RK3 B;  1Q7Y Q;  2PP6 A;  5KJ7 D;  3RK2 D;  2LXC B;  2JO1 A;  3NTN A;  1L0N E;  2V7Q J;  1JY3 N;  3MHV A;  5EFW B;  1T2K C;  3CCU P;  2OYI A;  4H0L D;  3Q1M A;  2ZXE B;  1QVG O;  1A02 F;  3AEG C;  3M0A A;  3A0H H;  1G2C B;  5APT A;  3H1L E;  3GF3 A;  2LXB A;  1MV8 A;  5K5G B;  2AXT H;  1JO5 A;  1DH3 A;  3CCL P;  3AED C;  3MP7 B;  2KZJ A;  2E75 C;  3CWB E;  4KT0 J;  2QJK C;  2WSF J;  2QJY B;  1PFI A;  5AW7 B;  2Z5I A;  3JC2 2;  3F5H A;  4YTP C;  4I6M C;  1S1C X;  1EC5 A;  1IFN A;  4GOF A;  1L4A D;  4JBZ A;  4TLF A;  2C9N Y;  1GL2 B;  1NO4 A;  5AVR B;  3TGU G;  1FBM A;  1RQU A;  2E76 D;  4N6J A;  1FAV A;  2V4H A;  3P8C D;  1T3U A;  2E74 B;  3M9H A;  4I1L A;  4O9B A;  1PPJ G;  1LTG C;  2JP3 A;  3RK3 C;  2O1J A;  2JR8 A;  1Q90 D;  3KZI E;  3L73 G;  3TYY A;  5KLI B;  3L71 E;  4PV1 D;  1SS1 A;  4K35 A;  1S72 P;  2FFD B;  3BAS A;  1KTM A;  3CX5 I;  1SP4 A;  2AXT E;  1M1J B;  3KYQ A;  4PD4 D;  4U3F J;  4U3F G;  5CCH C;  1BGY E;  4LGD E;  1L0L G;  2FY8 A;  2YKO A;  3CX5 E;  1BCC G;  2KP8 A;  3E1I A;  1SQB K;  2M3E A;  5APQ A;  3T97 B;  1XTG B;  3V2R A;  1Y47 A;  1H89 A;  1KIL A;  2GA1 A;  1CI6 A;  1QL1 A;  2FYU G;  1SQP D;  1G1I A;  1Y8A A;  4JQ0 D;  4PV1 C;  4ASV A;  3G4S P;  2K88 A;  5L8R J;  3CCQ P;  1GL2 C;  2OAR A;  1OVR A;  1YJW P;  1VDF A;  5DJU B;  1YQ4 C;  1HWT C;  2GM4 A;  1JY2 N;  3H1I E;  4HH2 A;  5CJ4 A;  5KLV J;  2O01 H;  2ZVO B;  1J1D C;  3A7O A;  3C1L A;  2Q3E A;  2K9J B;  4DOJ A;  5KLV E;  1AQ5 A;  2J5U A;  2FFD C;  4W80 A;  2O01 N;  1A02 J;  3H1J E;  1OVU A;  2Y0D A;  4EIJ A;  2KS1 A;  1BCC J;  1EZV I;  2KYV A;  1L4A C;  3TF5 A;  3L4F A;  3WUU A;  2WVR A;  1URQ B;  1FZE A;  1WMK A;  2W6A A;  3L75 J;  2FYU E;  2B89 A;  4D6T E;  4D6T D;  3CC4 P;  3GW6 A;  5TJH A;  2WIT A;  3GLM A;  4JYB A;  1WRG A;  1QL2 A;  1S9K E;  1N2D C;  1MZ9 A;  2O3J A;  3RK2 B;  2AEJ A;  2Y0C A;  2K37 A;  1ZOY C;  2H7H A;  1L0N G;  1OXZ A;  3AE6 C;  5TIS H;  2KSE A;  3AE1 C;  1FDO A;  2JDI H;  3A5T A;  1HJB A;  1GU4 A;  3F89 A;  5CJ0 A;  3HTK A;  5AW0 B;  1HBW A;  3L71 J;  1LT1 A;  2G3A A;  3M06 A;  3MTU E;  1W2E A;  1M1J A;  4WVZ A;  1KB9 H;  3GHG A;  3H1L D;  4I7Z C;  5E79 E;  1VQ4 P;  2FYN B;  2R5D A;  2W6B A;  1N86 A;  2YIU C;  1HTL C;  1W5C E;  1IFI A;  2HOD A;  3HUS C;  1N7S B;  1RF1 C;  4LLH A;  3PLN A;  1KQS O;  3VMA A;  1L4A B;  2Y9Y A;  5AW9 B;  3BRV B;  3B5N A;  3CI9 A;  3RGU A;  1L0N D;  3RL0 B;  3R4Y A;  3D6Y A;  2KOG A;  1SQX J;  3HUS A;  1KIL C;  1PGJ A;  3CCM P;  1U7J A;  1XTC C;  2I1J A;  2N1T A;  2WSE J;  1VQ5 P;  1DIP A;  1YI2 P;  1FJP A;  1SQQ K;  1KB9 D;  2QJY C;  3JCU H;  2N9B A;  1S2E A;  3L71 G;  4I2L C;  5GTI E;  3GF7 A;  3I55 P;  1Q82 Q;  3EFF K;  2MJZ A;  1VQ9 P;  2A45 I;  4GDO A;  1NOH A;  4DT0 A;  1SFC C;  3L75 E;  1OW7 A;  1ZR4 A;  4JPZ B;  3BVH A;  3CME P;  1BCC E;  2R44 A;  5AW8 B;  4GIF A;  2WQY C;  2N1T B;  3H1J J;  3KDP B;  3U1A A;  4MN4 C;  1QEX A;  2XDJ A;  3HTK B;  2XZR A;  1SQQ J;  2XU6 A;  2ZT9 C;  1JTH A;  5KKZ C;  1OWA A;  5KLV K;  1LTA C;  5AVT B;  3CPW O;  1Q2N A;  3NMD A;  3I5C A;  2ZXX A;  2ITA A;  3AE7 C;  1SQQ E;  3CXH H;  2W90 A;  1SQV E;  1N7S A;  1JY2 O;  1L2P A;  2Q1K A;  2HYN A;  3CXH I;  3HE4 A;  3VP8 A;  4NPF X;  3VMX A;  2NPS B;  1M56 D;  2KUB A;  2WT7 A;  2E5Y A;  1KIL B;  1N8R Q;  2IPP A;  3PJS K;  2B87 A;  1Z56 A;  2M8R A;  3L74 J;  3D6Z A;  1SQQ D;  2A06 G;  1EXI A;  2V7Q H;  1IFJ A;  1ZXG A;  2POH A;  5AW3 B;  3CD6 P;  1BDC A;  4RES B;  1KQF B;  3CC2 P;  5AVV B;  1QGK B;  2R5B A;  2YXR B;  1AQT A;  3B5N D;  3IFM A;  3M0D C;  3IN6 A;  1GU5 A;  1BGY J;  5BVZ A;  3O8Z A;  3H6P A;  3JCU E;  1EDL A;  1QLE D;  3AE9 C;  3A0H E;  1LGH B;  1YQ3 C;  1PGO A;  2OQQ A;  4GOD A;  4KHX A;  4AQR D;  2L91 A;  2B87 B;  3TDK A;  2C0W A;  3L73 E;  4JYC A;  3U59 A;  1PP9 E;  2KK7 A;  2M5A B;  1YJ9 P;  4OVN F;  4WBA A;  3SSU A;  5KAF H;  1H8A A;  2P2U A;  1SQB J;  3HE4 B;  3LW5 J;  3CCV P;  4PD4 H;  1P84 E;  1BE3 D;  3K5B A;  1GZL A;  3L75 G;  3GMA A;  1OZH A;  4YXW H;  3MGN A;  2WPS A;  3L73 J; 
#chains in the Genus database with same CATH homology
 2H8P D;  1LWU A;  4Y99 B;  1SVF A;  1JY3 P;  1NHL A;  3IR9 A;  4XA4 A;  5AW2 B;  4ZKP A;  2VRS A;  1N73 A;  3MIW A;  3NFQ A;  1GD2 E;  1E5W A;  4IFF A;  1FDM A;  1LT9 B;  3VOP A;  4DZO A;  2HPC B;  1JMM A;  1KZU B;  2WZ7 A;  3HUS B;  1RF1 B;  2YO2 A;  1YYC A;  3H32 A;  5APW A;  4IFD K;  4WY4 A;  1VPC A;  1ZN5 A;  3HD7 C;  1X79 B;  5AVZ B;  1N73 B;  2P67 A;  3UIA A;  1FZC B;  1S9K D;  3HD7 D;  2OYI C;  1JY3 O;  3VYI A;  3HE5 A;  3SWF A;  3SWY A;  3GHG B;  1GDT A;  1JNM A;  3P7K A;  2M3B A;  1J1E C;  1L4A A;  2PAJ A;  1LT9 C;  3EQ2 A;  3EFG A;  3V4W A;  2HOD B;  5AW5 B;  5AVW B;  2CPB A;  2KB7 P;  2XNX A;  1LTJ B;  2OYH B;  1SQX K;  1FZF A;  3LW5 H;  3HD7 B;  5APS A;  5AW4 B;  1L0L K;  1GTW A;  2KSJ A;  1NKZ B;  3TSI A;  2KLV A;  3V2Q A;  2HFE D;  3GHG C;  1ZR2 A;  5APV A;  3MD0 A;  3L36 A;  5CMZ A;  1SLQ A;  3B5N C;  2WPQ A;  4XE5 B;  3PP5 A;  2WSF H;  2GUV A;  1HH0 A;  2XKM A;  3HD7 A;  1T2K D;  5AVS B;  4AUW A;  1LTJ A;  3RK2 C;  5KJ7 C;  2OYH A;  3OJA B;  2FFD A;  1MFZ A;  1X8Y A;  4Y99 C;  3G3Z A;  4C7R A;  2NPS D;  1T8Z A;  3OAK A;  2Z5H A;  2JJL A;  1L0N K;  1RE3 A;  5APU A;  1LT9 A;  1SFC D;  2JEE A;  3HRN A;  3B5N B;  1N7S C;  1SQV K;  4AYC A;  1DEB A;  1RE3 C;  5BU5 A;  3RL0 C;  3V2N A;  1GW3 A;  1MUU A;  2OYI B;  1GW4 A;  4OH8 B;  4N78 D;  2GUS A;  4WY4 D;  2N1T C;  1NWQ A;  2FYU K;  3P8M C;  3WMM 0;  1HGZ A;  2IFM A;  1FU1 A;  2R32 A;  2WTY A;  4GKG A;  5APX A;  3U1C A;  1FZB A;  3B8E B;  2WT7 B;  5AVX B;  5AW6 B;  1URQ A;  1IFD A;  3LID A;  2H43 A;  4C7N B;  2BAS A;  5APY A;  4WY4 C;  2A45 G;  3V5B A;  3M0D A;  3CL3 D;  2E43 A;  3KQG A;  2J59 M;  2Q5U A;  2QM7 A;  3P8C E;  3H32 B;  3VP9 A;  1GK4 A;  5AVY B;  1YTZ I;  4N78 E;  2HPC A;  2P1J A;  1M7L A;  3HE5 B;  1IK9 A;  3VMZ A;  1LWU C;  1J1D B;  3V4Q A;  2C9L Y;  2YKQ A;  3A2A A;  1CSB A;  2FKW B;  1G2C A;  1FZA A;  4WB4 A;  1FOS F;  4ZKU A;  4EOT A;  2IFN A;  1N73 C;  1LTI C;  4JF7 A;  2I1K A;  5CCH A;  1JUN A;  4B86 A;  3L37 A;  4GT1 A;  1KFM A;  3N7N A;  4W7Z A;  1KIL D;  2YO3 A;  1LTJ C;  2HG5 D;  2R3C A;  5KJ7 A;  2OYH C;  1JCC A;  2WSC H;  2WWW A;  1SQP K;  3MUD A;  1AFO A;  4N3Y B;  1H88 A;  1FJK A;  1JTH B;  3A3Y B;  3M91 A;  1URQ D;  2Q3I A;  1JCD A;  2W27 A;  3TNU A;  2YMY A;  1SFC B;  3KPE A;  1ZLL A;  2ZFC A;  1T3J A;  2C0X A;  3V2P A;  4WY4 B;  3VN0 A;  1CI6 B;  1HGV A;  1KFN A;  5CCH D;  1JY2 P;  1FOS E;  1FZC C;  4LC1 A;  1HUC A;  3R2P A;  1IJD B;  3M9B A;  2J58 A;  2FXM A;  1LTT C;  1FZC A;  2L5G B;  1RF0 C;  4M3L A;  3VTP C;  1J1E B;  1GL2 A;  3BAT A;  5CCG A;  1LWU B;  1EQ7 A;  1GK6 A;  2LKM A;  1DX7 A;  1RF0 A;  3L35 A;  1LTB C;  2FYZ A;  3N4X A;  1NTM K;  2N1T D;  1IO4 A;  1NKN A;  5AVQ B;  3OA7 A;  5CHX A;  5AW1 B;  1NTK K;  1CZQ A;  1G1J A;  3RK3 D;  3TK1 A;  3NXS A;  1M1J C;  1IC2 A;  1CW5 A;  1N7L A;  3C9I A;  1N7S D;  4C46 A;  3II6 A;  1ZV8 A;  3T97 A;  4HYT B;  2HLO A;  2XV5 A;  2NPS C;  2E42 A;  2YNY A;  5AVU B;  1WT6 A;  3CLQ A;  4C7N A;  1NTZ K;  1X9V A;  2NPS A;  2WPR A;  2YKP A;  1NAF A;  2Q7C A;  1KQL A;  4W7Y A;  5CCG C;  2P7J A;  1J2J B;  1NU1 K;  2QM8 A;  3BRT B;  3P32 A;  1LTS C;  1SFC A;  2IX7 C;  1IFM A;  2O1K A;  1YTZ T;  2WSE H;  3RL0 D;  3TNU B;  1URQ C;  2A45 H;  2CPS A;  4IFM A;  1NH4 A;  1RY3 A;  1RE4 C;  5CCG D;  1HVV A;  5KTB A;  3VMY A;  3LIE A;  1JOC A;  1RE4 A;  2Z4E A;  1GL2 D;  3RK3 B;  2PP6 A;  5KJ7 D;  3RK2 D;  3NTN A;  1JY3 N;  1T2K C;  2OYI A;  2ZXE B;  1A02 F;  3M0A A;  1G2C B;  5APT A;  1MV8 A;  1JO5 A;  1DH3 A;  1PFI A;  5AW7 B;  2Z5I A;  4I6M C;  2C9N Y;  1IFN A;  1L4A D;  1GL2 B;  1NO4 A;  5AVR B;  1FBM A;  4N6J A;  1FAV A;  3P8C D;  1T3U A;  4I1L A;  3M9H A;  4O9B A;  3RK3 C;  1LTG C;  1FJP A;  2O1J A;  3TYY A;  2FFD B;  3BAS A;  1SP4 A;  1M1J B;  3KYQ A;  5CCH C;  4LGD E;  2YKO A;  3E1I A;  5APQ A;  2KP8 A;  3V2R A;  1SQB K;  1XTG B;  1H89 A;  1KIL A;  1CI6 A;  1QL1 A;  1G1I A;  1GL2 C;  2OAR A;  1VDF A;  1HWT C;  2GM4 A;  1JY2 N;  4HH2 A;  5CJ4 A;  2O01 H;  1J1D C;  3A7O A;  4DOJ A;  1AQ5 A;  2FFD C;  4W80 A;  1A02 J;  4EIJ A;  2KYV A;  1L4A C;  3L4F A;  1URQ B;  1FZE A;  2W6A A;  2WIT A;  1S9K E;  4JYB A;  1WRG A;  1QL2 A;  1N2D C;  1MZ9 A;  3RK2 B;  2H7H A;  1OXZ A;  3A5T A;  1HJB A;  1GU4 A;  5CJ0 A;  3HTK A;  5AW0 B;  1HBW A;  3M06 A;  3MTU E;  1W2E A;  1M1J A;  3GHG A;  2R5D A;  2W6B A;  1N86 A;  1HTL C;  1IFI A;  2HOD A;  3HUS C;  1N7S B;  1RF1 C;  4LLH A;  1L4A B;  5AW9 B;  3BRV B;  3B5N A;  3CI9 A;  3RL0 B;  2KOG A;  3HUS A;  1KIL C;  1RF1 A;  1XTC C;  2I1J A;  2N1T A;  1SQQ K;  2N9B A;  4I2L C;  2MJZ A;  2A45 I;  1NOH A;  1SFC C;  1ZR4 A;  3BVH A;  5AW8 B;  4GIF A;  3U1A A;  2N1T B;  3KDP B;  2XDJ A;  3HTK B;  2XZR A;  2XU6 A;  1JTH A;  5KLV K;  1OWA A;  1LTA C;  5AVT B;  3NMD A;  3I5C A;  1FZG A;  3M9Q A;  1N7S A;  1JY2 O;  3HE4 A;  3VP8 A;  2HYN A;  3VMX A;  5BU8 B;  2WT7 A;  2NPS B;  1KIL B;  2IPP A;  2M8R A;  1Z56 A;  1IFJ A;  5AW3 B;  2POH A;  4RES B;  5AVV B;  2Q9I A;  2R5B A;  3B5N D;  3IFM A;  1GU5 A;  3M0D C;  5BVZ A;  3O8Z A;  3H6P A;  1LGH B;  4KHX A;  4AQR D;  2C0W A;  3U59 A;  4JYC A;  1H8A A;  4WBA A;  2P2U A;  3HE4 B;  1GZL A;  3MGN A;  2WPS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...