3JCUH

Cryo-em structure of spinach psii-lhcii supercomplex at 3.2 angstrom resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
PKPTTVGALLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVLLDGISM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Structure of spinach photosystem II-LHCII supercomplex at 3.2 A resolution
doi rcsb
molecule tags Membrane protein
total genus 13
structure length 59
sequence length 59
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 3jcuH01
5TISH 3JCUH 5GTIH 4IL6H 4UB6H 4UB8H 5E79H 5GTHH 5KAIH 5B66H 3A0HH 5H2FH 2AXTH 3KZIH 5KAFH 5B5EH 3WU2H 4PJ0H 1S5LH 3A0BH
chains in the Genus database with same CATH superfamily
1GD2E 1KYOI 2Y9ZA 1NYHA 1X8YA 1RHZB 2QEXP 2A45H 3AEFC 1YQ4C 2V4HA 2FFDA 2Q6QA 5H2FH 3HD7B 5CBNA 3K5BA 3HUSC 3SSUA 2KXPB 2QJYB 2JR8A 1VQ7P 3L70J 1NOHA 4NPEA 1S9KD 5APSA 5AW1B 1LTTC 1ZV8A 2NRGA 2YXQB 1NH4A 4W80A 1S1CX 2AEJA 5BVZA 1MUUA 1S9KE 1NTZK 3SWKA 1GK4A 2NPSD 2XDJA 4EI2A 1KFMA 1SQVD 1M57D 3RGUA 5CCGD 2WT7B 5E79H 2QG4A 1PL5A 3FGAD 2IBZD 5GTHE 1W2EA 1KB9I 1NHLA 1SQVE 3MHVA 4JQ0D 1NTZG 1H88A 1KV4A 2POHA 2IBZE 1R5SA 1EC5A 3HTKA 2J59M 3M91A 1KYOE 1NGMB 1IZNB 5AVWB 2Q3EA 2Z4EA 3AE8C 1VQNP 1FZAA 1FBMA 1SQQK 2HODB 2XNXA 2ZVNB 1DD3A 3M0DC 4PJ0E 1PZQA 1E79H 1L0NK 3RBXA 3OJAB 2ITAA 3CD6P 4AUWA 1BCCD 3L74J 3L73G 3CI9A 1AFOA 1PP9J 4I2LC 1VQPP 1JTHA 1T3JA 4WVZA 1SQQG 1S72P 2YIUC 1BCCE 3CCMP 3ITKA 3AEBC 4RJTA 1L0NG 2W90A 4GOEA 2M5AB 2E74C 3CPWO 1RF0A 1IFNA 5KLIB 4L74A 3HE5A 3V6IA 3H1JG 3PTZA 1GL2D 2KSEA 1IFJA 1FOSE 1PPJD 3H1HJ 1MV8A 1KB9E 1DIPA 5GTIE 1OW8A 1L4AD 3B5NA 2IPPA 2OARA 1ZN5A 1YJWP 2G3AA 1LTJC 2P10A 4JF7A 3MTUE 2KOGA 3II6A 1NVOA 3D6YA 3EWKA 5KAFE 3H1LJ 3V2RA 3Q5RA 2KS1A 4K3AA 5AVQB 2B9BA 1SP4A 2CK3H 3JSVC 1NWQA 2E76D 1JCDA 1YITP 3VP9A 2Y0DA 4GKGA 1URQC 3OW2O 2FY8A 1S5LX 1SQBD 1FDIA 2M0BA 1LT9C 1JMBA 2L91A 3MP7B 1FZCB 4PD4I 1BSNA 2AEFA 2WSEH 1DEEG 2WVRA 4N3YB 4PV1B 4OGQD 2E74B 3V5BA 1SFCD 1FU1A 1YTZI 1ZMEC 3L71E 4IL6H 2WSCH 1RQUA 3G3ZA 1DH3A 4EDFA 3SFEC 3MUDC 3RK3E 3C8VA 2Q3IA 4YTPC 5AVVB 1QLED 1JM0A 2W27A 5APYA 3TGUE 2ZT9C 4YPCA 2A45G 3CXHD 4EYYQ 1GZLA 2BCCG 2IFNA 3Q3DA 1LT1A 2IYPA 3FWLA 3HD7D 1ZR4A 3H25A 1FE6A 3CCUP 1U57A 2JWDA 2E42A 1GDTA 3L71J 1UIXA 1G1JA 1EZVG 3V2NA 2QM8A 2ZXEB 3H1KG 1K73Q 1LT9B 5AVXB 1BGYD 1UIIA 1HGZA 5M1BA 4PD4E 3CCSP 3TNUB 3TGUJ 1CSBA 2O3JA 4WY4C 1S5LE 1HVVA 2P1JA 1KQGB 5DJTB 2OYHB 1CI6A 1KTMA 1MZ9A 1ZW0A 2NPSA 1T2KD 5CCGA 1EDLA 3CX5D 3C1LA 3O8ZA 2LR2A 3Q5PA 4I7ZC 3CX5E 1BSHA 2ZT9B 3FXDA 1U7MA 4UB8E 1KILC 1NTKD 5KLVG 2CPSA 1NKNA 2KP8A 3F89A 1USDA 4JYCA 3PP5A 4B86A 4BRYB 1RE4A 2E43A 3CCEP 1NTKE 3E1RA 2KSJA 1YBKA 3L75D 4DJGA 3PHLA 3KYQA 2GUSA 4H44C 4D6TD 1SQXJ 4JYBA 3USSA 1A02F 1SLQA 1L0LG 3V2PA 4DCKA 3R2PA 1P84D 1PFIA 1GL2A 1NU1K 4XA4A 2OYIC 1L4AA 1IFPA 3KQGA 4RKUJ 4I7ZB 4KT0J 1AA0A 1JCCA 3F5HA 2V7QJ 4LGDE 4GIFA 4U3FJ 1NU1G 1KILB 3CWBJ 3BCCE 1VF5B 3IFMA 4R4LA 3GF3A 2VRSA 1JY3O 1H8AA 1MFTA 4YXWH 1VL2A 5TISE 2YMKA 2N9BA 1G2CA 1OIPA 3W67A 1HH0A 2RKLA 2KYVA 1RY3A 1RF1C 2PGDA 4H44B 4CPGA 2JDIH 3CC7P 2A06E 2QJYC 2QRXA 5AW4B 1SQPD 2XV5A 5B5EE 3JCUH 4W7YA 4C7NB 1SFCA 4OWFA 1NTZD 1H89A 2R5BA 3VP8A 5GTHH 1OVUA 1M1JA 2AEMA 3BCCJ 4N6JA 1NTZE 2OYIB 1E5WA 1OFCX 2B87B 3L72E 1KYOH 1Y8AA 2HPCB 3HD7A 1A02J 1X22A 3L73D 1NTME 2QSIA 5B66E 1URQD 4PJ0H 1NJIQ 1FJKA 4U7JA 1SQQD 3GHGA 4QMAA 3L73E 1L0ND 1LWUA 3JC22 3U1AA 1YI2P 3CMAP 1VQ6P 2E5TA 1BE3G 1FDMA 1L0NE 2N1TD 1RF1B 1OZHA 1AV1A 4N78D 3H1JD 3L72J 1OXZA 2C9NY 2KNCA 1VQ5P 2WT7A 2W6JH 1LNQA 4I1LA 3Q2YA 3KDPB 3H1JE 3V4QA 2H88C 2O1JA 3VMYA 1NTMJ 4KJMA 2WTYA 4H0LC 1SQPK 3KZIE 3HE4B 1KB9H 2K88A 2ZT9D 2FYUG 2FYNB 5KLIC 3QWOC 4KHXA 1ZP0C 2E75C 3TYYA 1VQ8P 2D2CC 5KAFH 2ZFCA 3H1IG 1SQPG 1FOSF 2AXTE 4C7RA 3HUSA 1ZXGA 2KB7P 3N7NA 2PFXA 1LTSC 2BEQD 1GU5A 3NXSA 1LTIC 3O6QA 3QH9A 1HWTC 2H43A 4NPDA 2M5AA 1LTGC 4WY4D 3FWNA 3WMM0 3VMAA 3MD0A 1YJ9P 5AW7B 4LLHA 3AE9C 1D7MA 4DZOA 2Q9IA 3L70G 2QJPC 3B5NC 3VMXA 1SQVJ 1FZCC 4WB4A 1HF9A 2E5YA 2Z5HA 2BCCD 4HH2A 4PV1C 4H0LB 3SWYA 1H0TB 3HTKB 4IFMA 4UB6E 2HR3A 1NAFA 2BCCE 2XKMA 3L36A 2E75B 1AQ5A 1HBWA 1KILD 2D2CB 1EZVD 4EOTA 3H32B 4OVNF 3H1KD 3M0DA 1QX8A 2R3CA 1PPJE 2YO2A 2Y0CA 1EZVE 1JUNA 1JTHB 4TLFA 5AW3B 3H1KE 1BCCJ 3CXHI 2H7HA 1JY3P 2YNYA 5KTBA 4PD4H 1M1KQ 1VQOP 1IK7A 3L74G 3HE5B 1LP1A 2M8RA 1PP9G 1QVFO 5APWA 3IF4A 2M3BA 2QJPB 3M0AA 3B5NB 5CMZA 1JY2O 1SQBE 2YMYA 1AVOA 1FZFA 3PH0A 2YO3A 2KK7A 2W6AA 4HKZH 1JOCA 5APUA 1HTLC 2OYHC 1LTJA 5KLVD 1OX3A 2MJZA 2KS1B 1KQSO 2IDBA 4OH8B 2K9JA 1Q86Q 3H1HG 5CHXA 1Q82Q 3IN6A 2Q5UA 3WU2H 4IL6X 2Q7CA 3CX5I 2HLOA 1URQA 2QM7A 2W83C 3AEAC 1N2DC 5EFWB 1IC2A 1FZGA 1X79B 2UWJE 3H1LG 3AE3C 1LT9A 3S1KA 3T97A 1FZEA 1SQBJ 2FYZA 3CXHE 3LW5J 1L0LD 3D70A 2PAJA 2V7QH 3TNUA 5BU8B 3GMAA 1IFMA 2N1TA 4WWIA 4A7PA 1Q2NA 4H13C 1M90Q 2BEZF 3A2AA 2P58A 4IOIH 4HB1A 3RK2C 2OQQA 4TT3H 2R32A 1BGYE 1NU1D 1N73A 2JJLA 3VTPC 3R4YA 2QIWA 1JY3N 1OVVA 3B71A 5CCHC 3S9OA 1EDJA 5KLVK 3VMZA 1RE3C 1QL2A 1P84I 5BU5A 1VQ9P 3P8MC 3AE4C 3I56P 3W68A 1GK6A 1EXJA 5APQA 2P2UA 3CMEP 5AW9B 1ZR2A 4GDOA 2Z5IA 1BGYJ 3A0BE 1VF5C 2HG5D 3L71G 2O01J 2RH0A 4WY4A 2NPSB 2LXCB 3Q1MA 3OAKA 1L0LK 5L8RJ 5B5EH 2R44A 3I5CA 4H13B 1NO4A 4H0LD 4ASVA 3RBZA 3TGUG 3D71A 3L75E 3RK2B 3SWFA 5AW2B 3A5TA 4NPFX 3CCQP 1VDFA 2E75D 2WPQA 1OWAA 2K1AA 4D6TE 1KQLA 4W7ZA 2D2CD 2XZRA 3WUVA 3S4RA 2C0WA 4YXDC 3A3YB 1KILA 3V4WA 3G9RA 1NTKJ 3GF7A 1P84E 5B66H 1SS1A 2JWAA 1N7SC 1KQFB 2FKWB 2C9LY 1BE3D 1QGKB 1WT6A 3GW6A 3L75J 4Y99B 2ZYGA 1KN7A 2WPRA 2O01N 1SQXK 2R5DA 2AXCA 3RK3C 1ZRTD 4XE5B 4D6TJ 5CJ4A 4C7NA 3FXEA 5KJ7C 1Z56A 1M1JC 3BRTB 4EIJA 1GL2B 2FYUD 3CCLP 1VQMP 1FZBA 2ZYAA 4PV1D 1SQXG 1L4AB 1ZLLA 1YTZT 2E74D 1T6AA 2PRRA 4GODA 2OYIA 2QVAA 1JY2P 2B87A 3H1ID 1RQVA 2FXPA 4IFFA 2K3RA 1CW5A 4WBAA 4JPZB 3H1IE 1TU3F 3L37A 1SQPE 1DD4A 2AXTH 1JEKA 2FYNC 4C46A 1KFNA 2LKMA 4GT1A 3Q5SA 3EQ2A 2IFMA 1N7SB 1BDCA 2FFDC 1PGPA 1OW6A 4I6MC 4U3FG 2Q1KA 4ZMDA 2WWWA 3CWBG 1KD1Q 1RF1A 3L70D 3HRNA 2QA4P 3A7OA 4OGQB 2CPBA 1AVYA 3RK3B 2B88A 2JP3A 1BDDA 4BWNA 5CBOA 2WSFJ 3AEGC 1M1JB 2ZVOB 3P32A 1KC8Q 1Q7YQ 1SQQE 2YKOA 1NTZJ 3A0HE 2HFED 3AE1C 4UB6H 5TJHA 1MKMA 2FYUK 1M8OB 1N7LA 4N78E 3P7KA 4GOFA 3BCCG 1HJBA 2HYNA 4O9BA 3PJSK 5APXA 5GTIH 4XFJA 3WUUA 2H89C 4Y28J 3OA7A 3GHGB 3L73J 1Y9BA 2A45I 1LWUB 3NFQA 2W8ZA 1SQQJ 2FFDB 2RMZA 1LJ2A 2QJKB 5KAIE 2WQYC 1L0NJ 3U1CA 2OGUA 2HODA 1GMJA 3L74D 2A06G 1JY2N 1YHQP 1PP9D 1IJDB 3JCUE 5C39A 3TDKA 2KNCB 1J1DC 5DJUB 3M9QA 1HJ0A 1EZVI 4H13D 3L74E 5AVYB 4DOJA 3H1JJ 1EDKA 1PP9E 2OTKE 1K9MQ 3BVHA 3N4XA 2OTJP 3D6ZA 3B4SA 1KYOD 2WMMA 1QEXA 1GTWA 1DEBA 3RK2D 2QE7H 1NTMK 2Y0EA 1RF0C 1T8ZA 1H0TA 2G8YA 2IZ0A 1MFZA 1FDOA 4ZKPA 1PGJA 3LW5H 3BRVB 3L72G 1PV3A 3H1HD 3TF5A 1VQ4P 4LC1A 4ZNCA 1PGOA 3CC4P 5CCHD 1K05A 3H1HE 1K04A 1NTMG 1QL1A 3HUSB 1S2EA 2KZIA 3H32A 3CCVP 3RL0C 3H1LD 2FXMA 3PLNA 4IFDK 5APVA 2JKVA 5H2FE 1M56D 3O6QB 3H1LE 4ZKUA 5AW5B 3B8EB 1T3UA 4MN4C 2JEEA 3AE5C 3CXHH 1FS0E 3ZDMA 4ASWA 2OTLP 1VF5D 2B89A 2SPZA 1KB9D 1KILE 1LTBC 2WZ7A 4DT0A 3PRJA 3MZWB 1J1DB 1IFIA 2KLUA 1J1EC 1SQVK 1G1IA 1FZCA 4H44D 2I8DA 3TSIA 1PGQA 4L75A 2GM4A 1EDIA 5E79E 2ZYDA 2BCCJ 1FAVA 3CL3D 1S5LH 1VQLP 3FX0A 2O01H 4RO0A 3AE6C 1SQVG 1FJPA 3H6PA 3L35A 1PIXA 1S3JA 3M9HA 2IBZG 2H8PD 1S4XA 1N7SD 3VN0A 3BASA 3RL0g 3RL0B 3CX5H 3TK1A 3H1KJ 2KUBA 2PP6A 1JO5A 1Q90D 3C9IA 3L71D 4UB8H 3AECC 2YIUB 1WMKA 5K5GB 3CCRP 5KLVE 2N1TC 2WPSA 3M06A 1USEA 3RK3D 2YXRB 1KZUB 3A0BH 1LP1B 3UIAA 5AVZB 4L73A 4HJGH 2K9YA 3NMDA 2WPVB 5KJ7D 3TGUD 2IZ1A 1AJYA 1KMIZ 5AW8B 5AW6B 1BCCG 1J1EB 1YQ3C 3AEEC 2K37A 3P8CD 1N73C 1N86A 1IK9A 1LTJB 2P67A 1QVGO 2NPSC 3CC2P 3G71P 3AE7C 2I1KA 3M9BA 5CCGC 1L0LE 2RN0A 2OYHA 4L76A 2K9JB 2MKVA 3P8CE 2KIKA 3CLQA 3V2QA 1X9VA 5KLVJ 3MUDA 3EFFK 1PPJG 2JO1A 4BXLA 1LGHB 1JNMA 1WRGA 1OW7A 2ZAEB 3CCJP 1URQB 4PD4D 1P84H 3L4FA 1GW3A 5AVUB 3T97B 2GA1A 1K8AQ 1EXIA 1SQBK 2ZJSE 1NU1E 3IR9A 1GW4A 1RE4C 1YIJP 2OYOA 4AQRD 1J2JB 2N1TB 1X0TA 1L0LJ 1W5CE 4BRYA 1OVRA 1JB0J 3MGNA 1JMMA 2NZ2A 1VQKP 1SQXD 2IX7C 1VPCA 2DW3A 4JBZA 5AW0B 1SQBG 2XNDH 4Y99C 2N9YB 5TISH 5AVRB 1SQXE 2I1JA 4IL6E 1N73B 3VYIA 2WITA 1CI6B 2L5GB 1RH5B 5AVSB 1GL2C 1NU1J 1IFDA 2YKQA 3WU2E 5CCHA 1L4AC 3KPEA 1HGVA 2WSFH 1DX7A 3AEDC 4M3LA 3WUTA 1RE3A 3SFDC 4U3FD 5KKZC 3AE2C 1FC2C 3CWBD 2WSEJ 3I55P 5CJ0A 1SVFA 4U3FE 3ABVC 3KXDA 1ZOYC 3VOPA 3E1IA 2WSCJ 2FXOA 2E76C 3CWBE 3U59A 2XU6A 3GLMA 4R4MA 1R8EA 4WY4B 1YYCA 2KI7B 2KZJA 1N8RQ 1CZQA 3IAOA 2W6BA 3KHUA 3BATA 2C0XA 1NAYA 2YKPA 1BGYG 3G6EP 1BE3E 1R5LA 4OGQC 3A0HH 1HUCA 1SFCC 1NKZB 4HYTB 2P7JA 1KORA 3G4SP 3BCCD 4K35A 2ZXXA 1XTGB 5APTA 3B5ND 1LTAC 1ZRTE 2J5UA 2Y9YA 3RL0D 3KZIH 2R3SA 5AVTB 1EQ7A 1NTKK 1Y47A 2FYUE 4Z1MH 4RESB 1U7JA 1Q81Q 1N7SA 5KKZB 2A06D 2GUVA 3HD7C 3E7KA 2HPCA 1BE3J 5KAIH 1AQTA 3NTNA 1M7LA 1OMIA 3MIWA 2E76B 3GHGC 1NTKG 1GU4A 1IO4A 1L2PA 1LWUC 2J58A 1YJNP 2FBWC 1XTCC 2QJKC 5KJ7A 1G2CB 3L72D 3L75G 4AYCA 3GG2A 2FYUJ 2WSSH 3LIDA 2KLVA 4D6TG 3EFGA 1NTMD 1SFCB 2LXBA 1T2KC 2M3EA 1W2BO 3L70E 3H1IJ 1SQPJ 2BASA 2IYOA 3LIEA 2O1KA 3HE4A 2IBZI
chains in the Genus database with same CATH topology
5TISH 3JCUH 5GTIH 4IL6H 4UB6H 4UB8H 5E79H 5GTHH 5KAIH 5B66H 3A0HH 5H2FH 2AXTH 3KZIH 5KAFH 5B5EH 3WU2H 4PJ0H 1S5LH 3A0BH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TIS H;  3JCU H;  5GTI H;  4IL6 H;  4UB6 H;  4UB8 H;  5E79 H;  5GTH H;  5KAI H;  5B66 H;  3A0H H;  5H2F H;  2AXT H;  3KZI H;  5KAF H;  5B5E H;  3WU2 H;  4PJ0 H;  1S5L H;  3A0B H; 
#chains in the Genus database with same CATH topology
 1GD2 E;  1KYO I;  2Y9Z A;  1NYH A;  1X8Y A;  1RHZ B;  2QEX P;  2A45 H;  3AEF C;  1YQ4 C;  2V4H A;  2FFD A;  2Q6Q A;  5H2F H;  3HD7 B;  5CBN A;  3K5B A;  3HUS C;  3SSU A;  2KXP B;  2QJY B;  2JR8 A;  1VQ7 P;  3L70 J;  1NOH A;  4NPE A;  1S9K D;  5APS A;  5AW1 B;  1LTT C;  1ZV8 A;  2NRG A;  2YXQ B;  1NH4 A;  4W80 A;  1S1C X;  2AEJ A;  5BVZ A;  1MUU A;  1S9K E;  1NTZ K;  3SWK A;  1GK4 A;  2NPS D;  2XDJ A;  4EI2 A;  1KFM A;  1SQV D;  1M57 D;  3RGU A;  5CCG D;  2WT7 B;  5E79 H;  2QG4 A;  1PL5 A;  3FGA D;  2IBZ D;  5GTH E;  1W2E A;  1KB9 I;  1NHL A;  1SQV E;  3MHV A;  4JQ0 D;  1NTZ G;  1H88 A;  1KV4 A;  2POH A;  2IBZ E;  1R5S A;  1EC5 A;  3HTK A;  2J59 M;  3M91 A;  1KYO E;  1NGM B;  1IZN B;  5AVW B;  2Q3E A;  2Z4E A;  3AE8 C;  1VQN P;  1FZA A;  1FBM A;  1SQQ K;  2HOD B;  2XNX A;  2ZVN B;  1DD3 A;  3M0D C;  4PJ0 E;  1PZQ A;  1E79 H;  1L0N K;  3RBX A;  3OJA B;  2ITA A;  3CD6 P;  4AUW A;  1BCC D;  3L74 J;  3L73 G;  3CI9 A;  1AFO A;  1PP9 J;  4I2L C;  1VQP P;  1JTH A;  1T3J A;  4WVZ A;  1SQQ G;  1S72 P;  2YIU C;  1BCC E;  3CCM P;  3ITK A;  3AEB C;  4RJT A;  1L0N G;  2W90 A;  4GOE A;  2M5A B;  2E74 C;  3CPW O;  1RF0 A;  1IFN A;  5KLI B;  4L74 A;  3HE5 A;  3V6I A;  3H1J G;  3PTZ A;  1GL2 D;  2KSE A;  1IFJ A;  1FOS E;  1PPJ D;  3H1H J;  1MV8 A;  1KB9 E;  1DIP A;  5GTI E;  1OW8 A;  1L4A D;  3B5N A;  2IPP A;  2OAR A;  1ZN5 A;  1YJW P;  2G3A A;  1LTJ C;  2P10 A;  4JF7 A;  3MTU E;  2KOG A;  3II6 A;  1NVO A;  3D6Y A;  3EWK A;  5KAF E;  3H1L J;  3V2R A;  3Q5R A;  2KS1 A;  4K3A A;  5AVQ B;  2B9B A;  1SP4 A;  2CK3 H;  3JSV C;  1NWQ A;  2E76 D;  1JCD A;  1YIT P;  3VP9 A;  2Y0D A;  4GKG A;  1URQ C;  3OW2 O;  2FY8 A;  1S5L X;  1SQB D;  1FDI A;  2M0B A;  1LT9 C;  1JMB A;  2L91 A;  3MP7 B;  1FZC B;  4PD4 I;  1BSN A;  2AEF A;  2WSE H;  1DEE G;  2WVR A;  4N3Y B;  4PV1 B;  4OGQ D;  2E74 B;  3V5B A;  1SFC D;  1FU1 A;  1YTZ I;  1ZME C;  3L71 E;  4IL6 H;  2WSC H;  1RQU A;  3G3Z A;  1DH3 A;  4EDF A;  3SFE C;  3MUD C;  3RK3 E;  3C8V A;  2Q3I A;  4YTP C;  5AVV B;  1QLE D;  1JM0 A;  2W27 A;  5APY A;  3TGU E;  2ZT9 C;  4YPC A;  2A45 G;  3CXH D;  4EYY Q;  1GZL A;  2BCC G;  2IFN A;  3Q3D A;  1LT1 A;  2IYP A;  3FWL A;  3HD7 D;  1ZR4 A;  3H25 A;  1FE6 A;  3CCU P;  1U57 A;  2JWD A;  2E42 A;  1GDT A;  3L71 J;  1UIX A;  1G1J A;  1EZV G;  3V2N A;  2QM8 A;  2ZXE B;  3H1K G;  1K73 Q;  1LT9 B;  5AVX B;  1BGY D;  1UII A;  1HGZ A;  5M1B A;  4PD4 E;  3CCS P;  3TNU B;  3TGU J;  1CSB A;  2O3J A;  4WY4 C;  1S5L E;  1HVV A;  2P1J A;  1KQG B;  5DJT B;  2OYH B;  1CI6 A;  1KTM A;  1MZ9 A;  1ZW0 A;  2NPS A;  1T2K D;  5CCG A;  1EDL A;  3CX5 D;  3C1L A;  3O8Z A;  2LR2 A;  3Q5P A;  4I7Z C;  3CX5 E;  1BSH A;  2ZT9 B;  3FXD A;  1U7M A;  4UB8 E;  1KIL C;  1NTK D;  5KLV G;  2CPS A;  1NKN A;  2KP8 A;  3F89 A;  1USD A;  4JYC A;  3PP5 A;  4B86 A;  4BRY B;  1RE4 A;  2E43 A;  3CCE P;  1NTK E;  3E1R A;  2KSJ A;  1YBK A;  3L75 D;  4DJG A;  3PHL A;  3KYQ A;  2GUS A;  4H44 C;  4D6T D;  1SQX J;  4JYB A;  3USS A;  1A02 F;  1SLQ A;  1L0L G;  3V2P A;  4DCK A;  3R2P A;  1P84 D;  1PFI A;  1GL2 A;  1NU1 K;  4XA4 A;  2OYI C;  1L4A A;  1IFP A;  3KQG A;  4RKU J;  4I7Z B;  4KT0 J;  1AA0 A;  1JCC A;  3F5H A;  2V7Q J;  4LGD E;  4GIF A;  4U3F J;  1NU1 G;  1KIL B;  3CWB J;  3BCC E;  1VF5 B;  3IFM A;  4R4L A;  3GF3 A;  2VRS A;  1JY3 O;  1H8A A;  1MFT A;  4YXW H;  1VL2 A;  5TIS E;  2YMK A;  2N9B A;  1G2C A;  1OIP A;  3W67 A;  1HH0 A;  2RKL A;  2KYV A;  1RY3 A;  1RF1 C;  2PGD A;  4H44 B;  4CPG A;  2JDI H;  3CC7 P;  2A06 E;  2QJY C;  2QRX A;  5AW4 B;  1SQP D;  2XV5 A;  5B5E E;  3JCU H;  4W7Y A;  4C7N B;  1SFC A;  4OWF A;  1NTZ D;  1H89 A;  2R5B A;  3VP8 A;  5GTH H;  1OVU A;  1M1J A;  2AEM A;  3BCC J;  4N6J A;  1NTZ E;  2OYI B;  1E5W A;  1OFC X;  2B87 B;  3L72 E;  1KYO H;  1Y8A A;  2HPC B;  3HD7 A;  1A02 J;  1X22 A;  3L73 D;  1NTM E;  2QSI A;  5B66 E;  1URQ D;  4PJ0 H;  1NJI Q;  1FJK A;  4U7J A;  1SQQ D;  3GHG A;  4QMA A;  3L73 E;  1L0N D;  1LWU A;  3JC2 2;  3U1A A;  1YI2 P;  3CMA P;  1VQ6 P;  2E5T A;  1BE3 G;  1FDM A;  1L0N E;  2N1T D;  1RF1 B;  1OZH A;  1AV1 A;  4N78 D;  3H1J D;  3L72 J;  1OXZ A;  2C9N Y;  2KNC A;  1VQ5 P;  2WT7 A;  2W6J H;  1LNQ A;  4I1L A;  3Q2Y A;  3KDP B;  3H1J E;  3V4Q A;  2H88 C;  2O1J A;  3VMY A;  1NTM J;  4KJM A;  2WTY A;  4H0L C;  1SQP K;  3KZI E;  3HE4 B;  1KB9 H;  2K88 A;  2ZT9 D;  2FYU G;  2FYN B;  5KLI C;  3QWO C;  4KHX A;  1ZP0 C;  2E75 C;  3TYY A;  1VQ8 P;  2D2C C;  5KAF H;  2ZFC A;  3H1I G;  1SQP G;  1FOS F;  2AXT E;  4C7R A;  3HUS A;  1ZXG A;  2KB7 P;  3N7N A;  2PFX A;  1LTS C;  2BEQ D;  1GU5 A;  3NXS A;  1LTI C;  3O6Q A;  3QH9 A;  1HWT C;  2H43 A;  4NPD A;  2M5A A;  1LTG C;  4WY4 D;  3FWN A;  3WMM 0;  3VMA A;  3MD0 A;  1YJ9 P;  5AW7 B;  4LLH A;  3AE9 C;  1D7M A;  4DZO A;  2Q9I A;  3L70 G;  2QJP C;  3B5N C;  3VMX A;  1SQV J;  1FZC C;  4WB4 A;  1HF9 A;  2E5Y A;  2Z5H A;  2BCC D;  4HH2 A;  4PV1 C;  4H0L B;  3SWY A;  1H0T B;  3HTK B;  4IFM A;  4UB6 E;  2HR3 A;  1NAF A;  2BCC E;  2XKM A;  3L36 A;  2E75 B;  1AQ5 A;  1HBW A;  1KIL D;  2D2C B;  1EZV D;  4EOT A;  3H32 B;  4OVN F;  3H1K D;  3M0D A;  1QX8 A;  2R3C A;  1PPJ E;  2YO2 A;  2Y0C A;  1EZV E;  1JUN A;  1JTH B;  4TLF A;  5AW3 B;  3H1K E;  1BCC J;  3CXH I;  2H7H A;  1JY3 P;  2YNY A;  5KTB A;  4PD4 H;  1M1K Q;  1VQO P;  1IK7 A;  3L74 G;  3HE5 B;  1LP1 A;  2M8R A;  1PP9 G;  1QVF O;  5APW A;  3IF4 A;  2M3B A;  2QJP B;  3M0A A;  3B5N B;  5CMZ A;  1JY2 O;  1SQB E;  2YMY A;  1AVO A;  1FZF A;  3PH0 A;  2YO3 A;  2KK7 A;  2W6A A;  4HKZ H;  1JOC A;  5APU A;  1HTL C;  2OYH C;  1LTJ A;  5KLV D;  1OX3 A;  2MJZ A;  2KS1 B;  1KQS O;  2IDB A;  4OH8 B;  2K9J A;  1Q86 Q;  3H1H G;  5CHX A;  1Q82 Q;  3IN6 A;  2Q5U A;  3WU2 H;  4IL6 X;  2Q7C A;  3CX5 I;  2HLO A;  1URQ A;  2QM7 A;  2W83 C;  3AEA C;  1N2D C;  5EFW B;  1IC2 A;  1FZG A;  1X79 B;  2UWJ E;  3H1L G;  3AE3 C;  1LT9 A;  3S1K A;  3T97 A;  1FZE A;  1SQB J;  2FYZ A;  3CXH E;  3LW5 J;  1L0L D;  3D70 A;  2PAJ A;  2V7Q H;  3TNU A;  5BU8 B;  3GMA A;  1IFM A;  2N1T A;  4WWI A;  4A7P A;  1Q2N A;  4H13 C;  1M90 Q;  2BEZ F;  3A2A A;  2P58 A;  4IOI H;  4HB1 A;  3RK2 C;  2OQQ A;  4TT3 H;  2R32 A;  1BGY E;  1NU1 D;  1N73 A;  2JJL A;  3VTP C;  3R4Y A;  2QIW A;  1JY3 N;  1OVV A;  3B71 A;  5CCH C;  3S9O A;  1EDJ A;  5KLV K;  3VMZ A;  1RE3 C;  1QL2 A;  1P84 I;  5BU5 A;  1VQ9 P;  3P8M C;  3AE4 C;  3I56 P;  3W68 A;  1GK6 A;  1EXJ A;  5APQ A;  2P2U A;  3CME P;  5AW9 B;  1ZR2 A;  4GDO A;  2Z5I A;  1BGY J;  3A0B E;  1VF5 C;  2HG5 D;  3L71 G;  2O01 J;  2RH0 A;  4WY4 A;  2NPS B;  2LXC B;  3Q1M A;  3OAK A;  1L0L K;  5L8R J;  5B5E H;  2R44 A;  3I5C A;  4H13 B;  1NO4 A;  4H0L D;  4ASV A;  3RBZ A;  3TGU G;  3D71 A;  3L75 E;  3RK2 B;  3SWF A;  5AW2 B;  3A5T A;  4NPF X;  3CCQ P;  1VDF A;  2E75 D;  2WPQ A;  1OWA A;  2K1A A;  4D6T E;  1KQL A;  4W7Z A;  2D2C D;  2XZR A;  3WUV A;  3S4R A;  2C0W A;  4YXD C;  3A3Y B;  1KIL A;  3V4W A;  3G9R A;  1NTK J;  3GF7 A;  1P84 E;  5B66 H;  1SS1 A;  2JWA A;  1N7S C;  1KQF B;  2FKW B;  2C9L Y;  1BE3 D;  1QGK B;  1WT6 A;  3GW6 A;  3L75 J;  4Y99 B;  2ZYG A;  1KN7 A;  2WPR A;  2O01 N;  1SQX K;  2R5D A;  2AXC A;  3RK3 C;  1ZRT D;  4XE5 B;  4D6T J;  5CJ4 A;  4C7N A;  3FXE A;  5KJ7 C;  1Z56 A;  1M1J C;  3BRT B;  4EIJ A;  1GL2 B;  2FYU D;  3CCL P;  1VQM P;  1FZB A;  2ZYA A;  4PV1 D;  1SQX G;  1L4A B;  1ZLL A;  1YTZ T;  2E74 D;  1T6A A;  2PRR A;  4GOD A;  2OYI A;  2QVA A;  1JY2 P;  2B87 A;  3H1I D;  1RQV A;  2FXP A;  4IFF A;  2K3R A;  1CW5 A;  4WBA A;  4JPZ B;  3H1I E;  1TU3 F;  3L37 A;  1SQP E;  1DD4 A;  2AXT H;  1JEK A;  2FYN C;  4C46 A;  1KFN A;  2LKM A;  4GT1 A;  3Q5S A;  3EQ2 A;  2IFM A;  1N7S B;  1BDC A;  2FFD C;  1PGP A;  1OW6 A;  4I6M C;  4U3F G;  2Q1K A;  4ZMD A;  2WWW A;  3CWB G;  1KD1 Q;  1RF1 A;  3L70 D;  3HRN A;  2QA4 P;  3A7O A;  4OGQ B;  2CPB A;  1AVY A;  3RK3 B;  2B88 A;  2JP3 A;  1BDD A;  4BWN A;  5CBO A;  2WSF J;  3AEG C;  1M1J B;  2ZVO B;  3P32 A;  1KC8 Q;  1Q7Y Q;  1SQQ E;  2YKO A;  1NTZ J;  3A0H E;  2HFE D;  3AE1 C;  4UB6 H;  5TJH A;  1MKM A;  2FYU K;  1M8O B;  1N7L A;  4N78 E;  3P7K A;  4GOF A;  3BCC G;  1HJB A;  2HYN A;  4O9B A;  3PJS K;  5APX A;  5GTI H;  4XFJ A;  3WUU A;  2H89 C;  4Y28 J;  3OA7 A;  3GHG B;  3L73 J;  1Y9B A;  2A45 I;  1LWU B;  3NFQ A;  2W8Z A;  1SQQ J;  2FFD B;  2RMZ A;  1LJ2 A;  2QJK B;  5KAI E;  2WQY C;  1L0N J;  3U1C A;  2OGU A;  2HOD A;  1GMJ A;  3L74 D;  2A06 G;  1JY2 N;  1YHQ P;  1PP9 D;  1IJD B;  3JCU E;  5C39 A;  3TDK A;  2KNC B;  1J1D C;  5DJU B;  3M9Q A;  1HJ0 A;  1EZV I;  4H13 D;  3L74 E;  5AVY B;  4DOJ A;  3H1J J;  1EDK A;  1PP9 E;  2OTK E;  1K9M Q;  3BVH A;  3N4X A;  2OTJ P;  3D6Z A;  3B4S A;  1KYO D;  2WMM A;  1QEX A;  1GTW A;  1DEB A;  3RK2 D;  2QE7 H;  1NTM K;  2Y0E A;  1RF0 C;  1T8Z A;  1H0T A;  2G8Y A;  2IZ0 A;  1MFZ A;  1FDO A;  4ZKP A;  1PGJ A;  3LW5 H;  3BRV B;  3L72 G;  1PV3 A;  3H1H D;  3TF5 A;  1VQ4 P;  4LC1 A;  4ZNC A;  1PGO A;  3CC4 P;  5CCH D;  1K05 A;  3H1H E;  1K04 A;  1NTM G;  1QL1 A;  3HUS B;  1S2E A;  2KZI A;  3H32 A;  3CCV P;  3RL0 C;  3H1L D;  2FXM A;  3PLN A;  4IFD K;  5APV A;  2JKV A;  5H2F E;  1M56 D;  3O6Q B;  3H1L E;  4ZKU A;  5AW5 B;  3B8E B;  1T3U A;  4MN4 C;  2JEE A;  3AE5 C;  3CXH H;  1FS0 E;  3ZDM A;  4ASW A;  2OTL P;  1VF5 D;  2B89 A;  2SPZ A;  1KB9 D;  1KIL E;  1LTB C;  2WZ7 A;  4DT0 A;  3PRJ A;  3MZW B;  1J1D B;  1IFI A;  2KLU A;  1J1E C;  1SQV K;  1G1I A;  1FZC A;  4H44 D;  2I8D A;  3TSI A;  1PGQ A;  4L75 A;  2GM4 A;  1EDI A;  5E79 E;  2ZYD A;  2BCC J;  1FAV A;  3CL3 D;  1S5L H;  1VQL P;  3FX0 A;  2O01 H;  4RO0 A;  3AE6 C;  1SQV G;  1FJP A;  3H6P A;  3L35 A;  1PIX A;  1S3J A;  3M9H A;  2IBZ G;  2H8P D;  1S4X A;  1N7S D;  3VN0 A;  3BAS A;  3RL0 g;  3RL0 B;  3CX5 H;  3TK1 A;  3H1K J;  2KUB A;  2PP6 A;  1JO5 A;  1Q90 D;  3C9I A;  3L71 D;  4UB8 H;  3AEC C;  2YIU B;  1WMK A;  5K5G B;  3CCR P;  5KLV E;  2N1T C;  2WPS A;  3M06 A;  1USE A;  3RK3 D;  2YXR B;  1KZU B;  3A0B H;  1LP1 B;  3UIA A;  5AVZ B;  4L73 A;  4HJG H;  2K9Y A;  3NMD A;  2WPV B;  5KJ7 D;  3TGU D;  2IZ1 A;  1AJY A;  1KMI Z;  5AW8 B;  5AW6 B;  1BCC G;  1J1E B;  1YQ3 C;  3AEE C;  2K37 A;  3P8C D;  1N73 C;  1N86 A;  1IK9 A;  1LTJ B;  2P67 A;  1QVG O;  2NPS C;  3CC2 P;  3G71 P;  3AE7 C;  2I1K A;  3M9B A;  5CCG C;  1L0L E;  2RN0 A;  2OYH A;  4L76 A;  2K9J B;  2MKV A;  3P8C E;  2KIK A;  3CLQ A;  3V2Q A;  1X9V A;  5KLV J;  3MUD A;  3EFF K;  1PPJ G;  2JO1 A;  4BXL A;  1LGH B;  1JNM A;  1WRG A;  1OW7 A;  2ZAE B;  3CCJ P;  1URQ B;  4PD4 D;  1P84 H;  3L4F A;  1GW3 A;  5AVU B;  3T97 B;  2GA1 A;  1K8A Q;  1EXI A;  1SQB K;  2ZJS E;  1NU1 E;  3IR9 A;  1GW4 A;  1RE4 C;  1YIJ P;  2OYO A;  4AQR D;  1J2J B;  2N1T B;  1X0T A;  1L0L J;  1W5C E;  4BRY A;  1OVR A;  1JB0 J;  3MGN A;  1JMM A;  2NZ2 A;  1VQK P;  1SQX D;  2IX7 C;  1VPC A;  2DW3 A;  4JBZ A;  5AW0 B;  1SQB G;  2XND H;  4Y99 C;  2N9Y B;  5TIS H;  5AVR B;  1SQX E;  2I1J A;  4IL6 E;  1N73 B;  3VYI A;  2WIT A;  1CI6 B;  2L5G B;  1RH5 B;  5AVS B;  1GL2 C;  1NU1 J;  1IFD A;  2YKQ A;  3WU2 E;  5CCH A;  1L4A C;  3KPE A;  1HGV A;  2WSF H;  1DX7 A;  3AED C;  4M3L A;  3WUT A;  1RE3 A;  3SFD C;  4U3F D;  5KKZ C;  3AE2 C;  1FC2 C;  3CWB D;  2WSE J;  3I55 P;  5CJ0 A;  1SVF A;  4U3F E;  3ABV C;  3KXD A;  1ZOY C;  3VOP A;  3E1I A;  2WSC J;  2FXO A;  2E76 C;  3CWB E;  3U59 A;  2XU6 A;  3GLM A;  4R4M A;  1R8E A;  4WY4 B;  1YYC A;  2KI7 B;  2KZJ A;  1N8R Q;  1CZQ A;  3IAO A;  2W6B A;  3KHU A;  3BAT A;  2C0X A;  1NAY A;  2YKP A;  1BGY G;  3G6E P;  1BE3 E;  1R5L A;  4OGQ C;  3A0H H;  1HUC A;  1SFC C;  1NKZ B;  4HYT B;  2P7J A;  1KOR A;  3G4S P;  3BCC D;  4K35 A;  2ZXX A;  1XTG B;  5APT A;  3B5N D;  1LTA C;  1ZRT E;  2J5U A;  2Y9Y A;  3RL0 D;  3KZI H;  2R3S A;  5AVT B;  1EQ7 A;  1NTK K;  1Y47 A;  2FYU E;  4Z1M H;  4RES B;  1U7J A;  1Q81 Q;  1N7S A;  5KKZ B;  2A06 D;  2GUV A;  3HD7 C;  3E7K A;  2HPC A;  1BE3 J;  5KAI H;  1AQT A;  3NTN A;  1M7L A;  1OMI A;  3MIW A;  2E76 B;  3GHG C;  1NTK G;  1GU4 A;  1IO4 A;  1L2P A;  1LWU C;  2J58 A;  1YJN P;  2FBW C;  1XTC C;  2QJK C;  5KJ7 A;  1G2C B;  3L72 D;  3L75 G;  4AYC A;  3GG2 A;  2FYU J;  2WSS H;  3LID A;  2KLV A;  4D6T G;  3EFG A;  1NTM D;  1SFC B;  2LXB A;  1T2K C;  2M3E A;  1W2B O;  3L70 E;  3H1I J;  1SQP J;  2BAS A;  2IYO A;  3LIE A;  2O1K A;  3HE4 A;  2IBZ I; 
#chains in the Genus database with same CATH homology
 5TIS H;  3JCU H;  5GTI H;  4IL6 H;  4UB6 H;  4UB8 H;  5E79 H;  5GTH H;  5KAI H;  5B66 H;  3A0H H;  5H2F H;  2AXT H;  3KZI H;  5KAF H;  5B5E H;  3WU2 H;  4PJ0 H;  1S5L H;  3A0B H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...