3JCUH

Cryo-em structure of spinach psii-lhcii supercomplex at 3.2 angstrom resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
PKPTTVGALLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVLLDGISM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Photosystem II protein D1
publication title Structure of spinach photosystem II-LHCII supercomplex at 3.2 A resolution
doi rcsb
total genus 13
structure length 59
sequence length 59
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 3jcuH01
3KZIH 3WU2H 5H2FH 1S5LH 3A0BH 4UB6H 4PJ0H 3A0HH 5KAIH 3JCUH 5KAFH 5B66H 5GTIH 2AXTH 5E79H 4IL6H 5B5EH 5GTHH 4UB8H 5TISH
chains in the Genus database with same CATH superfamily
1IFMA 1HUCA 1KFNA 1RE3A 2XDJA 1UIXA 2N1TB 2IX7C 3CMEP 2YIUB 3VMAA 3IN6A 1EZVE 3TF5A 3II6A 1SP4A 4N3YB 2HYNA 1EQ7A 3H1KG 5TJHA 4YPCA 3LIDA 5CCHA 1BE3E 1FC2C 1X22A 3L73E 4GKGA 3V2NA 1YBKA 1NWQA 2FFDC 2FYUG 4Z1MH 1GD2E 1SLQA 2KSEA 3H1KD 1N7SA 3WUTA 1LTTC 3TNUB 5KAIE 1W2BO 2E75C 2IFMA 3PHLA 1E5WA 3B8EB 2QE7H 4GOEA 1N7SB 2WPVB 1RY3A 1SQVE 4WB4A 4AYCA 2YNYA 3FX0A 2W8ZA 3A7OA 2J58A 2E75D 1HTLC 3BRVB 1QLED 2QM8A 1XTGB 1EZVD 3OJAB 2A06G 4JF7A 5CJ0A 1M7LA 4TT3H 2JWDA 1DIPA 3M06A 1FE6A 3FWNA 1BE3D 2IBZE 3N7NA 1NTKE 3L73D 3V4QA 2FKWB 3L71G 1GU5A 2BASA 2KNCB 2RN0A 2QA4P 1LTBC 1KFMA 3CX5I 2AXTH 3MUDC 3O6QB 3GHGC 2KK7A 1JM0A 3SFDC 5KJ7A 2GUSA 1SQBK 2AEFA 4UB8H 3D71A 5TISE 3L71D 1WRGA 3L72G 3C8VA 4PJ0E 1ZP0C 1SQVD 1YJWP 4H0LC 3CXHD 1AFOA 1YTZT 3H1HG 4ASVA 1GW4A 2WSSH 3PJSK 5K5GB 1FDIA 1M57D 2ZT9B 3H1LE 3M9QA 2N9BA 4EIJA 2XZRA 4HJGH 1R5LA 2IBZD 1VQ5P 1KB9I 3FXDA 2HG5D 1JB0J 1JCCA 5B5EH 2HLOA 4UB6H 1N73C 4OGQB 4I2LC 3MZWB 1FAVA 1JOCA 5CCGC 1LWUC 3HUSA 2FYZA 2QJPB 5GTHE 1N73A 5H2FE 3WU2E 4BRYA 3V5BA 3Q1MA 3HUSB 5CCGD 3AE5C 1H0TA 3VOPA 2ZJSE 3SWKA 5KTBA 3GF7A 4PD4H 2WPRA 2IDBA 4BRYB 3H1LD 3AE4C 1AV1A 3QWOC 2KB7P 3TYYA 1H0TB 2J59M 1DEEG 1EC5A 2KZJA 4JBZA 1JY3O 1BGYJ 1U57A 1KMIZ 5KAIH 1NTMK 5AVWB 5GTIE 3S4RA 1IC2A 2ZYDA 2PAJA 4OH8B 2P67A 1VQLP 1DX7A 3S1KA 3L72J 1L0LE 3L75G 2WITA 1P84E 3H1HJ 3H1IG 3LIEA 3Q2YA 3D6ZA 4RO0A 4Y99C 2VRSA 3PTZA 5CJ4A 5AW9B 2O1JA 4D6TG 2BEZF 3RL0g 4H44D 2G8YA 2E5YA 5APYA 2K9JA 4W7YA 1NGMB 3AEAC 1K8AQ 3VP9A 1T6AA 1J1DB 4NPDA 4WY4B 4HB1A 1RE4A 1VF5C 4D6TD 1SQXG 1KTMA 3RK2B 1NJIQ 2KLVA 3M9BA 2OYIC 3C9IA 3BVHA 2WSFJ 1BCCG 3BCCE 1NH4A 3A5TA 1VF5D 1L0LD 1NTZJ 1U7JA 2BCCG 4H13B 1S5LX 1GDTA 1P84D 4RJTA 1OVVA 1QX8A 3GF3A 3CWBE 2JJLA 2PP6A 5E79E 2QRXA 2Z5IA 3B4SA 1GU4A 3TGUE 1NKZB 2A45G 1OW7A 2QJYB 5KLVG 1OW6A 3E1IA 3SWYA 1IK7A 4C7NA 1R5SA 1JTHA 5GTHH 1L0NK 1K9MQ 3B71A 5H2FH 3O8ZA 3Q5RA 1HJ0A 3NFQA 1LT9B 1NAYA 1KQSO 1PPJG 1W2EA 1KC8Q 3HTKA 3BCCD 1K73Q 1ZN5A 1X9VA 1WMKA 1M56D 3L75J 4RKUJ 4BWNA 3G4SP 1VL2A 3H1IJ 5BU8B 1SQBE 3HTKB 3CWBD 1N86A 2WT7A 3V6IA 1A02F 2P1JA 4C7RA 1PFIA 3MTUE 1AJYA 3AE6C 5APVA 2QSIA 3PRJA 1PP9G 2WVRA 1D7MA 1J1EC 1URQD 3TGUD 3FXEA 1SQQJ 3LW5H 3CX5H 1G1IA 3RK3B 3R2PA 3HD7A 1T2KC 2YKQA 3B5NA 3I56P 2L5GB 1NTZK 2YO2A 3SSUA 3CCSP 4IFFA 3VP8A 2V4HA 3RL0B 1SQXJ 3HD7B 1PP9D 2O1KA 2E76B 3RGUA 1GTWA 4R4LA 1T2KD 1BCCJ 1CZQA 1KILB 1ZLLA 1NU1G 3R4YA 1JCDA 2QG4A 2K9YA 1EDLA 2BCCJ 2M3EA 4MN4C 3L74E 2M5AB 1SQBD 3GMAA 1WT6A 4UB8E 1HWTC 1KB9H 4U3FE 1N7LA 3FWLA 1GL2D 1RF1C 2O01J 3T97A 2DW3A 4L75A 5AVQB 5KLVJ 3CMAP 1FZCA 1H88A 2E42A 1YIJP 2WSEJ 2KYVA 3H1JE 3AE8C 3FGAD 1RF1A 3F89A 1PGQA 3T97B 2QJKB 1VQ4P 2AEMA 1L4AA 4AQRD 2WQYC 2M8RA 1FU1A 3EFFK 1FZCB 2K1AA 1G2CB 1OX3A 2G3AA 2KLUA 2WSCJ 2I1KA 1EXJA 4R4MA 1NTME 1JY2O 1T8ZA 1FDMA 1L4AB 5E79H 1SQQK 3M0DC 4IOIH 3L70E 5B5EE 1T3UA 2M3BA 5KLIB 3G6EP 2LR2A 3L74D 5KKZC 4UB6E 1S2EA 1CI6A 5CHXA 2NPSC 3VYIA 3HE4A 1VQMP 1VQNP 1IFJA 1SQXK 1HF9A 1PIXA 4U3FD 1A02J 2N1TD 1S4XA 3V2PA 1CI6B 2KUBA 4LGDE 3EWKA 1T3JA 4KHXA 2NPSD 2OTKE 5AVZB 3CCLP 3H1JD 2K37A 3V4WA 1ZV8A 3JCUH 2Q9IA 1JMMA 3OAKA 1H8AA 1ZXGA 4PD4E 2OYHC 2RKLA 1EXIA 1RQUA 1M1JC 2Y0CA 1RH5B 3IFMA 4I7ZB 1OXZA 1SQPJ 2KS1A 1HGZA 2E43A 1KYOI 1NTMD 2FFDA 1FZFA 1EZVG 3I55P 3A2AA 1NU1J 2Y0DA 1LTJC 5APWA 3L70D 1YJNP 3TDKA 2KS1B 3P8MC 2O3JA 3PP5A 1BE3G 3L73G 2W6AA 1LTJA 3HE5A 4I6MC 1BGYE 1QGKB 1YYCA 1ZRTE 2E75B 4XE5B 4K3AA 1JY3P 3OW2O 1SVFA 4IL6X 1JUNA 2R3CA 4PD4D 1SQVG 2XU6A 2IPPA 1RF0C 1EDKA 1IZNB 5CMZA 1IFNA 2ZAEB 3SFEC 3CCMP 1JO5A 3H1HE 4EI2A 1M90Q 4JPZB 1L0NE 2QM7A 3Q5SA 1RF0A 1LP1A 1X8YA 5C39A 1IK9A 5AW8B 2IBZG 2H89C 3MUDA 1YHQP 3GHGA 1QL1A 3P32A 5AW7B 1VQOP 2Y0EA 1S3JA 3GG2A 4I1LA 2N9YB 1LP1B 1BGYD 2IZ1A 5KJ7D 3GHGB 1SQPK 1ZRTD 1OW8A 1FJPA 3H1KJ 3KDPB 2K88A 1K04A 1NU1K 1OZHA 1NTKD 4H0LB 2FYUJ 1NKNA 3H6PA 2KI7B 5AVRB 1NTZE 3U1AA 1DD3A 1L0ND 3H1LG 5AW0B 4LC1A 1DEBA 2GUVA 1BE3J 2HPCA 5AVYB 3L73J 4W80A 1FJKA 3AE7C 2A45I 5CCGA 1GZLA 1LWUA 1Y47A 2HPCB 1N73B 3W68A 1GW3A 1LWUB 1OIPA 4OVNF 1S72P 5AW1B 3L71J 2Y9ZA 2LKMA 1ZR4A 1QEXA 1SQVJ 3E1RA 1BSHA 3V2QA 3CX5E 4DOJA 3EQ2A 1NVOA 3S9OA 3CL3D 4XA4A 3H1IE 4JQ0D 1DH3A 2ZYAA 4M3LA 2CPSA 2H7HA 1AVOA 1QVFO 2FYUK 1Q81Q 1IFDA 3P7KA 1SQQE 4H44C 4XFJA 3M91A 1SFCC 3G71P 2C9NY 1Q82Q 1LTIC 3SWFA 2WMMA 3F5HA 3C1LA 1KN7A 1J1DC 1SFCD 3CCEP 1KB9E 4WY4C 2AEJA 1L0LG 3CLQA 3KXDA 4Y99B 2YXQB 2K9JB 3CX5D 4KJMA 3CCJP 2OARA 4WY4D 1NO4A 1AQ5A 4L73A 3H1LJ 3RK2D 3TSIA 3M9HA 4IFDK 1XTCC 1J2JB 4OWFA 2OYIA 3CPWO 2W90A 1SQVK 1S1CX 1VF5B 2MKVA 2B87A 2Q3EA 2GM4A 4HYTB 2NRGA 2OYIB 2WSFH 1E79H 1LGHB 3MP7B 1USDA 2W83C 1Y8AA 2FXMA 3USSA 1KYOH 2YMYA 4HH2A 5B66E 1DD4A 3BCCG 1KB9D 1YQ3C 1YITP 3RK3E 4PV1B 4W7ZA 2YO3A 5DJUB 3Q3DA 1Q86Q 1NYHA 1LT9C 1JNMA 1JY2P 3CWBG 4C7NB 1IJDB 3GW6A 3JCUE 3D6YA 1JTHB 2OGUA 3TGUG 1FDOA 1Y9BA 3P8CE 1KILE 1URQC 1Q90D 1USEA 1MFTA 2FYNC 1KD1Q 3AEBC 2ZVOB 1URQA 4D6TJ 2D2CC 3RK3C 2E74C 2YMKA 2J5UA 1JY3N 4ZMDA 2WT7B 2JP3A 3G3ZA 2AXCA 3OA7A 2PGDA 1YJ9P 3Q5PA 4IFMA 1SQPE 3AE1C 3UIAA 3A0HH 4WVZA 1L0LJ 2D2CD 2XKMA 3RK3D 1EZVI 2E74D 4TLFA 1NU1E 1HVVA 1GK6A 3AE9C 2R44A 1SQBG 3B5NB 4DT0A 2I1JA 1J1EB 1KILC 3RBZA 1UIIA 2SPZA 2YXRB 4RESB 2H88C 2JWAA 2ZYGA 2HODA 3IAOA 2JEEA 3KPEA 1FOSE 3L37A 1GL2C 3P8CD 1VQPP 1KILD 3ITKA 2FY8A 2XV5A 2PFXA 1ZOYC 1JEKA 2FXPA 1CW5A 2KSJA 5KAFE 3CC7P 3CXHI 1FOSF 2W6JH 4K35A 1SQPD 3K5BA 1BSNA 1R8EA 2OTLP 1FS0E 3MHVA 2OYOA 3CC2P 2Q1KA 3L74G 3CWBJ 5AVUB 1RF1B 1FBMA 2O01H 2A45H 4ZKPA 4U3FG 1IFPA 4ZNCA 3AEGC 3TGUJ 2POHA 3A3YB 2UWJE 2WSEH 2R5BA 3KZIE 2H43A 1L4AD 1BDDA 2N1TC 3TK1A 2YIUC 3H1KE 2OQQA 1L0LK 3H1JG 3M0DA 5B66H 1PZQA 4GT1A 2WSCH 1RE3C 1VQ7P 2FBWC 1OFCX 1GMJA 3KHUA 1PP9J 1AVYA 4U7JA 2FYUE 3CCVP 2W6BA 2B88A 4DCKA 2V7QH 3ABVC 1KQFB 2YKOA 1NTMG 3HE4B 2NPSA 3W67A 5KKZB 3PLNA 5CCHC 3L70G 1EDJA 4I7ZC 2NPSB 4GODA 2Q6QA 1SQBJ 5AW2B 4L74A 1LTAC 5CCHD 3HRNA 2OYHA 1ZMEC 4EOTA 1N7SC 3U59A 1M1JA 1HGVA 3TNUA 5KLVK 3EFGA 2A06E 2FFDB 2BEQD 4IL6H 3KYQA 2OYHB 2WTYA 1M1JB 5BU5A 1N7SD 5EFWB 3A0BE 1YQ4C 1KORA 2IZ0A 3L71E 1PGPA 2FYUD 2Y9YA 1VQ9P 1LTJB 3HE5B 3CXHE 2P58A 1RQVA 5L8RJ 2FXOA 1MFZA 4GIFA 3L35A 4L76A 3L74J 4JYCA 3KQGA 1L2PA 3L72E 1YTZI 1CSBA 2KNCA 3NMDA 4B86A 1VQ8P 5DJTB 4N78E 4U3FJ 1X0TA 1BGYG 1LTSC 1S9KE 1S5LE 3O6QA 2MJZA 5KJ7C 2A06D 2Z4EA 3AE2C 2P7JA 1OMIA 5KAFH 1OWAA 2M0BA 3H1JJ 1NTKG 5BVZA 3CCQP 1LTGC 2WZ7A 3MGNA 4KT0J 3BATA 2ZT9C 2PRRA 1M8OB 3MD0A 1ZR2A 1IFIA 1NTMJ 3AECC 1G1JA 1FZEA 2C0WA 1H89A 1P84I 2ZT9D 3L70J 1L0NG 2IYPA 3NXSA 2Z5HA 3BASA 2Q3IA 3AEDC 2GA1A 3KZIH 4H0LD 4OGQC 1MUUA 3L72D 1JY2N 1OVUA 1KYOE 4N78D 2KXPB 3H1HD 2QJPC 4LLHA 4EYYQ 1S9KD 2IFNA 4C46A 4OGQD 1Z56A 3HUSC 3H32A 1W5CE 1KZUB 4O9BA 3VMYA 5AW3B 1TU3F 4DJGA 3H32B 2B9BA 2R3SA 3AE3C 2Q5UA 3WUUA 3H25A 4ZKUA 1NTZG 4DZOA 2LXBA 1SS1A 3CC4P 5APTA 1M1KQ 1FZGA 2JKVA 5AW4B 2O01N 1LT1A 4EDFA 5APQA 2ZXXA 3U1CA 1KYOD 3CCUP 3V2RA 1NTZD 3L75E 2QEXP 1FZBA 3A0BH 3A0HE 1PGOA 3GLMA 1QVGO 2H8PD 4ASWA 1NTKJ 2L91A 4D6TE 4N6JA 3CXHH 4YXDC 5M1BA 3AEFC 1AQTA 3NTNA 4BXLA 3VN0A 3I5CA 3MIWA 3IR9A 4NPFX 1HBWA 5APXA 2WWWA 3VMXA 4QMAA 1SQXE 1L0NJ 1HH0A 1SFCA 2JDIH 2WPSA 2ZFCA 4H44B 1K05A 5AVSB 1S5LH 5AW6B 1BCCE 1N2DC 3RK2C 1Q7YQ 1SFCB 1SQQG 1KQLA 2BCCE 4HKZH 3L75D 4WY4A 1KQGB 1RE4C 2C0XA 3IF4A 3H1ID 2KIKA 2R32A 2KZIA 4H13C 5TISH 3BRTB 4PJ0H 2C9LY 2CK3H 1KV4A 1SQQD 3D70A 1QL2A 1PV3A 5KLVE 2NZ2A 4H13D 2IYOA 3G9RA 1VDFA 1MV8A 2QJYC 1U7MA 2OTJP 1PGJA 3CD6P 2B87B 2E5TA 1SQXD 4PV1C 2ZVNB 2B89A 4YTPC 1NTKK 1PPJE 1NOHA 1BCCD 4AUWA 4PV1D 2BCCD 1X79B 3VTPC 4GDOA 1LT9A 1PP9E 1ZW0A 3N4XA 3M0AA 3WU2H 5CBNA 4YXWH 2JO1A 5KLVD 3LW5J 5APUA 4GOFA 2P10A 4WBAA 4IL6E 2CPBA 2W27A 1NAFA 2RMZA 5AVTB 3PH0A 1Q2NA 3RBXA 4JYBA 1URQB 4Y28J 1RHZB 3RL0C 2FYNB 1MKMA 5APSA 3HD7C 1PPJD 3B5NC 2I8DA 2E76C 2LXCB 3JSVC 1PL5A 5GTIH 2Q7CA 2D2CB 1AA0A 2E74B 3WMM0 3RL0D 1HJBA 3CCRP 3HD7D 3E7KA 2R5DA 3B5ND 3CI9A 3L4FA 2E76D 3JC22 2ITAA 4PD4I 3VMZA 1KILA 5AVVB 1P84H 3WUVA 2HODB 1SQPG 3ZDMA 2QIWA 2WPQA 2M5AA 5CBOA 4A7PA 1LJ2A 2XNXA 1GL2A 2KOGA 3AEEC 3QH9A 1OVRA 2AXTE 1VQKP 2QJKC 1GL2B 1EDIA 3BCCJ 2QVAA 1FZCC 4NPEA 1JMBA 3L36A 1YI2P 1NU1D 1FZAA 1VPCA 2ZXEB 2P2UA 1L4AC 2KP8A 2IBZI 1G2CA 1BDCA 4CPGA 5KLIC 1LNQA 1VQ6P 4WWIA 1N8RQ 1MZ9A 5AVXB 5AW5B 1GK4A 1NHLA 1IO4A 2YKPA 2RH0A 2JR8A 2XNDH 2V7QJ 2N1TA 2K3RA 2HFED 2HR3A
chains in the Genus database with same CATH topology
3KZIH 3WU2H 5H2FH 1S5LH 3A0BH 4UB6H 4PJ0H 3A0HH 5KAIH 3JCUH 5KAFH 5B66H 5GTIH 2AXTH 5E79H 4IL6H 5B5EH 5GTHH 4UB8H 5TISH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI H;  3WU2 H;  5H2F H;  1S5L H;  3A0B H;  4UB6 H;  4PJ0 H;  3A0H H;  5KAI H;  3JCU H;  5KAF H;  5B66 H;  5GTI H;  2AXT H;  5E79 H;  4IL6 H;  5B5E H;  5GTH H;  4UB8 H;  5TIS H; 
#chains in the Genus database with same CATH topology
 1IFM A;  1HUC A;  1KFN A;  1RE3 A;  2XDJ A;  1UIX A;  2N1T B;  2IX7 C;  3CME P;  2YIU B;  3VMA A;  3IN6 A;  1EZV E;  3TF5 A;  3II6 A;  1SP4 A;  4N3Y B;  2HYN A;  1EQ7 A;  3H1K G;  5TJH A;  4YPC A;  3LID A;  5CCH A;  1BE3 E;  1FC2 C;  1X22 A;  3L73 E;  4GKG A;  3V2N A;  1YBK A;  1NWQ A;  2FFD C;  2FYU G;  4Z1M H;  1GD2 E;  1SLQ A;  2KSE A;  3H1K D;  1N7S A;  3WUT A;  1LTT C;  3TNU B;  5KAI E;  1W2B O;  2E75 C;  2IFM A;  3PHL A;  1E5W A;  3B8E B;  2QE7 H;  4GOE A;  1N7S B;  2WPV B;  1RY3 A;  1SQV E;  4WB4 A;  4AYC A;  2YNY A;  3FX0 A;  2W8Z A;  3A7O A;  2J58 A;  2E75 D;  1HTL C;  3BRV B;  1QLE D;  2QM8 A;  1XTG B;  1EZV D;  3OJA B;  2A06 G;  4JF7 A;  5CJ0 A;  1M7L A;  4TT3 H;  2JWD A;  1DIP A;  3M06 A;  1FE6 A;  3FWN A;  1BE3 D;  2IBZ E;  3N7N A;  1NTK E;  3L73 D;  3V4Q A;  2FKW B;  3L71 G;  1GU5 A;  2BAS A;  2KNC B;  2RN0 A;  2QA4 P;  1LTB C;  1KFM A;  3CX5 I;  2AXT H;  3MUD C;  3O6Q B;  3GHG C;  2KK7 A;  1JM0 A;  3SFD C;  5KJ7 A;  2GUS A;  1SQB K;  2AEF A;  4UB8 H;  3D71 A;  5TIS E;  3L71 D;  1WRG A;  3L72 G;  3C8V A;  4PJ0 E;  1ZP0 C;  1SQV D;  1YJW P;  4H0L C;  3CXH D;  1AFO A;  1YTZ T;  3H1H G;  4ASV A;  1GW4 A;  2WSS H;  3PJS K;  5K5G B;  1FDI A;  1M57 D;  2ZT9 B;  3H1L E;  3M9Q A;  2N9B A;  4EIJ A;  2XZR A;  4HJG H;  1R5L A;  2IBZ D;  1VQ5 P;  1KB9 I;  3FXD A;  2HG5 D;  1JB0 J;  1JCC A;  5B5E H;  2HLO A;  4UB6 H;  1N73 C;  4OGQ B;  4I2L C;  3MZW B;  1FAV A;  1JOC A;  5CCG C;  1LWU C;  3HUS A;  2FYZ A;  2QJP B;  5GTH E;  1N73 A;  5H2F E;  3WU2 E;  4BRY A;  3V5B A;  3Q1M A;  3HUS B;  5CCG D;  3AE5 C;  1H0T A;  3VOP A;  2ZJS E;  3SWK A;  5KTB A;  3GF7 A;  4PD4 H;  2WPR A;  2IDB A;  4BRY B;  3H1L D;  3AE4 C;  1AV1 A;  3QWO C;  2KB7 P;  3TYY A;  1H0T B;  2J59 M;  1DEE G;  1EC5 A;  2KZJ A;  4JBZ A;  1JY3 O;  1BGY J;  1U57 A;  1KMI Z;  5KAI H;  1NTM K;  5AVW B;  5GTI E;  3S4R A;  1IC2 A;  2ZYD A;  2PAJ A;  4OH8 B;  2P67 A;  1VQL P;  1DX7 A;  3S1K A;  3L72 J;  1L0L E;  3L75 G;  2WIT A;  1P84 E;  3H1H J;  3H1I G;  3LIE A;  3Q2Y A;  3D6Z A;  4RO0 A;  4Y99 C;  2VRS A;  3PTZ A;  5CJ4 A;  5AW9 B;  2O1J A;  4D6T G;  2BEZ F;  3RL0 g;  4H44 D;  2G8Y A;  2E5Y A;  5APY A;  2K9J A;  4W7Y A;  1NGM B;  3AEA C;  1K8A Q;  3VP9 A;  1T6A A;  1J1D B;  4NPD A;  4WY4 B;  4HB1 A;  1RE4 A;  1VF5 C;  4D6T D;  1SQX G;  1KTM A;  3RK2 B;  1NJI Q;  2KLV A;  3M9B A;  2OYI C;  3C9I A;  3BVH A;  2WSF J;  1BCC G;  3BCC E;  1NH4 A;  3A5T A;  1VF5 D;  1L0L D;  1NTZ J;  1U7J A;  2BCC G;  4H13 B;  1S5L X;  1GDT A;  1P84 D;  4RJT A;  1OVV A;  1QX8 A;  3GF3 A;  3CWB E;  2JJL A;  2PP6 A;  5E79 E;  2QRX A;  2Z5I A;  3B4S A;  1GU4 A;  3TGU E;  1NKZ B;  2A45 G;  1OW7 A;  2QJY B;  5KLV G;  1OW6 A;  3E1I A;  3SWY A;  1IK7 A;  4C7N A;  1R5S A;  1JTH A;  5GTH H;  1L0N K;  1K9M Q;  3B71 A;  5H2F H;  3O8Z A;  3Q5R A;  1HJ0 A;  3NFQ A;  1LT9 B;  1NAY A;  1KQS O;  1PPJ G;  1W2E A;  1KC8 Q;  3HTK A;  3BCC D;  1K73 Q;  1ZN5 A;  1X9V A;  1WMK A;  1M56 D;  3L75 J;  4RKU J;  4BWN A;  3G4S P;  1VL2 A;  3H1I J;  5BU8 B;  1SQB E;  3HTK B;  3CWB D;  1N86 A;  2WT7 A;  3V6I A;  1A02 F;  2P1J A;  4C7R A;  1PFI A;  3MTU E;  1AJY A;  3AE6 C;  5APV A;  2QSI A;  3PRJ A;  1PP9 G;  2WVR A;  1D7M A;  1J1E C;  1URQ D;  3TGU D;  3FXE A;  1SQQ J;  3LW5 H;  3CX5 H;  1G1I A;  3RK3 B;  3R2P A;  3HD7 A;  1T2K C;  2YKQ A;  3B5N A;  3I56 P;  2L5G B;  1NTZ K;  2YO2 A;  3SSU A;  3CCS P;  4IFF A;  3VP8 A;  2V4H A;  3RL0 B;  1SQX J;  3HD7 B;  1PP9 D;  2O1K A;  2E76 B;  3RGU A;  1GTW A;  4R4L A;  1T2K D;  1BCC J;  1CZQ A;  1KIL B;  1ZLL A;  1NU1 G;  3R4Y A;  1JCD A;  2QG4 A;  2K9Y A;  1EDL A;  2BCC J;  2M3E A;  4MN4 C;  3L74 E;  2M5A B;  1SQB D;  3GMA A;  1WT6 A;  4UB8 E;  1HWT C;  1KB9 H;  4U3F E;  1N7L A;  3FWL A;  1GL2 D;  1RF1 C;  2O01 J;  3T97 A;  2DW3 A;  4L75 A;  5AVQ B;  5KLV J;  3CMA P;  1FZC A;  1H88 A;  2E42 A;  1YIJ P;  2WSE J;  2KYV A;  3H1J E;  3AE8 C;  3FGA D;  1RF1 A;  3F89 A;  1PGQ A;  3T97 B;  2QJK B;  1VQ4 P;  2AEM A;  1L4A A;  4AQR D;  2WQY C;  2M8R A;  1FU1 A;  3EFF K;  1FZC B;  2K1A A;  1G2C B;  1OX3 A;  2G3A A;  2KLU A;  2WSC J;  2I1K A;  1EXJ A;  4R4M A;  1NTM E;  1JY2 O;  1T8Z A;  1FDM A;  1L4A B;  5E79 H;  1SQQ K;  3M0D C;  4IOI H;  3L70 E;  5B5E E;  1T3U A;  2M3B A;  5KLI B;  3G6E P;  2LR2 A;  3L74 D;  5KKZ C;  4UB6 E;  1S2E A;  1CI6 A;  5CHX A;  2NPS C;  3VYI A;  3HE4 A;  1VQM P;  1VQN P;  1IFJ A;  1SQX K;  1HF9 A;  1PIX A;  4U3F D;  1A02 J;  2N1T D;  1S4X A;  3V2P A;  1CI6 B;  2KUB A;  4LGD E;  3EWK A;  1T3J A;  4KHX A;  2NPS D;  2OTK E;  5AVZ B;  3CCL P;  3H1J D;  2K37 A;  3V4W A;  1ZV8 A;  3JCU H;  2Q9I A;  1JMM A;  3OAK A;  1H8A A;  1ZXG A;  4PD4 E;  2OYH C;  2RKL A;  1EXI A;  1RQU A;  1M1J C;  2Y0C A;  1RH5 B;  3IFM A;  4I7Z B;  1OXZ A;  1SQP J;  2KS1 A;  1HGZ A;  2E43 A;  1KYO I;  1NTM D;  2FFD A;  1FZF A;  1EZV G;  3I55 P;  3A2A A;  1NU1 J;  2Y0D A;  1LTJ C;  5APW A;  3L70 D;  1YJN P;  3TDK A;  2KS1 B;  3P8M C;  2O3J A;  3PP5 A;  1BE3 G;  3L73 G;  2W6A A;  1LTJ A;  3HE5 A;  4I6M C;  1BGY E;  1QGK B;  1YYC A;  1ZRT E;  2E75 B;  4XE5 B;  4K3A A;  1JY3 P;  3OW2 O;  1SVF A;  4IL6 X;  1JUN A;  2R3C A;  4PD4 D;  1SQV G;  2XU6 A;  2IPP A;  1RF0 C;  1EDK A;  1IZN B;  5CMZ A;  1IFN A;  2ZAE B;  3SFE C;  3CCM P;  1JO5 A;  3H1H E;  4EI2 A;  1M90 Q;  4JPZ B;  1L0N E;  2QM7 A;  3Q5S A;  1RF0 A;  1LP1 A;  1X8Y A;  5C39 A;  1IK9 A;  5AW8 B;  2IBZ G;  2H89 C;  3MUD A;  1YHQ P;  3GHG A;  1QL1 A;  3P32 A;  5AW7 B;  1VQO P;  2Y0E A;  1S3J A;  3GG2 A;  4I1L A;  2N9Y B;  1LP1 B;  1BGY D;  2IZ1 A;  5KJ7 D;  3GHG B;  1SQP K;  1ZRT D;  1OW8 A;  1FJP A;  3H1K J;  3KDP B;  2K88 A;  1K04 A;  1NU1 K;  1OZH A;  1NTK D;  4H0L B;  2FYU J;  1NKN A;  3H6P A;  2KI7 B;  5AVR B;  1NTZ E;  3U1A A;  1DD3 A;  1L0N D;  3H1L G;  5AW0 B;  4LC1 A;  1DEB A;  2GUV A;  1BE3 J;  2HPC A;  5AVY B;  3L73 J;  4W80 A;  1FJK A;  3AE7 C;  2A45 I;  5CCG A;  1GZL A;  1LWU A;  1Y47 A;  2HPC B;  1N73 B;  3W68 A;  1GW3 A;  1LWU B;  1OIP A;  4OVN F;  1S72 P;  5AW1 B;  3L71 J;  2Y9Z A;  2LKM A;  1ZR4 A;  1QEX A;  1SQV J;  3E1R A;  1BSH A;  3V2Q A;  3CX5 E;  4DOJ A;  3EQ2 A;  1NVO A;  3S9O A;  3CL3 D;  4XA4 A;  3H1I E;  4JQ0 D;  1DH3 A;  2ZYA A;  4M3L A;  2CPS A;  2H7H A;  1AVO A;  1QVF O;  2FYU K;  1Q81 Q;  1IFD A;  3P7K A;  1SQQ E;  4H44 C;  4XFJ A;  3M91 A;  1SFC C;  3G71 P;  2C9N Y;  1Q82 Q;  1LTI C;  3SWF A;  2WMM A;  3F5H A;  3C1L A;  1KN7 A;  1J1D C;  1SFC D;  3CCE P;  1KB9 E;  4WY4 C;  2AEJ A;  1L0L G;  3CLQ A;  3KXD A;  4Y99 B;  2YXQ B;  2K9J B;  3CX5 D;  4KJM A;  3CCJ P;  2OAR A;  4WY4 D;  1NO4 A;  1AQ5 A;  4L73 A;  3H1L J;  3RK2 D;  3TSI A;  3M9H A;  4IFD K;  1XTC C;  1J2J B;  4OWF A;  2OYI A;  3CPW O;  2W90 A;  1SQV K;  1S1C X;  1VF5 B;  2MKV A;  2B87 A;  2Q3E A;  2GM4 A;  4HYT B;  2NRG A;  2OYI B;  2WSF H;  1E79 H;  1LGH B;  3MP7 B;  1USD A;  2W83 C;  1Y8A A;  2FXM A;  3USS A;  1KYO H;  2YMY A;  4HH2 A;  5B66 E;  1DD4 A;  3BCC G;  1KB9 D;  1YQ3 C;  1YIT P;  3RK3 E;  4PV1 B;  4W7Z A;  2YO3 A;  5DJU B;  3Q3D A;  1Q86 Q;  1NYH A;  1LT9 C;  1JNM A;  1JY2 P;  3CWB G;  4C7N B;  1IJD B;  3GW6 A;  3JCU E;  3D6Y A;  1JTH B;  2OGU A;  3TGU G;  1FDO A;  1Y9B A;  3P8C E;  1KIL E;  1URQ C;  1Q90 D;  1USE A;  1MFT A;  2FYN C;  1KD1 Q;  3AEB C;  2ZVO B;  1URQ A;  4D6T J;  2D2C C;  3RK3 C;  2E74 C;  2YMK A;  2J5U A;  1JY3 N;  4ZMD A;  2WT7 B;  2JP3 A;  3G3Z A;  2AXC A;  3OA7 A;  2PGD A;  1YJ9 P;  3Q5P A;  4IFM A;  1SQP E;  3AE1 C;  3UIA A;  3A0H H;  4WVZ A;  1L0L J;  2D2C D;  2XKM A;  3RK3 D;  1EZV I;  2E74 D;  4TLF A;  1NU1 E;  1HVV A;  1GK6 A;  3AE9 C;  2R44 A;  1SQB G;  3B5N B;  4DT0 A;  2I1J A;  1J1E B;  1KIL C;  3RBZ A;  1UII A;  2SPZ A;  2YXR B;  4RES B;  2H88 C;  2JWA A;  2ZYG A;  2HOD A;  3IAO A;  2JEE A;  3KPE A;  1FOS E;  3L37 A;  1GL2 C;  3P8C D;  1VQP P;  1KIL D;  3ITK A;  2FY8 A;  2XV5 A;  2PFX A;  1ZOY C;  1JEK A;  2FXP A;  1CW5 A;  2KSJ A;  5KAF E;  3CC7 P;  3CXH I;  1FOS F;  2W6J H;  4K35 A;  1SQP D;  3K5B A;  1BSN A;  1R8E A;  2OTL P;  1FS0 E;  3MHV A;  2OYO A;  3CC2 P;  2Q1K A;  3L74 G;  3CWB J;  5AVU B;  1RF1 B;  1FBM A;  2O01 H;  2A45 H;  4ZKP A;  4U3F G;  1IFP A;  4ZNC A;  3AEG C;  3TGU J;  2POH A;  3A3Y B;  2UWJ E;  2WSE H;  2R5B A;  3KZI E;  2H43 A;  1L4A D;  1BDD A;  2N1T C;  3TK1 A;  2YIU C;  3H1K E;  2OQQ A;  1L0L K;  3H1J G;  3M0D A;  5B66 H;  1PZQ A;  4GT1 A;  2WSC H;  1RE3 C;  1VQ7 P;  2FBW C;  1OFC X;  1GMJ A;  3KHU A;  1PP9 J;  1AVY A;  4U7J A;  2FYU E;  3CCV P;  2W6B A;  2B88 A;  4DCK A;  2V7Q H;  3ABV C;  1KQF B;  2YKO A;  1NTM G;  3HE4 B;  2NPS A;  3W67 A;  5KKZ B;  3PLN A;  5CCH C;  3L70 G;  1EDJ A;  4I7Z C;  2NPS B;  4GOD A;  2Q6Q A;  1SQB J;  5AW2 B;  4L74 A;  1LTA C;  5CCH D;  3HRN A;  2OYH A;  1ZME C;  4EOT A;  1N7S C;  3U59 A;  1M1J A;  1HGV A;  3TNU A;  5KLV K;  3EFG A;  2A06 E;  2FFD B;  2BEQ D;  4IL6 H;  3KYQ A;  2OYH B;  2WTY A;  1M1J B;  5BU5 A;  1N7S D;  5EFW B;  3A0B E;  1YQ4 C;  1KOR A;  2IZ0 A;  3L71 E;  1PGP A;  2FYU D;  2Y9Y A;  1VQ9 P;  1LTJ B;  3HE5 B;  3CXH E;  2P58 A;  1RQV A;  5L8R J;  2FXO A;  1MFZ A;  4GIF A;  3L35 A;  4L76 A;  3L74 J;  4JYC A;  3KQG A;  1L2P A;  3L72 E;  1YTZ I;  1CSB A;  2KNC A;  3NMD A;  4B86 A;  1VQ8 P;  5DJT B;  4N78 E;  4U3F J;  1X0T A;  1BGY G;  1LTS C;  1S9K E;  1S5L E;  3O6Q A;  2MJZ A;  5KJ7 C;  2A06 D;  2Z4E A;  3AE2 C;  2P7J A;  1OMI A;  5KAF H;  1OWA A;  2M0B A;  3H1J J;  1NTK G;  5BVZ A;  3CCQ P;  1LTG C;  2WZ7 A;  3MGN A;  4KT0 J;  3BAT A;  2ZT9 C;  2PRR A;  1M8O B;  3MD0 A;  1ZR2 A;  1IFI A;  1NTM J;  3AEC C;  1G1J A;  1FZE A;  2C0W A;  1H89 A;  1P84 I;  2ZT9 D;  3L70 J;  1L0N G;  2IYP A;  3NXS A;  2Z5H A;  3BAS A;  2Q3I A;  3AED C;  2GA1 A;  3KZI H;  4H0L D;  4OGQ C;  1MUU A;  3L72 D;  1JY2 N;  1OVU A;  1KYO E;  4N78 D;  2KXP B;  3H1H D;  2QJP C;  4LLH A;  4EYY Q;  1S9K D;  2IFN A;  4C46 A;  4OGQ D;  1Z56 A;  3HUS C;  3H32 A;  1W5C E;  1KZU B;  4O9B A;  3VMY A;  5AW3 B;  1TU3 F;  4DJG A;  3H32 B;  2B9B A;  2R3S A;  3AE3 C;  2Q5U A;  3WUU A;  3H25 A;  4ZKU A;  1NTZ G;  4DZO A;  2LXB A;  1SS1 A;  3CC4 P;  5APT A;  1M1K Q;  1FZG A;  2JKV A;  5AW4 B;  2O01 N;  1LT1 A;  4EDF A;  5APQ A;  2ZXX A;  3U1C A;  1KYO D;  3CCU P;  3V2R A;  1NTZ D;  3L75 E;  2QEX P;  1FZB A;  3A0B H;  3A0H E;  1PGO A;  3GLM A;  1QVG O;  2H8P D;  4ASW A;  1NTK J;  2L91 A;  4D6T E;  4N6J A;  3CXH H;  4YXD C;  5M1B A;  3AEF C;  1AQT A;  3NTN A;  4BXL A;  3VN0 A;  3I5C A;  3MIW A;  3IR9 A;  4NPF X;  1HBW A;  5APX A;  2WWW A;  3VMX A;  4QMA A;  1SQX E;  1L0N J;  1HH0 A;  1SFC A;  2JDI H;  2WPS A;  2ZFC A;  4H44 B;  1K05 A;  5AVS B;  1S5L H;  5AW6 B;  1BCC E;  1N2D C;  3RK2 C;  1Q7Y Q;  1SFC B;  1SQQ G;  1KQL A;  2BCC E;  4HKZ H;  3L75 D;  4WY4 A;  1KQG B;  1RE4 C;  2C0X A;  3IF4 A;  3H1I D;  2KIK A;  2R32 A;  2KZI A;  4H13 C;  5TIS H;  3BRT B;  4PJ0 H;  2C9L Y;  2CK3 H;  1KV4 A;  1SQQ D;  3D70 A;  1QL2 A;  1PV3 A;  5KLV E;  2NZ2 A;  4H13 D;  2IYO A;  3G9R A;  1VDF A;  1MV8 A;  2QJY C;  1U7M A;  2OTJ P;  1PGJ A;  3CD6 P;  2B87 B;  2E5T A;  1SQX D;  4PV1 C;  2ZVN B;  2B89 A;  4YTP C;  1NTK K;  1PPJ E;  1NOH A;  1BCC D;  4AUW A;  4PV1 D;  2BCC D;  1X79 B;  3VTP C;  4GDO A;  1LT9 A;  1PP9 E;  1ZW0 A;  3N4X A;  3M0A A;  3WU2 H;  5CBN A;  4YXW H;  2JO1 A;  5KLV D;  3LW5 J;  5APU A;  4GOF A;  2P10 A;  4WBA A;  4IL6 E;  2CPB A;  2W27 A;  1NAF A;  2RMZ A;  5AVT B;  3PH0 A;  1Q2N A;  3RBX A;  4JYB A;  1URQ B;  4Y28 J;  1RHZ B;  3RL0 C;  2FYN B;  1MKM A;  5APS A;  3HD7 C;  1PPJ D;  3B5N C;  2I8D A;  2E76 C;  2LXC B;  3JSV C;  1PL5 A;  5GTI H;  2Q7C A;  2D2C B;  1AA0 A;  2E74 B;  3WMM 0;  3RL0 D;  1HJB A;  3CCR P;  3HD7 D;  3E7K A;  2R5D A;  3B5N D;  3CI9 A;  3L4F A;  2E76 D;  3JC2 2;  2ITA A;  4PD4 I;  3VMZ A;  1KIL A;  5AVV B;  1P84 H;  3WUV A;  2HOD B;  1SQP G;  3ZDM A;  2QIW A;  2WPQ A;  2M5A A;  5CBO A;  4A7P A;  1LJ2 A;  2XNX A;  1GL2 A;  2KOG A;  3AEE C;  3QH9 A;  1OVR A;  2AXT E;  1VQK P;  2QJK C;  1GL2 B;  1EDI A;  3BCC J;  2QVA A;  1FZC C;  4NPE A;  1JMB A;  3L36 A;  1YI2 P;  1NU1 D;  1FZA A;  1VPC A;  2ZXE B;  2P2U A;  1L4A C;  2KP8 A;  2IBZ I;  1G2C A;  1BDC A;  4CPG A;  5KLI C;  1LNQ A;  1VQ6 P;  4WWI A;  1N8R Q;  1MZ9 A;  5AVX B;  5AW5 B;  1GK4 A;  1NHL A;  1IO4 A;  2YKP A;  2RH0 A;  2JR8 A;  2XND H;  2V7Q J;  2N1T A;  2K3R A;  2HFE D;  2HR3 A; 
#chains in the Genus database with same CATH homology
 3KZI H;  3WU2 H;  5H2F H;  1S5L H;  3A0B H;  4UB6 H;  4PJ0 H;  3A0H H;  5KAI H;  3JCU H;  5KAF H;  5B66 H;  5GTI H;  2AXT H;  5E79 H;  4IL6 H;  5B5E H;  5GTH H;  4UB8 H;  5TIS H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...