3JCUH

Cryo-em structure of spinach psii-lhcii supercomplex at 3.2 angstrom resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
PKPTTVGALLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVLLDGISM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1
publication title Structure of spinach photosystem II-LHCII supercomplex at 3.2 A resolution
doi rcsb
molecule tags Membrane protein
total genus 13
structure length 59
sequence length 59
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 3jcuH01
4PJ0H 5TISH 5B5EH 3JCUH 3KZIH 1S5LH 5B66H 3A0BH 3A0HH 4UB6H 5KAFH 3WU2H 2AXTH 4UB8H 5GTHH 4IL6H 5H2FH 5GTIH 5E79H 5KAIH
chains in the Genus database with same CATH superfamily
1LGHB 3MP7B 2FXMA 4EI2A 1SVFA 3A0HE 1VQ4P 4YXDC 3V4QA 2PP6A 4ASVA 4N78E 1SQPE 1JUNA 2KYVA 3KZIE 1M90Q 1N7SC 3KYQA 4N78D 4XE5B 1R5SA 3MHVA 1SQVE 2JO1A 5KTBA 2O3JA 2AEMA 1ZOYC 2I1KA 3E7KA 5AVXB 4B86A 2H8PD 2V4HA 1SQVD 2SPZA 3JCUE 2IZ1A 2AXCA 4K35A 5CJ0A 1R8EA 2JP3A 1PPJG 2R5BA 3BCCG 1Y9BA 1X79B 2Y0DA 2R32A 1DX7A 4H0LC 5M1BA 4IFDK 2G8YA 3L74D 3AEFC 5KAIH 2AEFA 5APQA 1NHLA 1RE4A 2Z4EA 1EC5A 2BCCE 2PFXA 2W90A 1SP4A 3WMM0 2KIKA 1JOCA 3VMAA 3UIAA 2OYHA 1J1EC 3GF3A 2QJKB 2PAJA 1AJYA 2H7HA 3V6IA 1L0LK 2J59M 5AW5B 2ZJSE 1H88A 2KZIA 1S1CX 2KSEA 3HE5A 2WPQA 5K5GB 3TNUA 1GL2A 5CCGD 4NPEA 1PV3A 2KZJA 5AW2B 4LGDE 3CX5E 2XNDH 2O1JA 1VQOP 2CPBA 4XA4A 4JPZB 1ZR2A 1NTZK 1N73C 3R4YA 1L2PA 1AVYA 4H44C 3IAOA 5AVYB 4HYTB 3CX5D 3H1HG 2AXTH 4H0LD 1VQNP 3P8CE 2NPSA 1UIIA 3V2QA 5B5EH 1JCDA 4ZKUA 2HPCA 3JSVC 1JTHA 4OH8B 2ZVOB 3GHGB 1FZCC 3P8CD 1NTKK 1NU1E 1L0LG 3S9OA 1SFCC 1YHQP 3GMAA 3AE9C 1D7MA 3LIDA 5EFWB 5GTIE 1BSHA 3L73E 2JWAA 3KDPB 1N8RQ 2K3RA 3PHLA 1NU1D 1X8YA 2D2CC 1RF1B 4IFFA 3L37A 1LTGC 3L73D 3RK2C 4C7NA 2IX7C 1FZBA 1NTZG 2N1TC 3C8VA 3H1JJ 3CD6P 3TF5A 1USDA 5AW7B 5AVUB 3CCVP 3IFMA 5CCHA 4H44D 1SQQE 1T3JA 1BGYG 1U7MA 1FDMA 1ZRTE 3CLQA 1NTME 3C1LA 3WUUA 1VQ5P 2QJYC 1NTKG 1OMIA 3RBXA 3CCRP 1LTAC 5AW0B 1YBKA 1W2EA 4XFJA 3A0BH 4L74A 1PZQA 2FFDB 1GDTA 3CPWO 2WSCJ 1SFCD 2KB7P 2ZT9B 2Q3IA 2E5TA 2QJPC 2D2CD 1LTJA 2W8ZA 1S5LE 1Q2NA 1Q86Q 4R4MA 4U3FG 1VF5C 2WSCH 3VMZA 2N1TD 1RQUA 1P84H 4W7YA 2K9YA 4WY4C 1SQXJ 3FWNA 3A2AA 3U59A 1BCCJ 2IBZI 1GU4A 1P84I 1EZVI 2XU6A 3HE4A 4RO0A 3L74G 4IL6H 5KLVJ 1OIPA 3SFEC 1VDFA 2B9BA 1OW8A 1UIXA 2KK7A 4TLFA 1LT9A 3M9QA 1SQPJ 1RF0C 3L35A 2K9JA 3AE1C 1FZGA 5AW8B 2KLVA 2OTLP 2OTKE 3M0AA 1Z56A 3H1LG 3CCJP 4MN4C 1VF5D 3EWKA 2R3SA 4JQ0D 2Q6QA 4L76A 1JMMA 4WY4D 1PPJE 2KXPB 2UWJE 5CBNA 3BCCE 3HD7A 3KZIH 1GMJA 1KILC 2JEEA 3VMXA 2OYHB 1YQ4C 1W5CE 5APWA 3M0DC 3NTNA 1FJPA 1L4AA 5AVRB 1A02J 3VP9A 1JO5A 2QM8A 2BCCJ 1HGVA 1NVOA 3JCUH 2OQQA 5AW4B 2B89A 1MKMA 3HE5B 4UB6E 1Q7YQ 3TNUB 1GL2B 1VQ7P 4BRYA 3LW5J 2DW3A 4H13C 3W68A 1JY2P 3AEGC 3MUDA 4EDFA 4N6JA 3I55P 2O1KA 2BEZF 3IF4A 3FGAD 4PD4D 3MD0A 1PGPA 2YO3A 1KILE 2FXOA 1M1JA 2I1JA 3WUTA 2Y0CA 3L75G 4N3YB 1OVVA 3RK3C 4BWNA 1L0NK 2H88C 3LW5H 2HG5D 2HPCB 1JTHB 1KILD 3H1HE 2WT7A 4C7RA 1QGKB 1JY2N 1LJ2A 3S1KA 2QG4A 3T97B 3H1HD 1AV1A 2OGUA 1ZV8A 4O9BA 1KQGB 1L0LE 2IYPA 1M1KQ 1KB9E 1JB0J 4C7NB 1J1DB 2J58A 3HUSA 3CX5I 3WU2H 1S4XA 4H13D 2W27A 3I56P 2Q9IA 3G9RA 1L0LD 1HUCA 1SQBJ 1ZW0A 3RK3E 4M3LA 1LTSC 1NTZE 2OYIC 1KYOH 3TK1A 1GZLA 2ZT9C 4UB8H 5TJHA 3RK3D 1NH4A 3L71J 1GK4A 5GTIH 2Y9YA 1NTZD 1BGYE 3N4XA 3VOPA 4OGQC 3USSA 1SQQJ 1KQFB 2OARA 1N7LA 2N9BA 1NTMJ 2H89C 2R3CA 1NTKE 4OVNF 1BGYD 2K37A 3FXDA 1FAVA 4AYCA 4YXWH 2XNXA 1IFPA 2RN0A 1LTJB 3E1RA 4YTPC 1NTKD 2AEJA 2A06D 4I7ZC 1PIXA 3NXSA 5CMZA 1RE3A 1BSNA 3G4SP 2E74C 1EDLA 1AFOA 3E1IA 4RKUJ 4U3FE 2YKQA 3KPEA 2C9LY 3Q5SA 2QRXA 1URQC 3RL0g 3P7KA 1HVVA 1G2CA 2ZT9D 3ABVC 3HE4B 4U3FD 1T3UA 2FYUJ 2ZYDA 3BATA 4OGQD 1KV4A 3M9BA 2M3BA 2Y0EA 3Q3DA 3WUVA 1S5LH 1LT9B 3L74E 3RL0B 3TGUJ 2GM4A 5KLIB 4KT0J 3B5NC 2K9JB 3CCEP 4GIFA 2P67A 1ZR4A 2B88A 1S72P 3H1IJ 3I5CA 1JMBA 2POHA 5CCGA 3TSIA 1VQLP 2ZYAA 3AEDC 2E5YA 2KNCA 2E74D 3H1LE 1J2JB 5APTA 1CI6A 3HD7B 3N7NA 2KP8A 3G71P 1OW7A 2WMMA 1URQD 4D6TD 1N7SD 4GKGA 3H1LD 3V4WA 1JCCA 3AE8C 2FYNB 1GL2C 5KJ7A 1BE3D 3PJSK 1FS0E 3GF7A 4A7PA 3EQ2A 1XTCC 3BCCJ 3V2PA 1LTTC 3GG2A 1EDKA 2L5GB 3H1KJ 3BASA 1K8AQ 4Y99C 3BRVB 3HTKA 1SLQA 2YIUB 4GOEA 3B5ND 1TU3F 1GTWA 1T2KC 1NJIQ 5CHXA 1USEA 1Q82Q 4DCKA 3R2PA 3S4RA 1S9KD 4I1LA 2RKLA 1M1JB 1FU1A 1IO4A 3H1JG 3CL3D 3VYIA 1N73A 5GTHE 4OWFA 3VN0A 2E75C 2FYZA 4ZNCA 1HGZA 1S2EA 1LP1A 4JF7A 2WT7B 2WWWA 1X0TA 2XZRA 1SQXK 2A45G 3O6QA 3L75E 2W83C 3JC22 3AEAC 1DD4A 4UB6H 2E76C 2WQYC 3K5BA 1M8OB 3CC7P 1YYCA 1FZCA 3L75D 5KKZC 1IFNA 3QH9A 3M91A 5KLVK 1SFCA 2R44A 4ASWA 3FXEA 3HUSB 2C9NY 5APUA 1KFMA 1JY3O 4GOFA 1T2KD 3BVHA 3CWBJ 1NKZB 4EYYQ 4Z1MH 1RHZB 1SQPK 2H43A 1G1IA 5E79E 1VQ9P 3EFGA 1RH5B 2IYOA 3L72J 2WSEH 2A06G 2N1TA 3A3YB 2FBWC 3D71A 1VQ6P 1PP9D 2YXQB 3U1CA 1BDDA 2E75D 1MUUA 3O8ZA 1Y8AA 1QLED 2E43A 1VQKP 5AVSB 1NOHA 3L70D 1ZMEC 1KB9H 1VL2A 1R5LA 2E76D 5KLVG 1KN7A 3RK2D 1L0ND 2KOGA 1E5WA 1YJWP 4U7JA 1KB9I 2O01N 4BXLA 2VRSA 1KQSO 4RESB 2CPSA 3H25A 3CMAP 1WRGA 3GW6A 4I6MC 1G2CB 3RL0C 4WY4A 1DH3A 1GW4A 2WPVB 1IK9A 3CCQP 2FYUD 2C0WA 1W2BO 3B4SA 3AE2C 3CCSP 1HBWA 3LIEA 2HODA 2FY8A 5H2FH 2L91A 1PGQA 4D6TG 4PJ0H 3RBZA 5TISH 2PRRA 1OZHA 3OJAB 2QA4P 3IR9A 1SQVJ 4DZOA 1XTGB 1BE3G 1KQLA 3A0HH 2MJZA 1SS1A 4NPDA 2QJKC 4IL6X 3CXHE 1MZ9A 1RF0A 3ZDMA 4KHXA 1OVRA 1X22A 1FZFA 3L74J 1EDJA 1H89A 2KNCB 1HJ0A 3CXHD 2NRGA 2P7JA 3KQGA 1YTZI 1CI6B 4DOJA 2IZ0A 1E79H 1AQ5A 1QVGO 2WSSH 4H0LB 2FKWB 3VMYA 5B5EE 1FZEA 3RL0D 1SQBK 2K1AA 4LLHA 2WPSA 1VQPP 5AW3B 1IC2A 1K04A 3P32A 1KILA 2N9YB 4PD4E 1J1EB 1EXJA 3HTKB 3M0DA 2P10A 1K73Q 2Q7CA 3GHGC 3CCMP 3W67A 1SQQK 3CCLP 4GODA 3NFQA 4R4LA 3TYYA 1NTMK 2NPSB 2K88A 3CI9A 1YJ9P 4IOIH 1RF1C 1HWTC 5C39A 1N73B 1YITP 3SWKA 1SQBG 4H44B 2HLOA 1LP1B 3H6PA 1PFIA 1FC2C 3O6QB 3CX5H 3H1JE 3EFFK 5APVA 2LXBA 1LWUA 3A0BE 5AW9B 3L71G 1NU1J 1PP9G 2G3AA 1RY3A 1FZCB 3H1JD 2JJLA 2FYUK 3L73J 1SFCB 2W6JH 3L70G 2HYNA 1DD3A 2Y9ZA 1WMKA 3A7OA 2FFDC 5AVVB 1L0NG 3PTZA 3CC2P 5GTHH 2QIWA 1S3JA 2N1TB 2KS1A 2M5AA 2BASA 2IBZD 2YNYA 1P84D 1EZVD 1VPCA 1M56D 2W6AA 2OYIA 1IJDB 2A06E 4PJ0E 4IL6E 2GA1A 3OW2O 1ZXGA 5AW6B 4KJMA 4NPFX 2YMYA 2FYUG 1YIJP 5L8RJ 3SFDC 2QE7H 1EDIA 1CW5A 1SQXD 2M8RA 4IFMA 3TGUG 5KLVE 1BCCD 2QJPB 1DIPA 1QVFO 1VF5B 3H1IG 1OWAA 5KLVD 1RQVA 2IFNA 1FOSF 1KMIZ 3AE7C 3L4FA 4YPCA 1NKNA 1Y47A 4WY4B 2HR3A 3NMDA 2O01J 1LNQA 1QL2A 3V2RA 2HFED 3AE3C 1SQPD 2ZXEB 2HODB 1URQA 1N7SA 2WITA 1IZNB 1RE4C 2YXRB 5AVWB 5CCGC 1JM0A 1HTLC 1QEXA 5DJUB 2O01H 2OYHC 5APSA 4D6TE 1NAFA 3H1KG 5CJ4A 3B5NA 1PL5A 1BE3E 4GT1A 3F5HA 2WTYA 5KJ7C 1S5LX 4ZMDA 4DJGA 5DJTB 1L4AB 1MFZA 2MKVA 3FX0A 1FBMA 2BCCD 3A5TA 1OX3A 3AE6C 3QWOC 1OW6A 3B71A 2Z5HA 2FXPA 2JR8A 2Z5IA 1KILB 5B66E 1QL1A 1S9KE 2NPSC 5BU5A 4BRYB 2IDBA 1BDCA 1VQ8P 4TT3H 3CXHH 1Q81Q 2I8DA 4L73A 3Q2YA 1FDOA 1GK6A 5AVTB 1YTZT 2P1JA 3CXHI 3D6ZA 5KAFE 3WU2E 4WVZA 3H32A 3MIWA 1JY3P 3AECC 4PV1B 4W80A 4H13B 5KJ7D 1OFCX 2YKOA 2P2UA 2YMKA 3CWBG 1ZN5A 1FOSE 2WPRA 1J1DC 1KYOE 1GL2D 3FWLA 2YO2A 4UB8E 3IN6A 2QM7A 3SWFA 4DT0A 2JWDA 3L72G 1KFNA 2PGDA 4PD4H 2GUSA 3T97A 2J5UA 3RK3B 1KYOD 2WSEJ 3H1HJ 5CCHC 2RMZA 2ZYGA 1SQBE 2W6BA 1LWUB 2IBZG 1JY3N 3V2NA 2NPSD 4PD4I 1EZVG 1DEBA 1NYHA 1M7LA 1SQBD 3B8EB 2Q1KA 1EQ7A 3MZWB 3L71E 1PP9E 1H0TA 1L0LJ 1OXZA 2B87A 1SQVK 1X9VA 3VTPC 3L71D 3L70E 1SQXG 1LTJC 2KS1B 1L0NE 1BCCG 2Q3EA 1SQQD 2M5AB 2M0BA 1NTZJ 1ZRTD 1ZLLA 1NTMD 2R5DA 2OYIB 2M3EA 3G6EP 2OTJP 2A45H 4RJTA 4LC1A 5AVQB 5CCHD 1BGYJ 1CSBA 3PH0A 1PGJA 1SQPG 2A45I 4OGQB 4WBAA 1AQTA 1NTKJ 2V7QJ 3M06A 3V5BA 3HRNA 1KD1Q 3L36A 2FYUE 2BEQD 2ITAA 1SQVG 5KAIE 3PRJA 1LT9C 2OYOA 5KLIC 3BRTB 2JKVA 4I7ZB 3AEBC 3II6A 3TGUE 1PGOA 2KI7B 2QSIA 2V7QH 3CMEP 4W7ZA 5CBOA 4U3FJ 2E74B 3MGNA 1NWQA 1EXIA 5BU8B 3H1IE 3TGUD 1YI2P 4EOTA 4JBZA 2LR2A 1Q90D 1URQB 1N7SB 1FZAA 1YQ3C 3SSUA 1N2DC 2LKMA 1KORA 2XKMA 1IFJA 2C0XA 3H1ID 2KSJA 2BCCG 3HD7C 1AA0A 1FDIA 2KLUA 2YKPA 3PLNA 2ZVNB 2FYNC 1NAYA 3PP5A 3G3ZA 1L4AC 2XDJA 3AE5C 1NU1K 1H8AA 4Y28J 2AXTE 2KUBA 3B5NB 2JDIH 3Q5RA 1QX8A 4K3AA 4I2LC 1HH0A 3H1KE 3OA7A 2YIUC 4D6TJ 1FE6A 2WSFJ 3F89A 1PPJD 4HH2A 3H1LJ 3GLMA 2ZAEB 1LT1A 3BCCD 3MUDC 1ZP0C 1BE3J 3H1KD 3OAKA 2WZ7A 3AEEC 5BVZA 1G1JA 1M1JC 1OVUA 1N86A 2LXCB 2NZ2A 2WSFH 4HB1A 5APXA 3HD7D 4WB4A 4PV1C 5AW1B 3CC4P 2QEXP 1GD2E 1AVOA 4HJGH 4QMAA 2E42A 1NU1G 2RH0A 3MTUE 2ZFCA 3TDKA 4WWIA 4Y99B 1L4AD 3H32B 1U7JA 3L73G 1IFDA 1K9MQ 1KTMA 2XV5A 1IK7A 3GHGA 4JYCA 1U57A 1JNMA 1NO4A 1KC8Q 1LWUC 4AUWA 1DEEG 2IFMA 3Q1MA 3HUSC 5AVZB 1T6AA 4GDOA 3SWYA 5B66H 4ZKPA 1RF1A 1JY2O 3C9IA 1JEKA 3RGUA 1IFIA 3CWBE 3ITKA 2QVAA 4CPGA 1GU5A 2Q5UA 3Q5PA 2E75B 1SQQG 1HJBA 3L75J 5APYA 1NTMG 2GUVA 3L72E 3CWBD 3KHUA 1LTIC 2D2CB 2P58A 5KAFH 4PV1D 1HF9A 2E76B 2IPPA 3AE4C 2IBZE 1A02F 3RK2B 1H0TB 1WT6A 1P84E 3L72D 1EZVE 1KB9D 3P8MC 1K05A 5KKZB 2B87B 1LTBC 3VP8A 1NGMB 2WVRA 1KZUB 3CCUP 2FFDA 3M9HA 4C46A 1T8ZA 2CK3H 1PP9J 2ZXXA 4EIJA 1FJKA 1KYOI 4AQRD 4HKZH 3D70A 1RE3C 1IFMA 2QJYB 1MV8A 1SQXE 4JYBA 1GW3A 3L70J 1CZQA 1BCCE 1MFTA 1YJNP 3D6YA 4L75A 1L0NJ 5H2FE 1VQMP 1M57D 3KXDA 5E79H 5TISE 3U1AA
chains in the Genus database with same CATH topology
4PJ0H 5TISH 5B5EH 3JCUH 3KZIH 1S5LH 5B66H 3A0BH 3A0HH 4UB6H 5KAFH 3WU2H 2AXTH 4UB8H 5GTHH 4IL6H 5H2FH 5GTIH 5E79H 5KAIH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJ0 H;  5TIS H;  5B5E H;  3JCU H;  3KZI H;  1S5L H;  5B66 H;  3A0B H;  3A0H H;  4UB6 H;  5KAF H;  3WU2 H;  2AXT H;  4UB8 H;  5GTH H;  4IL6 H;  5H2F H;  5GTI H;  5E79 H;  5KAI H; 
#chains in the Genus database with same CATH topology
 1LGH B;  3MP7 B;  2FXM A;  4EI2 A;  1SVF A;  3A0H E;  1VQ4 P;  4YXD C;  3V4Q A;  2PP6 A;  4ASV A;  4N78 E;  1SQP E;  1JUN A;  2KYV A;  3KZI E;  1M90 Q;  1N7S C;  3KYQ A;  4N78 D;  4XE5 B;  1R5S A;  3MHV A;  1SQV E;  2JO1 A;  5KTB A;  2O3J A;  2AEM A;  1ZOY C;  2I1K A;  3E7K A;  5AVX B;  4B86 A;  2H8P D;  2V4H A;  1SQV D;  2SPZ A;  3JCU E;  2IZ1 A;  2AXC A;  4K35 A;  5CJ0 A;  1R8E A;  2JP3 A;  1PPJ G;  2R5B A;  3BCC G;  1Y9B A;  1X79 B;  2Y0D A;  2R32 A;  1DX7 A;  4H0L C;  5M1B A;  4IFD K;  2G8Y A;  3L74 D;  3AEF C;  5KAI H;  2AEF A;  5APQ A;  1NHL A;  1RE4 A;  2Z4E A;  1EC5 A;  2BCC E;  2PFX A;  2W90 A;  1SP4 A;  3WMM 0;  2KIK A;  1JOC A;  3VMA A;  3UIA A;  2OYH A;  1J1E C;  3GF3 A;  2QJK B;  2PAJ A;  1AJY A;  2H7H A;  3V6I A;  1L0L K;  2J59 M;  5AW5 B;  2ZJS E;  1H88 A;  2KZI A;  1S1C X;  2KSE A;  3HE5 A;  2WPQ A;  5K5G B;  3TNU A;  1GL2 A;  5CCG D;  4NPE A;  1PV3 A;  2KZJ A;  5AW2 B;  4LGD E;  3CX5 E;  2XND H;  2O1J A;  1VQO P;  2CPB A;  4XA4 A;  4JPZ B;  1ZR2 A;  1NTZ K;  1N73 C;  3R4Y A;  1L2P A;  1AVY A;  4H44 C;  3IAO A;  5AVY B;  4HYT B;  3CX5 D;  3H1H G;  2AXT H;  4H0L D;  1VQN P;  3P8C E;  2NPS A;  1UII A;  3V2Q A;  5B5E H;  1JCD A;  4ZKU A;  2HPC A;  3JSV C;  1JTH A;  4OH8 B;  2ZVO B;  3GHG B;  1FZC C;  3P8C D;  1NTK K;  1NU1 E;  1L0L G;  3S9O A;  1SFC C;  1YHQ P;  3GMA A;  3AE9 C;  1D7M A;  3LID A;  5EFW B;  5GTI E;  1BSH A;  3L73 E;  2JWA A;  3KDP B;  1N8R Q;  2K3R A;  3PHL A;  1NU1 D;  1X8Y A;  2D2C C;  1RF1 B;  4IFF A;  3L37 A;  1LTG C;  3L73 D;  3RK2 C;  4C7N A;  2IX7 C;  1FZB A;  1NTZ G;  2N1T C;  3C8V A;  3H1J J;  3CD6 P;  3TF5 A;  1USD A;  5AW7 B;  5AVU B;  3CCV P;  3IFM A;  5CCH A;  4H44 D;  1SQQ E;  1T3J A;  1BGY G;  1U7M A;  1FDM A;  1ZRT E;  3CLQ A;  1NTM E;  3C1L A;  3WUU A;  1VQ5 P;  2QJY C;  1NTK G;  1OMI A;  3RBX A;  3CCR P;  1LTA C;  5AW0 B;  1YBK A;  1W2E A;  4XFJ A;  3A0B H;  4L74 A;  1PZQ A;  2FFD B;  1GDT A;  3CPW O;  2WSC J;  1SFC D;  2KB7 P;  2ZT9 B;  2Q3I A;  2E5T A;  2QJP C;  2D2C D;  1LTJ A;  2W8Z A;  1S5L E;  1Q2N A;  1Q86 Q;  4R4M A;  4U3F G;  1VF5 C;  2WSC H;  3VMZ A;  2N1T D;  1RQU A;  1P84 H;  4W7Y A;  2K9Y A;  4WY4 C;  1SQX J;  3FWN A;  3A2A A;  3U59 A;  1BCC J;  2IBZ I;  1GU4 A;  1P84 I;  1EZV I;  2XU6 A;  3HE4 A;  4RO0 A;  3L74 G;  4IL6 H;  5KLV J;  1OIP A;  3SFE C;  1VDF A;  2B9B A;  1OW8 A;  1UIX A;  2KK7 A;  4TLF A;  1LT9 A;  3M9Q A;  1SQP J;  1RF0 C;  3L35 A;  2K9J A;  3AE1 C;  1FZG A;  5AW8 B;  2KLV A;  2OTL P;  2OTK E;  3M0A A;  1Z56 A;  3H1L G;  3CCJ P;  4MN4 C;  1VF5 D;  3EWK A;  2R3S A;  4JQ0 D;  2Q6Q A;  4L76 A;  1JMM A;  4WY4 D;  1PPJ E;  2KXP B;  2UWJ E;  5CBN A;  3BCC E;  3HD7 A;  3KZI H;  1GMJ A;  1KIL C;  2JEE A;  3VMX A;  2OYH B;  1YQ4 C;  1W5C E;  5APW A;  3M0D C;  3NTN A;  1FJP A;  1L4A A;  5AVR B;  1A02 J;  3VP9 A;  1JO5 A;  2QM8 A;  2BCC J;  1HGV A;  1NVO A;  3JCU H;  2OQQ A;  5AW4 B;  2B89 A;  1MKM A;  3HE5 B;  4UB6 E;  1Q7Y Q;  3TNU B;  1GL2 B;  1VQ7 P;  4BRY A;  3LW5 J;  2DW3 A;  4H13 C;  3W68 A;  1JY2 P;  3AEG C;  3MUD A;  4EDF A;  4N6J A;  3I55 P;  2O1K A;  2BEZ F;  3IF4 A;  3FGA D;  4PD4 D;  3MD0 A;  1PGP A;  2YO3 A;  1KIL E;  2FXO A;  1M1J A;  2I1J A;  3WUT A;  2Y0C A;  3L75 G;  4N3Y B;  1OVV A;  3RK3 C;  4BWN A;  1L0N K;  2H88 C;  3LW5 H;  2HG5 D;  2HPC B;  1JTH B;  1KIL D;  3H1H E;  2WT7 A;  4C7R A;  1QGK B;  1JY2 N;  1LJ2 A;  3S1K A;  2QG4 A;  3T97 B;  3H1H D;  1AV1 A;  2OGU A;  1ZV8 A;  4O9B A;  1KQG B;  1L0L E;  2IYP A;  1M1K Q;  1KB9 E;  1JB0 J;  4C7N B;  1J1D B;  2J58 A;  3HUS A;  3CX5 I;  3WU2 H;  1S4X A;  4H13 D;  2W27 A;  3I56 P;  2Q9I A;  3G9R A;  1L0L D;  1HUC A;  1SQB J;  1ZW0 A;  3RK3 E;  4M3L A;  1LTS C;  1NTZ E;  2OYI C;  1KYO H;  3TK1 A;  1GZL A;  2ZT9 C;  4UB8 H;  5TJH A;  3RK3 D;  1NH4 A;  3L71 J;  1GK4 A;  5GTI H;  2Y9Y A;  1NTZ D;  1BGY E;  3N4X A;  3VOP A;  4OGQ C;  3USS A;  1SQQ J;  1KQF B;  2OAR A;  1N7L A;  2N9B A;  1NTM J;  2H89 C;  2R3C A;  1NTK E;  4OVN F;  1BGY D;  2K37 A;  3FXD A;  1FAV A;  4AYC A;  4YXW H;  2XNX A;  1IFP A;  2RN0 A;  1LTJ B;  3E1R A;  4YTP C;  1NTK D;  2AEJ A;  2A06 D;  4I7Z C;  1PIX A;  3NXS A;  5CMZ A;  1RE3 A;  1BSN A;  3G4S P;  2E74 C;  1EDL A;  1AFO A;  3E1I A;  4RKU J;  4U3F E;  2YKQ A;  3KPE A;  2C9L Y;  3Q5S A;  2QRX A;  1URQ C;  3RL0 g;  3P7K A;  1HVV A;  1G2C A;  2ZT9 D;  3ABV C;  3HE4 B;  4U3F D;  1T3U A;  2FYU J;  2ZYD A;  3BAT A;  4OGQ D;  1KV4 A;  3M9B A;  2M3B A;  2Y0E A;  3Q3D A;  3WUV A;  1S5L H;  1LT9 B;  3L74 E;  3RL0 B;  3TGU J;  2GM4 A;  5KLI B;  4KT0 J;  3B5N C;  2K9J B;  3CCE P;  4GIF A;  2P67 A;  1ZR4 A;  2B88 A;  1S72 P;  3H1I J;  3I5C A;  1JMB A;  2POH A;  5CCG A;  3TSI A;  1VQL P;  2ZYA A;  3AED C;  2E5Y A;  2KNC A;  2E74 D;  3H1L E;  1J2J B;  5APT A;  1CI6 A;  3HD7 B;  3N7N A;  2KP8 A;  3G71 P;  1OW7 A;  2WMM A;  1URQ D;  4D6T D;  1N7S D;  4GKG A;  3H1L D;  3V4W A;  1JCC A;  3AE8 C;  2FYN B;  1GL2 C;  5KJ7 A;  1BE3 D;  3PJS K;  1FS0 E;  3GF7 A;  4A7P A;  3EQ2 A;  1XTC C;  3BCC J;  3V2P A;  1LTT C;  3GG2 A;  1EDK A;  2L5G B;  3H1K J;  3BAS A;  1K8A Q;  4Y99 C;  3BRV B;  3HTK A;  1SLQ A;  2YIU B;  4GOE A;  3B5N D;  1TU3 F;  1GTW A;  1T2K C;  1NJI Q;  5CHX A;  1USE A;  1Q82 Q;  4DCK A;  3R2P A;  3S4R A;  1S9K D;  4I1L A;  2RKL A;  1M1J B;  1FU1 A;  1IO4 A;  3H1J G;  3CL3 D;  3VYI A;  1N73 A;  5GTH E;  4OWF A;  3VN0 A;  2E75 C;  2FYZ A;  4ZNC A;  1HGZ A;  1S2E A;  1LP1 A;  4JF7 A;  2WT7 B;  2WWW A;  1X0T A;  2XZR A;  1SQX K;  2A45 G;  3O6Q A;  3L75 E;  2W83 C;  3JC2 2;  3AEA C;  1DD4 A;  4UB6 H;  2E76 C;  2WQY C;  3K5B A;  1M8O B;  3CC7 P;  1YYC A;  1FZC A;  3L75 D;  5KKZ C;  1IFN A;  3QH9 A;  3M91 A;  5KLV K;  1SFC A;  2R44 A;  4ASW A;  3FXE A;  3HUS B;  2C9N Y;  5APU A;  1KFM A;  1JY3 O;  4GOF A;  1T2K D;  3BVH A;  3CWB J;  1NKZ B;  4EYY Q;  4Z1M H;  1RHZ B;  1SQP K;  2H43 A;  1G1I A;  5E79 E;  1VQ9 P;  3EFG A;  1RH5 B;  2IYO A;  3L72 J;  2WSE H;  2A06 G;  2N1T A;  3A3Y B;  2FBW C;  3D71 A;  1VQ6 P;  1PP9 D;  2YXQ B;  3U1C A;  1BDD A;  2E75 D;  1MUU A;  3O8Z A;  1Y8A A;  1QLE D;  2E43 A;  1VQK P;  5AVS B;  1NOH A;  3L70 D;  1ZME C;  1KB9 H;  1VL2 A;  1R5L A;  2E76 D;  5KLV G;  1KN7 A;  3RK2 D;  1L0N D;  2KOG A;  1E5W A;  1YJW P;  4U7J A;  1KB9 I;  2O01 N;  4BXL A;  2VRS A;  1KQS O;  4RES B;  2CPS A;  3H25 A;  3CMA P;  1WRG A;  3GW6 A;  4I6M C;  1G2C B;  3RL0 C;  4WY4 A;  1DH3 A;  1GW4 A;  2WPV B;  1IK9 A;  3CCQ P;  2FYU D;  2C0W A;  1W2B O;  3B4S A;  3AE2 C;  3CCS P;  1HBW A;  3LIE A;  2HOD A;  2FY8 A;  5H2F H;  2L91 A;  1PGQ A;  4D6T G;  4PJ0 H;  3RBZ A;  5TIS H;  2PRR A;  1OZH A;  3OJA B;  2QA4 P;  3IR9 A;  1SQV J;  4DZO A;  1XTG B;  1BE3 G;  1KQL A;  3A0H H;  2MJZ A;  1SS1 A;  4NPD A;  2QJK C;  4IL6 X;  3CXH E;  1MZ9 A;  1RF0 A;  3ZDM A;  4KHX A;  1OVR A;  1X22 A;  1FZF A;  3L74 J;  1EDJ A;  1H89 A;  2KNC B;  1HJ0 A;  3CXH D;  2NRG A;  2P7J A;  3KQG A;  1YTZ I;  1CI6 B;  4DOJ A;  2IZ0 A;  1E79 H;  1AQ5 A;  1QVG O;  2WSS H;  4H0L B;  2FKW B;  3VMY A;  5B5E E;  1FZE A;  3RL0 D;  1SQB K;  2K1A A;  4LLH A;  2WPS A;  1VQP P;  5AW3 B;  1IC2 A;  1K04 A;  3P32 A;  1KIL A;  2N9Y B;  4PD4 E;  1J1E B;  1EXJ A;  3HTK B;  3M0D A;  2P10 A;  1K73 Q;  2Q7C A;  3GHG C;  3CCM P;  3W67 A;  1SQQ K;  3CCL P;  4GOD A;  3NFQ A;  4R4L A;  3TYY A;  1NTM K;  2NPS B;  2K88 A;  3CI9 A;  1YJ9 P;  4IOI H;  1RF1 C;  1HWT C;  5C39 A;  1N73 B;  1YIT P;  3SWK A;  1SQB G;  4H44 B;  2HLO A;  1LP1 B;  3H6P A;  1PFI A;  1FC2 C;  3O6Q B;  3CX5 H;  3H1J E;  3EFF K;  5APV A;  2LXB A;  1LWU A;  3A0B E;  5AW9 B;  3L71 G;  1NU1 J;  1PP9 G;  2G3A A;  1RY3 A;  1FZC B;  3H1J D;  2JJL A;  2FYU K;  3L73 J;  1SFC B;  2W6J H;  3L70 G;  2HYN A;  1DD3 A;  2Y9Z A;  1WMK A;  3A7O A;  2FFD C;  5AVV B;  1L0N G;  3PTZ A;  3CC2 P;  5GTH H;  2QIW A;  1S3J A;  2N1T B;  2KS1 A;  2M5A A;  2BAS A;  2IBZ D;  2YNY A;  1P84 D;  1EZV D;  1VPC A;  1M56 D;  2W6A A;  2OYI A;  1IJD B;  2A06 E;  4PJ0 E;  4IL6 E;  2GA1 A;  3OW2 O;  1ZXG A;  5AW6 B;  4KJM A;  4NPF X;  2YMY A;  2FYU G;  1YIJ P;  5L8R J;  3SFD C;  2QE7 H;  1EDI A;  1CW5 A;  1SQX D;  2M8R A;  4IFM A;  3TGU G;  5KLV E;  1BCC D;  2QJP B;  1DIP A;  1QVF O;  1VF5 B;  3H1I G;  1OWA A;  5KLV D;  1RQV A;  2IFN A;  1FOS F;  1KMI Z;  3AE7 C;  3L4F A;  4YPC A;  1NKN A;  1Y47 A;  4WY4 B;  2HR3 A;  3NMD A;  2O01 J;  1LNQ A;  1QL2 A;  3V2R A;  2HFE D;  3AE3 C;  1SQP D;  2ZXE B;  2HOD B;  1URQ A;  1N7S A;  2WIT A;  1IZN B;  1RE4 C;  2YXR B;  5AVW B;  5CCG C;  1JM0 A;  1HTL C;  1QEX A;  5DJU B;  2O01 H;  2OYH C;  5APS A;  4D6T E;  1NAF A;  3H1K G;  5CJ4 A;  3B5N A;  1PL5 A;  1BE3 E;  4GT1 A;  3F5H A;  2WTY A;  5KJ7 C;  1S5L X;  4ZMD A;  4DJG A;  5DJT B;  1L4A B;  1MFZ A;  2MKV A;  3FX0 A;  1FBM A;  2BCC D;  3A5T A;  1OX3 A;  3AE6 C;  3QWO C;  1OW6 A;  3B71 A;  2Z5H A;  2FXP A;  2JR8 A;  2Z5I A;  1KIL B;  5B66 E;  1QL1 A;  1S9K E;  2NPS C;  5BU5 A;  4BRY B;  2IDB A;  1BDC A;  1VQ8 P;  4TT3 H;  3CXH H;  1Q81 Q;  2I8D A;  4L73 A;  3Q2Y A;  1FDO A;  1GK6 A;  5AVT B;  1YTZ T;  2P1J A;  3CXH I;  3D6Z A;  5KAF E;  3WU2 E;  4WVZ A;  3H32 A;  3MIW A;  1JY3 P;  3AEC C;  4PV1 B;  4W80 A;  4H13 B;  5KJ7 D;  1OFC X;  2YKO A;  2P2U A;  2YMK A;  3CWB G;  1ZN5 A;  1FOS E;  2WPR A;  1J1D C;  1KYO E;  1GL2 D;  3FWL A;  2YO2 A;  4UB8 E;  3IN6 A;  2QM7 A;  3SWF A;  4DT0 A;  2JWD A;  3L72 G;  1KFN A;  2PGD A;  4PD4 H;  2GUS A;  3T97 A;  2J5U A;  3RK3 B;  1KYO D;  2WSE J;  3H1H J;  5CCH C;  2RMZ A;  2ZYG A;  1SQB E;  2W6B A;  1LWU B;  2IBZ G;  1JY3 N;  3V2N A;  2NPS D;  4PD4 I;  1EZV G;  1DEB A;  1NYH A;  1M7L A;  1SQB D;  3B8E B;  2Q1K A;  1EQ7 A;  3MZW B;  3L71 E;  1PP9 E;  1H0T A;  1L0L J;  1OXZ A;  2B87 A;  1SQV K;  1X9V A;  3VTP C;  3L71 D;  3L70 E;  1SQX G;  1LTJ C;  2KS1 B;  1L0N E;  1BCC G;  2Q3E A;  1SQQ D;  2M5A B;  2M0B A;  1NTZ J;  1ZRT D;  1ZLL A;  1NTM D;  2R5D A;  2OYI B;  2M3E A;  3G6E P;  2OTJ P;  2A45 H;  4RJT A;  4LC1 A;  5AVQ B;  5CCH D;  1BGY J;  1CSB A;  3PH0 A;  1PGJ A;  1SQP G;  2A45 I;  4OGQ B;  4WBA A;  1AQT A;  1NTK J;  2V7Q J;  3M06 A;  3V5B A;  3HRN A;  1KD1 Q;  3L36 A;  2FYU E;  2BEQ D;  2ITA A;  1SQV G;  5KAI E;  3PRJ A;  1LT9 C;  2OYO A;  5KLI C;  3BRT B;  2JKV A;  4I7Z B;  3AEB C;  3II6 A;  3TGU E;  1PGO A;  2KI7 B;  2QSI A;  2V7Q H;  3CME P;  4W7Z A;  5CBO A;  4U3F J;  2E74 B;  3MGN A;  1NWQ A;  1EXI A;  5BU8 B;  3H1I E;  3TGU D;  1YI2 P;  4EOT A;  4JBZ A;  2LR2 A;  1Q90 D;  1URQ B;  1N7S B;  1FZA A;  1YQ3 C;  3SSU A;  1N2D C;  2LKM A;  1KOR A;  2XKM A;  1IFJ A;  2C0X A;  3H1I D;  2KSJ A;  2BCC G;  3HD7 C;  1AA0 A;  1FDI A;  2KLU A;  2YKP A;  3PLN A;  2ZVN B;  2FYN C;  1NAY A;  3PP5 A;  3G3Z A;  1L4A C;  2XDJ A;  3AE5 C;  1NU1 K;  1H8A A;  4Y28 J;  2AXT E;  2KUB A;  3B5N B;  2JDI H;  3Q5R A;  1QX8 A;  4K3A A;  4I2L C;  1HH0 A;  3H1K E;  3OA7 A;  2YIU C;  4D6T J;  1FE6 A;  2WSF J;  3F89 A;  1PPJ D;  4HH2 A;  3H1L J;  3GLM A;  2ZAE B;  1LT1 A;  3BCC D;  3MUD C;  1ZP0 C;  1BE3 J;  3H1K D;  3OAK A;  2WZ7 A;  3AEE C;  5BVZ A;  1G1J A;  1M1J C;  1OVU A;  1N86 A;  2LXC B;  2NZ2 A;  2WSF H;  4HB1 A;  5APX A;  3HD7 D;  4WB4 A;  4PV1 C;  5AW1 B;  3CC4 P;  2QEX P;  1GD2 E;  1AVO A;  4HJG H;  4QMA A;  2E42 A;  1NU1 G;  2RH0 A;  3MTU E;  2ZFC A;  3TDK A;  4WWI A;  4Y99 B;  1L4A D;  3H32 B;  1U7J A;  3L73 G;  1IFD A;  1K9M Q;  1KTM A;  2XV5 A;  1IK7 A;  3GHG A;  4JYC A;  1U57 A;  1JNM A;  1NO4 A;  1KC8 Q;  1LWU C;  4AUW A;  1DEE G;  2IFM A;  3Q1M A;  3HUS C;  5AVZ B;  1T6A A;  4GDO A;  3SWY A;  5B66 H;  4ZKP A;  1RF1 A;  1JY2 O;  3C9I A;  1JEK A;  3RGU A;  1IFI A;  3CWB E;  3ITK A;  2QVA A;  4CPG A;  1GU5 A;  2Q5U A;  3Q5P A;  2E75 B;  1SQQ G;  1HJB A;  3L75 J;  5APY A;  1NTM G;  2GUV A;  3L72 E;  3CWB D;  3KHU A;  1LTI C;  2D2C B;  2P58 A;  5KAF H;  4PV1 D;  1HF9 A;  2E76 B;  2IPP A;  3AE4 C;  2IBZ E;  1A02 F;  3RK2 B;  1H0T B;  1WT6 A;  1P84 E;  3L72 D;  1EZV E;  1KB9 D;  3P8M C;  1K05 A;  5KKZ B;  2B87 B;  1LTB C;  3VP8 A;  1NGM B;  2WVR A;  1KZU B;  3CCU P;  2FFD A;  3M9H A;  4C46 A;  1T8Z A;  2CK3 H;  1PP9 J;  2ZXX A;  4EIJ A;  1FJK A;  1KYO I;  4AQR D;  4HKZ H;  3D70 A;  1RE3 C;  1IFM A;  2QJY B;  1MV8 A;  1SQX E;  4JYB A;  1GW3 A;  3L70 J;  1CZQ A;  1BCC E;  1MFT A;  1YJN P;  3D6Y A;  4L75 A;  1L0N J;  5H2F E;  1VQM P;  1M57 D;  3KXD A;  5E79 H;  5TIS E;  3U1A A; 
#chains in the Genus database with same CATH homology
 4PJ0 H;  5TIS H;  5B5E H;  3JCU H;  3KZI H;  1S5L H;  5B66 H;  3A0B H;  3A0H H;  4UB6 H;  5KAF H;  3WU2 H;  2AXT H;  4UB8 H;  5GTH H;  4IL6 H;  5H2F H;  5GTI H;  5E79 H;  5KAI H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...