2FXOA

Structure of the human beta-myosin s2 fragment
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
129
structure length
129
Chain Sequence
GSSPLLKSAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMNKRLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myosin heavy chain, cardiac muscle beta isoform
publication title Crystal structures of human cardiac {beta}-myosin II S2-{Delta} provide insight into the functional role of the S2 subfragment
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 59
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1050 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Coiled-coil dimerization domain from cortexillin I 2fxoA00
1D7MA 2FXOA
chains in the Genus database with same CATH superfamily
1IFNA 1L4AB 5APUA 1VPCA 5BVZA 2VRSA 1OVUA 3AEDC 1URQC 2Y9ZA 5KJ7D 1KB9D 1RH5B 4U3FE 1QGKB 3BRVB 3H1HD 3TNUA 2IDBA 4L75A 1HJBA 2RN0A 3EQ2A 2W6AA 1BCCE 2B87B 2W27A 1L4AD 2RMZA 3CXHD 5TISH 2E76C 1LTJB 3AEBC 3CMAP 3GHGA 2GA1A 1GL2B 2O3JA 1FE6A 2C0XA 3VN0A 2A06D 2QJYC 1SQXK 3QWOC 3VOPA 1SQPK 1T2KD 5AVZB 1SQQE 1WMKA 3CLQA 3TK1A 4YXWH 1SQXG 2J59M 2WZ7A 1NU1K 3E1RA 1BE3J 1SQPG 4WB4A 1YTZT 3WMM0 2QSIA 2XNDH 1KB9E 1GL2D 2J5UA 4AYCA 1MKMA 1VQ7P 3H1HE 1NU1G 2OYIC 3F5HA 2H7HA 1Q7YQ 2ZFCA 4UB8H 3FWLA 1K9MQ 2BCCD 3CXHE 3JCUH 1LTJA 3H1JG 2OYHC 3BRTB 5DJUB 2HODA 2V7QH 2PAJA 2AEFA 4HYTB 4IL6H 2A06E 2E43A 1VQNP 1LP1B 5KTBA 4U3FJ 2R5DA 2MJZA 3ITKA 3A3YB 3BCCD 3V2QA 2J58A 1HWTC 4GOFA 2M8RA 2R3CA 1SFCB 3L36A 3U1AA 1KFMA 2CPBA 3CI9A 2BCCE 3G6EP 2ZYAA 3HTKB 1YITP 1H0TB 1SQQJ 3AE9C 5KAFH 4DT0A 1S9KD 2K37A 3A0BE 1SQBJ 1SFCD 2KZIA 1GK4A 4U7JA 3L71D 2W6BA 1NKZB 3H1HJ 5APVA 2QEXP 3BCCE 4LGDE 1N8RQ 1KV4A 1ZOYC 2JWAA 1KMIZ 1EZVD 3L75G 5AVRB 4BWNA 2YO3A 1K04A 3I56P 2M3EA 1SQPJ 1ZW0A 1LT9C 3ABVC 3V2PA 1OFCX 2IZ0A 1NVOA 1RE3C 1KQGB 3HTKA 1H0TA 2AEJA 3MD0A 4DJGA 1SVFA 3LIDA 1R5LA 1AV1A 1S9KE 1JTHA 2PP6A 2JR8A 3AE7C 2JEEA 5AW0B 2M5AA 2WSEJ 3L71E 5B66H 4H0LB 2OGUA 1J1DC 3M9QA 3JSVC 1NTKK 2O01H 4HH2A 1EZVE 1PGOA 2IYPA 3NTNA 1FZCA 5B5EH 3S4RA 2BCCJ 5CJ4A 1NTKG 3D6ZA 2Z5IA 5CJ0A 1CSBA 1JUNA 3C9IA 3PRJA 1GTWA 2XZRA 1HF9A 4MN4C 2YIUC 3B8EB 4H0LD 4EDFA 1GK6A 4GODA 2ZXEB 1T6AA 5AVXB 2E75B 3HD7C 5CCGC 3TSIA 4JBZA 3H1LG 2MKVA 3BCCJ 2FFDB 1YJNP 2YKOA 1DEBA 1T3JA 2Z5HA 3L74D 2OYIA 2V4HA 3FXDA 2LR2A 2P10A 5AVSB 5KKZB 1MFTA 4WBAA 2E75D 3RK3B 2CK3H 1KD1Q 4HB1A 3VP8A 3ZDMA 1N86A 2FBWC 2QJPC 1H89A 1L0LK 3RK2B 3VMYA 4OGQC 2QA4P 4IOIH 4HKZH 3T97A 4W7YA 1NJIQ 3B5NC 5CCHD 1L0NK 2YKPA 3EFFK 3A0HE 3MUDC 3PHLA 1L0LG 3RK3D 1LWUA 3L71J 3L70D 1PV3A 1Y47A 2FFDA 4LLHA 1L0NG 4GKGA 4ZKPA 3HUSB 3SFEC 3L74E 1PPJD 4RKUJ 1U57A 3L37A 1QVGO 2E74B 4RJTA 2D2CD 2Q5UA 1JO5A 2IBZD 1JEKA 1YIJP 1RHZB 3CCQP 4D6TD 4R4MA 3Q5RA 2KLVA 1M56D 2I1JA 5KJ7C 4XFJA 3CX5D 1N7SB 1P84H 2R3SA 4ASVA 3C1LA 1YTZI 1LTBC 1P84I 2E74D 1Q90D 1FDIA 1L4AC 3M9BA 1ZMEC 1OW7A 3RK3E 1NTZK 3A7OA 3L70E 5APTA 1N7LA 1NTMJ 4UB6E 2ZXXA 1QVFO 1LTIC 2QVAA 2H88C 2JO1A 1NH4A 1M1JB 4NPDA 1NTZG 4NPEA 1PPJE 1N73B 3IF4A 1T2KC 4I6MC 3G4SP 2JJLA 1FU1A 1H8AA 2IBZE 1HGVA 4D6TE 1JY2O 3H1IG 1BGYD 3HE4B 1N7SA 2WWWA 1GL2C 2K9JB 3CX5E 1K8AQ 3IAOA 1QLED 3GF3A 4AUWA 1KILA 2IFMA 4WY4A 1DD4A 1FAVA 3CCVP 2Y0EA 2UWJE 3AE8C 3L74J 2HLOA 1GDTA 3CC2P 1M1JA 1LJ2A 2WVRA 3CWBG 2O1JA 1GW3A 1QEXA 1XTGB 4K35A 4K3AA 1Q2NA 2Q1KA 2AXTH 4C7NB 1NHLA 3KZIE 3PP5A 3TNUB 3M91A 2YKQA 1KYOD 3P32A 1J2JB 4WVZA 3HE4A 1DH3A 1AJYA 1BGYE 4DZOA 1IFDA 2NPSB 1FZAA 3V2RA 1EDLA 3RL0D 1RF1A 1Q82Q 2ZT9B 2LXCB 3L70J 1MV8A 5AVVB 4N3YB 4PV1B 4PJ0E 3M9HA 1S5LH 1QL1A 3AE3C 4H44B 1RF0C 1R8EA 1BDCA 1USDA 4PD4D 4OVNF 1IK7A 4L74A 3FX0A 1UIXA 2Q3IA 4JYBA 3M0DC 4D6TJ 1SFCC 2ZT9D 1SQBD 1GZLA 1ZN5A 4EIJA 1MFZA 2FXOA 4PV1D 4C7NA 3TGUE 2XDJA 3WU2E 1KYOE 3CCRP 3MUDA 2WMMA 2NPSA 1LT1A 3CCEP 4ZMDA 1PGPA 1SQXD 3GLMA 1SQPD 1YQ3C 1IFMA 3MZWB 2HODB 2WSFH 3V4QA 1ZR2A 1NU1D 1G1IA 2W83C 3HE5A 1YQ4C 4EI2A 1LNQA 4PD4E 4XE5B 4Y99B 3SFDC 3H1KG 1JMMA 2YNYA 4M3LA 2FYNB 1JM0A 2E5TA 3OAKA 1AVOA 2SPZA 2R5BA 3H1JD 1SQBE 1BGYJ 5L8RJ 5E79H 2N1TA 3Q5SA 2LKMA 1IFIA 2Q3EA 3MTUE 1EDIA 2PGDA 3NFQA 4KJMA 4KHXA 3L73G 4OWFA 2AEMA 3KPEA 1GD2E 1SQXE 3CCJP 1SQPE 2CPSA 3H32A 1VQ8P 5AVYB 3NMDA 1JY3N 2K1AA 1NU1E 2M0BA 3VMAA 2KSEA 3H6PA 3VYIA 5TISE 3TGUJ 2WSCH 3H1JE 1USEA 4CPGA 2WQYC 1DEEG 3TYYA 1IC2A 2WSSH 2E75C 1VF5B 1HVVA 1T3UA 1A02J 3L35A 1RE4C 1W2BO 4BRYA 3I55P 5CBNA 1W5CE 2Y0CA 5CCHC 3U59A 1URQB 1JTHB 3RK3C 3V5BA 2HPCA 4W80A 4A7PA 2O1KA 2JDIH 2WPQA 4UB8E 2M5AB 3JCUE 3AEEC 1VL2A 1EZVI 4IL6E 1SQXJ 2D2CC 1FZCB 2QM8A 3B71A 1BSHA 3P8MC 3CCMP 2KZJA 1L2PA 1E5WA 3WUVA 1VDFA 1VQOP 2R44A 2IFNA 1NU1J 4ZNCA 4JQ0D 1HGZA 3HUSC 3PTZA 1KZUB 5APXA 1UIIA 1QL2A 3KXDA 1K05A 2E74C 1URQA 3KHUA 1NTKD 1NGMB 3H1JJ 1FC2C 2OARA 3MP7B 2RKLA 3QH9A 5APYA 1FDOA 1IJDB 1H88A 4IL6X 4OH8B 2H43A 1YHQP 2OYIB 2POHA 1NTMD 1NOHA 4JF7A 4EYYQ 3SWFA 2FYUK 3HRNA 2XU6A 3V4WA 3AEFC 3LW5H 5APQA 5KAFE 5CHXA 3CMEP 5GTIH 1A02F 1IFJA 3H1LD 3PJSK 1JY3O 2Q6QA 2G8YA 1M57D 2FYUG 1KC8Q 3AE1C 1HJ0A 4ASWA 3CCLP 4DCKA 2K9YA 5AW3B 3T97B 1BDDA 1CI6B 1JY2N 1N73C 1LWUB 5APWA 1LTSC 4TT3H 1X79B 1NTKE 3CCUP 3I5CA 3TF5A 1FS0E 2YXRB 1VQ9P 2V7QJ 2QM7A 1VQ5P 1WT6A 1NTME 4DOJA 3AE2C 5H2FE 1L0LD 2H89C 2OYHA 3H1LE 3VMZA 1ZR4A 1KORA 1HH0A 1KQLA 2NRGA 1RQUA 1G2CA 1AQTA 1KQFB 5B66E 1J1EC 5M1BA 3L75J 1NYHA 1CI6A 3L72G 3RL0C 1EC5A 2KUBA 3Q2YA 4YTPC 2ZVNB 1LTGC 3RGUA 2K3RA 1K73Q 5B5EE 1EXJA 1AA0A 1FBMA 5AVUB 3RK2D 3WUUA 2W8ZA 4ZKUA 3JC22 1LGHB 1L0LE 1Z56A 3S1KA 2KS1B 2ZT9C 2KI7B 2FY8A 2IBZI 1S3JA 2P7JA 1SQVK 1L0NE 2PRRA 3GHGC 2KB7P 3VTPC 3CX5I 1NTZD 2AXCA 1KILB 1SQVG 4WY4B 1NTKJ 1EXIA 2GM4A 1SLQA 1J1DB 3H1ID 5KAIH 1EDJA 1U7JA 2KLUA 2B88A 1FZEA 1N7SD 1IO4A 1RQVA 2FXMA 2KSJA 1PP9G 2Q9IA 1LT9A 1VQLP 2P58A 3H1LJ 1KILD 4Y28J 2IBZG 4WY4D 5KLVK 3KZIH 2KS1A 1RE3A 4WWIA 5APSA 4B86A 1FDMA 1LTJC 5KLVG 2FKWB 1WRGA 1OWAA 3CWBD 3HD7B 1OX3A 2O01N 1R5SA 1LTTC 2O01J 3OJAB 3CD6P 4PJ0H 1NTZE 1RF1B 2ZVOB 2FYNC 3IN6A 3GF7A 3E7KA 1JY2P 3H1IE 3KQGA 2I8DA 5AVTB 5BU8B 2FXPA 4IFDK 3Q1MA 5AW2B 1L0LJ 1YJWP 3P8CD 4Z1MH 3GW6A 3BASA 2QJKB 1KILE 1L0NJ 1G1JA 4OGQB 3S9OA 3KYQA 1BE3G 3TGUD 2A45I 3B5NB 5GTHE 1KYOI 3HD7A 5CCGA 1D7MA 1M90Q 2B9BA 3CWBE 3RL0g 1OW6A 1CZQA 1GMJA 4R4LA 1X8YA 1E79H 2NZ2A 2E5YA 3HE5B 3M0AA 1FOSF 1VQ4P 2NPSD 2G3AA 3G3ZA 3D6YA 1IFPA 2C9NY 1JOCA 3P8CE 1KB9H 4U3FG 2OTLP 1DIPA 5CBOA 4H13B 2N1TB 4JPZB 1KB9I 1PP9J 1NTZJ 1BCCG 2Y0DA 4H44D 3O6QA 3B5NA 3H1KD 2QG4A 3CXHH 2KOGA 3CC4P 4BXLA 4L76A 2HG5D 4N78D 3H1IJ 3SWKA 1YI2P 1X22A 5KLVJ 1M8OB 1SQQK 3CXHI 2Z4EA 2WPSA 4EOTA 3H32B 4H13D 2AXTE 2N1TD 1SQBK 3AEGC 2ZJSE 1SQQG 2B89A 3C8VA 1HBWA 4GDOA 2R32A 3L73D 3H25A 5KJ7A 1SQBG 1FZCC 3V6IA 2WSEH 1GU4A 3H1HG 3CWBJ 2OQQA 1S5LE 4QMAA 1Y9BA 5DJTB 1L4AA 3GMAA 3H1KE 4RO0A 1QX8A 1XTCC 5AW6B 3R4YA 2KXPB 4N78E 1JNMA 5TJHA 4LC1A 3D71A 1U7MA 4GT1A 5KLIB 4BRYB 2A06G 3OA7A 3A0BH 4H0LC 2B87A 2OTKE 1DX7A 2L5GB 2ZYGA 3USSA 1S5LX 2IZ1A 2JWDA 2HPCB 3L73E 1M7LA 3V2NA 1GL2A 2YXQB 1FJPA 4I7ZB 1OMIA 3E1IA 4C7RA 5AW8B 2JKVA 2KNCB 1X9VA 1RY3A 1ZRTD 1KFNA 1LWUC 1PGJA 2BCCG 1BCCJ 2QIWA 3VMXA 1TU3F 3AE5C 2FFDC 3CC7P 2Y9YA 5E79E 2BASA 3A2AA 4IFMA 2PFXA 1SS1A 1JMBA 3KDPB 2W90A 4RESB 3L75D 1YJ9P 2KIKA 5KKZC 4I1LA 2XV5A 1VF5D 1ZXGA 1BSNA 2YMYA 1NO4A 2P67A 3BCCG 2XNXA 2HR3A 3RK2C 3H1KJ 1LP1A 1NKNA 2KNCA 2E76B 2YMKA 1URQD 3Q3DA 5AW4B 1ZRTE 1RF0A 4IFFA 1T8ZA 2QJYB 2LXBA 2KYVA 2OYOA 3IR9A 3M0DA 2IYOA 3PH0A 3GG2A 3L73J 1FZGA 1SFCA 3TDKA 2HYNA 3L75E 4XA4A 2E76D 1VQMP 3G71P 2FYUD 3L71G 2ZYDA 2WSFJ 2ITAA 2OTJP 5H2FH 1EQ7A 1N7SC 4O9BA 1EZVG 3MGNA 3MHVA 1KILC 1PFIA 4WY4C 2GUVA 4GOEA 2OYHB 1S2EA 5AVQB 1FJKA 1PZQA 1YBKA 3AECC 1G2CB 2M3BA 2N9YB 1PGQA 3A0HH 1YYCA 1M1JC 1OVRA 3B4SA 1KN7A 1NTMK 1JY3P 4JYCA 2C9LY 2GUSA 2WPRA 2FYUE 1NAFA 2W6JH 3N4XA 1NTMG 3II6A 3A5TA 2FYZA 3RBZA 1JB0J 3L72D 2WTYA 4KT0J 2RH0A 3AE6C 1Y8AA 2ZAEB 1NWQA 1RF1C 1Q81Q 2IPPA 3NXSA 1KTMA 2WSCJ 1L0ND 3N7NA 1FOSE 3K5BA 2E42A 1S4XA 3Q5PA 1AFOA 1ZP0C 4C46A 4UB6H 1JCDA 1FZBA 2BEZF 2QJKC 5GTIE 3BATA 3BVHA 5AW9B 3L74G 2I1KA 5K5GB 2K88A 1EDKA 2D2CB 1SP4A 5C39A 3AEAC 1LTAC 1SQVD 1LT9B 2NPSC 3G9RA 5CMZA 3F89A 1HTLC 1NAYA 3L72E 5AVWB 1VQ6P 1RE4A 3R2PA 1CW5A 3CX5H 2C0WA 2WPVB 1MUUA 4PV1C 2YO2A 5AW7B 1PL5A 4H44C 5CCHA 1PP9D 1GW4A 3P7KA 1AQ5A 1VQPP 2FYUJ 1ZLLA 4HJGH 3L70G 3AE4C 2KP8A 4L73A 5KLVD 2L91A 3SWYA 4H13C 3M06A 2N1TC 1P84D 1PPJG 3FGAD 1AVYA 1KQSO 2P2UA 3FXEA 1M1KQ 2N9BA 1SQVE 4AQRD 1S72P 4D6TG 1JCCA 4NPFX 2YIUB 5GTHH 2H8PD 1HUCA 3HUSA 1OW8A 1MZ9A 3LW5J 1PP9E 1OXZA 4Y99C 3U1CA 2IX7C 1Q86Q 1GU5A 1N2DC 1BE3D 1W2EA 3EFGA 5KLVE 3FWNA 4I2LC 3L4FA 3L72J 1P84E 3HD7D 5AW1B 4GIFA 5CCGD 2WT7B 2A45H 3UIAA 2QJPB 3PLNA 1IZNB 3WU2H 1J1EB 1KYOH 3D70A 1ZV8A 2JP3A 3CL3D 1BGYG 5KAIE 1X0TA 5KLIC 1PIXA 3O6QB 4W7ZA 3RL0B 3WUTA 2BEQD 1N73A 3CCSP 1S1CX 2KK7A 4U3FD 1DD3A 3O8ZA 4YXDC 2QRXA 3VP9A 3SSUA 3W67A 5BU5A 2HFED 4N6JA 2DW3A 1IK9A 4OGQD 4PD4H 3LIEA 1BCCD 1BE3E 2K9JA 1VQKP 1OIPA 1FZFA 3OW2O 4YPCA 4I7ZC 1SQVJ 3B5ND 3RBXA 4PD4I 3IFMA 1OVVA 2P1JA 3W68A 2WT7A 2QE7H 1VF5C 2XKMA 3GHGB 5EFWB 4TLFA 3EWKA 3CPWO 2A45G 3MIWA 3TGUG 1OZHA 2WITA 5AW5B 1SQQD 2Q7CA
chains in the Genus database with same CATH topology
1D7MA 2FXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7M A;  2FXO A; 
#chains in the Genus database with same CATH topology
 1IFN A;  1L4A B;  5APU A;  1VPC A;  5BVZ A;  2VRS A;  1OVU A;  3AED C;  1URQ C;  2Y9Z A;  5KJ7 D;  1KB9 D;  1RH5 B;  4U3F E;  1QGK B;  3BRV B;  3H1H D;  3TNU A;  2IDB A;  4L75 A;  1HJB A;  2RN0 A;  3EQ2 A;  2W6A A;  1BCC E;  2B87 B;  2W27 A;  1L4A D;  2RMZ A;  3CXH D;  5TIS H;  2E76 C;  1LTJ B;  3AEB C;  3CMA P;  3GHG A;  2GA1 A;  1GL2 B;  2O3J A;  1FE6 A;  2C0X A;  3VN0 A;  2A06 D;  2QJY C;  1SQX K;  3QWO C;  3VOP A;  1SQP K;  1T2K D;  5AVZ B;  1SQQ E;  1WMK A;  3CLQ A;  3TK1 A;  4YXW H;  1SQX G;  2J59 M;  2WZ7 A;  1NU1 K;  3E1R A;  1BE3 J;  1SQP G;  4WB4 A;  1YTZ T;  3WMM 0;  2QSI A;  2XND H;  1KB9 E;  1GL2 D;  2J5U A;  4AYC A;  1MKM A;  1VQ7 P;  3H1H E;  1NU1 G;  2OYI C;  3F5H A;  2H7H A;  1Q7Y Q;  2ZFC A;  4UB8 H;  3FWL A;  1K9M Q;  2BCC D;  3CXH E;  3JCU H;  1LTJ A;  3H1J G;  2OYH C;  3BRT B;  5DJU B;  2HOD A;  2V7Q H;  2PAJ A;  2AEF A;  4HYT B;  4IL6 H;  2A06 E;  2E43 A;  1VQN P;  1LP1 B;  5KTB A;  4U3F J;  2R5D A;  2MJZ A;  3ITK A;  3A3Y B;  3BCC D;  3V2Q A;  2J58 A;  1HWT C;  4GOF A;  2M8R A;  2R3C A;  1SFC B;  3L36 A;  3U1A A;  1KFM A;  2CPB A;  3CI9 A;  2BCC E;  3G6E P;  2ZYA A;  3HTK B;  1YIT P;  1H0T B;  1SQQ J;  3AE9 C;  5KAF H;  4DT0 A;  1S9K D;  2K37 A;  3A0B E;  1SQB J;  1SFC D;  2KZI A;  1GK4 A;  4U7J A;  3L71 D;  2W6B A;  1NKZ B;  3H1H J;  5APV A;  2QEX P;  3BCC E;  4LGD E;  1N8R Q;  1KV4 A;  1ZOY C;  2JWA A;  1KMI Z;  1EZV D;  3L75 G;  5AVR B;  4BWN A;  2YO3 A;  1K04 A;  3I56 P;  2M3E A;  1SQP J;  1ZW0 A;  1LT9 C;  3ABV C;  3V2P A;  1OFC X;  2IZ0 A;  1NVO A;  1RE3 C;  1KQG B;  3HTK A;  1H0T A;  2AEJ A;  3MD0 A;  4DJG A;  1SVF A;  3LID A;  1R5L A;  1AV1 A;  1S9K E;  1JTH A;  2PP6 A;  2JR8 A;  3AE7 C;  2JEE A;  5AW0 B;  2M5A A;  2WSE J;  3L71 E;  5B66 H;  4H0L B;  2OGU A;  1J1D C;  3M9Q A;  3JSV C;  1NTK K;  2O01 H;  4HH2 A;  1EZV E;  1PGO A;  2IYP A;  3NTN A;  1FZC A;  5B5E H;  3S4R A;  2BCC J;  5CJ4 A;  1NTK G;  3D6Z A;  2Z5I A;  5CJ0 A;  1CSB A;  1JUN A;  3C9I A;  3PRJ A;  1GTW A;  2XZR A;  1HF9 A;  4MN4 C;  2YIU C;  3B8E B;  4H0L D;  4EDF A;  1GK6 A;  4GOD A;  2ZXE B;  1T6A A;  5AVX B;  2E75 B;  3HD7 C;  5CCG C;  3TSI A;  4JBZ A;  3H1L G;  2MKV A;  3BCC J;  2FFD B;  1YJN P;  2YKO A;  1DEB A;  1T3J A;  2Z5H A;  3L74 D;  2OYI A;  2V4H A;  3FXD A;  2LR2 A;  2P10 A;  5AVS B;  5KKZ B;  1MFT A;  4WBA A;  2E75 D;  3RK3 B;  2CK3 H;  1KD1 Q;  4HB1 A;  3VP8 A;  3ZDM A;  1N86 A;  2FBW C;  2QJP C;  1H89 A;  1L0L K;  3RK2 B;  3VMY A;  4OGQ C;  2QA4 P;  4IOI H;  4HKZ H;  3T97 A;  4W7Y A;  1NJI Q;  3B5N C;  5CCH D;  1L0N K;  2YKP A;  3EFF K;  3A0H E;  3MUD C;  3PHL A;  1L0L G;  3RK3 D;  1LWU A;  3L71 J;  3L70 D;  1PV3 A;  1Y47 A;  2FFD A;  4LLH A;  1L0N G;  4GKG A;  4ZKP A;  3HUS B;  3SFE C;  3L74 E;  1PPJ D;  4RKU J;  1U57 A;  3L37 A;  1QVG O;  2E74 B;  4RJT A;  2D2C D;  2Q5U A;  1JO5 A;  2IBZ D;  1JEK A;  1YIJ P;  1RHZ B;  3CCQ P;  4D6T D;  4R4M A;  3Q5R A;  2KLV A;  1M56 D;  2I1J A;  5KJ7 C;  4XFJ A;  3CX5 D;  1N7S B;  1P84 H;  2R3S A;  4ASV A;  3C1L A;  1YTZ I;  1LTB C;  1P84 I;  2E74 D;  1Q90 D;  1FDI A;  1L4A C;  3M9B A;  1ZME C;  1OW7 A;  3RK3 E;  1NTZ K;  3A7O A;  3L70 E;  5APT A;  1N7L A;  1NTM J;  4UB6 E;  2ZXX A;  1QVF O;  1LTI C;  2QVA A;  2H88 C;  2JO1 A;  1NH4 A;  1M1J B;  4NPD A;  1NTZ G;  4NPE A;  1PPJ E;  1N73 B;  3IF4 A;  1T2K C;  4I6M C;  3G4S P;  2JJL A;  1FU1 A;  1H8A A;  2IBZ E;  1HGV A;  4D6T E;  1JY2 O;  3H1I G;  1BGY D;  3HE4 B;  1N7S A;  2WWW A;  1GL2 C;  2K9J B;  3CX5 E;  1K8A Q;  3IAO A;  1QLE D;  3GF3 A;  4AUW A;  1KIL A;  2IFM A;  4WY4 A;  1DD4 A;  1FAV A;  3CCV P;  2Y0E A;  2UWJ E;  3AE8 C;  3L74 J;  2HLO A;  1GDT A;  3CC2 P;  1M1J A;  1LJ2 A;  2WVR A;  3CWB G;  2O1J A;  1GW3 A;  1QEX A;  1XTG B;  4K35 A;  4K3A A;  1Q2N A;  2Q1K A;  2AXT H;  4C7N B;  1NHL A;  3KZI E;  3PP5 A;  3TNU B;  3M91 A;  2YKQ A;  1KYO D;  3P32 A;  1J2J B;  4WVZ A;  3HE4 A;  1DH3 A;  1AJY A;  1BGY E;  4DZO A;  1IFD A;  2NPS B;  1FZA A;  3V2R A;  1EDL A;  3RL0 D;  1RF1 A;  1Q82 Q;  2ZT9 B;  2LXC B;  3L70 J;  1MV8 A;  5AVV B;  4N3Y B;  4PV1 B;  4PJ0 E;  3M9H A;  1S5L H;  1QL1 A;  3AE3 C;  4H44 B;  1RF0 C;  1R8E A;  1BDC A;  1USD A;  4PD4 D;  4OVN F;  1IK7 A;  4L74 A;  3FX0 A;  1UIX A;  2Q3I A;  4JYB A;  3M0D C;  4D6T J;  1SFC C;  2ZT9 D;  1SQB D;  1GZL A;  1ZN5 A;  4EIJ A;  1MFZ A;  2FXO A;  4PV1 D;  4C7N A;  3TGU E;  2XDJ A;  3WU2 E;  1KYO E;  3CCR P;  3MUD A;  2WMM A;  2NPS A;  1LT1 A;  3CCE P;  4ZMD A;  1PGP A;  1SQX D;  3GLM A;  1SQP D;  1YQ3 C;  1IFM A;  3MZW B;  2HOD B;  2WSF H;  3V4Q A;  1ZR2 A;  1NU1 D;  1G1I A;  2W83 C;  3HE5 A;  1YQ4 C;  4EI2 A;  1LNQ A;  4PD4 E;  4XE5 B;  4Y99 B;  3SFD C;  3H1K G;  1JMM A;  2YNY A;  4M3L A;  2FYN B;  1JM0 A;  2E5T A;  3OAK A;  1AVO A;  2SPZ A;  2R5B A;  3H1J D;  1SQB E;  1BGY J;  5L8R J;  5E79 H;  2N1T A;  3Q5S A;  2LKM A;  1IFI A;  2Q3E A;  3MTU E;  1EDI A;  2PGD A;  3NFQ A;  4KJM A;  4KHX A;  3L73 G;  4OWF A;  2AEM A;  3KPE A;  1GD2 E;  1SQX E;  3CCJ P;  1SQP E;  2CPS A;  3H32 A;  1VQ8 P;  5AVY B;  3NMD A;  1JY3 N;  2K1A A;  1NU1 E;  2M0B A;  3VMA A;  2KSE A;  3H6P A;  3VYI A;  5TIS E;  3TGU J;  2WSC H;  3H1J E;  1USE A;  4CPG A;  2WQY C;  1DEE G;  3TYY A;  1IC2 A;  2WSS H;  2E75 C;  1VF5 B;  1HVV A;  1T3U A;  1A02 J;  3L35 A;  1RE4 C;  1W2B O;  4BRY A;  3I55 P;  5CBN A;  1W5C E;  2Y0C A;  5CCH C;  3U59 A;  1URQ B;  1JTH B;  3RK3 C;  3V5B A;  2HPC A;  4W80 A;  4A7P A;  2O1K A;  2JDI H;  2WPQ A;  4UB8 E;  2M5A B;  3JCU E;  3AEE C;  1VL2 A;  1EZV I;  4IL6 E;  1SQX J;  2D2C C;  1FZC B;  2QM8 A;  3B71 A;  1BSH A;  3P8M C;  3CCM P;  2KZJ A;  1L2P A;  1E5W A;  3WUV A;  1VDF A;  1VQO P;  2R44 A;  2IFN A;  1NU1 J;  4ZNC A;  4JQ0 D;  1HGZ A;  3HUS C;  3PTZ A;  1KZU B;  5APX A;  1UII A;  1QL2 A;  3KXD A;  1K05 A;  2E74 C;  1URQ A;  3KHU A;  1NTK D;  1NGM B;  3H1J J;  1FC2 C;  2OAR A;  3MP7 B;  2RKL A;  3QH9 A;  5APY A;  1FDO A;  1IJD B;  1H88 A;  4IL6 X;  4OH8 B;  2H43 A;  1YHQ P;  2OYI B;  2POH A;  1NTM D;  1NOH A;  4JF7 A;  4EYY Q;  3SWF A;  2FYU K;  3HRN A;  2XU6 A;  3V4W A;  3AEF C;  3LW5 H;  5APQ A;  5KAF E;  5CHX A;  3CME P;  5GTI H;  1A02 F;  1IFJ A;  3H1L D;  3PJS K;  1JY3 O;  2Q6Q A;  2G8Y A;  1M57 D;  2FYU G;  1KC8 Q;  3AE1 C;  1HJ0 A;  4ASW A;  3CCL P;  4DCK A;  2K9Y A;  5AW3 B;  3T97 B;  1BDD A;  1CI6 B;  1JY2 N;  1N73 C;  1LWU B;  5APW A;  1LTS C;  4TT3 H;  1X79 B;  1NTK E;  3CCU P;  3I5C A;  3TF5 A;  1FS0 E;  2YXR B;  1VQ9 P;  2V7Q J;  2QM7 A;  1VQ5 P;  1WT6 A;  1NTM E;  4DOJ A;  3AE2 C;  5H2F E;  1L0L D;  2H89 C;  2OYH A;  3H1L E;  3VMZ A;  1ZR4 A;  1KOR A;  1HH0 A;  1KQL A;  2NRG A;  1RQU A;  1G2C A;  1AQT A;  1KQF B;  5B66 E;  1J1E C;  5M1B A;  3L75 J;  1NYH A;  1CI6 A;  3L72 G;  3RL0 C;  1EC5 A;  2KUB A;  3Q2Y A;  4YTP C;  2ZVN B;  1LTG C;  3RGU A;  2K3R A;  1K73 Q;  5B5E E;  1EXJ A;  1AA0 A;  1FBM A;  5AVU B;  3RK2 D;  3WUU A;  2W8Z A;  4ZKU A;  3JC2 2;  1LGH B;  1L0L E;  1Z56 A;  3S1K A;  2KS1 B;  2ZT9 C;  2KI7 B;  2FY8 A;  2IBZ I;  1S3J A;  2P7J A;  1SQV K;  1L0N E;  2PRR A;  3GHG C;  2KB7 P;  3VTP C;  3CX5 I;  1NTZ D;  2AXC A;  1KIL B;  1SQV G;  4WY4 B;  1NTK J;  1EXI A;  2GM4 A;  1SLQ A;  1J1D B;  3H1I D;  5KAI H;  1EDJ A;  1U7J A;  2KLU A;  2B88 A;  1FZE A;  1N7S D;  1IO4 A;  1RQV A;  2FXM A;  2KSJ A;  1PP9 G;  2Q9I A;  1LT9 A;  1VQL P;  2P58 A;  3H1L J;  1KIL D;  4Y28 J;  2IBZ G;  4WY4 D;  5KLV K;  3KZI H;  2KS1 A;  1RE3 A;  4WWI A;  5APS A;  4B86 A;  1FDM A;  1LTJ C;  5KLV G;  2FKW B;  1WRG A;  1OWA A;  3CWB D;  3HD7 B;  1OX3 A;  2O01 N;  1R5S A;  1LTT C;  2O01 J;  3OJA B;  3CD6 P;  4PJ0 H;  1NTZ E;  1RF1 B;  2ZVO B;  2FYN C;  3IN6 A;  3GF7 A;  3E7K A;  1JY2 P;  3H1I E;  3KQG A;  2I8D A;  5AVT B;  5BU8 B;  2FXP A;  4IFD K;  3Q1M A;  5AW2 B;  1L0L J;  1YJW P;  3P8C D;  4Z1M H;  3GW6 A;  3BAS A;  2QJK B;  1KIL E;  1L0N J;  1G1J A;  4OGQ B;  3S9O A;  3KYQ A;  1BE3 G;  3TGU D;  2A45 I;  3B5N B;  5GTH E;  1KYO I;  3HD7 A;  5CCG A;  1D7M A;  1M90 Q;  2B9B A;  3CWB E;  3RL0 g;  1OW6 A;  1CZQ A;  1GMJ A;  4R4L A;  1X8Y A;  1E79 H;  2NZ2 A;  2E5Y A;  3HE5 B;  3M0A A;  1FOS F;  1VQ4 P;  2NPS D;  2G3A A;  3G3Z A;  3D6Y A;  1IFP A;  2C9N Y;  1JOC A;  3P8C E;  1KB9 H;  4U3F G;  2OTL P;  1DIP A;  5CBO A;  4H13 B;  2N1T B;  4JPZ B;  1KB9 I;  1PP9 J;  1NTZ J;  1BCC G;  2Y0D A;  4H44 D;  3O6Q A;  3B5N A;  3H1K D;  2QG4 A;  3CXH H;  2KOG A;  3CC4 P;  4BXL A;  4L76 A;  2HG5 D;  4N78 D;  3H1I J;  3SWK A;  1YI2 P;  1X22 A;  5KLV J;  1M8O B;  1SQQ K;  3CXH I;  2Z4E A;  2WPS A;  4EOT A;  3H32 B;  4H13 D;  2AXT E;  2N1T D;  1SQB K;  3AEG C;  2ZJS E;  1SQQ G;  2B89 A;  3C8V A;  1HBW A;  4GDO A;  2R32 A;  3L73 D;  3H25 A;  5KJ7 A;  1SQB G;  1FZC C;  3V6I A;  2WSE H;  1GU4 A;  3H1H G;  3CWB J;  2OQQ A;  1S5L E;  4QMA A;  1Y9B A;  5DJT B;  1L4A A;  3GMA A;  3H1K E;  4RO0 A;  1QX8 A;  1XTC C;  5AW6 B;  3R4Y A;  2KXP B;  4N78 E;  1JNM A;  5TJH A;  4LC1 A;  3D71 A;  1U7M A;  4GT1 A;  5KLI B;  4BRY B;  2A06 G;  3OA7 A;  3A0B H;  4H0L C;  2B87 A;  2OTK E;  1DX7 A;  2L5G B;  2ZYG A;  3USS A;  1S5L X;  2IZ1 A;  2JWD A;  2HPC B;  3L73 E;  1M7L A;  3V2N A;  1GL2 A;  2YXQ B;  1FJP A;  4I7Z B;  1OMI A;  3E1I A;  4C7R A;  5AW8 B;  2JKV A;  2KNC B;  1X9V A;  1RY3 A;  1ZRT D;  1KFN A;  1LWU C;  1PGJ A;  2BCC G;  1BCC J;  2QIW A;  3VMX A;  1TU3 F;  3AE5 C;  2FFD C;  3CC7 P;  2Y9Y A;  5E79 E;  2BAS A;  3A2A A;  4IFM A;  2PFX A;  1SS1 A;  1JMB A;  3KDP B;  2W90 A;  4RES B;  3L75 D;  1YJ9 P;  2KIK A;  5KKZ C;  4I1L A;  2XV5 A;  1VF5 D;  1ZXG A;  1BSN A;  2YMY A;  1NO4 A;  2P67 A;  3BCC G;  2XNX A;  2HR3 A;  3RK2 C;  3H1K J;  1LP1 A;  1NKN A;  2KNC A;  2E76 B;  2YMK A;  1URQ D;  3Q3D A;  5AW4 B;  1ZRT E;  1RF0 A;  4IFF A;  1T8Z A;  2QJY B;  2LXB A;  2KYV A;  2OYO A;  3IR9 A;  3M0D A;  2IYO A;  3PH0 A;  3GG2 A;  3L73 J;  1FZG A;  1SFC A;  3TDK A;  2HYN A;  3L75 E;  4XA4 A;  2E76 D;  1VQM P;  3G71 P;  2FYU D;  3L71 G;  2ZYD A;  2WSF J;  2ITA A;  2OTJ P;  5H2F H;  1EQ7 A;  1N7S C;  4O9B A;  1EZV G;  3MGN A;  3MHV A;  1KIL C;  1PFI A;  4WY4 C;  2GUV A;  4GOE A;  2OYH B;  1S2E A;  5AVQ B;  1FJK A;  1PZQ A;  1YBK A;  3AEC C;  1G2C B;  2M3B A;  2N9Y B;  1PGQ A;  3A0H H;  1YYC A;  1M1J C;  1OVR A;  3B4S A;  1KN7 A;  1NTM K;  1JY3 P;  4JYC A;  2C9L Y;  2GUS A;  2WPR A;  2FYU E;  1NAF A;  2W6J H;  3N4X A;  1NTM G;  3II6 A;  3A5T A;  2FYZ A;  3RBZ A;  1JB0 J;  3L72 D;  2WTY A;  4KT0 J;  2RH0 A;  3AE6 C;  1Y8A A;  2ZAE B;  1NWQ A;  1RF1 C;  1Q81 Q;  2IPP A;  3NXS A;  1KTM A;  2WSC J;  1L0N D;  3N7N A;  1FOS E;  3K5B A;  2E42 A;  1S4X A;  3Q5P A;  1AFO A;  1ZP0 C;  4C46 A;  4UB6 H;  1JCD A;  1FZB A;  2BEZ F;  2QJK C;  5GTI E;  3BAT A;  3BVH A;  5AW9 B;  3L74 G;  2I1K A;  5K5G B;  2K88 A;  1EDK A;  2D2C B;  1SP4 A;  5C39 A;  3AEA C;  1LTA C;  1SQV D;  1LT9 B;  2NPS C;  3G9R A;  5CMZ A;  3F89 A;  1HTL C;  1NAY A;  3L72 E;  5AVW B;  1VQ6 P;  1RE4 A;  3R2P A;  1CW5 A;  3CX5 H;  2C0W A;  2WPV B;  1MUU A;  4PV1 C;  2YO2 A;  5AW7 B;  1PL5 A;  4H44 C;  5CCH A;  1PP9 D;  1GW4 A;  3P7K A;  1AQ5 A;  1VQP P;  2FYU J;  1ZLL A;  4HJG H;  3L70 G;  3AE4 C;  2KP8 A;  4L73 A;  5KLV D;  2L91 A;  3SWY A;  4H13 C;  3M06 A;  2N1T C;  1P84 D;  1PPJ G;  3FGA D;  1AVY A;  1KQS O;  2P2U A;  3FXE A;  1M1K Q;  2N9B A;  1SQV E;  4AQR D;  1S72 P;  4D6T G;  1JCC A;  4NPF X;  2YIU B;  5GTH H;  2H8P D;  1HUC A;  3HUS A;  1OW8 A;  1MZ9 A;  3LW5 J;  1PP9 E;  1OXZ A;  4Y99 C;  3U1C A;  2IX7 C;  1Q86 Q;  1GU5 A;  1N2D C;  1BE3 D;  1W2E A;  3EFG A;  5KLV E;  3FWN A;  4I2L C;  3L4F A;  3L72 J;  1P84 E;  3HD7 D;  5AW1 B;  4GIF A;  5CCG D;  2WT7 B;  2A45 H;  3UIA A;  2QJP B;  3PLN A;  1IZN B;  3WU2 H;  1J1E B;  1KYO H;  3D70 A;  1ZV8 A;  2JP3 A;  3CL3 D;  1BGY G;  5KAI E;  1X0T A;  5KLI C;  1PIX A;  3O6Q B;  4W7Z A;  3RL0 B;  3WUT A;  2BEQ D;  1N73 A;  3CCS P;  1S1C X;  2KK7 A;  4U3F D;  1DD3 A;  3O8Z A;  4YXD C;  2QRX A;  3VP9 A;  3SSU A;  3W67 A;  5BU5 A;  2HFE D;  4N6J A;  2DW3 A;  1IK9 A;  4OGQ D;  4PD4 H;  3LIE A;  1BCC D;  1BE3 E;  2K9J A;  1VQK P;  1OIP A;  1FZF A;  3OW2 O;  4YPC A;  4I7Z C;  1SQV J;  3B5N D;  3RBX A;  4PD4 I;  3IFM A;  1OVV A;  2P1J A;  3W68 A;  2WT7 A;  2QE7 H;  1VF5 C;  2XKM A;  3GHG B;  5EFW B;  4TLF A;  3EWK A;  3CPW O;  2A45 G;  3MIW A;  3TGU G;  1OZH A;  2WIT A;  5AW5 B;  1SQQ D;  2Q7C A; 
#chains in the Genus database with same CATH homology
 1D7M A;  2FXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...