2FXOA

Structure of the human beta-myosin s2 fragment
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
129
structure length
129
Chain Sequence
GSSPLLKSAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMNKRLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Myosin heavy chain, cardiac muscle beta isoform
publication title Crystal structures of human cardiac {beta}-myosin II S2-{Delta} provide insight into the functional role of the S2 subfragment
pubmed doi rcsb
source organism Homo sapiens
molecule tags Contractile protein
total genus 59
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1050 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Coiled-coil dimerization domain from cortexillin I 2fxoA00
1D7MA 2FXOA
chains in the Genus database with same CATH superfamily
3H1LJ 1SQXE 1P84I 3RL0g 1NTKD 4BRYA 1FS0E 1NTMD 2N1TA 1KFMA 1LP1B 5KLIC 1GK6A 1KB9H 1URQC 3M9BA 1EDIA 2O01H 3SFEC 1AJYA 1BCCD 1YHQP 3CCLP 1AV1A 5APWA 2FFDA 3EFFK 1BGYD 1K73Q 4PJ0E 2ZAEB 3CX5D 4JF7A 2WITA 1FZAA 1KN7A 1K9MQ 2YKQA 2NPSB 4LC1A 2E76B 2O01N 3AE4C 3CD6P 3H1LG 3H1IJ 2BCCJ 3H32A 1SQBD 3MGNA 3L72J 2FKWB 4H0LC 4ZKUA 4JPZB 1FDMA 5AVZB 5GTIH 4M3LA 5KLVK 1URQD 2JWAA 1PIXA 3GF7A 2XDJA 1NKNA 3R4YA 1KQGB 3AE3C 3KXDA 2IBZI 1OX3A 4IL6X 3A5TA 3G71P 1SQQK 2PGDA 1RY3A 5BVZA 2E75B 1NAYA 1SQPJ 2CPSA 2KYVA 1EC5A 4IL6H 2IX7C 4H0LD 4EIJA 3CLQA 3HUSB 2M3BA 2WTYA 1SFCB 2BCCG 3CMAP 1KB9E 2Y0EA 3GG2A 2PP6A 2DW3A 3L72G 3NXSA 3LW5J 4N78E 3CCSP 2VRSA 1R5LA 4A7PA 2WZ7A 3H1LD 1S9KE 3CXHD 3E1IA 2Q9IA 1AFOA 3KZIH 3HD7B 1YQ4C 1ZLLA 2FYNC 1G2CB 2QE7H 4OGQC 1FDIA 1PGJA 3FWNA 1DD4A 1KFNA 3MUDA 2V4HA 1NTZK 1SVFA 3W68A 4L76A 3Q5PA 1SQPG 5CCGC 1EQ7A 4DOJA 1FE6A 1EZVE 3VYIA 3L73E 1PGQA 2WPRA 5AW3B 2IYOA 4D6TJ 1VF5C 3M0DA 5AVXB 4QMAA 2KB7P 2KNCB 3H1ID 4OGQD 1OFCX 1BDDA 3GHGC 2BCCD 1K05A 3L72D 4Y28J 1X79B 5B5EH 3HD7A 2P1JA 3V2QA 5CCGD 1VQ6P 2H89C 3ABVC 5AVYB 2KSEA 4AYCA 2G3AA 3II6A 3TDKA 1KYOH 2HFED 1QGKB 2FXMA 3Q5RA 4N3YB 1IK9A 2XZRA 1NH4A 4WY4C 1SQPD 1JUNA 1VF5D 3I5CA 3KZIE 2IZ1A 2JP3A 1T8ZA 3HTKB 3A0HH 3OJAB 3P7KA 1SQXK 1QVFO 2K9YA 3TK1A 1LWUC 3S4RA 3G6EP 1FZCA 2QRXA 1YITP 2QIWA 2KNCA 1QL2A 1FOSE 3RK2B 3PRJA 2YXRB 2KXPB 2OYHC 2OQQA 5AVQB 1T3JA 1M56D 1AA0A 5TISE 5DJUB 3AEDC 1ZRTE 1VQ5P 2YXQB 2D2CC 2Z5IA 3H1KJ 5EFWB 1SLQA 3HE4B 5E79H 2M3EA 4WY4D 1CI6B 2WSEH 2QM8A 2Y9ZA 5KAIH 3M9QA 3IN6A 1NOHA 3VOPA 2JKVA 3H1JE 1MFZA 3C9IA 3WU2H 3I56P 1EXIA 1EXJA 1E5WA 1RH5B 4BXLA 1L0NE 5AW0B 3HTKA 3EWKA 1P84H 2IBZG 5CBOA 2BEQD 3CCVP 2KP8A 1S5LH 3AE9C 2R3SA 3R2PA 1NU1K 3B71A 1KYOE 1W2BO 1OW7A 1FC2C 2XKMA 1PP9G 3KPEA 4D6TD 2POHA 2D2CD 3Q2YA 3FX0A 1N7LA 1R8EA 2WSSH 1GL2A 5KLVE 3EFGA 5H2FH 1HGZA 3CWBE 1WMKA 1PPJE 1X22A 1KMIZ 3FGAD 1HJBA 1ZP0C 4DCKA 1LTJC 2HR3A 3HE4A 4YXWH 1CI6A 2W6JH 4XA4A 1HJ0A 4GIFA 3W67A 1SQQE 3HRNA 2WSFJ 2G8YA 1VQOP 2OYIC 3L70E 3TYYA 3OAKA 4PD4H 1OW6A 1N7SB 2ZVOB 1SQVK 2M5AB 1DIPA 1IK7A 2N1TC 1T3UA 4XE5B 2IBZD 1JM0A 2FXPA 2E74B 2AXCA 3RK3B 1RF1B 4L74A 2K1AA 5KAIE 3L75E 1FU1A 4IFMA 2QJKC 3L71E 2HLOA 3WUTA 1Q82Q 1HWTC 2FFDC 3V4QA 2ZYGA 4LLHA 2J59M 2CK3H 4RESB 3RBZA 3VTPC 3SWYA 2YMYA 3H1KD 1KQFB 1OZHA 3A0BH 4HJGH 1Q7YQ 1FZGA 4AQRD 3G9RA 1JY3N 1NTZE 1YYCA 3IFMA 2HPCB 2Q3EA 2LXBA 2N1TD 3B8EB 2W27A 4R4MA 2SPZA 2ZJSE 5KKZC 2JDIH 2ZT9B 1L0LE 2RMZA 3JC22 5APVA 1N7SA 1VQ4P 2BASA 2M5AA 1GD2E 3SWFA 2J58A 3RK3E 1H8AA 1TU3F 1PGOA 3D6YA 3M0AA 3M91A 2WWWA 3L73J 1L2PA 1IFJA 2V7QH 4PD4E 1YJ9P 2QG4A 3CCUP 3WUVA 4RO0A 3P32A 2WSCJ 4BWNA 5L8RJ 2AEJA 1LT1A 1IFDA 3N7NA 2CPBA 1M1JA 2KUBA 3B4SA 3AEGC 1GW4A 2RN0A 4IFFA 1Q2NA 2O3JA 1VL2A 5B66E 4YTPC 4MN4C 2J5UA 4GT1A 2FYUK 2ZVNB 4I1LA 3CCEP 5AVTB 2BEZF 2KS1B 1ZXGA 1EZVG 3L73G 3MUDC 1VQMP 1KILB 1S2EA 3F5HA 1VDFA 4DJGA 1M7LA 4UB8H 1YIJP 4I7ZB 3CC4P 1FZFA 1VQPP 1HTLC 3H25A 1Y47A 2ITAA 2Q5UA 4N78D 3F89A 5APQA 5AVUB 3HUSC 2QJYC 1HF9A 3BCCE 4Y99B 1L0NK 1SFCC 2GA1A 1GK4A 1L4AB 4AUWA 3M0DC 3TSIA 3CX5H 2WVRA 4C7NA 5KAFE 3RGUA 3AEFC 3G4SP 1RHZB 1VQNP 1GU5A 3A3YB 1CZQA 3L74E 3NFQA 4K35A 4NPFX 3HD7C 2W90A 1PZQA 3A2AA 1NU1E 2WPVB 3VP9A 1K8AQ 3TF5A 1HUCA 2AXTE 3GMAA 1LP1A 1EZVD 4GOFA 4W7YA 3L73D 1J2JB 2JEEA 3QWOC 2A06G 4UB6H 4LGDE 2QEXP 4H44B 2KOGA 4JQ0D 1JO5A 1JY3P 3AE6C 3D6ZA 1VPCA 5KLVJ 1U7JA 3HD7D 1BE3J 2QSIA 5KLIB 1FZCC 1NTKE 2NPSA 1DD3A 1LJ2A 3H1IG 1KV4A 1PFIA 2OYOA 3GF3A 4UB8E 1SQVE 3MD0A 2P58A 3E7KA 1HH0A 4YPCA 3TGUE 1RE3A 1SQQJ 2H43A 1BGYE 3E1RA 3BRVB 3CXHH 3L70J 1OWAA 3FXDA 1NWQA 1Y8AA 4L75A 3CC7P 2HODB 4I2LC 1QL1A 1HGVA 4H0LB 2A06D 5GTIE 5KLVG 2LXCB 3AE5C 2YIUC 3CPWO 1BE3G 1L0LK 1NAFA 3PH0A 1SQBE 2R3CA 2OTKE 3L71J 1MZ9A 1PPJG 2W8ZA 1PV3A 2Q1KA 1J1DC 3HUSA 1ZRTD 3L37A 3JSVC 1GL2C 1SFCA 3RK2C 2ZYDA 3USSA 2QJPC 1W2EA 1NTZJ 1SQQG 2R5DA 2IFMA 4HH2A 1SS1A 3L70G 2KLUA 4IL6E 2UWJE 1KZUB 2IPPA 1G2CA 1FZEA 3BVHA 2YNYA 4HKZH 3Q1MA 1RE4A 2HODA 1NVOA 3V2RA 3P8MC 2GUSA 1KYOD 3HE5B 1J1EC 1GL2D 3PHLA 4ZKPA 1NHLA 2YMKA 1EDLA 5KLVD 2HYNA 2KZJA 1OVVA 1S72P 3VMYA 3CXHE 1BE3D 3AE7C 4D6TG 2JO1A 2OARA 1KB9I 1PPJD 3Q5SA 4HYTB 1NTZG 1RQUA 1T6AA 2FYUE 3B5NB 3AEAC 1JCDA 1IC2A 2K3RA 1Q86Q 3V2PA 1IJDB 3LW5H 1A02F 5CJ4A 2E42A 4ZNCA 2C9NY 1CSBA 1SQQD 1EDKA 4U3FJ 4GKGA 2N9BA 3L70D 1JY2N 1VQ9P 4XFJA 2Z4EA 5AW6B 3VMZA 1SQXJ 1Q81Q 1CW5A 2ZXXA 1N7SC 3HE5A 2Z5HA 1EZVI 4W80A 1S5LX 2XNXA 4EI2A 5B5EE 4WVZA 2BCCE 1JY3O 3L71D 3D71A 3RL0C 4ASWA 2E74C 3RK3C 4ZMDA 2YKOA 2Q6QA 4PV1B 1QEXA 4KT0J 3L35A 3IR9A 3B5NA 1NTZD 3H6PA 4GOEA 1LTBC 3BCCJ 4U3FG 2YKPA 2KZIA 3H1KG 1U57A 4DZOA 1N7SD 3A0HE 2RH0A 1AQ5A 1M1JC 3NTNA 2E5TA 4DT0A 1SQXG 3L74J 3V2NA 3G3ZA 1GTWA 1FDOA 1VQLP 5GTHH 3RL0D 3VMAA 1NU1J 2E74D 2ZT9C 3RK3D 5AW4B 1H0TB 1RF0A 1NTKK 4YXDC 1WT6A 1FOSF 3V6IA 1NTMK 2OGUA 4KJMA 3M06A 2KK7A 3P8CE 4TT3H 2D2CB 2MKVA 1IZNB 2WMMA 4JYBA 1YBKA 2A45G 2C0WA 4PD4D 5E79E 3BATA 2E5YA 1Y9BA 1X8YA 3ITKA 1JTHB 3S9OA 1MV8A 1DH3A 3WU2E 3PJSK 2ZT9D 5BU8B 1P84E 3L74G 4U3FD 2WT7B 1S1CX 1S5LE 2WQYC 2O01J 1SQVJ 1NU1G 3MTUE 2P7JA 3SFDC 1SQBK 1SQXD 1USDA 4H13C 3TGUJ 1H0TA 2OTJP 2FBWC 1PGPA 5H2FE 4B86A 3AEEC 1IFMA 5CCHA 1LT9B 1KYOI 4WBAA 1YTZI 1MKMA 2K88A 1QVGO 4C46A 1ZW0A 1A02J 1RF1A 1HBWA 1JTHA 1NKZB 4NPEA 2AEMA 2P2UA 2R5BA 1YJWP 3AEBC 1LTTC 4H13D 5APXA 5C39A 1IFIA 2LR2A 2WT7A 4Y99C 3L74D 3SWKA 1X0TA 4IOIH 1G1JA 2NPSC 2E76C 3CL3D 2KSJA 2JR8A 3CMEP 2HPCA 1NU1D 1NYHA 1AVOA 2Q3IA 2IBZE 1QLED 1PP9E 1LT9A 2Y0CA 1RE3C 4Z1MH 1JMMA 2WSFH 2HG5D 3A0BE 4L73A 1GZLA 2XU6A 1BSNA 1OW8A 1W5CE 2ZXEB 3H32B 4H44C 2NPSD 2E76D 3C1LA 1JCCA 3L36A 2KI7B 2E75C 1Q90D 1KB9D 1BDCA 1LNQA 2FYUJ 1SQVD 1N73B 4IFDK 3LIDA 3O6QB 1ZR4A 1IFNA 1NO4A 1S9KD 3TGUD 4OH8B 1DEBA 2IDBA 3H1HE 1KTMA 5AVSB 2W6AA 1LTSC 3U1AA 1JMBA 4H44D 1AQTA 3MZWB 1OXZA 1LTIC 1YTZT 3BRTB 2B87B 2KS1A 2E75D 2XNDH 1MUUA 3KHUA 1D7MA 1KILE 3FXEA 1RE4C 3H1JJ 5KJ7A 1SQPK 1KILA 2C9LY 4PD4I 1L0NJ 3Q3DA 2M0BA 1Z56A 1SFCD 1ZR2A 2FYUG 2FY8A 5TJHA 1QX8A 1FJPA 1ZN5A 5M1BA 3NMDA 4O9BA 1N73A 1M90Q 5AW5B 1S3JA 3O6QA 3AE2C 2WSCH 1GMJA 3IF4A 1L4AA 3CWBJ 3C8VA 2H88C 1URQB 1EDJA 1NTME 3PP5A 4ASVA 4RJTA 5CMZA 1X9VA 2K37A 3EQ2A 3VP8A 2QJYB 1BCCE 3H1JG 2B87A 3WUUA 1L0NG 3OW2O 2WPSA 1N2DC 1ZOYC 3TNUB 3PLNA 3CX5E 3KDPB 5APTA 1YQ3C 4JBZA 1AVYA 2IZ0A 2MJZA 2QM7A 2A45I 1XTGB 4OWFA 2Y0DA 3GLMA 2WSEJ 5K5GB 2FYUD 1YI2P 1VQ7P 4RKUJ 4I6MC 3L75J 1JY2O 3CWBG 5AVWB 5DJTB 2O1JA 1T2KC 2WPQA 3B5NC 4OVNF 1LTGC 1G1IA 1URQA 5AW7B 2N9YB 4UB6E 1RQVA 2E43A 2L5GB 5AW9B 5TISH 1KQSO 2PAJA 1M1KQ 5BU5A 1KQLA 3CCQP 4K3AA 2R44A 1FZCB 3H1JD 1L0LJ 3PTZA 3TNUA 5AW1B 1DEEG 1JB0J 1L0ND 2YO2A 2QVAA 3L4FA 1RF0C 1OVRA 1T2KD 3N4XA 2KLVA 1FJKA 3B5ND 3L75G 3L71G 3T97B 3MHVA 3RK2D 5CBNA 2H7HA 3CC2P 5CJ0A 2FYNB 1LTAC 4PV1C 4OGQB 3H1LE 2B88A 1XTCC 3CWBD 3AE1C 3RBXA 4CPGA 2IYPA 3LIEA 1PL5A 4WB4A 2P67A 2P10A 2YIUB 4KHXA 3GW6A 2GM4A 1OIPA 4U7JA 4WWIA 1L0LG 1N86A 2A06E 2ZYAA 3CX5I 1J1DB 4HB1A 3O8ZA 3P8CD 2NZ2A 1GL2B 3V5BA 1PP9J 1K04A 4W7ZA 2B9BA 2QJPB 5APSA 1VF5B 2I1KA 4PV1D 3CCMP 3GHGB 3KYQA 5CCHC 4GDOA 4N6JA 3S1KA 5AW8B 3T97A 1YJNP 1LGHB 3H1IE 3L75D 3A7OA 1NJIQ 2K9JB 1GW3A 3L72E 2B89A 2R32A 3FWLA 3U1CA 1OVUA 1E79H 1RF1C 1P84D 1M8OB 5AW2B 5CCGA 1J1EB 3WMM0 1KD1Q 2Q7CA 2PRRA 4WY4B 1H89A 1MFTA 3KQGA 1SP4A 3ZDMA 3SSUA 5CCHD 1IFPA 4NPDA 3U59A 1VQKP 1L0LD 1SQPE 2V7QJ 1JEKA 3H1HJ 1LWUB 3UIAA 3I55P 1UIXA 2FYZA 1BE3E 3GHGA 1UIIA 3M9HA 3JCUH 5CHXA 1LT9C 2OYHB 2L91A 3CCJP 3CXHI 2JWDA 2K9JA 4C7RA 2I8DA 1N8RQ 1S4XA 3BCCG 5APYA 1FZBA 5KTBA 2C0XA 4WY4A 5AVVB 4R4LA 2RKLA 2W83C 3D70A 3H1HG 1DX7A 1NTKJ 3RL0B 1WRGA 2ZFCA 1NGMB 1NTMJ 2Y9YA 2NRGA 3OA7A 1ZMEC 4EOTA 1LWUA 1PP9D 2GUVA 5AVRB 5B66H 1BCCJ 1IO4A 4JYCA 2OYHA 4D6TE 1FAVA 2FXOA 1BGYJ 1M1JB 1LTJB 2JJLA 2M8RA 2XV5A 2I1JA 5KJ7C 1KILC 2W6BA 4GODA 5GTHE 2IFNA 1JNMA 3JCUE 1HVVA 1FBMA 4I7ZC 1NTKG 1GU4A 3AE8C 1SQBJ 2A45H 2QA4P 3BCCD 3CCRP 2OYIB 1NTMG 2H8PD 4PJ0H 2KIKA 4BRYB 3QH9A 2OTLP 3K5BA 1R5SA 1SQVG 2LKMA 3MP7B 1N73C 2N1TB 3BASA 1JY2P 3H1HD 1OMIA 1L4AC 3TGUG 1BCCG 4EYYQ 5KAFH 2PFXA 4TLFA 1H88A 3IAOA 1BSHA 1BGYG 1KORA 2QJKB 2FFDB 5KJ7D 1KILD 3V4WA 1LTJA 2AXTH 1ZV8A 1VQ8P 5APUA 2O1KA 3VMXA 1JOCA 3MIWA 4C7NB 3CI9A 4U3FE 1U7MA 1GDTA 3H1KE 3VN0A 4H13B 1SQBG 1USEA 3AECC 2AEFA 1M57D 1KC8Q 4EDFA 1L4AD 5KKZB 2OYIA 2YO3A
chains in the Genus database with same CATH topology
1D7MA 2FXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7M A;  2FXO A; 
#chains in the Genus database with same CATH topology
 3H1L J;  1SQX E;  1P84 I;  3RL0 g;  1NTK D;  4BRY A;  1FS0 E;  1NTM D;  2N1T A;  1KFM A;  1LP1 B;  5KLI C;  1GK6 A;  1KB9 H;  1URQ C;  3M9B A;  1EDI A;  2O01 H;  3SFE C;  1AJY A;  1BCC D;  1YHQ P;  3CCL P;  1AV1 A;  5APW A;  2FFD A;  3EFF K;  1BGY D;  1K73 Q;  4PJ0 E;  2ZAE B;  3CX5 D;  4JF7 A;  2WIT A;  1FZA A;  1KN7 A;  1K9M Q;  2YKQ A;  2NPS B;  4LC1 A;  2E76 B;  2O01 N;  3AE4 C;  3CD6 P;  3H1L G;  3H1I J;  2BCC J;  3H32 A;  1SQB D;  3MGN A;  3L72 J;  2FKW B;  4H0L C;  4ZKU A;  4JPZ B;  1FDM A;  5AVZ B;  5GTI H;  4M3L A;  5KLV K;  1URQ D;  2JWA A;  1PIX A;  3GF7 A;  2XDJ A;  1NKN A;  3R4Y A;  1KQG B;  3AE3 C;  3KXD A;  2IBZ I;  1OX3 A;  4IL6 X;  3A5T A;  3G71 P;  1SQQ K;  2PGD A;  1RY3 A;  5BVZ A;  2E75 B;  1NAY A;  1SQP J;  2CPS A;  2KYV A;  1EC5 A;  4IL6 H;  2IX7 C;  4H0L D;  4EIJ A;  3CLQ A;  3HUS B;  2M3B A;  2WTY A;  1SFC B;  2BCC G;  3CMA P;  1KB9 E;  2Y0E A;  3GG2 A;  2PP6 A;  2DW3 A;  3L72 G;  3NXS A;  3LW5 J;  4N78 E;  3CCS P;  2VRS A;  1R5L A;  4A7P A;  2WZ7 A;  3H1L D;  1S9K E;  3CXH D;  3E1I A;  2Q9I A;  1AFO A;  3KZI H;  3HD7 B;  1YQ4 C;  1ZLL A;  2FYN C;  1G2C B;  2QE7 H;  4OGQ C;  1FDI A;  1PGJ A;  3FWN A;  1DD4 A;  1KFN A;  3MUD A;  2V4H A;  1NTZ K;  1SVF A;  3W68 A;  4L76 A;  3Q5P A;  1SQP G;  5CCG C;  1EQ7 A;  4DOJ A;  1FE6 A;  1EZV E;  3VYI A;  3L73 E;  1PGQ A;  2WPR A;  5AW3 B;  2IYO A;  4D6T J;  1VF5 C;  3M0D A;  5AVX B;  4QMA A;  2KB7 P;  2KNC B;  3H1I D;  4OGQ D;  1OFC X;  1BDD A;  3GHG C;  2BCC D;  1K05 A;  3L72 D;  4Y28 J;  1X79 B;  5B5E H;  3HD7 A;  2P1J A;  3V2Q A;  5CCG D;  1VQ6 P;  2H89 C;  3ABV C;  5AVY B;  2KSE A;  4AYC A;  2G3A A;  3II6 A;  3TDK A;  1KYO H;  2HFE D;  1QGK B;  2FXM A;  3Q5R A;  4N3Y B;  1IK9 A;  2XZR A;  1NH4 A;  4WY4 C;  1SQP D;  1JUN A;  1VF5 D;  3I5C A;  3KZI E;  2IZ1 A;  2JP3 A;  1T8Z A;  3HTK B;  3A0H H;  3OJA B;  3P7K A;  1SQX K;  1QVF O;  2K9Y A;  3TK1 A;  1LWU C;  3S4R A;  3G6E P;  1FZC A;  2QRX A;  1YIT P;  2QIW A;  2KNC A;  1QL2 A;  1FOS E;  3RK2 B;  3PRJ A;  2YXR B;  2KXP B;  2OYH C;  2OQQ A;  5AVQ B;  1T3J A;  1M56 D;  1AA0 A;  5TIS E;  5DJU B;  3AED C;  1ZRT E;  1VQ5 P;  2YXQ B;  2D2C C;  2Z5I A;  3H1K J;  5EFW B;  1SLQ A;  3HE4 B;  5E79 H;  2M3E A;  4WY4 D;  1CI6 B;  2WSE H;  2QM8 A;  2Y9Z A;  5KAI H;  3M9Q A;  3IN6 A;  1NOH A;  3VOP A;  2JKV A;  3H1J E;  1MFZ A;  3C9I A;  3WU2 H;  3I56 P;  1EXI A;  1EXJ A;  1E5W A;  1RH5 B;  4BXL A;  1L0N E;  5AW0 B;  3HTK A;  3EWK A;  1P84 H;  2IBZ G;  5CBO A;  2BEQ D;  3CCV P;  2KP8 A;  1S5L H;  3AE9 C;  2R3S A;  3R2P A;  1NU1 K;  3B71 A;  1KYO E;  1W2B O;  1OW7 A;  1FC2 C;  2XKM A;  1PP9 G;  3KPE A;  4D6T D;  2POH A;  2D2C D;  3Q2Y A;  3FX0 A;  1N7L A;  1R8E A;  2WSS H;  1GL2 A;  5KLV E;  3EFG A;  5H2F H;  1HGZ A;  3CWB E;  1WMK A;  1PPJ E;  1X22 A;  1KMI Z;  3FGA D;  1HJB A;  1ZP0 C;  4DCK A;  1LTJ C;  2HR3 A;  3HE4 A;  4YXW H;  1CI6 A;  2W6J H;  4XA4 A;  1HJ0 A;  4GIF A;  3W67 A;  1SQQ E;  3HRN A;  2WSF J;  2G8Y A;  1VQO P;  2OYI C;  3L70 E;  3TYY A;  3OAK A;  4PD4 H;  1OW6 A;  1N7S B;  2ZVO B;  1SQV K;  2M5A B;  1DIP A;  1IK7 A;  2N1T C;  1T3U A;  4XE5 B;  2IBZ D;  1JM0 A;  2FXP A;  2E74 B;  2AXC A;  3RK3 B;  1RF1 B;  4L74 A;  2K1A A;  5KAI E;  3L75 E;  1FU1 A;  4IFM A;  2QJK C;  3L71 E;  2HLO A;  3WUT A;  1Q82 Q;  1HWT C;  2FFD C;  3V4Q A;  2ZYG A;  4LLH A;  2J59 M;  2CK3 H;  4RES B;  3RBZ A;  3VTP C;  3SWY A;  2YMY A;  3H1K D;  1KQF B;  1OZH A;  3A0B H;  4HJG H;  1Q7Y Q;  1FZG A;  4AQR D;  3G9R A;  1JY3 N;  1NTZ E;  1YYC A;  3IFM A;  2HPC B;  2Q3E A;  2LXB A;  2N1T D;  3B8E B;  2W27 A;  4R4M A;  2SPZ A;  2ZJS E;  5KKZ C;  2JDI H;  2ZT9 B;  1L0L E;  2RMZ A;  3JC2 2;  5APV A;  1N7S A;  1VQ4 P;  2BAS A;  2M5A A;  1GD2 E;  3SWF A;  2J58 A;  3RK3 E;  1H8A A;  1TU3 F;  1PGO A;  3D6Y A;  3M0A A;  3M91 A;  2WWW A;  3L73 J;  1L2P A;  1IFJ A;  2V7Q H;  4PD4 E;  1YJ9 P;  2QG4 A;  3CCU P;  3WUV A;  4RO0 A;  3P32 A;  2WSC J;  4BWN A;  5L8R J;  2AEJ A;  1LT1 A;  1IFD A;  3N7N A;  2CPB A;  1M1J A;  2KUB A;  3B4S A;  3AEG C;  1GW4 A;  2RN0 A;  4IFF A;  1Q2N A;  2O3J A;  1VL2 A;  5B66 E;  4YTP C;  4MN4 C;  2J5U A;  4GT1 A;  2FYU K;  2ZVN B;  4I1L A;  3CCE P;  5AVT B;  2BEZ F;  2KS1 B;  1ZXG A;  1EZV G;  3L73 G;  3MUD C;  1VQM P;  1KIL B;  1S2E A;  3F5H A;  1VDF A;  4DJG A;  1M7L A;  4UB8 H;  1YIJ P;  4I7Z B;  3CC4 P;  1FZF A;  1VQP P;  1HTL C;  3H25 A;  1Y47 A;  2ITA A;  2Q5U A;  4N78 D;  3F89 A;  5APQ A;  5AVU B;  3HUS C;  2QJY C;  1HF9 A;  3BCC E;  4Y99 B;  1L0N K;  1SFC C;  2GA1 A;  1GK4 A;  1L4A B;  4AUW A;  3M0D C;  3TSI A;  3CX5 H;  2WVR A;  4C7N A;  5KAF E;  3RGU A;  3AEF C;  3G4S P;  1RHZ B;  1VQN P;  1GU5 A;  3A3Y B;  1CZQ A;  3L74 E;  3NFQ A;  4K35 A;  4NPF X;  3HD7 C;  2W90 A;  1PZQ A;  3A2A A;  1NU1 E;  2WPV B;  3VP9 A;  1K8A Q;  3TF5 A;  1HUC A;  2AXT E;  3GMA A;  1LP1 A;  1EZV D;  4GOF A;  4W7Y A;  3L73 D;  1J2J B;  2JEE A;  3QWO C;  2A06 G;  4UB6 H;  4LGD E;  2QEX P;  4H44 B;  2KOG A;  4JQ0 D;  1JO5 A;  1JY3 P;  3AE6 C;  3D6Z A;  1VPC A;  5KLV J;  1U7J A;  3HD7 D;  1BE3 J;  2QSI A;  5KLI B;  1FZC C;  1NTK E;  2NPS A;  1DD3 A;  1LJ2 A;  3H1I G;  1KV4 A;  1PFI A;  2OYO A;  3GF3 A;  4UB8 E;  1SQV E;  3MD0 A;  2P58 A;  3E7K A;  1HH0 A;  4YPC A;  3TGU E;  1RE3 A;  1SQQ J;  2H43 A;  1BGY E;  3E1R A;  3BRV B;  3CXH H;  3L70 J;  1OWA A;  3FXD A;  1NWQ A;  1Y8A A;  4L75 A;  3CC7 P;  2HOD B;  4I2L C;  1QL1 A;  1HGV A;  4H0L B;  2A06 D;  5GTI E;  5KLV G;  2LXC B;  3AE5 C;  2YIU C;  3CPW O;  1BE3 G;  1L0L K;  1NAF A;  3PH0 A;  1SQB E;  2R3C A;  2OTK E;  3L71 J;  1MZ9 A;  1PPJ G;  2W8Z A;  1PV3 A;  2Q1K A;  1J1D C;  3HUS A;  1ZRT D;  3L37 A;  3JSV C;  1GL2 C;  1SFC A;  3RK2 C;  2ZYD A;  3USS A;  2QJP C;  1W2E A;  1NTZ J;  1SQQ G;  2R5D A;  2IFM A;  4HH2 A;  1SS1 A;  3L70 G;  2KLU A;  4IL6 E;  2UWJ E;  1KZU B;  2IPP A;  1G2C A;  1FZE A;  3BVH A;  2YNY A;  4HKZ H;  3Q1M A;  1RE4 A;  2HOD A;  1NVO A;  3V2R A;  3P8M C;  2GUS A;  1KYO D;  3HE5 B;  1J1E C;  1GL2 D;  3PHL A;  4ZKP A;  1NHL A;  2YMK A;  1EDL A;  5KLV D;  2HYN A;  2KZJ A;  1OVV A;  1S72 P;  3VMY A;  3CXH E;  1BE3 D;  3AE7 C;  4D6T G;  2JO1 A;  2OAR A;  1KB9 I;  1PPJ D;  3Q5S A;  4HYT B;  1NTZ G;  1RQU A;  1T6A A;  2FYU E;  3B5N B;  3AEA C;  1JCD A;  1IC2 A;  2K3R A;  1Q86 Q;  3V2P A;  1IJD B;  3LW5 H;  1A02 F;  5CJ4 A;  2E42 A;  4ZNC A;  2C9N Y;  1CSB A;  1SQQ D;  1EDK A;  4U3F J;  4GKG A;  2N9B A;  3L70 D;  1JY2 N;  1VQ9 P;  4XFJ A;  2Z4E A;  5AW6 B;  3VMZ A;  1SQX J;  1Q81 Q;  1CW5 A;  2ZXX A;  1N7S C;  3HE5 A;  2Z5H A;  1EZV I;  4W80 A;  1S5L X;  2XNX A;  4EI2 A;  5B5E E;  4WVZ A;  2BCC E;  1JY3 O;  3L71 D;  3D71 A;  3RL0 C;  4ASW A;  2E74 C;  3RK3 C;  4ZMD A;  2YKO A;  2Q6Q A;  4PV1 B;  1QEX A;  4KT0 J;  3L35 A;  3IR9 A;  3B5N A;  1NTZ D;  3H6P A;  4GOE A;  1LTB C;  3BCC J;  4U3F G;  2YKP A;  2KZI A;  3H1K G;  1U57 A;  4DZO A;  1N7S D;  3A0H E;  2RH0 A;  1AQ5 A;  1M1J C;  3NTN A;  2E5T A;  4DT0 A;  1SQX G;  3L74 J;  3V2N A;  3G3Z A;  1GTW A;  1FDO A;  1VQL P;  5GTH H;  3RL0 D;  3VMA A;  1NU1 J;  2E74 D;  2ZT9 C;  3RK3 D;  5AW4 B;  1H0T B;  1RF0 A;  1NTK K;  4YXD C;  1WT6 A;  1FOS F;  3V6I A;  1NTM K;  2OGU A;  4KJM A;  3M06 A;  2KK7 A;  3P8C E;  4TT3 H;  2D2C B;  2MKV A;  1IZN B;  2WMM A;  4JYB A;  1YBK A;  2A45 G;  2C0W A;  4PD4 D;  5E79 E;  3BAT A;  2E5Y A;  1Y9B A;  1X8Y A;  3ITK A;  1JTH B;  3S9O A;  1MV8 A;  1DH3 A;  3WU2 E;  3PJS K;  2ZT9 D;  5BU8 B;  1P84 E;  3L74 G;  4U3F D;  2WT7 B;  1S1C X;  1S5L E;  2WQY C;  2O01 J;  1SQV J;  1NU1 G;  3MTU E;  2P7J A;  3SFD C;  1SQB K;  1SQX D;  1USD A;  4H13 C;  3TGU J;  1H0T A;  2OTJ P;  2FBW C;  1PGP A;  5H2F E;  4B86 A;  3AEE C;  1IFM A;  5CCH A;  1LT9 B;  1KYO I;  4WBA A;  1YTZ I;  1MKM A;  2K88 A;  1QVG O;  4C46 A;  1ZW0 A;  1A02 J;  1RF1 A;  1HBW A;  1JTH A;  1NKZ B;  4NPE A;  2AEM A;  2P2U A;  2R5B A;  1YJW P;  3AEB C;  1LTT C;  4H13 D;  5APX A;  5C39 A;  1IFI A;  2LR2 A;  2WT7 A;  4Y99 C;  3L74 D;  3SWK A;  1X0T A;  4IOI H;  1G1J A;  2NPS C;  2E76 C;  3CL3 D;  2KSJ A;  2JR8 A;  3CME P;  2HPC A;  1NU1 D;  1NYH A;  1AVO A;  2Q3I A;  2IBZ E;  1QLE D;  1PP9 E;  1LT9 A;  2Y0C A;  1RE3 C;  4Z1M H;  1JMM A;  2WSF H;  2HG5 D;  3A0B E;  4L73 A;  1GZL A;  2XU6 A;  1BSN A;  1OW8 A;  1W5C E;  2ZXE B;  3H32 B;  4H44 C;  2NPS D;  2E76 D;  3C1L A;  1JCC A;  3L36 A;  2KI7 B;  2E75 C;  1Q90 D;  1KB9 D;  1BDC A;  1LNQ A;  2FYU J;  1SQV D;  1N73 B;  4IFD K;  3LID A;  3O6Q B;  1ZR4 A;  1IFN A;  1NO4 A;  1S9K D;  3TGU D;  4OH8 B;  1DEB A;  2IDB A;  3H1H E;  1KTM A;  5AVS B;  2W6A A;  1LTS C;  3U1A A;  1JMB A;  4H44 D;  1AQT A;  3MZW B;  1OXZ A;  1LTI C;  1YTZ T;  3BRT B;  2B87 B;  2KS1 A;  2E75 D;  2XND H;  1MUU A;  3KHU A;  1D7M A;  1KIL E;  3FXE A;  1RE4 C;  3H1J J;  5KJ7 A;  1SQP K;  1KIL A;  2C9L Y;  4PD4 I;  1L0N J;  3Q3D A;  2M0B A;  1Z56 A;  1SFC D;  1ZR2 A;  2FYU G;  2FY8 A;  5TJH A;  1QX8 A;  1FJP A;  1ZN5 A;  5M1B A;  3NMD A;  4O9B A;  1N73 A;  1M90 Q;  5AW5 B;  1S3J A;  3O6Q A;  3AE2 C;  2WSC H;  1GMJ A;  3IF4 A;  1L4A A;  3CWB J;  3C8V A;  2H88 C;  1URQ B;  1EDJ A;  1NTM E;  3PP5 A;  4ASV A;  4RJT A;  5CMZ A;  1X9V A;  2K37 A;  3EQ2 A;  3VP8 A;  2QJY B;  1BCC E;  3H1J G;  2B87 A;  3WUU A;  1L0N G;  3OW2 O;  2WPS A;  1N2D C;  1ZOY C;  3TNU B;  3PLN A;  3CX5 E;  3KDP B;  5APT A;  1YQ3 C;  4JBZ A;  1AVY A;  2IZ0 A;  2MJZ A;  2QM7 A;  2A45 I;  1XTG B;  4OWF A;  2Y0D A;  3GLM A;  2WSE J;  5K5G B;  2FYU D;  1YI2 P;  1VQ7 P;  4RKU J;  4I6M C;  3L75 J;  1JY2 O;  3CWB G;  5AVW B;  5DJT B;  2O1J A;  1T2K C;  2WPQ A;  3B5N C;  4OVN F;  1LTG C;  1G1I A;  1URQ A;  5AW7 B;  2N9Y B;  4UB6 E;  1RQV A;  2E43 A;  2L5G B;  5AW9 B;  5TIS H;  1KQS O;  2PAJ A;  1M1K Q;  5BU5 A;  1KQL A;  3CCQ P;  4K3A A;  2R44 A;  1FZC B;  3H1J D;  1L0L J;  3PTZ A;  3TNU A;  5AW1 B;  1DEE G;  1JB0 J;  1L0N D;  2YO2 A;  2QVA A;  3L4F A;  1RF0 C;  1OVR A;  1T2K D;  3N4X A;  2KLV A;  1FJK A;  3B5N D;  3L75 G;  3L71 G;  3T97 B;  3MHV A;  3RK2 D;  5CBN A;  2H7H A;  3CC2 P;  5CJ0 A;  2FYN B;  1LTA C;  4PV1 C;  4OGQ B;  3H1L E;  2B88 A;  1XTC C;  3CWB D;  3AE1 C;  3RBX A;  4CPG A;  2IYP A;  3LIE A;  1PL5 A;  4WB4 A;  2P67 A;  2P10 A;  2YIU B;  4KHX A;  3GW6 A;  2GM4 A;  1OIP A;  4U7J A;  4WWI A;  1L0L G;  1N86 A;  2A06 E;  2ZYA A;  3CX5 I;  1J1D B;  4HB1 A;  3O8Z A;  3P8C D;  2NZ2 A;  1GL2 B;  3V5B A;  1PP9 J;  1K04 A;  4W7Z A;  2B9B A;  2QJP B;  5APS A;  1VF5 B;  2I1K A;  4PV1 D;  3CCM P;  3GHG B;  3KYQ A;  5CCH C;  4GDO A;  4N6J A;  3S1K A;  5AW8 B;  3T97 A;  1YJN P;  1LGH B;  3H1I E;  3L75 D;  3A7O A;  1NJI Q;  2K9J B;  1GW3 A;  3L72 E;  2B89 A;  2R32 A;  3FWL A;  3U1C A;  1OVU A;  1E79 H;  1RF1 C;  1P84 D;  1M8O B;  5AW2 B;  5CCG A;  1J1E B;  3WMM 0;  1KD1 Q;  2Q7C A;  2PRR A;  4WY4 B;  1H89 A;  1MFT A;  3KQG A;  1SP4 A;  3ZDM A;  3SSU A;  5CCH D;  1IFP A;  4NPD A;  3U59 A;  1VQK P;  1L0L D;  1SQP E;  2V7Q J;  1JEK A;  3H1H J;  1LWU B;  3UIA A;  3I55 P;  1UIX A;  2FYZ A;  1BE3 E;  3GHG A;  1UII A;  3M9H A;  3JCU H;  5CHX A;  1LT9 C;  2OYH B;  2L91 A;  3CCJ P;  3CXH I;  2JWD A;  2K9J A;  4C7R A;  2I8D A;  1N8R Q;  1S4X A;  3BCC G;  5APY A;  1FZB A;  5KTB A;  2C0X A;  4WY4 A;  5AVV B;  4R4L A;  2RKL A;  2W83 C;  3D70 A;  3H1H G;  1DX7 A;  1NTK J;  3RL0 B;  1WRG A;  2ZFC A;  1NGM B;  1NTM J;  2Y9Y A;  2NRG A;  3OA7 A;  1ZME C;  4EOT A;  1LWU A;  1PP9 D;  2GUV A;  5AVR B;  5B66 H;  1BCC J;  1IO4 A;  4JYC A;  2OYH A;  4D6T E;  1FAV A;  2FXO A;  1BGY J;  1M1J B;  1LTJ B;  2JJL A;  2M8R A;  2XV5 A;  2I1J A;  5KJ7 C;  1KIL C;  2W6B A;  4GOD A;  5GTH E;  2IFN A;  1JNM A;  3JCU E;  1HVV A;  1FBM A;  4I7Z C;  1NTK G;  1GU4 A;  3AE8 C;  1SQB J;  2A45 H;  2QA4 P;  3BCC D;  3CCR P;  2OYI B;  1NTM G;  2H8P D;  4PJ0 H;  2KIK A;  4BRY B;  3QH9 A;  2OTL P;  3K5B A;  1R5S A;  1SQV G;  2LKM A;  3MP7 B;  1N73 C;  2N1T B;  3BAS A;  1JY2 P;  3H1H D;  1OMI A;  1L4A C;  3TGU G;  1BCC G;  4EYY Q;  5KAF H;  2PFX A;  4TLF A;  1H88 A;  3IAO A;  1BSH A;  1BGY G;  1KOR A;  2QJK B;  2FFD B;  5KJ7 D;  1KIL D;  3V4W A;  1LTJ A;  2AXT H;  1ZV8 A;  1VQ8 P;  5APU A;  2O1K A;  3VMX A;  1JOC A;  3MIW A;  4C7N B;  3CI9 A;  4U3F E;  1U7M A;  1GDT A;  3H1K E;  3VN0 A;  4H13 B;  1SQB G;  1USE A;  3AEC C;  2AEF A;  1M57 D;  1KC8 Q;  4EDF A;  1L4A D;  5KKZ B;  2OYI A;  2YO3 A; 
#chains in the Genus database with same CATH homology
 1D7M A;  2FXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...