2FXOA

Structure of the human beta-myosin s2 fragment
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
129
structure length
129
Chain Sequence
GSSPLLKSAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMNKRLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Contractile protein
molecule keywords Myosin heavy chain, cardiac muscle beta isoform
publication title Crystal structures of human cardiac {beta}-myosin II S2-{Delta} provide insight into the functional role of the S2 subfragment
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 129
sequence length 129
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1050 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Coiled-coil dimerization domain from cortexillin I 2fxoA00
2FXOA 1D7MA
chains in the Genus database with same CATH superfamily
1VQNP 1SQQD 1VQ5P 2YKPA 2IYPA 5KLVE 1JOCA 2O1JA 4UB8E 2YKQA 2YXRB 2G3AA 1Q82Q 1S5LH 3PHLA 5KLVG 3AE7C 4C7NB 1DIPA 1L4AC 2PRRA 1KFMA 2OYHC 2P67A 1URQB 3I55P 1BDCA 2NPSA 3AE6C 2E75D 1KYOD 1RH5B 1J1EC 3Q3DA 3RK3C 4WVZA 1NYHA 4WY4B 3JC22 3WU2H 1P84I 2WT7A 2QEXP 1BDDA 1NU1K 2WVRA 1NAYA 2Q5UA 4PD4D 1FZFA 1DD4A 2ZAEB 3RL0D 1KB9H 2O01H 5APWA 5AW2B 5CCHD 2IYOA 3TSIA 3BCCD 2M0BA 1SQQJ 4NPFX 2AXTH 1QVGO 5GTIE 1RY3A 4C7NA 4H0LD 2KOGA 2OYIB 3HE4B 1HUCA 3U1CA 1MV8A 1ZW0A 2AXCA 2XDJA 2Z5IA 1URQA 1ZP0C 2WITA 2E74D 4I7ZB 3QWOC 2XNXA 2FXOA 4TT3H 5B66E 2N1TC 5KAFE 2KP8A 4WY4A 2L5GB 1DEBA 4OGQB 2KUBA 5KJ7A 3P32A 4U3FE 3HTKA 1Q2NA 2A06E 1N73B 1Y47A 4U3FG 1GL2C 3H1LG 2A06G 3L72E 2WPQA 3CXHE 4H13B 1X9VA 3B5NC 3L72G 2FYUD 2ZYDA 5APYA 4KHXA 1T3JA 3OW2O 1JMMA 3L35A 1NTZK 2QJPC 1KILA 1DX7A 5EFWB 4PV1B 1FS0E 1Q86Q 2JWAA 3A2AA 1S2EA 1LT9B 1PP9E 2W83C 4L76A 2R32A 3RK2C 3M9QA 1PP9G 5C39A 4CPGA 2Z5HA 1U57A 1JMBA 5L8RJ 3H1JD 2B89A 3W68A 1H89A 5GTHH 2D2CD 1GD2E 1N73A 1NKNA 1FZCB 1S72P 2FYUK 3FWNA 1VQ8P 3CWBJ 3CI9A 1USDA 4DT0A 1FZEA 4W7ZA 2WSCH 4DZOA 1T2KD 2KI7B 1KILE 2BASA 3CCUP 4HYTB 2WSFH 1PFIA 1K05A 1HBWA 1IJDB 4RO0A 3G6EP 3OJAB 4HJGH 1YQ4C 2O01N 1M1JB 4JBZA 1NTKE 2XNDH 5DJUB 1OIPA 3LIDA 2Y9YA 1U7JA 2E75C 1E5WA 1NTKG 2JWDA 3HD7B 1SFCD 3CC4P 2IPPA 2OTLP 2ZYAA 1EDLA 3H1JJ 1ZRTD 1RE3C 3H1ID 1RF1B 1N7SD 3RL0C 1LTIC 2Q1KA 1SQPK 1KYOI 5CCHC 1SP4A 4GOFA 1ZXGA 1FOSE 2IX7C 3SWYA 3WU2E 3E1RA 1Q90D 2ZT9C 1GU4A 1KN7A 1AVYA 1JO5A 3PRJA 2O3JA 3L75E 2E74C 3T97A 1M7LA 1KB9E 4W80A 3L75G 3V6IA 3IN6A 3U1AA 2KXPB 5H2FE 2V4HA 2BCCD 2AXTE 1QL2A 2QJKB 3N4XA 5AW1B 1S9KE 1JNMA 3L70J 5TISH 3MIWA 1RF1A 1HWTC 1FBMA 2A45G 3AEDC 3M9HA 1YQ3C 3KZIH 1BCCE 3H1IJ 2P7JA 2GM4A 2AEJA 1JY3N 1OWAA 3BRVB 2WZ7A 2Q3EA 5KLVD 1BCCG 2C0WA 2WPVB 2HFED 2M8RA 4WB4A 1LTTC 4IL6E 1GDTA 5APSA 4H44B 3PJSK 1MFZA 1NH4A 4YXWH 1IFDA 2K9JB 2I8DA 1YJ9P 2BEQD 1VF5B 1YITP 3B8EB 3IAOA 4IFMA 4BRYA 1L0LD 3O8ZA 3C8VA 2D2CC 5B5EH 2IBZD 2BCCJ 3AE9C 4RJTA 3SSUA 2POHA 2JKVA 2PP6A 1WT6A 2XU6A 3GW6A 1GW3A 4DJGA 1AV1A 1SQVE 1HF9A 1HJ0A 2LR2A 1GK6A 1SQVG 1QX8A 1T2KC 1K9MQ 2YO3A 3IFMA 1VQ9P 1L4AB 5KLVJ 3TF5A 2OYHB 2YIUC 1FJPA 3FWLA 5CMZA 1OVRA 1SQXE 3VTPC 2B87B 3A7OA 3D71A 1J1EB 3RK3B 1L0LK 1SQXG 3CCLP 3USSA 1SFCC 5APQA 1EDJA 1FDMA 1OW6A 3VP8A 1NTME 2QVAA 3EFGA 2JP3A 1AQ5A 2QSIA 2MJZA 2ZXXA 1NTMG 1NO4A 3Q5SA 4IFDK 1YTZI 3PLNA 1BGYE 3MHVA 3H1KE 3CXHD 3KQGA 2GUSA 2K9YA 1OMIA 3C1LA 2ZFCA 1BGYG 5CJ0A 3H1KG 3S4RA 1OVUA 4EOTA 1NHLA 2MKVA 3CX5E 2IZ0A 4IL6X 4PJ0H 1Y8AA 2NPSB 3FXDA 1BE3E 2OYHA 2JR8A 4W7YA 3A3YB 1BE3G 3ITKA 2WT7B 3RL0g 2FYNC 3MGNA 2N1TB 1FDOA 3VYIA 1JCCA 1CI6A 2QJYC 3AEEC 1FDIA 1X79B 1D7MA 3MUDC 3AE1C 5KKZC 3IF4A 4D6TG 1KYOH 1JCDA 1GL2B 2KSJA 4LGDE 1Q81Q 3V5BA 1L0NE 1PPJE 1IZNB 3MP7B 1JB0J 3B5NB 2FFDC 1L0NG 2P1JA 2CK3H 1PPJG 3L72J 3CPWO 1S3JA 3A0BE 5E79E 1P84E 2FXMA 2QJPB 1QLED 1RE4C 2FBWC 3L74E 3QH9A 1DH3A 1EZVI 3RK2B 3EQ2A 3L74G 5KLIC 2W6BA 1J1DC 3RK3E 1JY2O 3HTKB 2N1TA 1SQQK 3W67A 1EXIA 5APVA 2YMYA 2PAJA 5APXA 3KZIE 2LXCB 4OGQD 2WTYA 3P8MC 2ZVOB 3M06A 2KLUA 3HE5A 2NZ2A 3CD6P 1UIXA 3L36A 2R5BA 1GL2A 3C9IA 1QGKB 4LLHA 1AA0A 4H13D 2W90A 3L73G 3NXSA 1KILB 3B5NA 4HKZH 1Z56A 4L75A 5AVRB 2YKOA 3D70A 1KQFB 3AE8C 1FU1A 2I1KA 1K04A 3AEFC 3AE3C 3BRTB 3F89A 4PV1D 4EYYQ 3H1HE 4YPCA 3LIEA 1H0TA 2KZIA 3H1HG 5B5EE 1NGMB 5AVXB 3LW5J 3L75D 3WUVA 3WMM0 2KSEA 3H1LE 1NTKJ 2RH0A 1X8YA 3P8CE 1KB9D 3GF7A 3D6ZA 3A0HH 3CCVP 3CWBD 2YO2A 1K73Q 5CCGC 3GMAA 1SQBD 1S9KD 1LWUC 4AQRD 1T8ZA 2ZYGA 3M9BA 1W2BO 1N7LA 3L37A 2XV5A 5BVZA 2QG4A 3ABVC 2ITAA 3GHGC 2HG5D 2QA4P 2ZT9B 3AECC 1ZLLA 3SFDC 2QM7A 5TJHA 1JUNA 1CW5A 5AVYB 4BWNA 2Q7CA 3HD7D 3ZDMA 1SQBK 3L75J 1LJ2A 1HH0A 3VOPA 2O01J 1RE3A 3BATA 1NU1E 2E42A 2B88A 1N2DC 1VQMP 4WWIA 1SQBJ 1NU1G 2DW3A 2LKMA 5CCHA 2OGUA 4AUWA 5DJTB 1SQVD 4DCKA 3PTZA 1E79H 4QMAA 1KV4A 2RMZA 1IK7A 4GDOA 2OYIC 3O6QA 1G1JA 2NRGA 4R4MA 3T97B 3II6A 1LTJC 3CC7P 1KYOE 2QE7H 1VQKP 1UIIA 3L70D 4I1LA 2GA1A 1RQUA 2OARA 1JTHB 2KZJA 1S5LE 2Y0CA 1JM0A 5CBOA 2D2CB 1FOSF 4C46A 3WUTA 1NTMD 1ZV8A 1NKZB 1FZGA 2VRSA 1X22A 1MUUA 1KZUB 3L71E 3N7NA 3BCCE 4H13C 2N9YB 3H1KD 3L71G 5AVSB 2Y0DA 3BCCG 4PD4I 4H0LC 1SQVJ 1YYCA 1QVFO 1VL2A 1GK4A 3E7KA 4ZMDA 1AJYA 3V4QA 2M3BA 2AEFA 2HR3A 2YIUB 3CX5D 5KTBA 2C9LY 1NTZE 4M3LA 5AW0B 4H44D 3TNUB 1LT9C 4UB8H 4Y28J 1NTZG 2KYVA 1R5SA 4BRYB 4N78D 2V7QH 2H7HA 1SFCB 1NTMK 1SQXJ 1JTHA 2HPCB 2I1JA 3OAKA 1GMJA 2SPZA 3GF3A 1YBKA 2OTKE 1W2EA 5AW5B 1ZR4A 3FXEA 3GG2A 3G3ZA 1NTMJ 1LTBC 1AVOA 2WSCJ 1L0ND 5AW9B 1PPJD 2E76D 1IFMA 2FYUE 2WSFJ 3IR9A 2CPBA 4NPEA 2FYUG 1BGYJ 3H1KJ 1OXZA 1P84D 3TGUE 2L91A 1L4AD 2R44A 1PGOA 3HUSC 4I6MC 1VQPP 3L74D 1R8EA 3TGUG 1FZBA 1R5LA 5AW3B 3G9RA 2KNCB 1M1JC 3TNUA 1NJIQ 1KQGB 1BE3J 1DD3A 4N6JA 2IZ1A 5GTIH 1MZ9A 3RK3D 1OFCX 3HD7C 3V2NA 4ASVA 2QJYB 1W5CE 1SFCA 1S5LX 3GLMA 2WSEH 2HPCA 5K5GB 1L2PA 3VMZA 1N86A 1VDFA 1PGPA 3FGAD 5KKZB 2W8ZA 3RGUA 5KLVK 2PGDA 4TLFA 5B66H 5KAFH 4IOIH 2FFDB 3MD0A 3Q5PA 2YNYA 1KORA 1VQOP 4RESB 4MN4C 1SQPE 2PFXA 1L0NJ 1FE6A 1HVVA 2M3EA 1SQPG 5GTHE 1S1CX 5CJ4A 2NPSD 3CXHH 4GIFA 5KLIB 1H88A 2KNCA 1CI6B 3L74J 2WSSH 2Z4EA 4U3FD 3H1LD 1FZAA 3F5HA 2A06D 3V4WA 1KTMA 3MUDA 1N7SC 1ZRTE 3P7KA 3L72D 1QL1A 2W6AA 3H1IG 1VQ4P 3G4SP 4Y99C 2Q6QA 2FFDA 1HGZA 3M0DC 1AFOA 4ZKPA 1LT1A 2C0XA 1WMKA 1PP9D 1RE4A 1URQD 3VMYA 2R5DA 1EXJA 3RBZA 3RK2D 4H44C 2FXPA 3D6YA 5AVZB 1YHQP 3S9OA 1KMIZ 3Q2YA 3JCUH 4WY4D 1OW7A 3KHUA 3H1HJ 4OVNF 4B86A 2ZVNB 3TK1A 4D6TE 5KJ7D 3HE5B 2BCCE 2J58A 2H89C 1RF0C 2Q9IA 1T6AA 4U3FJ 2BCCG 3H1LJ 2P2UA 4XE5B 1EZVE 1LWUB 1NU1D 1KQSO 5AVQB 2YXQB 1Y9BA 5AVWB 1EZVG 1U7MA 4PD4H 2FKWB 4RKUJ 5AW6B 2E76C 1KILD 3JSVC 2N9BA 4UB6H 4GKGA 1IO4A 3A5TA 2E5TA 3GHGB 3VN0A 2B9BA 3S1KA 1H0TB 4K35A 5KAIH 1HJBA 4ZNCA 1ZN5A 1NTKD 1MKMA 5TISE 1PP9J 2JO1A 3CL3D 5M1BA 2ZXEB 1VQ6P 1A02J 2R3SA 2WMMA 1L0LE 1PL5A 2KIKA 5CCGA 3L73E 1S4XA 2IBZE 2JDIH 4XFJA 1KC8Q 1L0LG 3CMAP 2IDBA 4GT1A 3H32B 2IBZG 1LWUA 1BSHA 1KD1Q 3L71D 4A7PA 5H2FH 1NU1J 1AQTA 3CCEP 2IBZI 3VMAA 1IFIA 1IFJA 1NTKK 4JQ0D 3L4FA 2A45H 3GHGA 4NPDA 2RN0A 5BU5A 3CMEP 1QEXA 2NPSC 2E75B 2ZT9D 1PIXA 3KPEA 1NTZD 1LTJB 4EI2A 1M56D 1SVFA 3V2QA 1NAFA 3K5BA 3CCJP 3TYYA 4ZKUA 1IC2A 1WRGA 4YTPC 4IL6H 4C7RA 1JY3O 1X0TA 3RL0B 2KLVA 3R2PA 4IFFA 3CC2P 5CBNA 2AEMA 2C9NY 3H32A 1BCCD 1BSNA 4K3AA 2FYZA 1Q7YQ 2FY8A 1HTLC 3SFEC 2M5AB 1A02F 4H0LB 3L71J 3O6QB 5CHXA 1LP1B 1HGVA 1EDIA 3BCCJ 2XKMA 4DOJA 3KYQA 3TGUD 1VPCA 1M8OB 3CXHI 1JY2P 1URQC 2OYIA 3HE4A 2E74B 4OWFA 1CZQA 4OH8B 1LTJA 5AVVB 3EFFK 4WY4C 4LC1A 2GUVA 3I5CA 1NTZJ 1XTCC 2KS1B 5KJ7C 2LXBA 2HYNA 3WUUA 2W6JH 2UWJE 1SQQE 3BASA 4PJ0E 1M1KQ 1JEKA 1SQQG 1NWQA 4JPZB 1GZLA 1BCCJ 1KILC 1KFNA 3RBXA 2O1KA 2M5AA 3JCUE 2OTJP 1SQPD 1GW4A 1LP1A 2FYUJ 3HUSB 3H25A 3I56P 3AEAC 1LTGC 1LTAC 2KB7P 3OA7A 1SQXD 2YMKA 3PH0A 1YTZT 4JYBA 4L73A 1KQLA 4I7ZC 4YXDC 1LT9A 4KT0J 3TGUJ 1NVOA 2HLOA 3KXDA 3Q5RA 4OGQC 1TU3F 2KS1A 3CX5H 2K1AA 4PD4E 3PP5A 1N73C 1JY2N 2W27A 1SQVK 1JY3P 4UB6E 4Z1MH 5AVTB 2P58A 1BGYD 5APTA 5KAIE 1FZCA 1J2JB 1T3UA 2Y0EA 1VQ7P 1OW8A 2JEEA 1PGJA 1SQXK 2P10A 4PV1C 2WQYC 1BE3D 2OQQA 1CSBA 2OYOA 3AE5C 3AE2C 4EDFA 3FX0A 1SQPJ 1FJKA 3HUSA 4HB1A 1ZMEC 1RHZB 2WPSA 5AW7B 1M1JA 1VF5D 1GTWA 1ZOYC 3EWKA 2CPSA 3A0BH 1NOHA 5E79H 1P84H 2R3CA 3V2PA 3HD7A 4D6TD 1M90Q 3CWBE 1DEEG 3MZWB 1FZCC 1N7SB 3CWBG 1SQBE 1EDKA 3KDPB 2BEZF 1G1IA 2H88C 4XA4A 4JYCA 1EZVD 1SQBG 2IFNA 1KB9I 1FC2C 4Y99B 1SS1A 1H8AA 5AW4B 3U59A 5AVUB 3A0HE 2A45I 4ASWA 4GODA 2K3RA 2KK7A 3CCMP 2K37A 3NTNA 3CCRP 2FYNB 2Y9ZA 1SLQA 1MFTA 2ZJSE 3E1IA 3H1JE 1K8AQ 3NMDA 1EC5A 2J5UA 3H1JG 1LTSC 1L0NK 5APUA 3R4YA 4D6TJ 1PV3A 1LGHB 2Q3IA 1RF1C 3CCSP 1N7SA 3L73D 2J59M 4JF7A 2IFMA 2E43A 5AW8B 3Q1MA 4GOEA 2E76B 3SWKA 2JJLA 2WPRA 2H43A 1PGQA 1ZR2A 2QIWA 3M0DA 2HODB 3AE4C 3H1HD 3HRNA 1YI2P 4O9BA 3TDKA 1G2CB 1YIJP 1J1DB 3H6PA 3MTUE 3NFQA 2V7QJ 3M91A 2N1TD 1FAVA 3L70E 2K9JA 3P8CD 4HH2A 3SWFA 4R4LA 4EIJA 2QRXA 1OX3A 3BVHA 2QM8A 3AEBC 3L70G 2QJKC 3CCQP 1GL2D 3H1IE 2WWWA 5CCGD 1RF0A 3G71P 3VP9A 3V2RA 4U7JA 1L0LJ 3B5ND 1GU5A 4WBAA 1YJWP 3L73J 4BXLA 1IFPA 1EQ7A 2XZRA 3UIAA 2K88A 3B71A 4N3YB 5BU8B 2HODA 2E5YA 1XTGB 1L4AA 1G2CA 1IK9A 1PZQA 2H8PD 4AYCA 3B4SA 3M0AA 1VQLP 1RQVA 1OVVA 3CLQA 2G8YA 1VF5C 1N8RQ 3VMXA 4N78E 1LNQA 2B87A 1IFNA 4L74A 2WSEJ 3AEGC 3LW5H 3CX5I 1OZHA 2RKLA 1USEA 4I2LC 1YJNP 1M57D 4KJMA
chains in the Genus database with same CATH topology
2FXOA 1D7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FXO A;  1D7M A; 
#chains in the Genus database with same CATH topology
 1VQN P;  1SQQ D;  1VQ5 P;  2YKP A;  2IYP A;  5KLV E;  1JOC A;  2O1J A;  4UB8 E;  2YKQ A;  2YXR B;  2G3A A;  1Q82 Q;  1S5L H;  3PHL A;  5KLV G;  3AE7 C;  4C7N B;  1DIP A;  1L4A C;  2PRR A;  1KFM A;  2OYH C;  2P67 A;  1URQ B;  3I55 P;  1BDC A;  2NPS A;  3AE6 C;  2E75 D;  1KYO D;  1RH5 B;  1J1E C;  3Q3D A;  3RK3 C;  4WVZ A;  1NYH A;  4WY4 B;  3JC2 2;  3WU2 H;  1P84 I;  2WT7 A;  2QEX P;  1BDD A;  1NU1 K;  2WVR A;  1NAY A;  2Q5U A;  4PD4 D;  1FZF A;  1DD4 A;  2ZAE B;  3RL0 D;  1KB9 H;  2O01 H;  5APW A;  5AW2 B;  5CCH D;  2IYO A;  3TSI A;  3BCC D;  2M0B A;  1SQQ J;  4NPF X;  2AXT H;  1QVG O;  5GTI E;  1RY3 A;  4C7N A;  4H0L D;  2KOG A;  2OYI B;  3HE4 B;  1HUC A;  3U1C A;  1MV8 A;  1ZW0 A;  2AXC A;  2XDJ A;  2Z5I A;  1URQ A;  1ZP0 C;  2WIT A;  2E74 D;  4I7Z B;  3QWO C;  2XNX A;  2FXO A;  4TT3 H;  5B66 E;  2N1T C;  5KAF E;  2KP8 A;  4WY4 A;  2L5G B;  1DEB A;  4OGQ B;  2KUB A;  5KJ7 A;  3P32 A;  4U3F E;  3HTK A;  1Q2N A;  2A06 E;  1N73 B;  1Y47 A;  4U3F G;  1GL2 C;  3H1L G;  2A06 G;  3L72 E;  2WPQ A;  3CXH E;  4H13 B;  1X9V A;  3B5N C;  3L72 G;  2FYU D;  2ZYD A;  5APY A;  4KHX A;  1T3J A;  3OW2 O;  1JMM A;  3L35 A;  1NTZ K;  2QJP C;  1KIL A;  1DX7 A;  5EFW B;  4PV1 B;  1FS0 E;  1Q86 Q;  2JWA A;  3A2A A;  1S2E A;  1LT9 B;  1PP9 E;  2W83 C;  4L76 A;  2R32 A;  3RK2 C;  3M9Q A;  1PP9 G;  5C39 A;  4CPG A;  2Z5H A;  1U57 A;  1JMB A;  5L8R J;  3H1J D;  2B89 A;  3W68 A;  1H89 A;  5GTH H;  2D2C D;  1GD2 E;  1N73 A;  1NKN A;  1FZC B;  1S72 P;  2FYU K;  3FWN A;  1VQ8 P;  3CWB J;  3CI9 A;  1USD A;  4DT0 A;  1FZE A;  4W7Z A;  2WSC H;  4DZO A;  1T2K D;  2KI7 B;  1KIL E;  2BAS A;  3CCU P;  4HYT B;  2WSF H;  1PFI A;  1K05 A;  1HBW A;  1IJD B;  4RO0 A;  3G6E P;  3OJA B;  4HJG H;  1YQ4 C;  2O01 N;  1M1J B;  4JBZ A;  1NTK E;  2XND H;  5DJU B;  1OIP A;  3LID A;  2Y9Y A;  1U7J A;  2E75 C;  1E5W A;  1NTK G;  2JWD A;  3HD7 B;  1SFC D;  3CC4 P;  2IPP A;  2OTL P;  2ZYA A;  1EDL A;  3H1J J;  1ZRT D;  1RE3 C;  3H1I D;  1RF1 B;  1N7S D;  3RL0 C;  1LTI C;  2Q1K A;  1SQP K;  1KYO I;  5CCH C;  1SP4 A;  4GOF A;  1ZXG A;  1FOS E;  2IX7 C;  3SWY A;  3WU2 E;  3E1R A;  1Q90 D;  2ZT9 C;  1GU4 A;  1KN7 A;  1AVY A;  1JO5 A;  3PRJ A;  2O3J A;  3L75 E;  2E74 C;  3T97 A;  1M7L A;  1KB9 E;  4W80 A;  3L75 G;  3V6I A;  3IN6 A;  3U1A A;  2KXP B;  5H2F E;  2V4H A;  2BCC D;  2AXT E;  1QL2 A;  2QJK B;  3N4X A;  5AW1 B;  1S9K E;  1JNM A;  3L70 J;  5TIS H;  3MIW A;  1RF1 A;  1HWT C;  1FBM A;  2A45 G;  3AED C;  3M9H A;  1YQ3 C;  3KZI H;  1BCC E;  3H1I J;  2P7J A;  2GM4 A;  2AEJ A;  1JY3 N;  1OWA A;  3BRV B;  2WZ7 A;  2Q3E A;  5KLV D;  1BCC G;  2C0W A;  2WPV B;  2HFE D;  2M8R A;  4WB4 A;  1LTT C;  4IL6 E;  1GDT A;  5APS A;  4H44 B;  3PJS K;  1MFZ A;  1NH4 A;  4YXW H;  1IFD A;  2K9J B;  2I8D A;  1YJ9 P;  2BEQ D;  1VF5 B;  1YIT P;  3B8E B;  3IAO A;  4IFM A;  4BRY A;  1L0L D;  3O8Z A;  3C8V A;  2D2C C;  5B5E H;  2IBZ D;  2BCC J;  3AE9 C;  4RJT A;  3SSU A;  2POH A;  2JKV A;  2PP6 A;  1WT6 A;  2XU6 A;  3GW6 A;  1GW3 A;  4DJG A;  1AV1 A;  1SQV E;  1HF9 A;  1HJ0 A;  2LR2 A;  1GK6 A;  1SQV G;  1QX8 A;  1T2K C;  1K9M Q;  2YO3 A;  3IFM A;  1VQ9 P;  1L4A B;  5KLV J;  3TF5 A;  2OYH B;  2YIU C;  1FJP A;  3FWL A;  5CMZ A;  1OVR A;  1SQX E;  3VTP C;  2B87 B;  3A7O A;  3D71 A;  1J1E B;  3RK3 B;  1L0L K;  1SQX G;  3CCL P;  3USS A;  1SFC C;  5APQ A;  1EDJ A;  1FDM A;  1OW6 A;  3VP8 A;  1NTM E;  2QVA A;  3EFG A;  2JP3 A;  1AQ5 A;  2QSI A;  2MJZ A;  2ZXX A;  1NTM G;  1NO4 A;  3Q5S A;  4IFD K;  1YTZ I;  3PLN A;  1BGY E;  3MHV A;  3H1K E;  3CXH D;  3KQG A;  2GUS A;  2K9Y A;  1OMI A;  3C1L A;  2ZFC A;  1BGY G;  5CJ0 A;  3H1K G;  3S4R A;  1OVU A;  4EOT A;  1NHL A;  2MKV A;  3CX5 E;  2IZ0 A;  4IL6 X;  4PJ0 H;  1Y8A A;  2NPS B;  3FXD A;  1BE3 E;  2OYH A;  2JR8 A;  4W7Y A;  3A3Y B;  1BE3 G;  3ITK A;  2WT7 B;  3RL0 g;  2FYN C;  3MGN A;  2N1T B;  1FDO A;  3VYI A;  1JCC A;  1CI6 A;  2QJY C;  3AEE C;  1FDI A;  1X79 B;  1D7M A;  3MUD C;  3AE1 C;  5KKZ C;  3IF4 A;  4D6T G;  1KYO H;  1JCD A;  1GL2 B;  2KSJ A;  4LGD E;  1Q81 Q;  3V5B A;  1L0N E;  1PPJ E;  1IZN B;  3MP7 B;  1JB0 J;  3B5N B;  2FFD C;  1L0N G;  2P1J A;  2CK3 H;  1PPJ G;  3L72 J;  3CPW O;  1S3J A;  3A0B E;  5E79 E;  1P84 E;  2FXM A;  2QJP B;  1QLE D;  1RE4 C;  2FBW C;  3L74 E;  3QH9 A;  1DH3 A;  1EZV I;  3RK2 B;  3EQ2 A;  3L74 G;  5KLI C;  2W6B A;  1J1D C;  3RK3 E;  1JY2 O;  3HTK B;  2N1T A;  1SQQ K;  3W67 A;  1EXI A;  5APV A;  2YMY A;  2PAJ A;  5APX A;  3KZI E;  2LXC B;  4OGQ D;  2WTY A;  3P8M C;  2ZVO B;  3M06 A;  2KLU A;  3HE5 A;  2NZ2 A;  3CD6 P;  1UIX A;  3L36 A;  2R5B A;  1GL2 A;  3C9I A;  1QGK B;  4LLH A;  1AA0 A;  4H13 D;  2W90 A;  3L73 G;  3NXS A;  1KIL B;  3B5N A;  4HKZ H;  1Z56 A;  4L75 A;  5AVR B;  2YKO A;  3D70 A;  1KQF B;  3AE8 C;  1FU1 A;  2I1K A;  1K04 A;  3AEF C;  3AE3 C;  3BRT B;  3F89 A;  4PV1 D;  4EYY Q;  3H1H E;  4YPC A;  3LIE A;  1H0T A;  2KZI A;  3H1H G;  5B5E E;  1NGM B;  5AVX B;  3LW5 J;  3L75 D;  3WUV A;  3WMM 0;  2KSE A;  3H1L E;  1NTK J;  2RH0 A;  1X8Y A;  3P8C E;  1KB9 D;  3GF7 A;  3D6Z A;  3A0H H;  3CCV P;  3CWB D;  2YO2 A;  1K73 Q;  5CCG C;  3GMA A;  1SQB D;  1S9K D;  1LWU C;  4AQR D;  1T8Z A;  2ZYG A;  3M9B A;  1W2B O;  1N7L A;  3L37 A;  2XV5 A;  5BVZ A;  2QG4 A;  3ABV C;  2ITA A;  3GHG C;  2HG5 D;  2QA4 P;  2ZT9 B;  3AEC C;  1ZLL A;  3SFD C;  2QM7 A;  5TJH A;  1JUN A;  1CW5 A;  5AVY B;  4BWN A;  2Q7C A;  3HD7 D;  3ZDM A;  1SQB K;  3L75 J;  1LJ2 A;  1HH0 A;  3VOP A;  2O01 J;  1RE3 A;  3BAT A;  1NU1 E;  2E42 A;  2B88 A;  1N2D C;  1VQM P;  4WWI A;  1SQB J;  1NU1 G;  2DW3 A;  2LKM A;  5CCH A;  2OGU A;  4AUW A;  5DJT B;  1SQV D;  4DCK A;  3PTZ A;  1E79 H;  4QMA A;  1KV4 A;  2RMZ A;  1IK7 A;  4GDO A;  2OYI C;  3O6Q A;  1G1J A;  2NRG A;  4R4M A;  3T97 B;  3II6 A;  1LTJ C;  3CC7 P;  1KYO E;  2QE7 H;  1VQK P;  1UII A;  3L70 D;  4I1L A;  2GA1 A;  1RQU A;  2OAR A;  1JTH B;  2KZJ A;  1S5L E;  2Y0C A;  1JM0 A;  5CBO A;  2D2C B;  1FOS F;  4C46 A;  3WUT A;  1NTM D;  1ZV8 A;  1NKZ B;  1FZG A;  2VRS A;  1X22 A;  1MUU A;  1KZU B;  3L71 E;  3N7N A;  3BCC E;  4H13 C;  2N9Y B;  3H1K D;  3L71 G;  5AVS B;  2Y0D A;  3BCC G;  4PD4 I;  4H0L C;  1SQV J;  1YYC A;  1QVF O;  1VL2 A;  1GK4 A;  3E7K A;  4ZMD A;  1AJY A;  3V4Q A;  2M3B A;  2AEF A;  2HR3 A;  2YIU B;  3CX5 D;  5KTB A;  2C9L Y;  1NTZ E;  4M3L A;  5AW0 B;  4H44 D;  3TNU B;  1LT9 C;  4UB8 H;  4Y28 J;  1NTZ G;  2KYV A;  1R5S A;  4BRY B;  4N78 D;  2V7Q H;  2H7H A;  1SFC B;  1NTM K;  1SQX J;  1JTH A;  2HPC B;  2I1J A;  3OAK A;  1GMJ A;  2SPZ A;  3GF3 A;  1YBK A;  2OTK E;  1W2E A;  5AW5 B;  1ZR4 A;  3FXE A;  3GG2 A;  3G3Z A;  1NTM J;  1LTB C;  1AVO A;  2WSC J;  1L0N D;  5AW9 B;  1PPJ D;  2E76 D;  1IFM A;  2FYU E;  2WSF J;  3IR9 A;  2CPB A;  4NPE A;  2FYU G;  1BGY J;  3H1K J;  1OXZ A;  1P84 D;  3TGU E;  2L91 A;  1L4A D;  2R44 A;  1PGO A;  3HUS C;  4I6M C;  1VQP P;  3L74 D;  1R8E A;  3TGU G;  1FZB A;  1R5L A;  5AW3 B;  3G9R A;  2KNC B;  1M1J C;  3TNU A;  1NJI Q;  1KQG B;  1BE3 J;  1DD3 A;  4N6J A;  2IZ1 A;  5GTI H;  1MZ9 A;  3RK3 D;  1OFC X;  3HD7 C;  3V2N A;  4ASV A;  2QJY B;  1W5C E;  1SFC A;  1S5L X;  3GLM A;  2WSE H;  2HPC A;  5K5G B;  1L2P A;  3VMZ A;  1N86 A;  1VDF A;  1PGP A;  3FGA D;  5KKZ B;  2W8Z A;  3RGU A;  5KLV K;  2PGD A;  4TLF A;  5B66 H;  5KAF H;  4IOI H;  2FFD B;  3MD0 A;  3Q5P A;  2YNY A;  1KOR A;  1VQO P;  4RES B;  4MN4 C;  1SQP E;  2PFX A;  1L0N J;  1FE6 A;  1HVV A;  2M3E A;  1SQP G;  5GTH E;  1S1C X;  5CJ4 A;  2NPS D;  3CXH H;  4GIF A;  5KLI B;  1H88 A;  2KNC A;  1CI6 B;  3L74 J;  2WSS H;  2Z4E A;  4U3F D;  3H1L D;  1FZA A;  3F5H A;  2A06 D;  3V4W A;  1KTM A;  3MUD A;  1N7S C;  1ZRT E;  3P7K A;  3L72 D;  1QL1 A;  2W6A A;  3H1I G;  1VQ4 P;  3G4S P;  4Y99 C;  2Q6Q A;  2FFD A;  1HGZ A;  3M0D C;  1AFO A;  4ZKP A;  1LT1 A;  2C0X A;  1WMK A;  1PP9 D;  1RE4 A;  1URQ D;  3VMY A;  2R5D A;  1EXJ A;  3RBZ A;  3RK2 D;  4H44 C;  2FXP A;  3D6Y A;  5AVZ B;  1YHQ P;  3S9O A;  1KMI Z;  3Q2Y A;  3JCU H;  4WY4 D;  1OW7 A;  3KHU A;  3H1H J;  4OVN F;  4B86 A;  2ZVN B;  3TK1 A;  4D6T E;  5KJ7 D;  3HE5 B;  2BCC E;  2J58 A;  2H89 C;  1RF0 C;  2Q9I A;  1T6A A;  4U3F J;  2BCC G;  3H1L J;  2P2U A;  4XE5 B;  1EZV E;  1LWU B;  1NU1 D;  1KQS O;  5AVQ B;  2YXQ B;  1Y9B A;  5AVW B;  1EZV G;  1U7M A;  4PD4 H;  2FKW B;  4RKU J;  5AW6 B;  2E76 C;  1KIL D;  3JSV C;  2N9B A;  4UB6 H;  4GKG A;  1IO4 A;  3A5T A;  2E5T A;  3GHG B;  3VN0 A;  2B9B A;  3S1K A;  1H0T B;  4K35 A;  5KAI H;  1HJB A;  4ZNC A;  1ZN5 A;  1NTK D;  1MKM A;  5TIS E;  1PP9 J;  2JO1 A;  3CL3 D;  5M1B A;  2ZXE B;  1VQ6 P;  1A02 J;  2R3S A;  2WMM A;  1L0L E;  1PL5 A;  2KIK A;  5CCG A;  3L73 E;  1S4X A;  2IBZ E;  2JDI H;  4XFJ A;  1KC8 Q;  1L0L G;  3CMA P;  2IDB A;  4GT1 A;  3H32 B;  2IBZ G;  1LWU A;  1BSH A;  1KD1 Q;  3L71 D;  4A7P A;  5H2F H;  1NU1 J;  1AQT A;  3CCE P;  2IBZ I;  3VMA A;  1IFI A;  1IFJ A;  1NTK K;  4JQ0 D;  3L4F A;  2A45 H;  3GHG A;  4NPD A;  2RN0 A;  5BU5 A;  3CME P;  1QEX A;  2NPS C;  2E75 B;  2ZT9 D;  1PIX A;  3KPE A;  1NTZ D;  1LTJ B;  4EI2 A;  1M56 D;  1SVF A;  3V2Q A;  1NAF A;  3K5B A;  3CCJ P;  3TYY A;  4ZKU A;  1IC2 A;  1WRG A;  4YTP C;  4IL6 H;  4C7R A;  1JY3 O;  1X0T A;  3RL0 B;  2KLV A;  3R2P A;  4IFF A;  3CC2 P;  5CBN A;  2AEM A;  2C9N Y;  3H32 A;  1BCC D;  1BSN A;  4K3A A;  2FYZ A;  1Q7Y Q;  2FY8 A;  1HTL C;  3SFE C;  2M5A B;  1A02 F;  4H0L B;  3L71 J;  3O6Q B;  5CHX A;  1LP1 B;  1HGV A;  1EDI A;  3BCC J;  2XKM A;  4DOJ A;  3KYQ A;  3TGU D;  1VPC A;  1M8O B;  3CXH I;  1JY2 P;  1URQ C;  2OYI A;  3HE4 A;  2E74 B;  4OWF A;  1CZQ A;  4OH8 B;  1LTJ A;  5AVV B;  3EFF K;  4WY4 C;  4LC1 A;  2GUV A;  3I5C A;  1NTZ J;  1XTC C;  2KS1 B;  5KJ7 C;  2LXB A;  2HYN A;  3WUU A;  2W6J H;  2UWJ E;  1SQQ E;  3BAS A;  4PJ0 E;  1M1K Q;  1JEK A;  1SQQ G;  1NWQ A;  4JPZ B;  1GZL A;  1BCC J;  1KIL C;  1KFN A;  3RBX A;  2O1K A;  2M5A A;  3JCU E;  2OTJ P;  1SQP D;  1GW4 A;  1LP1 A;  2FYU J;  3HUS B;  3H25 A;  3I56 P;  3AEA C;  1LTG C;  1LTA C;  2KB7 P;  3OA7 A;  1SQX D;  2YMK A;  3PH0 A;  1YTZ T;  4JYB A;  4L73 A;  1KQL A;  4I7Z C;  4YXD C;  1LT9 A;  4KT0 J;  3TGU J;  1NVO A;  2HLO A;  3KXD A;  3Q5R A;  4OGQ C;  1TU3 F;  2KS1 A;  3CX5 H;  2K1A A;  4PD4 E;  3PP5 A;  1N73 C;  1JY2 N;  2W27 A;  1SQV K;  1JY3 P;  4UB6 E;  4Z1M H;  5AVT B;  2P58 A;  1BGY D;  5APT A;  5KAI E;  1FZC A;  1J2J B;  1T3U A;  2Y0E A;  1VQ7 P;  1OW8 A;  2JEE A;  1PGJ A;  1SQX K;  2P10 A;  4PV1 C;  2WQY C;  1BE3 D;  2OQQ A;  1CSB A;  2OYO A;  3AE5 C;  3AE2 C;  4EDF A;  3FX0 A;  1SQP J;  1FJK A;  3HUS A;  4HB1 A;  1ZME C;  1RHZ B;  2WPS A;  5AW7 B;  1M1J A;  1VF5 D;  1GTW A;  1ZOY C;  3EWK A;  2CPS A;  3A0B H;  1NOH A;  5E79 H;  1P84 H;  2R3C A;  3V2P A;  3HD7 A;  4D6T D;  1M90 Q;  3CWB E;  1DEE G;  3MZW B;  1FZC C;  1N7S B;  3CWB G;  1SQB E;  1EDK A;  3KDP B;  2BEZ F;  1G1I A;  2H88 C;  4XA4 A;  4JYC A;  1EZV D;  1SQB G;  2IFN A;  1KB9 I;  1FC2 C;  4Y99 B;  1SS1 A;  1H8A A;  5AW4 B;  3U59 A;  5AVU B;  3A0H E;  2A45 I;  4ASW A;  4GOD A;  2K3R A;  2KK7 A;  3CCM P;  2K37 A;  3NTN A;  3CCR P;  2FYN B;  2Y9Z A;  1SLQ A;  1MFT A;  2ZJS E;  3E1I A;  3H1J E;  1K8A Q;  3NMD A;  1EC5 A;  2J5U A;  3H1J G;  1LTS C;  1L0N K;  5APU A;  3R4Y A;  4D6T J;  1PV3 A;  1LGH B;  2Q3I A;  1RF1 C;  3CCS P;  1N7S A;  3L73 D;  2J59 M;  4JF7 A;  2IFM A;  2E43 A;  5AW8 B;  3Q1M A;  4GOE A;  2E76 B;  3SWK A;  2JJL A;  2WPR A;  2H43 A;  1PGQ A;  1ZR2 A;  2QIW A;  3M0D A;  2HOD B;  3AE4 C;  3H1H D;  3HRN A;  1YI2 P;  4O9B A;  3TDK A;  1G2C B;  1YIJ P;  1J1D B;  3H6P A;  3MTU E;  3NFQ A;  2V7Q J;  3M91 A;  2N1T D;  1FAV A;  3L70 E;  2K9J A;  3P8C D;  4HH2 A;  3SWF A;  4R4L A;  4EIJ A;  2QRX A;  1OX3 A;  3BVH A;  2QM8 A;  3AEB C;  3L70 G;  2QJK C;  3CCQ P;  1GL2 D;  3H1I E;  2WWW A;  5CCG D;  1RF0 A;  3G71 P;  3VP9 A;  3V2R A;  4U7J A;  1L0L J;  3B5N D;  1GU5 A;  4WBA A;  1YJW P;  3L73 J;  4BXL A;  1IFP A;  1EQ7 A;  2XZR A;  3UIA A;  2K88 A;  3B71 A;  4N3Y B;  5BU8 B;  2HOD A;  2E5Y A;  1XTG B;  1L4A A;  1G2C A;  1IK9 A;  1PZQ A;  2H8P D;  4AYC A;  3B4S A;  3M0A A;  1VQL P;  1RQV A;  1OVV A;  3CLQ A;  2G8Y A;  1VF5 C;  1N8R Q;  3VMX A;  4N78 E;  1LNQ A;  2B87 A;  1IFN A;  4L74 A;  2WSE J;  3AEG C;  3LW5 H;  3CX5 I;  1OZH A;  2RKL A;  1USE A;  4I2L C;  1YJN P;  1M57 D;  4KJM A; 
#chains in the Genus database with same CATH homology
 2FXO A;  1D7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...