4GIFA

C-terminal coiled-coil domain of transient receptor potential channel trpp3 (pkd2l1, polycystin-l)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
45
structure length
45
Chain Sequence
GGWVSGEEFYMLTRRVLQLETVLEGVVSQIDAVGSKLKMLERKGW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Polycystic kidney disease 2-like 1 protein
publication title Molecular mechanism of the assembly of an acid-sensing receptor ion channel complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2012-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18109 Fer4_24 Ferredoxin I 4Fe-4S cluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4gifA00
4N78D 3N7NA 5BU5A 1NKNA 1IC2A 1X79B 3OJAB 4N3YB 5KTBA 3HRNA 5BVZA 3C9IA 3U1AA 4I1LA 3N4XA 4O9BA 3BATA 4GIFA 3U59A 3VP8A 3VP9A 2JEEA 3BASA 5BU8B 3U1CA 4ZKPA 2FXMA 4ZKUA 3P8CD 1WT6A 2POHA
chains in the Genus database with same CATH superfamily
1KYOH 1BCCG 3I56P 4ASWA 1LP1B 3EWKA 3A5TA 3CI9A 1VDFA 1K8AQ 3USSA 3HRNA 3L72E 1OVUA 3H1HD 1J1DB 2E76D 1SQQG 1L0LD 2ZXXA 1JMBA 1LT9A 3U59A 4PV1C 1NU1G 3LW5H 2HFED 1GDTA 2OTJP 5BU8B 4H13B 2XV5A 3AE2C 1SQBK 1QL2A 1YYCA 3WMM0 5EFWB 1EXJA 3TGUG 1Y9BA 3AECC 2J5UA 4KJMA 3EFFK 1NTKE 1YJWP 1MFTA 1IFDA 1K9MQ 3EQ2A 2XU6A 1HTLC 2R32A 5CCHC 1LTJC 1N73A 3VOPA 2V4HA 3CL3D 2VRSA 3H1IE 4ASVA 1SQPD 1ZR2A 3KYQA 2E74B 3V6IA 1MV8A 4MN4C 2WWWA 1AFOA 2A06G 1VPCA 2JWAA 1BCCE 2W27A 3P8MC 2O01J 2WPSA 3RL0B 2IYOA 4BRYB 3HD7A 3HD7D 1KFMA 4RO0A 5APUA 1U57A 3FGAD 2O1KA 3SWFA 1H0TB 3PLNA 1MFZA 3O6QA 1SQQE 1PFIA 1QVFO 4OGQC 2AEFA 3WUUA 3U1CA 4JPZB 1ZXGA 3TNUA 3D6ZA 3VTPC 1N7SA 1N7SD 1NTMJ 1FZCA 1OW6A 2R5BA 3GHGA 1KILC 5KJ7A 2PGDA 5KJ7D 1LP1A 2GM4A 3KXDA 3L74D 2M5AB 3RBXA 1L4AB 3A2AA 4BXLA 1GU5A 2IFNA 2JDIH 5AVWB 4H13D 1ZP0C 3AE1C 3B8EB 1Z56A 3H1LD 1S9KD 3TGUJ 1OIPA 4U3FD 3S9OA 5AVSB 1PP9G 3OA7A 1U7MA 3CC7P 3AE4C 3P32A 3BRVB 2Z5IA 2ZFCA 4GODA 1IFJA 3MTUE 3CD6P 2GA1A 2YKPA 2E74D 3PHLA 1L0LG 4WY4C 1NTZD 4NPEA 5AW3B 3TDKA 4UB8E 1GK4A 1T6AA 2OTLP 1SFCB 2M8RA 1GZLA 4D6TE 2HR3A 1H88A 4N78E 2N9BA 3RL0D 2OYOA 3HTKB 4BRYA 1HH0A 5KAFE 1W5CE 4AYCA 3G4SP 1H0TA 4TT3H 1HWTC 3CCRP 3C8VA 2G3AA 3IAOA 3L75D 1KYOD 3RGUA 1IFNA 1BGYD 4H0LC 3RK3B 1OWAA 2ZYAA 2ZXEB 1Q90D 1SQPG 4K35A 2ZYDA 2NRGA 3R4YA 4I7ZB 1PP9E 1X22A 5AW5B 5K5GB 1SLQA 2Q6QA 3HUSB 3W68A 2Q7CA 3PP5A 1L4AA 1L4AD 1FOSE 1N86A 1OXZA 3P8CD 1EDKA 3QH9A 1AA0A 3TYYA 2JO1A 3PTZA 1CSBA 2K37A 1RF0C 5BVZA 1SQBE 1SP4A 3KHUA 2WSCH 1DEEG 3KDPB 1GU4A 1RE3C 4NPDA 2C9NY 1QL1A 3MZWB 1LTSC 3Q5SA 3RK2C 3FXDA 2B89A 4HH2A 2BCCD 4UB8H 3TK1A 3H1HJ 3L74G 4H44B 2K9JA 4YXWH 1LT1A 2QEXP 1S2EA 1DIPA 4YXDC 1JCDA 2AEMA 5KLVK 2JP3A 4WWIA 3G71P 2Z5HA 3A0HE 1SFCA 1SFCD 3H1LG 2IZ1A 2R5DA 4U3FG 3B4SA 1K05A 2YXQB 3CCQP 1E79H 1KYOI 1DX7A 3GMAA 5AW2B 5TISH 1M1JC 2L5GB 2WSFJ 1X79B 2E75B 1PGPA 3AE6C 2KZIA 4W7YA 2XNDH 3LIEA 2FYUD 3M0DC 3RK3D 3CWBE 4HKZH 2OYIC 1EDLA 2YIUB 2FFDB 4JYBA 1NTZG 1T3JA 3MHVA 3D71A 4EI2A 1GL2C 1OW7A 2H43A 3HUSA 2WSFH 1SQXJ 5CJ0A 3SFDC 1NOHA 1RF1C 1NTMK 2O1JA 3AEDC 2IBZE 1NHLA 1JM0A 5AVZB 3N7NA 3CXHH 3L75G 1M57D 1OX3A 2WPVB 5APTA 1IFIA 1MZ9A 2Y9ZA 1NU1K 1EC5A 1HGVA 2WSEJ 4EYYQ 3UIAA 3ITKA 2E76C 1G2CB 4YTPC 4ZMDA 2RMZA 1VQPP 5GTIE 4H44D 2YKOA 1L0NJ 2IX7C 1FZFA 3H1JE 4M3LA 2P58A 3EFGA 1KB9H 2C0XA 2FKWB 2ITAA 1LT9B 2WSEH 3H1LJ 3CC2P 4KT0J 2L91A 4L74A 3C1LA 1FOSF 1W2EA 4HYTB 1OFCX 5B5EE 1KC8Q 2BCCG 4IFDK 3SFEC 2QM7A 2E75D 3CX5E 1YHQP 3AEEC 1X8YA 1DH3A 1H8AA 3VN0A 4WB4A 1UIIA 1LTAC 1N73B 4Y28J 4IL6E 2FFDA 1NTZJ 1Q2NA 1JEKA 1RE4C 5M1BA 1M56D 3KZIE 3TSIA 5KLIC 3CMEP 2IZ0A 1BE3D 2LR2A 2HLOA 2ZT9B 1KILE 3L75J 2OYHC 4D6TD 1P84E 2QJKC 2IYPA 4OVNF 1HVVA 1N7SC 5AVYB 1BGYJ 5KAIE 4RESB 1BDCA 2C0WA 2KIKA 3GHGC 2FYUG 5KJ7C 2KS1A 4PJ0H 1QX8A 3WU2E 1IK9A 4PD4E 3PRJA 3AEBC 1VQNP 1J1DC 2E5YA 4ZNCA 1KD1Q 2PFXA 1G2CA 5H2FE 1U7JA 3CPWO 4QMAA 3A7OA 1EDIA 4LGDE 4H13C 5KLVE 2PAJA 3OAKA 3G3ZA 5AVTB 1Q7YQ 2CK3H 4CPGA 1VF5C 4L73A 4DOJA 1L0LK 1PPJD 3BCCJ 2BCCJ 1S3JA 1LNQA 1XTGB 5APQA 1EZVE 1N7LA 2E74C 2HG5D 2FXOA 3A0BH 3L70E 3H1KJ 4C7NB 2CPSA 2N1TB 4BWNA 3CLQA 4U7JA 1AQ5A 3L4FA 3CXHD 3GW6A 3RL0C 3L72J 2NZ2A 3S1KA 1SQPK 1NTME 4WBAA 1M8OB 2BASA 1MKMA 3JC22 1SQXD 2KI7B 2ZT9D 2PRRA 2BEZF 1G1IA 1ZRTE 1EQ7A 1NU1E 2FYUJ 3GLMA 1GD2E 1IK7A 2WPQA 5KKZC 3P7KA 2JR8A 1FJKA 2KP8A 2YO2A 4DJGA 3TGUE 4AQRD 1KB9D 3IFMA 1JY2N 3D6YA 2IFMA 5APYA 3RL0g 1VQ5P 3H1IJ 4Z1MH 1KFNA 2QM8A 3FXEA 2FXPA 1L0ND 3L36A 1JY3N 1ZV8A 1HJBA 2FYNC 4W7ZA 3V5BA 2HPCB 3MUDA 2H88C 3NTNA 3V2NA 2NPSA 2A06E 4C46A 2UWJE 4I6MC 3QWOC 1AJYA 3L35A 3L71D 1OMIA 1J1EB 1WMKA 3AEAC 3F5HA 3ZDMA 3CXHI 1VL2A 4C7NA 2N1TA 2N1TD 3H1HG 1SFCC 2K9JB 4N3YB 3K5BA 1LWUC 1BSNA 2YMKA 3PJSK 1FZBA 1MUUA 4XA4A 1S5LX 3KQGA 1KQSO 1S1CX 2OARA 2GUVA 1PPJG 1NTZK 2M0BA 3NMDA 4GDOA 2LKMA 5GTHE 1S5LE 2E42A 1Q81Q 5CHXA 5CCHA 1LTJA 3Q2YA 1ZOYC 1YI2P 2SPZA 2FY8A 4B86A 1OVRA 1KB9I 4UB6E 1HGZA 3AE5C 1PV3A 1SQVD 4GOFA 2YO3A 3A3YB 1LTGC 1Y47A 1KV4A 2WSCJ 1FDOA 1YQ3C 4DT0A 3L73D 3WUTA 4L76A 2R3CA 1BE3J 4XE5B 5CBOA 1LJ2A 3JCUE 1SQXG 3BVHA 1NWQA 3AE9C 3PH0A 2QA4P 4D6TJ 3GG2A 4HB1A 2LXBA 1KQFB 3NXSA 2QJPC 1IJDB 1R5SA 1L0LE 2HPCA 1M90Q 3IR9A 4R4MA 1BDDA 3BCCD 3GF3A 5B66E 4H44C 5AVRB 3GF7A 2JJLA 2OTKE 1PL5A 3WUVA 3CCSP 1NAYA 5CCGA 1DD3A 5CCGD 1YQ4C 4JQ0D 2K1AA 2D2CB 5KAFH 3H1KD 1S5LH 1L0NG 1JO5A 2R3SA 1SQPE 3RK2B 3E1IA 3U1AA 3L72D 2Y0CA 2E75C 1SQBJ 4GKGA 3H32B 1FZAA 3L71G 5KTBA 2C9LY 3Q3DA 3F89A 4IFFA 3V4QA 1NTKD 2WZ7A 2IPPA 2H7HA 2XKMA 1LTBC 2FYUK 1NKZB 1KTMA 2YNYA 3L70D 1KQLA 1AV1A 5E79E 3H1ID 1VQ4P 1ZW0A 4XFJA 2YMYA 3G6EP 3L74E 3O8ZA 1VQ9P 1M7LA 1A02J 1LTIC 2AXTE 1BCCD 2Q3EA 1BGYG 1SQVG 2R44A 3H1LE 1S9KE 2KS1B 4U3FE 1ZMEC 1SQQD 2KUBA 3A0HH 3T97B 1NAFA 3L73G 3CWBJ 2JWDA 1LT9C 3BATA 2D2CD 1AVOA 3D70A 1RE3A 3CCJP 1CW5A 2W6BA 3Q5RA 1WT6A 1T8ZA 1H89A 1NTZE 5AW9B 3BRTB 5CBNA 2P2UA 5AW4B 2QJYB 1FC2C 3H32A 2ZJSE 4C7RA 3BCCG 3L71J 4ZKUA 1N73C 2FYZA 1SVFA 4IL6X 1IC2A 5E79H 3SSUA 4A7PA 3SWYA 4NPFX 3L75E 3AEFC 1KYOE 1L2PA 2HODB 1JY2O 2CPBA 1JNMA 3H1KG 4EDFA 4IFMA 1T2KD 5AW1B 2HYNA 5TJHA 1GW3A 2ZT9C 3HD7C 3AE3C 3L72G 1USDA 1JY3O 4DCKA 3B5NB 1FU1A 2LXCB 2KSEA 4WVZA 2Q1KA 3P8CE 1W2BO 3M0DA 2O3JA 1X9VA 4N6JA 4N78D 5GTIH 2A45H 4Y99B 1SQVJ 1FZCC 2KSJA 3C9IA 2Z4EA 3IF4A 1GL2A 2H8PD 1NTKG 5AW6B 1GK6A 2QRXA 5KLIB 3T97A 3L73J 2N9YB 2BCCE 1R8EA 2PP6A 3H1IG 2OYHB 4OH8B 2H89C 1QEXA 5B5EH 1PP9D 4GIFA 3MUDC 3CX5H 3JSVC 2K3RA 3VMAA 1J2JB 5AVXB 1URQB 2JKVA 3H6PA 4RKUJ 3AE8C 2NPSB 1OVVA 4IL6H 1JMMA 1PZQA 3E1RA 2KYVA 1SQBD 2RH0A 3CCMP 2Y0EA 3KZIH 1E5WA 2N1TC 1PGQA 1FS0E 3L37A 1YJ9P 1KN7A 2YXRB 2HODA 1ZLLA 2ZVOB 4PV1B 1HUCA 2FYUE 3RK3E 1VF5B 1P84H 1YIJP 2O01N 5KLVJ 5KAIH 3B5NA 3B5ND 1XTCC 3WU2H 2GUSA 4PD4H 3G9RA 3S4RA 1K73Q 2WTYA 1SQXK 1LTJB 5H2FH 5APVA 1HBWA 1YTZT 1KQGB 1JY2P 1AVYA 1RE4A 4L75A 2WSSH 5AW0B 1NTKJ 3FWLA 2Y0DA 2W83C 1KZUB 3E7KA 3L70J 1L4AC 1JY3P 1USEA 2M3BA 3CWBD 2Q9IA 2OYHA 1YJNP 1FDMA 2QVAA 1VQ7P 1BE3G 1YTZI 1JB0J 3I55P 1SS1A 2O01H 4OGQB 1YITP 4JF7A 4O9BA 1VQLP 4D6TG 1BCCJ 5KKZB 1URQA 1URQD 1OZHA 5AW8B 1L0NK 2YKQA 2KXPB 2IBZD 2NPSD 1J1EC 1TU3F 1KILB 1SQQJ 3M06A 5CCGC 2DW3A 1JTHB 1NU1J 2J58A 4JYCA 3W67A 3V4WA 1K04A 1HJ0A 1KORA 2WQYC 1WRGA 3VP9A 4EIJA 3Q5PA 2POHA 2KK7A 4PV1D 5CJ4A 1N2DC 3CCVP 2KB7P 2FYNB 3FWNA 3NFQA 1VQMP 1VQKP 1VF5D 2W6JH 4LLHA 2W90A 3R2PA 2WPRA 3CCUP 1RQUA 3MP7B 2QE7H 2V7QJ 2E43A 1KMIZ 3H1JD 1GW4A 1CI6B 1SQBG 2RKLA 4HJGH 1BE3E 3MGNA 2I1KA 5AVUB 3RK3C 4I1LA 5CCHD 3HE5B 2ZYGA 2I8DA 1EDJA 2MKVA 1LWUB 4I7ZC 3B71A 1PIXA 2V7QH 1RY3A 1LTTC 4WY4B 1JUNA 1FDIA 2I1JA 2K88A 2G8YA 3KPEA 3HUSC 3CX5D 5L8RJ 3OW2O 1SQVK 1NH4A 2AXCA 4K3AA 3CCEP 2W6AA 1DD4A 1FZEA 2B9BA 1VQOP 2JEEA 1D7MA 5AW7B 2QSIA 4OGQD 1UIXA 2IBZI 2AEJA 3H1HE 3M9QA 5TISE 3ABVC 3SWKA 4H0LB 3V2RA 3V2QA 3II6A 2M5AA 2W8ZA 4RJTA 1KILA 1KILD 4TLFA 1P84D 1PPJE 1JTHA 3LIDA 2KLUA 2B88A 2K9YA 1Y8AA 2D2CC 1FZGA 1AQTA 1CZQA 1S4XA 3CWBG 1NYHA 1BSHA 1PP9J 4PD4D 2QJPB 3CC4P 2A45I 5GTHH 1ZN5A 1FBMA 3M0AA 3VMXA 1VQ6P 2KNCB 4UB6H 3CXHE 1RH5B 5KLVD 2IBZG 5C39A 1CI6A 1L0LJ 1T3UA 1SQXE 5AVQB 5AVVB 3HE5A 2YIUC 4GOEA 1LWUA 3CX5I 1NGMB 1LGHB 2FFDC 1T2KC 3JCUH 4WY4A 4WY4D 2IDBA 3HTKA 1HF9A 3TF5A 1EZVD 2OQQA 2BEQD 1JOCA 1KB9E 3HE4B 4W80A 2A45G 1NTKK 2Q5UA 3VMYA 3H1JG 1M1JB 3MD0A 1SQPJ 4IOIH 1M1KQ 5B66H 5BU5A 1L0NE 1NTMD 1FAVA 4H0LD 2FBWC 3OJAB 1QVGO 1GTWA 2XDJA 1P84I 1EXIA 2E5TA 2OYIB 2Q3IA 1IZNB 1FJPA 5APXA 3V2PA 1RQVA 2XZRA 4EOTA 1GL2B 1ZRTD 1G1JA 2WT7B 2WMMA 3AE7C 1JCCA 1NU1D 1RF1B 4PD4I 1FE6A 2KZJA 3IN6A 4R4LA 3L71E 2J59M 1SQQK 3N4XA 3MIWA 1RF0A 3TGUD 2B87B 1Q86Q 1QLED 4I2LC 2Y9YA 4DZOA 5APWA 4GT1A 3RK2D 2QJYC 2KNCA 2P10A 3Q1MA 3L74J 2QIWA 4YPCA 5CMZA 1IFPA 1OW8A 2ZAEB 5DJTB 4PJ0E 2E76B 1VQ8P 2KOGA 2P7JA 3M9BA 3CCLP 2A06D 4U3FJ 2WVRA 4AUWA 1ZR4A 1NO4A 1EZVI 1X0TA 1PGOA 3RBZA 1BGYE 3B5NC 3VP8A 1SQVE 2P1JA 3VMZA 3M91A 1QGKB 1R5LA 2P67A 1GMJA 2AXTH 3VYIA 2KLVA 3HE4A 3H25A 1Q82Q 3H1JJ 5KLVG 1YBKA 1N8RQ 3M9HA 1M1JA 3L73E 3AEGC 1IFMA 2ZVNB 4Y99C 5DJUB 2WITA 2MJZA 1S72P 1RHZB 2RN0A 2OYIA 1DEBA 4JBZA 4LC1A 2OGUA 4KHXA 1NVOA 3A0BE 1GL2D 3I5CA 3HD7B 2WT7A 1EZVG 1RF1A 2FXMA 3BCCE 3O6QB 3L70G 1NKNA 4OWFA 1A02F 2B87A 2M3EA 1NJIQ 1PGJA 1URQC 5APSA 2QJKB 3TNUB 3FX0A 3LW5J 1N7SB 2NPSC 1IO4A 1FZCB 3H1KE 1NTMG 3GHGB 3BASA 4ZKPA 2XNXA 2QG4A 3CMAP
chains in the Genus database with same CATH topology
1J1EC 1KILB 3A5TA 3CI9A 1VDFA 5AVRB 1G2CB 3M06A 5CCGC 3HRNA 1JTHB 2J58A 2JJLA 1J1DB 4JYCA 3V4WA 2YKOA 5CCGA 5CCGD 2IX7C 1WRGA 1LT9A 3U59A 1FZFA 3VP9A 4M3LA 3LW5H 2HFED 1GDTA 4EIJA 5BU8B 3EFGA 2XV5A 2POHA 2C0XA 2FKWB 5CJ4A 1SQBK 1LT9B 1N2DC 2WSEH 2KB7P 1QL2A 1YYCA 3WMM0 3NFQA 1JO5A 4LLHA 3R2PA 3RK2B 2WPRA 3E1IA 3U1AA 1FOSF 1W2EA 4HYTB 2E43A 1IFDA 4GKGA 4IFDK 2QM7A 3EQ2A 1GW4A 2XU6A 1HTLC 1FZAA 3H32B 2R32A 1CI6B 1X8YA 5CCHC 1LTJC 1N73A 3VOPA 1DH3A 3CL3D 5KTBA 2C9LY 1H8AA 2VRSA 3VN0A 3MGNA 2I1KA 4WB4A 5AVUB 3RK3C 4I1LA 5CCHD 1ZR2A 3KYQA 1LTAC 1N73B 3HE5B 1MV8A 4IFFA 2FFDA 2WWWA 1LWUB 1AFOA 1RE4C 3V4QA 2WZ7A 1RY3A 1LTTC 4WY4B 1JUNA 1VPCA 2IPPA 3TSIA 2I1JA 2H7HA 2XKMA 3KPEA 1LTBC 2FYUK 1NKZB 3HUSC 2W27A 3P8MC 3RL0B 2WPSA 2YNYA 3HD7A 3HD7D 1KQLA 1KFMA 1SQVK 1NH4A 5APUA 2O1KA 3SWFA 2W6AA 2HLOA 1FZEA 1MFZA 2YMYA 1PFIA 2OYHC 2JEEA 3U1CA 5AW7B 1HVVA 3O8ZA 1N7SC 5AVYB 1M7LA 3TNUA 4RESB 1A02J 1LTIC 2C0WA 3GHGC 3M9QA 3VTPC 1N7SA 1N7SD 5KJ7C 1FZCA 2R5BA 3V2RA 3V2QA 3GHGA 1KILC 3II6A 5KJ7A 5KJ7D 1IK9A 1S9KE 1J1DC 1KILA 2GM4A 1KILD 1G2CA 1JTHA 3LIDA 1NAFA 1L4AB 3A7OA 3A2AA 4LGDE 1FZGA 1CZQA 2PAJA 1LT9C 3BATA 3OAKA 2IFNA 1GU5A 3G3ZA 5AVWB 5AVTB 3B8EB 1RE3A 1Z56A 1S9KD 1CW5A 2W6BA 2A45I 1WT6A 5AVSB 1T8ZA 4DOJA 1L0LK 1ZN5A 1FBMA 1H89A 3M0AA 3VMXA 5AW9B 3OA7A 3P32A 3BRVB 3BRTB 2Z5IA 2ZFCA 1XTGB 2P2UA 5AW4B 5APQA 3H32A 4C7RA 1CI6A 1N7LA 1IFJA 3MTUE 4ZKUA 1T3UA 1N73C 2FYZA 1SVFA 1IC2A 2HG5D 5AVQB 2YKPA 5AVVB 3SWYA 4C7NB 2CPSA 2N1TB 3HE5A 4WY4C 2HODB 1JY2O 3CLQA 1LWUA 5AW3B 2FFDC 1LGHB 1T2KC 2CPBA 1AQ5A 1GK4A 1JNMA 4WY4A 3L4FA 4WY4D 3RL0C 3HTKA 1SFCB 2M8RA 1GZLA 4IFMA 1H88A 1T2KD 5AW1B 4N78E 2HYNA 3RL0D 1SQPK 4WBAA 1GW3A 3HTKB 2BASA 1HH0A 3HD7C 4AYCA 1JY3O 1JOCA 3B5NB 3HE4B 4W80A 1FU1A 1HWTC 2A45G 1NTKK 2Q5UA 3VMYA 1G1IA 1M1JB 3MD0A 1IFNA 1EQ7A 3P8CE 3M0DA 3RK3B 1X9VA 1OWAA 1GD2E 2ZXEB 4N6JA 4N78D 5BU5A 2WPQA 3P7KA 1FAVA 1FJKA 2A45H 4Y99B 3OJAB 2KP8A 2YO2A 1FZCC 1GTWA 2XDJA 2KSJA 3C9IA 2Q3IA 2OYIB 4AQRD 2Z4EA 1FJPA 1GL2A 5AW5B 2H8PD 5APXA 3IFMA 5AW6B 3V2PA 1GK6A 1JY2N 2XZRA 1SLQA 3HUSB 2IFMA 5APYA 4EOTA 2Q7CA 3PP5A 3T97A 1GL2B 1L4AA 1L4AD 1FOSE 1G1JA 1N86A 2WT7B 1OXZA 3P8CD 1KFNA 1JCCA 2QM8A 3TYYA 1RF1B 2PP6A 1CSBA 1RF0C 2OYHB 5BVZA 4OH8B 3L36A 2J59M 1SP4A 1JY3N 1ZV8A 1SQQK 2WSCH 3N4XA 1HJBA 3MIWA 4GIFA 1RF0A 3KDPB 1GU4A 1RE3C 2C9NY 1QL1A 4W7ZA 1LTSC 3V5BA 3RK2C 4I2LC 3MUDA 2HPCB 1J2JB 3NTNA 3V2NA 2NPSA 4HH2A 5AVXB 1URQB 4DZOA 5APWA 4C46A 3H6PA 4GT1A 3RK2D 2NPSB 4I6MC 1JMMA 3L35A 2KYVA 5CMZA 3TK1A 1J1EB 1E5WA 2N1TC 3L37A 2KOGA 4C7NA 2N1TA 2N1TD 1JCDA 2P7JA 2HODA 3M9BA 5KLVK 1SFCC 1ZLLA 4N3YB 1LWUC 2Z5HA 4AUWA 1ZR4A 1NO4A 1HUCA 1SFCA 1SFCD 1FZBA 1MUUA 4XA4A 2R5DA 3KQGA 3B5NC 3VP8A 2P1JA 3VMZA 2OARA 3M91A 2P67A 1DX7A 2GUVA 1NTZK 3NMDA 3B5NA 3B5ND 2KLVA 3HE4A 3VYIA 5AW2B 1XTCC 1M1JC 2L5GB 1X79B 2GUSA 2LKMA 3M9HA 2E42A 1M1JA 5CHXA 5CCHA 1LTJA 4W7YA 1IFMA 2WTYA 3LIEA 4Y99C 3M0DC 2WITA 3RK3D 4B86A 1SQXK 1LTJB 2MJZA 1HGZA 2OYIC 5APVA 1HBWA 1YTZT 2YO3A 1JY2P 2FFDB 1RE4A 4JYBA 2OYIA 1T3JA 5AW0B 1DEBA 3A3YB 1LTGC 1GL2C 4LC1A 2H43A 3HUSA 2WSFH 4KHXA 5CJ0A 1KZUB 1NOHA 1GL2D 1RF1C 3I5CA 3HD7B 1NTMK 1L4AC 2WT7A 2O1JA 1JY3P 1NHLA 2R3CA 4XE5B 1RF1A 2M3BA 3BVHA 5AVZB 2FXMA 2Q9IA 2OYHA 1NWQA 3N7NA 1NKNA 1FDMA 1YTZI 1A02F 3NXSA 5APTA 2O01H 1IJDB 1URQC 1IFIA 5APSA 4JF7A 1MZ9A 3TNUB 4O9BA 2HPCA 1NU1K 1N7SB 1URQA 3IR9A 1URQD 2NPSC 1IO4A 5AW8B 1FZCB 1HGVA 1L0NK 2YKQA 3GHGB 3BASA 4ZKPA 2XNXA 3UIAA 2NPSD 2N9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N78 D;  3N7N A;  5BU5 A;  1NKN A;  1IC2 A;  1X79 B;  3OJA B;  4N3Y B;  5KTB A;  3HRN A;  5BVZ A;  3C9I A;  3U1A A;  4I1L A;  3N4X A;  4O9B A;  3BAT A;  4GIF A;  3U59 A;  3VP8 A;  3VP9 A;  2JEE A;  3BAS A;  5BU8 B;  3U1C A;  4ZKP A;  2FXM A;  4ZKU A;  3P8C D;  1WT6 A;  2POH A; 
#chains in the Genus database with same CATH topology
 1KYO H;  1BCC G;  3I56 P;  4ASW A;  1LP1 B;  3EWK A;  3A5T A;  3CI9 A;  1VDF A;  1K8A Q;  3USS A;  3HRN A;  3L72 E;  1OVU A;  3H1H D;  1J1D B;  2E76 D;  1SQQ G;  1L0L D;  2ZXX A;  1JMB A;  1LT9 A;  3U59 A;  4PV1 C;  1NU1 G;  3LW5 H;  2HFE D;  1GDT A;  2OTJ P;  5BU8 B;  4H13 B;  2XV5 A;  3AE2 C;  1SQB K;  1QL2 A;  1YYC A;  3WMM 0;  5EFW B;  1EXJ A;  3TGU G;  1Y9B A;  3AEC C;  2J5U A;  4KJM A;  3EFF K;  1NTK E;  1YJW P;  1MFT A;  1IFD A;  1K9M Q;  3EQ2 A;  2XU6 A;  1HTL C;  2R32 A;  5CCH C;  1LTJ C;  1N73 A;  3VOP A;  2V4H A;  3CL3 D;  2VRS A;  3H1I E;  4ASV A;  1SQP D;  1ZR2 A;  3KYQ A;  2E74 B;  3V6I A;  1MV8 A;  4MN4 C;  2WWW A;  1AFO A;  2A06 G;  1VPC A;  2JWA A;  1BCC E;  2W27 A;  3P8M C;  2O01 J;  2WPS A;  3RL0 B;  2IYO A;  4BRY B;  3HD7 A;  3HD7 D;  1KFM A;  4RO0 A;  5APU A;  1U57 A;  3FGA D;  2O1K A;  3SWF A;  1H0T B;  3PLN A;  1MFZ A;  3O6Q A;  1SQQ E;  1PFI A;  1QVF O;  4OGQ C;  2AEF A;  3WUU A;  3U1C A;  4JPZ B;  1ZXG A;  3TNU A;  3D6Z A;  3VTP C;  1N7S A;  1N7S D;  1NTM J;  1FZC A;  1OW6 A;  2R5B A;  3GHG A;  1KIL C;  5KJ7 A;  2PGD A;  5KJ7 D;  1LP1 A;  2GM4 A;  3KXD A;  3L74 D;  2M5A B;  3RBX A;  1L4A B;  3A2A A;  4BXL A;  1GU5 A;  2IFN A;  2JDI H;  5AVW B;  4H13 D;  1ZP0 C;  3AE1 C;  3B8E B;  1Z56 A;  3H1L D;  1S9K D;  3TGU J;  1OIP A;  4U3F D;  3S9O A;  5AVS B;  1PP9 G;  3OA7 A;  1U7M A;  3CC7 P;  3AE4 C;  3P32 A;  3BRV B;  2Z5I A;  2ZFC A;  4GOD A;  1IFJ A;  3MTU E;  3CD6 P;  2GA1 A;  2YKP A;  2E74 D;  3PHL A;  1L0L G;  4WY4 C;  1NTZ D;  4NPE A;  5AW3 B;  3TDK A;  4UB8 E;  1GK4 A;  1T6A A;  2OTL P;  1SFC B;  2M8R A;  1GZL A;  4D6T E;  2HR3 A;  1H88 A;  4N78 E;  2N9B A;  3RL0 D;  2OYO A;  3HTK B;  4BRY A;  1HH0 A;  5KAF E;  1W5C E;  4AYC A;  3G4S P;  1H0T A;  4TT3 H;  1HWT C;  3CCR P;  3C8V A;  2G3A A;  3IAO A;  3L75 D;  1KYO D;  3RGU A;  1IFN A;  1BGY D;  4H0L C;  3RK3 B;  1OWA A;  2ZYA A;  2ZXE B;  1Q90 D;  1SQP G;  4K35 A;  2ZYD A;  2NRG A;  3R4Y A;  4I7Z B;  1PP9 E;  1X22 A;  5AW5 B;  5K5G B;  1SLQ A;  2Q6Q A;  3HUS B;  3W68 A;  2Q7C A;  3PP5 A;  1L4A A;  1L4A D;  1FOS E;  1N86 A;  1OXZ A;  3P8C D;  1EDK A;  3QH9 A;  1AA0 A;  3TYY A;  2JO1 A;  3PTZ A;  1CSB A;  2K37 A;  1RF0 C;  5BVZ A;  1SQB E;  1SP4 A;  3KHU A;  2WSC H;  1DEE G;  3KDP B;  1GU4 A;  1RE3 C;  4NPD A;  2C9N Y;  1QL1 A;  3MZW B;  1LTS C;  3Q5S A;  3RK2 C;  3FXD A;  2B89 A;  4HH2 A;  2BCC D;  4UB8 H;  3TK1 A;  3H1H J;  3L74 G;  4H44 B;  2K9J A;  4YXW H;  1LT1 A;  2QEX P;  1S2E A;  1DIP A;  4YXD C;  1JCD A;  2AEM A;  5KLV K;  2JP3 A;  4WWI A;  3G71 P;  2Z5H A;  3A0H E;  1SFC A;  1SFC D;  3H1L G;  2IZ1 A;  2R5D A;  4U3F G;  3B4S A;  1K05 A;  2YXQ B;  3CCQ P;  1E79 H;  1KYO I;  1DX7 A;  3GMA A;  5AW2 B;  5TIS H;  1M1J C;  2L5G B;  2WSF J;  1X79 B;  2E75 B;  1PGP A;  3AE6 C;  2KZI A;  4W7Y A;  2XND H;  3LIE A;  2FYU D;  3M0D C;  3RK3 D;  3CWB E;  4HKZ H;  2OYI C;  1EDL A;  2YIU B;  2FFD B;  4JYB A;  1NTZ G;  1T3J A;  3MHV A;  3D71 A;  4EI2 A;  1GL2 C;  1OW7 A;  2H43 A;  3HUS A;  2WSF H;  1SQX J;  5CJ0 A;  3SFD C;  1NOH A;  1RF1 C;  1NTM K;  2O1J A;  3AED C;  2IBZ E;  1NHL A;  1JM0 A;  5AVZ B;  3N7N A;  3CXH H;  3L75 G;  1M57 D;  1OX3 A;  2WPV B;  5APT A;  1IFI A;  1MZ9 A;  2Y9Z A;  1NU1 K;  1EC5 A;  1HGV A;  2WSE J;  4EYY Q;  3UIA A;  3ITK A;  2E76 C;  1G2C B;  4YTP C;  4ZMD A;  2RMZ A;  1VQP P;  5GTI E;  4H44 D;  2YKO A;  1L0N J;  2IX7 C;  1FZF A;  3H1J E;  4M3L A;  2P58 A;  3EFG A;  1KB9 H;  2C0X A;  2FKW B;  2ITA A;  1LT9 B;  2WSE H;  3H1L J;  3CC2 P;  4KT0 J;  2L91 A;  4L74 A;  3C1L A;  1FOS F;  1W2E A;  4HYT B;  1OFC X;  5B5E E;  1KC8 Q;  2BCC G;  4IFD K;  3SFE C;  2QM7 A;  2E75 D;  3CX5 E;  1YHQ P;  3AEE C;  1X8Y A;  1DH3 A;  1H8A A;  3VN0 A;  4WB4 A;  1UII A;  1LTA C;  1N73 B;  4Y28 J;  4IL6 E;  2FFD A;  1NTZ J;  1Q2N A;  1JEK A;  1RE4 C;  5M1B A;  1M56 D;  3KZI E;  3TSI A;  5KLI C;  3CME P;  2IZ0 A;  1BE3 D;  2LR2 A;  2HLO A;  2ZT9 B;  1KIL E;  3L75 J;  2OYH C;  4D6T D;  1P84 E;  2QJK C;  2IYP A;  4OVN F;  1HVV A;  1N7S C;  5AVY B;  1BGY J;  5KAI E;  4RES B;  1BDC A;  2C0W A;  2KIK A;  3GHG C;  2FYU G;  5KJ7 C;  2KS1 A;  4PJ0 H;  1QX8 A;  3WU2 E;  1IK9 A;  4PD4 E;  3PRJ A;  3AEB C;  1VQN P;  1J1D C;  2E5Y A;  4ZNC A;  1KD1 Q;  2PFX A;  1G2C A;  5H2F E;  1U7J A;  3CPW O;  4QMA A;  3A7O A;  1EDI A;  4LGD E;  4H13 C;  5KLV E;  2PAJ A;  3OAK A;  3G3Z A;  5AVT B;  1Q7Y Q;  2CK3 H;  4CPG A;  1VF5 C;  4L73 A;  4DOJ A;  1L0L K;  1PPJ D;  3BCC J;  2BCC J;  1S3J A;  1LNQ A;  1XTG B;  5APQ A;  1EZV E;  1N7L A;  2E74 C;  2HG5 D;  2FXO A;  3A0B H;  3L70 E;  3H1K J;  4C7N B;  2CPS A;  2N1T B;  4BWN A;  3CLQ A;  4U7J A;  1AQ5 A;  3L4F A;  3CXH D;  3GW6 A;  3RL0 C;  3L72 J;  2NZ2 A;  3S1K A;  1SQP K;  1NTM E;  4WBA A;  1M8O B;  2BAS A;  1MKM A;  3JC2 2;  1SQX D;  2KI7 B;  2ZT9 D;  2PRR A;  2BEZ F;  1G1I A;  1ZRT E;  1EQ7 A;  1NU1 E;  2FYU J;  3GLM A;  1GD2 E;  1IK7 A;  2WPQ A;  5KKZ C;  3P7K A;  2JR8 A;  1FJK A;  2KP8 A;  2YO2 A;  4DJG A;  3TGU E;  4AQR D;  1KB9 D;  3IFM A;  1JY2 N;  3D6Y A;  2IFM A;  5APY A;  3RL0 g;  1VQ5 P;  3H1I J;  4Z1M H;  1KFN A;  2QM8 A;  3FXE A;  2FXP A;  1L0N D;  3L36 A;  1JY3 N;  1ZV8 A;  1HJB A;  2FYN C;  4W7Z A;  3V5B A;  2HPC B;  3MUD A;  2H88 C;  3NTN A;  3V2N A;  2NPS A;  2A06 E;  4C46 A;  2UWJ E;  4I6M C;  3QWO C;  1AJY A;  3L35 A;  3L71 D;  1OMI A;  1J1E B;  1WMK A;  3AEA C;  3F5H A;  3ZDM A;  3CXH I;  1VL2 A;  4C7N A;  2N1T A;  2N1T D;  3H1H G;  1SFC C;  2K9J B;  4N3Y B;  3K5B A;  1LWU C;  1BSN A;  2YMK A;  3PJS K;  1FZB A;  1MUU A;  4XA4 A;  1S5L X;  3KQG A;  1KQS O;  1S1C X;  2OAR A;  2GUV A;  1PPJ G;  1NTZ K;  2M0B A;  3NMD A;  4GDO A;  2LKM A;  5GTH E;  1S5L E;  2E42 A;  1Q81 Q;  5CHX A;  5CCH A;  1LTJ A;  3Q2Y A;  1ZOY C;  1YI2 P;  2SPZ A;  2FY8 A;  4B86 A;  1OVR A;  1KB9 I;  4UB6 E;  1HGZ A;  3AE5 C;  1PV3 A;  1SQV D;  4GOF A;  2YO3 A;  3A3Y B;  1LTG C;  1Y47 A;  1KV4 A;  2WSC J;  1FDO A;  1YQ3 C;  4DT0 A;  3L73 D;  3WUT A;  4L76 A;  2R3C A;  1BE3 J;  4XE5 B;  5CBO A;  1LJ2 A;  3JCU E;  1SQX G;  3BVH A;  1NWQ A;  3AE9 C;  3PH0 A;  2QA4 P;  4D6T J;  3GG2 A;  4HB1 A;  2LXB A;  1KQF B;  3NXS A;  2QJP C;  1IJD B;  1R5S A;  1L0L E;  2HPC A;  1M90 Q;  3IR9 A;  4R4M A;  1BDD A;  3BCC D;  3GF3 A;  5B66 E;  4H44 C;  5AVR B;  3GF7 A;  2JJL A;  2OTK E;  1PL5 A;  3WUV A;  3CCS P;  1NAY A;  5CCG A;  1DD3 A;  5CCG D;  1YQ4 C;  4JQ0 D;  2K1A A;  2D2C B;  5KAF H;  3H1K D;  1S5L H;  1L0N G;  1JO5 A;  2R3S A;  1SQP E;  3RK2 B;  3E1I A;  3U1A A;  3L72 D;  2Y0C A;  2E75 C;  1SQB J;  4GKG A;  3H32 B;  1FZA A;  3L71 G;  5KTB A;  2C9L Y;  3Q3D A;  3F89 A;  4IFF A;  3V4Q A;  1NTK D;  2WZ7 A;  2IPP A;  2H7H A;  2XKM A;  1LTB C;  2FYU K;  1NKZ B;  1KTM A;  2YNY A;  3L70 D;  1KQL A;  1AV1 A;  5E79 E;  3H1I D;  1VQ4 P;  1ZW0 A;  4XFJ A;  2YMY A;  3G6E P;  3L74 E;  3O8Z A;  1VQ9 P;  1M7L A;  1A02 J;  1LTI C;  2AXT E;  1BCC D;  2Q3E A;  1BGY G;  1SQV G;  2R44 A;  3H1L E;  1S9K E;  2KS1 B;  4U3F E;  1ZME C;  1SQQ D;  2KUB A;  3A0H H;  3T97 B;  1NAF A;  3L73 G;  3CWB J;  2JWD A;  1LT9 C;  3BAT A;  2D2C D;  1AVO A;  3D70 A;  1RE3 A;  3CCJ P;  1CW5 A;  2W6B A;  3Q5R A;  1WT6 A;  1T8Z A;  1H89 A;  1NTZ E;  5AW9 B;  3BRT B;  5CBN A;  2P2U A;  5AW4 B;  2QJY B;  1FC2 C;  3H32 A;  2ZJS E;  4C7R A;  3BCC G;  3L71 J;  4ZKU A;  1N73 C;  2FYZ A;  1SVF A;  4IL6 X;  1IC2 A;  5E79 H;  3SSU A;  4A7P A;  3SWY A;  4NPF X;  3L75 E;  3AEF C;  1KYO E;  1L2P A;  2HOD B;  1JY2 O;  2CPB A;  1JNM A;  3H1K G;  4EDF A;  4IFM A;  1T2K D;  5AW1 B;  2HYN A;  5TJH A;  1GW3 A;  2ZT9 C;  3HD7 C;  3AE3 C;  3L72 G;  1USD A;  1JY3 O;  4DCK A;  3B5N B;  1FU1 A;  2LXC B;  2KSE A;  4WVZ A;  2Q1K A;  3P8C E;  1W2B O;  3M0D A;  2O3J A;  1X9V A;  4N6J A;  4N78 D;  5GTI H;  2A45 H;  4Y99 B;  1SQV J;  1FZC C;  2KSJ A;  3C9I A;  2Z4E A;  3IF4 A;  1GL2 A;  2H8P D;  1NTK G;  5AW6 B;  1GK6 A;  2QRX A;  5KLI B;  3T97 A;  3L73 J;  2N9Y B;  2BCC E;  1R8E A;  2PP6 A;  3H1I G;  2OYH B;  4OH8 B;  2H89 C;  1QEX A;  5B5E H;  1PP9 D;  4GIF A;  3MUD C;  3CX5 H;  3JSV C;  2K3R A;  3VMA A;  1J2J B;  5AVX B;  1URQ B;  2JKV A;  3H6P A;  4RKU J;  3AE8 C;  2NPS B;  1OVV A;  4IL6 H;  1JMM A;  1PZQ A;  3E1R A;  2KYV A;  1SQB D;  2RH0 A;  3CCM P;  2Y0E A;  3KZI H;  1E5W A;  2N1T C;  1PGQ A;  1FS0 E;  3L37 A;  1YJ9 P;  1KN7 A;  2YXR B;  2HOD A;  1ZLL A;  2ZVO B;  4PV1 B;  1HUC A;  2FYU E;  3RK3 E;  1VF5 B;  1P84 H;  1YIJ P;  2O01 N;  5KLV J;  5KAI H;  3B5N A;  3B5N D;  1XTC C;  3WU2 H;  2GUS A;  4PD4 H;  3G9R A;  3S4R A;  1K73 Q;  2WTY A;  1SQX K;  1LTJ B;  5H2F H;  5APV A;  1HBW A;  1YTZ T;  1KQG B;  1JY2 P;  1AVY A;  1RE4 A;  4L75 A;  2WSS H;  5AW0 B;  1NTK J;  3FWL A;  2Y0D A;  2W83 C;  1KZU B;  3E7K A;  3L70 J;  1L4A C;  1JY3 P;  1USE A;  2M3B A;  3CWB D;  2Q9I A;  2OYH A;  1YJN P;  1FDM A;  2QVA A;  1VQ7 P;  1BE3 G;  1YTZ I;  1JB0 J;  3I55 P;  1SS1 A;  2O01 H;  4OGQ B;  1YIT P;  4JF7 A;  4O9B A;  1VQL P;  4D6T G;  1BCC J;  5KKZ B;  1URQ A;  1URQ D;  1OZH A;  5AW8 B;  1L0N K;  2YKQ A;  2KXP B;  2IBZ D;  2NPS D;  1J1E C;  1TU3 F;  1KIL B;  1SQQ J;  3M06 A;  5CCG C;  2DW3 A;  1JTH B;  1NU1 J;  2J58 A;  4JYC A;  3W67 A;  3V4W A;  1K04 A;  1HJ0 A;  1KOR A;  2WQY C;  1WRG A;  3VP9 A;  4EIJ A;  3Q5P A;  2POH A;  2KK7 A;  4PV1 D;  5CJ4 A;  1N2D C;  3CCV P;  2KB7 P;  2FYN B;  3FWN A;  3NFQ A;  1VQM P;  1VQK P;  1VF5 D;  2W6J H;  4LLH A;  2W90 A;  3R2P A;  2WPR A;  3CCU P;  1RQU A;  3MP7 B;  2QE7 H;  2V7Q J;  2E43 A;  1KMI Z;  3H1J D;  1GW4 A;  1CI6 B;  1SQB G;  2RKL A;  4HJG H;  1BE3 E;  3MGN A;  2I1K A;  5AVU B;  3RK3 C;  4I1L A;  5CCH D;  3HE5 B;  2ZYG A;  2I8D A;  1EDJ A;  2MKV A;  1LWU B;  4I7Z C;  3B71 A;  1PIX A;  2V7Q H;  1RY3 A;  1LTT C;  4WY4 B;  1JUN A;  1FDI A;  2I1J A;  2K88 A;  2G8Y A;  3KPE A;  3HUS C;  3CX5 D;  5L8R J;  3OW2 O;  1SQV K;  1NH4 A;  2AXC A;  4K3A A;  3CCE P;  2W6A A;  1DD4 A;  1FZE A;  2B9B A;  1VQO P;  2JEE A;  1D7M A;  5AW7 B;  2QSI A;  4OGQ D;  1UIX A;  2IBZ I;  2AEJ A;  3H1H E;  3M9Q A;  5TIS E;  3ABV C;  3SWK A;  4H0L B;  3V2R A;  3V2Q A;  3II6 A;  2M5A A;  2W8Z A;  4RJT A;  1KIL A;  1KIL D;  4TLF A;  1P84 D;  1PPJ E;  1JTH A;  3LID A;  2KLU A;  2B88 A;  2K9Y A;  1Y8A A;  2D2C C;  1FZG A;  1AQT A;  1CZQ A;  1S4X A;  3CWB G;  1NYH A;  1BSH A;  1PP9 J;  4PD4 D;  2QJP B;  3CC4 P;  2A45 I;  5GTH H;  1ZN5 A;  1FBM A;  3M0A A;  3VMX A;  1VQ6 P;  2KNC B;  4UB6 H;  3CXH E;  1RH5 B;  5KLV D;  2IBZ G;  5C39 A;  1CI6 A;  1L0L J;  1T3U A;  1SQX E;  5AVQ B;  5AVV B;  3HE5 A;  2YIU C;  4GOE A;  1LWU A;  3CX5 I;  1NGM B;  1LGH B;  2FFD C;  1T2K C;  3JCU H;  4WY4 A;  4WY4 D;  2IDB A;  3HTK A;  1HF9 A;  3TF5 A;  1EZV D;  2OQQ A;  2BEQ D;  1JOC A;  1KB9 E;  3HE4 B;  4W80 A;  2A45 G;  1NTK K;  2Q5U A;  3VMY A;  3H1J G;  1M1J B;  3MD0 A;  1SQP J;  4IOI H;  1M1K Q;  5B66 H;  5BU5 A;  1L0N E;  1NTM D;  1FAV A;  4H0L D;  2FBW C;  3OJA B;  1QVG O;  1GTW A;  2XDJ A;  1P84 I;  1EXI A;  2E5T A;  2OYI B;  2Q3I A;  1IZN B;  1FJP A;  5APX A;  3V2P A;  1RQV A;  2XZR A;  4EOT A;  1GL2 B;  1ZRT D;  1G1J A;  2WT7 B;  2WMM A;  3AE7 C;  1JCC A;  1NU1 D;  1RF1 B;  4PD4 I;  1FE6 A;  2KZJ A;  3IN6 A;  4R4L A;  3L71 E;  2J59 M;  1SQQ K;  3N4X A;  3MIW A;  1RF0 A;  3TGU D;  2B87 B;  1Q86 Q;  1QLE D;  4I2L C;  2Y9Y A;  4DZO A;  5APW A;  4GT1 A;  3RK2 D;  2QJY C;  2KNC A;  2P10 A;  3Q1M A;  3L74 J;  2QIW A;  4YPC A;  5CMZ A;  1IFP A;  1OW8 A;  2ZAE B;  5DJT B;  4PJ0 E;  2E76 B;  1VQ8 P;  2KOG A;  2P7J A;  3M9B A;  3CCL P;  2A06 D;  4U3F J;  2WVR A;  4AUW A;  1ZR4 A;  1NO4 A;  1EZV I;  1X0T A;  1PGO A;  3RBZ A;  1BGY E;  3B5N C;  3VP8 A;  1SQV E;  2P1J A;  3VMZ A;  3M91 A;  1QGK B;  1R5L A;  2P67 A;  1GMJ A;  2AXT H;  3VYI A;  2KLV A;  3HE4 A;  3H25 A;  1Q82 Q;  3H1J J;  5KLV G;  1YBK A;  1N8R Q;  3M9H A;  1M1J A;  3L73 E;  3AEG C;  1IFM A;  2ZVN B;  4Y99 C;  5DJU B;  2WIT A;  2MJZ A;  1S72 P;  1RHZ B;  2RN0 A;  2OYI A;  1DEB A;  4JBZ A;  4LC1 A;  2OGU A;  4KHX A;  1NVO A;  3A0B E;  1GL2 D;  3I5C A;  3HD7 B;  2WT7 A;  1EZV G;  1RF1 A;  2FXM A;  3BCC E;  3O6Q B;  3L70 G;  1NKN A;  4OWF A;  1A02 F;  2B87 A;  2M3E A;  1NJI Q;  1PGJ A;  1URQ C;  5APS A;  2QJK B;  3TNU B;  3FX0 A;  3LW5 J;  1N7S B;  2NPS C;  1IO4 A;  1FZC B;  3H1K E;  1NTM G;  3GHG B;  3BAS A;  4ZKP A;  2XNX A;  2QG4 A;  3CMA P; 
#chains in the Genus database with same CATH homology
 1J1E C;  1KIL B;  3A5T A;  3CI9 A;  1VDF A;  5AVR B;  1G2C B;  3M06 A;  5CCG C;  3HRN A;  1JTH B;  2J58 A;  2JJL A;  1J1D B;  4JYC A;  3V4W A;  2YKO A;  5CCG A;  5CCG D;  2IX7 C;  1WRG A;  1LT9 A;  3U59 A;  1FZF A;  3VP9 A;  4M3L A;  3LW5 H;  2HFE D;  1GDT A;  4EIJ A;  5BU8 B;  3EFG A;  2XV5 A;  2POH A;  2C0X A;  2FKW B;  5CJ4 A;  1SQB K;  1LT9 B;  1N2D C;  2WSE H;  2KB7 P;  1QL2 A;  1YYC A;  3WMM 0;  3NFQ A;  1JO5 A;  4LLH A;  3R2P A;  3RK2 B;  2WPR A;  3E1I A;  3U1A A;  1FOS F;  1W2E A;  4HYT B;  2E43 A;  1IFD A;  4GKG A;  4IFD K;  2QM7 A;  3EQ2 A;  1GW4 A;  2XU6 A;  1HTL C;  1FZA A;  3H32 B;  2R32 A;  1CI6 B;  1X8Y A;  5CCH C;  1LTJ C;  1N73 A;  3VOP A;  1DH3 A;  3CL3 D;  5KTB A;  2C9L Y;  1H8A A;  2VRS A;  3VN0 A;  3MGN A;  2I1K A;  4WB4 A;  5AVU B;  3RK3 C;  4I1L A;  5CCH D;  1ZR2 A;  3KYQ A;  1LTA C;  1N73 B;  3HE5 B;  1MV8 A;  4IFF A;  2FFD A;  2WWW A;  1LWU B;  1AFO A;  1RE4 C;  3V4Q A;  2WZ7 A;  1RY3 A;  1LTT C;  4WY4 B;  1JUN A;  1VPC A;  2IPP A;  3TSI A;  2I1J A;  2H7H A;  2XKM A;  3KPE A;  1LTB C;  2FYU K;  1NKZ B;  3HUS C;  2W27 A;  3P8M C;  3RL0 B;  2WPS A;  2YNY A;  3HD7 A;  3HD7 D;  1KQL A;  1KFM A;  1SQV K;  1NH4 A;  5APU A;  2O1K A;  3SWF A;  2W6A A;  2HLO A;  1FZE A;  1MFZ A;  2YMY A;  1PFI A;  2OYH C;  2JEE A;  3U1C A;  5AW7 B;  1HVV A;  3O8Z A;  1N7S C;  5AVY B;  1M7L A;  3TNU A;  4RES B;  1A02 J;  1LTI C;  2C0W A;  3GHG C;  3M9Q A;  3VTP C;  1N7S A;  1N7S D;  5KJ7 C;  1FZC A;  2R5B A;  3V2R A;  3V2Q A;  3GHG A;  1KIL C;  3II6 A;  5KJ7 A;  5KJ7 D;  1IK9 A;  1S9K E;  1J1D C;  1KIL A;  2GM4 A;  1KIL D;  1G2C A;  1JTH A;  3LID A;  1NAF A;  1L4A B;  3A7O A;  3A2A A;  4LGD E;  1FZG A;  1CZQ A;  2PAJ A;  1LT9 C;  3BAT A;  3OAK A;  2IFN A;  1GU5 A;  3G3Z A;  5AVW B;  5AVT B;  3B8E B;  1RE3 A;  1Z56 A;  1S9K D;  1CW5 A;  2W6B A;  2A45 I;  1WT6 A;  5AVS B;  1T8Z A;  4DOJ A;  1L0L K;  1ZN5 A;  1FBM A;  1H89 A;  3M0A A;  3VMX A;  5AW9 B;  3OA7 A;  3P32 A;  3BRV B;  3BRT B;  2Z5I A;  2ZFC A;  1XTG B;  2P2U A;  5AW4 B;  5APQ A;  3H32 A;  4C7R A;  1CI6 A;  1N7L A;  1IFJ A;  3MTU E;  4ZKU A;  1T3U A;  1N73 C;  2FYZ A;  1SVF A;  1IC2 A;  2HG5 D;  5AVQ B;  2YKP A;  5AVV B;  3SWY A;  4C7N B;  2CPS A;  2N1T B;  3HE5 A;  4WY4 C;  2HOD B;  1JY2 O;  3CLQ A;  1LWU A;  5AW3 B;  2FFD C;  1LGH B;  1T2K C;  2CPB A;  1AQ5 A;  1GK4 A;  1JNM A;  4WY4 A;  3L4F A;  4WY4 D;  3RL0 C;  3HTK A;  1SFC B;  2M8R A;  1GZL A;  4IFM A;  1H88 A;  1T2K D;  5AW1 B;  4N78 E;  2HYN A;  3RL0 D;  1SQP K;  4WBA A;  1GW3 A;  3HTK B;  2BAS A;  1HH0 A;  3HD7 C;  4AYC A;  1JY3 O;  1JOC A;  3B5N B;  3HE4 B;  4W80 A;  1FU1 A;  1HWT C;  2A45 G;  1NTK K;  2Q5U A;  3VMY A;  1G1I A;  1M1J B;  3MD0 A;  1IFN A;  1EQ7 A;  3P8C E;  3M0D A;  3RK3 B;  1X9V A;  1OWA A;  1GD2 E;  2ZXE B;  4N6J A;  4N78 D;  5BU5 A;  2WPQ A;  3P7K A;  1FAV A;  1FJK A;  2A45 H;  4Y99 B;  3OJA B;  2KP8 A;  2YO2 A;  1FZC C;  1GTW A;  2XDJ A;  2KSJ A;  3C9I A;  2Q3I A;  2OYI B;  4AQR D;  2Z4E A;  1FJP A;  1GL2 A;  5AW5 B;  2H8P D;  5APX A;  3IFM A;  5AW6 B;  3V2P A;  1GK6 A;  1JY2 N;  2XZR A;  1SLQ A;  3HUS B;  2IFM A;  5APY A;  4EOT A;  2Q7C A;  3PP5 A;  3T97 A;  1GL2 B;  1L4A A;  1L4A D;  1FOS E;  1G1J A;  1N86 A;  2WT7 B;  1OXZ A;  3P8C D;  1KFN A;  1JCC A;  2QM8 A;  3TYY A;  1RF1 B;  2PP6 A;  1CSB A;  1RF0 C;  2OYH B;  5BVZ A;  4OH8 B;  3L36 A;  2J59 M;  1SP4 A;  1JY3 N;  1ZV8 A;  1SQQ K;  2WSC H;  3N4X A;  1HJB A;  3MIW A;  4GIF A;  1RF0 A;  3KDP B;  1GU4 A;  1RE3 C;  2C9N Y;  1QL1 A;  4W7Z A;  1LTS C;  3V5B A;  3RK2 C;  4I2L C;  3MUD A;  2HPC B;  1J2J B;  3NTN A;  3V2N A;  2NPS A;  4HH2 A;  5AVX B;  1URQ B;  4DZO A;  5APW A;  4C46 A;  3H6P A;  4GT1 A;  3RK2 D;  2NPS B;  4I6M C;  1JMM A;  3L35 A;  2KYV A;  5CMZ A;  3TK1 A;  1J1E B;  1E5W A;  2N1T C;  3L37 A;  2KOG A;  4C7N A;  2N1T A;  2N1T D;  1JCD A;  2P7J A;  2HOD A;  3M9B A;  5KLV K;  1SFC C;  1ZLL A;  4N3Y B;  1LWU C;  2Z5H A;  4AUW A;  1ZR4 A;  1NO4 A;  1HUC A;  1SFC A;  1SFC D;  1FZB A;  1MUU A;  4XA4 A;  2R5D A;  3KQG A;  3B5N C;  3VP8 A;  2P1J A;  3VMZ A;  2OAR A;  3M91 A;  2P67 A;  1DX7 A;  2GUV A;  1NTZ K;  3NMD A;  3B5N A;  3B5N D;  2KLV A;  3HE4 A;  3VYI A;  5AW2 B;  1XTC C;  1M1J C;  2L5G B;  1X79 B;  2GUS A;  2LKM A;  3M9H A;  2E42 A;  1M1J A;  5CHX A;  5CCH A;  1LTJ A;  4W7Y A;  1IFM A;  2WTY A;  3LIE A;  4Y99 C;  3M0D C;  2WIT A;  3RK3 D;  4B86 A;  1SQX K;  1LTJ B;  2MJZ A;  1HGZ A;  2OYI C;  5APV A;  1HBW A;  1YTZ T;  2YO3 A;  1JY2 P;  2FFD B;  1RE4 A;  4JYB A;  2OYI A;  1T3J A;  5AW0 B;  1DEB A;  3A3Y B;  1LTG C;  1GL2 C;  4LC1 A;  2H43 A;  3HUS A;  2WSF H;  4KHX A;  5CJ0 A;  1KZU B;  1NOH A;  1GL2 D;  1RF1 C;  3I5C A;  3HD7 B;  1NTM K;  1L4A C;  2WT7 A;  2O1J A;  1JY3 P;  1NHL A;  2R3C A;  4XE5 B;  1RF1 A;  2M3B A;  3BVH A;  5AVZ B;  2FXM A;  2Q9I A;  2OYH A;  1NWQ A;  3N7N A;  1NKN A;  1FDM A;  1YTZ I;  1A02 F;  3NXS A;  5APT A;  2O01 H;  1IJD B;  1URQ C;  1IFI A;  5APS A;  4JF7 A;  1MZ9 A;  3TNU B;  4O9B A;  2HPC A;  1NU1 K;  1N7S B;  1URQ A;  3IR9 A;  1URQ D;  2NPS C;  1IO4 A;  5AW8 B;  1FZC B;  1HGV A;  1L0N K;  2YKQ A;  3GHG B;  3BAS A;  4ZKP A;  2XNX A;  3UIA A;  2NPS D;  2N9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...